2WF8A

Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, glucose-1-phosphate and beryllium trifluoride
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near attack conformers dominate beta-phosphoglucomutase complexes where geometry and charge distribution reflect those of substrate.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 79
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf8A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf8A01
3N07A 4I9GA 2G08A 5ALQA 1QQ7A 5AI5A 3UM9A 1U7OA 3J7TA 5AVYA 2HI0A 3EF1A 3TLMA 4F72A 3AR2A 3QU2A 4YCLA 4B6JA 2FPRA 1YV9A 5ALOA 2B1QA 1L7MA 2R8YA 3DNPA 4CNQA 2ODAA 1XPJA 1RKVA 2MU2A 2WF9A 4RESA 4BNDA 5AM3A 3BWVA 2WFAA 3NASA 3OCVA 4UMDA 1RMQA 2HF2A 2WHEA 3SKYA 3AR4A 5AIAA 5ALMA 2HDOA 3U26A 3WK5A 4BBJA 5ALLA 3ONNA 2QYHA 3ZX5A 3B9BA 2YJ3A 1Q91A 3UMCA 2P27A 3FPBA 5ALIA 2JARA 1RPZA 4YGYA 4YIKA 4BEVA 2I7DA 4C4TA 4HGRA 3U7HB 3IRUA 3WK9A 3VAYA 2NO4A 3B9RA 4Y2VA 2C9MA 2HOQA 4HYTA 2Q5EA 3AR3A 5AM2A 3W5CA 1O08A 5AVXA 3AR8A 1NF2A 2G80A 5AKJA 3U7EB 5AW3A 4UAUA 2B30A 1S2OA 2HHLA 4YCMA 2DQSA 3ZU6A 4KNVA 5A3SA 2IA5A 3WKEA 4CF5A 4AS2A 1N9KA 5AHXA 3L0YA 5ALNA 3W5DA 2FUCA 2IOFA 1L8LA 3DAOA 4Y2XA 5ALSA 3NALA 4DFDA 1RMTA 3QUBA 2HEGA 2I55A 3ZVLA 3ZWKA 1RKUA 2C8KA 3F9RA 5AKYA 5AK5A 3WGUA 1YNSA 3A1CA 5AVTA 2AGVA 3OPXA 5AW2A 3L0BA 1Y8AA 2C4NA 1Z5UA 3RFUA 2HSZA 1ZD5A 1F5SA 3GYGA 5AW5A 1N8NA 3L8EA 3WKCA 3FPSA 4DWOA 3KZXA 2G1AA 4UARA 1XVIA 2AMYA 2GHQA 3QNMA 4HAIA 3N8GA 5ALFA 1ZJJA 3M1YA 1LTQA 2G07A 2R8EA 4G9BA 1AQ6A 4QJBA 4CE6A 3OCZA 2GHTA 4H1WA 4UMEA 2Q4RA 3MMZA 2FPXA 3FM9A 3DDHA 2FDRA 4Y2YA 4Y2TA 2WF7A 5AKKA 1Q92A 2O9JA 4PNHA 1Z4JA 3A3YA 4IG4A 1YJ5A 1SU4A 3AR6A 3AR5A 4BX3A 2ZBDA 1Z4OA 5AI8A 5AK6A 3FVVA 3NANA 4L6CA 4L57A 5ALYA 2P69A 3U7GA 5ALHA 4ZEWA 2YBDA 3KD3A 5AW9A 3L8HA 4CF3A 5FP0A 1TJ4A 4Y2SA 4EENA 1ZRMA 2P9JA 1VFPA 3QUCA 2CFRA 3A1EA 5AW8A 1Z4QA 2BDUA 2JAUA 5AI6A 2JAWA 2ZBEA 4QQFA 1Z88A 1YDFA 2I6XA 3KC2A 2RB5A 5ALPA 3QGMA 2R8ZA 4KX5A 5AVUA 3E84A 2W11A 1RMYA 3I1YA 4BYGA 4KNWA 5AVQA 5AVSA 4CF4A 2WF5A 4UASA 5AM1A 5AM4A 3L5KA 5A3RA 3W5BA 2C8LA 5E0OA 3EWIA 3ZVMA 3R09A 5AKXA 2YMLA 2MSNA 4KYTA 2HCFA 1L7NA 4KN8A 4EEKA 5AW6A 3IB6A 4XE5A 5AW1A 3QU4A 1RLMA 2WF6A 3CZ4A 1ZOLA 2YMMA 5ALZA 5AM5A 4YIHA 1S8OA 3WK6A 2PKEA 4HGNA 3B8EA 3QU5A 5AI4A 3NIWA 3ZVNA 5ALWA 2BDEA 5JJBA 2W4MA 4C4SA 2GFHA 1RLTA 3W5AA 2JGAA 3E8MA 2FI1A 3L8GA 3SF0A 2QLTA 3E81A 1XP5A 2NO5A 5AICA 1VJ5A 4L6AA 5AKEA 4RETA 3OCXA 4E88A 5ALDA 2RBKA 2YY6A 1TJ3A 3I6BA 4UM7A 1QYIA 2B8JA 1YMQA 2VKQA 2IYEA 2JAOA 2PQ0A 2YJ6A 1QQ6A 1L6RA 2AUTA 3KDPA 4XQ0A 3A1DA 4EZEA 1J8DA 4BNDB 2OM6A 2I34A 2OBBA 3MC1A 1QQ5A 5AW0A 3PGVA 3EPRA 1WZCA 3U7FB 3ZUPA 2RAVA 3R4CA 4UAVA 3UMGA 1RRCA 3KOOA 5ALUA 3QXGA 3DV9A 2B82A 3U19A 3WKAA 3ZW7A 1EK2A 1QH9A 3OCUA 2IOHA 2GO7A 3E58A 3PDWA 4NV0A 2G09A 4HGOA 5AESA 3HLTA 5ALJA 2EARA 1RC8A 2D2VA 5IT4A 3ZI4A 3WGVA 1NRWA 3FGOA 4XOUA 2CFTA 3L1VA 4IFTA 2EAUA 3ZTWA 1CQZA 3OCWA 3BA6A 2C88A 4GXTA 3ZTYA 2G0AA 1U7PA 1L8OA 3QUTA 4FYPA 3FZQA 3SLRA 4UM5A 1PW5A 4I9FA 1WR8A 1Z4NA 3QU7A 3L0CA 4ZEVA 3RF6A 3R9KA 3L1UA 4F71A 2RARA 3ZWDA 1JUDA 2X4DA 5ALGA 3M9LA 4NABA 2HX1A 3PGLA 5AKZA 4YH1A 2HO4A 4HGPA 4UU1A 4AP9A 5AVZA 1TE2A 2YMPA 4J2TA 2P11A 4MWOA 3ET4A 1X42A 4BEWA 3L7YA 4ZEXA 3QU9A 1J97A 3NUQA 3MN1A 5AKIA 3SD7A 2YFYA 4FE3A 4UMVA 5AKGA 2CFSA 4GIBA 2HF7A 4J03A 2ZBFA 2YJ4A 3SHQA 5T41A 4MUMA 5AKHA 4EX6A 2WF8A 1NNLA 1U2SA 2CN1A 2ZOSA 2Q4TA 1T5SA 1SWWA 2OA0A 2YJ5A 4NFLA 3QUQA 3AR7A 4C4RA 2FUEA 3WK4A 1Z4PX 2WM8A 3PCTA 4DW8A 2O2XA 4BKMA 5ALTA 5AI0A 2FPWA 3K1ZA 4O8CA 4HGQA 1ZD2P 4NAVA 5IT0A 3OCYA 3KBBA 5ALEA 3U13A 1RLOA 1Z4KA 1ZD4A 4Y2JA 1Z4IA 1TA0A 3AR9A 2YMQA 2AH5A 1RKQA 1RQLA 1L7OA 3ESRA 3NRJA 1EK1A 4NWIA 2YN4A 4Y3UA 3EF0A 3CNHA 2FPUA 3OTQA 1K1EA 1L7PA 1Z4LA 1Z4MA 3QYPA 2ZXEA 3IJ5A 3L8FA 1ZS9A 2BY4A 2ZG6A 2MU1A 1KYTA 3ESQA 3SMVA 2B0CA 2I54A 3ZX4A 3NAMA 3P96A 4UMFA 3ED5A 2FPSA 1ZD3A 2PR7A 3ET5A 3N1UA 4KX3A 3MPOA 2W43A 2FEAA 5ALRA 4JB3A 1O03A 5AW7A 2ZBGA 1FEZA 2IOFK 1CR6A 2B8EA 3N28A 2NYVA 3WKBA 1VJRA 4FFDA 1ZRNA 3WKDA 1TJ5A 4OHFA 1YS9A 4BX2A 4UU0A 4OFZA 3SKXA 5AK3A 4EELA 1IWOA 3I76A 4EX7A 4JDPA 3HYCA 5ALXA 3QX7A 1WPGA 2B1RA 3QLEA 3I28A 4OCZA 5A3QA 1U2TA 4YCNA 5IS2A 5AIBA 1T5TA 4Y2UA 5AVWA 2OYCA 3UMBA 5ALKA 5AVVA 1WVIA 1MH9A 1SWVA 3WK7A 3D6JA 4Y2RA 2I33A 4UATA 4XPZA 2EATA 2GMWA 4UW9A 5AM0A 4AS3A 3WK8A 4G63A 4BX0A 1LVHA 4DCCA 3S6JA 5AW4A 1T9ZA 4Y2PA 1RQNA 5AK4A 4Y2QA 4OD0A 5ALVA 2G06A 5AKLA 1Z5GA 1U02A 5AVRA 5AI9A 3N5KA 1RDFA 2R8XA
chains in the Genus database with same CATH superfamily
5IHPA 2F3RA 2FLKA 2R4QA 3W2FA 4BCDA 1SXDA 4KLJA 3P0IA 3GJ3A 1H4QA 3RSLA 1ZIPA 1KK3A 2DX7A 2P9ZA 4B7ZA 1M73E 2ZJYA 3NVMB 4XAQA 4P3KA 4TS4A 1DRUA 1G8AA 5TQVA 1KWKA 4MJ7A 3BS5A 3B70A 4NBWA 3RS7A 4YCLA 1JYEA 1U0GA 4BO3A 4DHWA 2CMKA 4ZMRA 5KOYA 3HBJA 4UHCA 2WIAA 1ZBDA 2YV3A 3EC7A 1B6TA 5G0SA 3DOOA 1A3CA 4Q02A 2Y66A 4Z7NB 3EPIA 1KAQA 2VHZA 3MUEA 4H7FA 4CN9A 3A2LA 3ANSA 1IEVA 1KR2A 3K30A 1OB2A 4JDUA 1DRVA 2RK6A 2WFAA 4GC6A 4GMKA 1Z2AA 2EWVA 1NAHA 1TAGA 4WZZA 3AHJA 3WWZA 2W55A 2BR5A 3H1TA 3TKYA 1MEEA 3VR2D 3FG9A 4QDUA 1V9SA 1JQ5A 2UAGA 1E6WA 1ODCA 2HK9A 1F2UB 4PYQA 3P1JA 3IUBA 1NW8A 2FE1A 4OAPA 5E0KB 3S27A 1MVOA 3Q8XB 2YJ3A 3ZNNA 1H2AS 4XVUA 5DXJA 2JARA 4JQOA 3SNHA 1I7LA 2JCBA 4V0SA 3T0IA 4F4DA 2AEMA 3EXIA 4TROA 1DJMA 1S2IA 5I9MA 1E2DA 2AMFA 1JFFB 1EM6A 2PLRA 3VH3A 4KITB 1WPQA 6GPBA 2DWQA 4DQSA 3TR0A 3WK9A 3VPGA 4RDXA 5BN1A 1P2GA 2JLUA 4EZIA 2O6HA 3L7MA 1SXGA 1QKKA 3RJKA 4NENA 5HM6A 5AM2A 1C0LA 1C0EA 2JJ1D 3FYUB 3PIDA 3Q6MA 4DPMA 5EHZA 3EVTA 3O5AA 1D4OA 1JX6A 1IPFA 4J9QA 2FRDC 2FJPA 3AR8A 1SBQA 4MUEA 1XDSA 4YALA 3T3IA 3A3KA 2QZ4A 1IEQA 1NZFA 2IDKA 2RGUA 2WQ7A 3GLFE 3KTQA 5EJIA 2O7SA 4XSGA 1SG0A 2G1PA 2YR0A 3BKXA 2GXSA 3L1JA 4BC1A 4P0PB 1G0NA 3LYUA 1TK5A 2BFMA 1SBHA 2UZIR 4YDHB 2VIXA 4ZANA 2SNIE 3V1TC 4DLRA 4FDVA 1KVTA 1GGNA 2CJWB 3NV9A 5J0UA 1MAUA 1U3FA 3I37X 2Z4SA 4A1OA 1Y3IA 3NBXX 3R3SA 1N5WA 4F9TA 3ZDAA 1C30B 4RZUA 3GCWA 3V4OA 1YUMA 4MV7A 5E7QA 3L1HA 1M3SA 3OH8A 5EIOA 5HIMA 2Q5CA 5L1JA 5ECGC 1F1BA 1M34B 1Y48E 4C8NA 3BIWA 3GPBA 2RBEA 4K9NA 4KOAA 1CFZA 3N0WA 5KTOA 3SQOA 3CS3A 5LUAA 5J4YA 1AGPA 3HPOA 5EZYA 3OJLA 3WIEA 1PJBA 5JHGB 4DFDA 1U7ZA 2I2CA 3RD5A 4GM4A 3QUBA 4N3AA 4B73A 5KWIA 4N1AA 4FU0A 3CBQA 4GT1A 4UBMA 3KKAC 3P9IA 3ICVA 4YUWA 1HYHA 1RIFA 2FYTA 2GN8A 3BE5A 3WOHA 4CU2A 3R0VA 4OI4A 2KSOA 1ZQMA 1G8GA 3MJSA 2H00A 1BVUA 1OW5A 1OAAA 3CLTC 5FB3A 2ZRQA 5HKBA 5J2DA 1LTHR 5DE3A 5KFOA 1JDTA 5AW5A 1KEJA 1ONOA 2Q62A 5IP5A 3CTMA 4S1VA 4N8EA 2AKYA 4HF7A 3WKCA 1IG0A 2NIPA 3GCXA 1RRKA 2ZATA 2J59A 4UARA 5KL1B 1G60A 2H0QA 4OHUA 5JROA 4O25A 5JLAA 1D0IA 3UCXA 1PQPA 2ZJ2A 1GGFA 1T3QA 4B85A 2X8LA 4J0EA 4JLUA 4E22A 3WL7A 1KEVA 4K4GA 1YD7A 2H7VA 2ZQZA 1D07A 1W5TA 3CZRA 2W2KB 2HWUA 4OEHA 4EUHA 2H2AA 3D8BA 1IAVA 2V5UA 4EZBA 3ZQ6A 4NQZA 2Y3IA 1DAOA 1S9DA 3V48A 4BWFB 1YGPA 3L1KA 4TMWA 5GVRA 3W77A 3V7UA 3R44A 2FDCA 5CT9A 4H1WA 4C9BA 5F3XB 1PHPA 1PNOA 1TCUA 2UYOA 4MQFA 3DDHA 3LL4A 2IXGA 1BWQA 3ANLA 3D7LA 2WB2A 4ARSA 1RWNA 4DL4A 1T8RA 1CNFA 2LRHA 3N2NA 5B37A 3A2KA 2XTMA 1XXHB 5DQIA 2ZYWX 2HSJA 3E1GA 2P6MA 3AWIA 4OLHA 3NT5A 4XQCA 5E8RA 5IT9A 2ZCVA 2B34A 3MK31 4IDEA 2R1TA 3GCZA 2QW8A 1NDQA 3KLNA 1TCVA 4DV7B 3CZ9A 4GEGA 1VPVA 4TXJA 4E6EA 5LMZA 2AR7A 4K6GA 4CT0A 1PNQA 2HCRA 1GLGA 1CRXA 4M86A 1SULA 4WFJA 5BSTA 4QDOA 2Z09A 4DG9A 3WLNA 1H2RS 4OYLA 1QOZA 1JS1X 5D2CA 2J9FB 3MUFA 1OYOA 4EHNA 3MMPA 2ID4A 3WNBA 3OEED 1STOA 1VFPA 1TQ8A 5BYKA 5TQ2B 2XBUA 3A1EA 3VHXA 1V1MA 3H8SA 2DBZA 3G3EA 4YROA 3W79A 3EGDB 3ZIUA 1OH8A 5KPDA 2PI4A 2QSUA 3T7CA 1V5WA 5I7OA 1EDDA 3AL0C 1UCFA 4B4DA 4M0LA 4PHPA 4RTOA 1BMTA 2C2MA 3Q7PA 4G1UC 4FS2A 1IZZA 5KNDD 3D6HA 3AFMA 2W11A 2VAVA 4DLLA 2R8RA 2HLDA 3W9UA 4WOCA 4I55F 1H1LB 1TAHA 4G9GA 2G83A 4D8UA 5LZ9A 4G01B 1CXZA 5BOSA 3PDUA 4LJ6A 2YW2A 1E5DA 1TUBA 3IAAA 1RP7A 3P4YA 4MHVA 5SYAA 4EB8A 2G1JA 3CN7A 3H2SA 3L77A 4LE2A 4YJ3F 1WDMA 5A3RA 4GU5A 4B4KA 5BQXA 1PZXA 5GTHU 3QE3A 2OYRA 3GIKA 1JQEA 5KWSA 4H59A 3HO1A 2ANCA 3CVWA 1K5OA 5CTJA 3OTGA 3P26A 3E3MA 2PDAA 3VR5A 3EEIA 2BFCA 3SVTA 1D3AA 4J76A 4O5KA 3KLOA 4MI6A 2OLKA 1XXHA 3ZHSA 2C5GA 2IEYA 2Z8ZA 3EGWA 4N3NA 3T7SA 5J4KA 4DL2A 3IUEA 5CURA 3BJYA 3CZ4A 2YMMA 4JKYA 3VU9A 4HB0A 4N5HX 1S3IA 3VYWA 1KIFA 2ODNA 4YIHA 3NIGB 1RJWA 5JPDA 3HI6A 1TW3A 1NUHA 5CFRA 1XTPA 2Q49A 4MDYA 5FUYA 4RJTA 1NTOA 3MXOA 4L8YA 2OFOA 1E3WA 1NV8A 5KKNB 1K8YB 2I4RA 1RM5A 1AKNA 3ADPA 1YVUA 2H4YA 1J5EB 5J2KA 1NJGA 5HF8A 1Y63A 1T25A 4RLQA 1P5ZB 5IJAA 2AFVA 1AUOA 4Y7DA 1VJ5A 3CFYA 2PFPA 5DNAA 2DH6A 2XADA 2QUAA 3A4IA 4DA0A 3HP7A 2QD1A 2WWIA 3IHLA 3QG5A 4GPZA 2D8CA 4K9QA 4GM1A 3TG8A 4OAQA 5DNYB 4FGSA 1JIHA 3HYNA 3OESA 3LLMA 1YMQA 4R1TA 3EXEB 4PS1A 1COWA 3Q0IA 3RVNA 4E7PA 5BORA 2IQ5A 4PIPA 4Q3NA 2OKGA 4EGQA 2JAOA 5A3VA 1YJ8A 2JG3A 2ZRAA 1LW7A 2CRXA 2OM2A 1QGDA 1XRNA 4U0KA 4UCXA 4XUDA 3ZGYA 2D2IA 1J8DA 2ST1A 2J0QA 1GZ7A 1KI6A 2JIRA 2OHJA 1D1PA 2RHBA 4LRYA 4DUZB 1TQ6A 1QQ5A 4OXYA 3DDOA 5DGBA 1SKWA 1ISFA 3F1LA 1O89A 1I7DA 1GAWA 1LSUA 2VG8A 3CISA 4GLBA 4GOMD 4X90A 3ZUPA 1PKEA 1RS0A 5DIZA 3U5ZB 1E1MA 3F0TA 3BXHA 3H19A 1YCHA 1L5NA 5BQPA 2WD8A 2VYND 5IULC 5K3CA 1ZVKA 1ETHA 5HRUA 2JGRA 1QH1B 3D8TA 3QBEA 1SUWA 1W0CA 1A4UA 3FF4A 1RI1A 3QBDA 4DZZA 1JF8A 3WWDA 3P71T 1TM1E 2Q5HA 1MQ3A 1FFEA 4OQPA 1Y3AA 2CYBA 4P82A 4UM9B 4U00A 2Z4TA 3Q4GA 2NZXA 2UDPA 2EQBA 3LX4A 5HPYB 4W9RA 3ZLBA 3NBFA 5C51B 2C99A 1N62A 5LXTF 3IHQB 1ZESA 1I1NA 1JG3A 1TF2A 1F17A 5J2TF 1FTYA 1RWVA 2ZKIA 1TYAE 3NJRA 2YDXA 4R9VA 3RSHA 1AVTA 3ETCA 3LFUA 2NV6A 1BNCA 4YMMA 2D0PB 5IN4A 2GGSA 1M2FA 1DUIA 5EA2A 3PR5B 5KG7A 3IMEA 7ICRA 2YYZA 3LG2A 3M9OB 3OX2A 4I1YA 3MWKA 2IYSA 5EVJA 3OWHA 4D8WA 1BEZA 5K0JA 1M1YA 3K0HA 3EXG1 2IPOA 3NTQA 5I7RA 5KJ6A 5E4TA 5FOXA 2V7EA 5IJ9A 1JR4A 1R5NA 1Z06A 4G89A 4KLMA 1UXOA 5EUBA 3ZWQA 1BDMA 3TOXA 4V3CA 3NV7A 3DA8A 1KBUA 1V48A 1NFRA 3LXXA 3D3NA 4RKEA 1PNRA 4L5JA 2V8OA 3PHHA 4W5OA 1XN4A 4U7WA 3DSRA 1XMIA 3L40A 4KXFB 1WS6A 3VNBA 5FYQA 1BE1A 1DLJA 3GVCA 2IZZA 3O0TA 3LWDA 3PGLA 3W8FA 5KBYA 2HO4A 3QQ5A 4UU1A 4J7UA 5AVZA 4IRXA 2E5SA 4J2TA 4CM7A 2VNJA 1KQQA 4OKSA 2VP9A 3AIKA 3ENVA 5DI3B 4MWOA 1X42A 2VXCA 4XGIA 4LWPA 2QTVA 4IVPA 5IARA 5KYYA 2OB2A 4RTPA 3DMYA 2PO5A 2XYRA 1WB5A 4EJMA 2C03A 4M9HA 3SBEA 4F4KA 4RX1A 2H92A 3PX0A 1MW9X 1H8ED 1ZQNA 1L5MA 2R7NA 5CLJA 3NRBA 5KTQA 1XHLA 4Y1GA 2YS6A 3KPYA 4O4JA 2WWHA 3TN7A 3F8SA 3DVRX 4LDQA 4RZRA 1YZ6A 2XRFA 3IA7A 4UEQA 4J16C 3KSDO 4EAAA 3BS4A 2JANA 2R00C 4WMLA 4LFAB 3REQB 4ETMA 7ICMA 1U2SA 4GAEA 5CP2A 2IF0A 3GJZA 1FDWA 4AJJA 3RTVA 1WCNA 1AX9A 2BUCA 3B6IA 3F47A 3DUWA 1Y9DA 5CM8B 4KIJA 4JXJA 4MGKR 2FFAA 4AT1A 4OI0A 2Q8NA 5LIRA 2PFQA 4TTRA 4HPXB 3GCDA 5IK2A 4DW8A 4L5YA 4UBKA 2VAPA 5EIFA 5LYJF 1LXCA 5AI0A 4URWR 1SB3C 1SL1A 1CZHA 1PS8A 3VPSA 1G5HA 1UODA 2F3SA 1BCSA 1FP4A 4FYIA 4J8PA 3Q87B 2PGNA 1L4EA 3RU3A 1LU9A 1PTJC 1I2ZA 3C1UA 3OOEA 2DBRA 3QMVA 5DM70 1MORA 5JO0A 2ZPAA 3BK2A 3HY4A 4DIMA 2ZITA 3O8NA 4K6MA 2BEUB 4CKYA 5BXYA 3R8FA 3CCFA 2HGZA 5ICCA 2JRZA 4EH1A 3A2MA 3ELYA 3T5PA 2J3JA 1N2CA 1FSGA 1P7VA 4UPDA 3SZOA 4FJ0A 3UHAA 1WUJS 2HNAA 2QRMA 5KCZA 5EWFA 1ZM7A 2YN4A 4FYKA 1NA5A 2O8NA 3RARA 3WJAA 4KVAA 1P3JA 1DAKA 3N39C 3IXMA 1TPZA 1PT8A 1RXVA 5EQJB 1CF4A 3ZZ0A 2KZZA 3IJ5A 3PQ3A 1VMKA 3W0LB 4CEJB 4KGZA 1VDZA 5FTJA 5FDFA 3ZDEA 3BDAA 1IH8A 3QKTA 2NO1A 2ES4A 1JIUA 4Q9LA 2PKWA 2QE6A 4KLLA 1FYXA 1QRTA 3DOIA 3EEFA 2XRZA 1EZ4A 1NF8A 3UJ8A 3AFGA 4XUGB 2XVMA 5GONB 2ZBRA 1L2TA 4TSKA 4H7PA 4UHJA 1N2CE 4AQDA 1BN7A 1JEDA 2IODA 3EOAI 4LF5B 1OLUB 3HSSA 4ECUA 1F8FA 3CNLA 3EBLA 3MOSA 2FEAA 5DMXA 1O03A 1GUFA 1FFCA 2YFKA 2H85A 1C50A 1TGYA 3A27A 5E7IA 1J2YA 3U4IA 4ZGGA 1FZQA 3SR0A 4MOWA 3CBGA 2LYHA 3E82A 5DCLA 6LDHA 9LDBA 1KH2A 1FQOA 2F1HA 3SFZA 3O2QB 5JZSA 1Z5PA 4DKJA 4CM4B 4EX7A 1IQUA 3ODPA 4MICA 4F4XA 1YB5A 1XVTA 3ZHOA 2VIIA 4BLPA 1SXJD 1FXWF 4XIGS 1HMYA 5ALXA 2AEJA 3LWZA 3O4VA 2VZLA 2XSZD 4PRZA 3H0KA 3QLEA 1L5KA 2I6FA 4IR7A 1VI5A 5J43A 3L6OO 4DYDA 1GXSB 1T10A 4MKGA 3CT6A 1SD1A 2AXQA 4CGYA 3NTUA 2HJGA 3BHNA 3JQFA 1T9BA 3CX8A 2PY6A 3B3AA 4MPDA 4Q9NA 1YHYA 1MH9A 4GOKA 1E0KA 3GVPA 4FCVA 3VYRB 3WMRA 1J0DA 3HXKA 3ZDFA 5CVDA 3RSSA 3FDZA 1WXQA 1L6NA 4ROTA 3I09A 1V6SA 1K3UB 4L15A 4C4PA 2JLYA 3GLHE 4NY1A 4TL7A 4Z54A 4WNAA 2AG1A 3ZEIA 1ZBQA 2BD0A 7ICPA 3LCRA 3WSVA 5EIBD 3UWKA 3U4QB 2PX2A 4MCIA 1FPMA 3PPXA 1Q16A 3VR3D 2OCYC 4PONA 3SAGA 1K4KA 4HGZA 1HURA 3VFDA 1ECLA 1BOFA 3VRHA 4C3UA 3KJQA 4J9MA 4L28A 4ERNA 5CDHA 4B31A 2M6KA 1F6WA 1FNNA 1Z5GA 3OPYB 3DR3A 3DZBA 3GILA 2BISA 2W37A 3KZVA 1XE3A 4PYRA 2PX3A 5FJIA 5CFLA 4Z2AA 3WAGA 1K1QA 2XOKA 4EFLA 5AXCA 4NHEA 4WDQA 3LP8A 1TZMA 3G9QA 4KIFA 4AMVA 3QFTA 1WAMA 2REQB 3UM9A 1UQUA 5CWRA 1Z6AA 2C42A 4JFRA 2SCUB 1HLFA 1CYDA 3CSUA 4M9RA 3OC6A 2OBLA 3IEUA 4JYAB 3HCPA 1X7WB 4XWTA 1PWHA 3CRXA 4DG8A 5C8ZA 3MWGA 5EPUA 1ADGA 1II8A 3V1NA 4CKWB 3HRHA 1YV9A 3HHPA 3IX7A 3F7MA 4NCAA 1GGKA 4RKQA 4Q43A 1X6IA 1A95A 4E5KA 5FLKA 4FFVA 5A0FA 1T36B 2ODAA 2R97A 3HWTA 3FTDA 2GPSA 4M8KA 2E3JA 1NHWA 3QE2A 4MITA 2H0RA 1V5FA 13PKA 1DPGA 3L8CA 1KXJA 4NMXB 1EDEA 4ZOLF 4ARBA 3EAFA 1C4WA 3O3MB 3K31A 4KAAA 2FUKA 3MWFA 1N5MA 4M9XA 1DB3A 5F9LA 2O5EA 2P62A 3IKJA 1GARA 1QK3A 4HQNA 3MRXA 1SHUX 3ZU4A 4DC0A 1G20A 1L4GA 2HA3A 4Q4AB 5DG8A 1BIFA 1P7PA 4HSGA 5K9ZA 3H5NA 3PXUA 4E11A 1P6UA 2GARA 1E2JA 2G5CA 2Z3WA 2ZVQX 2ZRKA 1KBQA 3LQ1A 3UQYS 3O2NA 4ZREA 2VHWA 3WMEA 2VDNB 3T52A 3MMSA 4JL8A 4BTVA 1Q91A 3EIQA 1YR3A 2OBNA 2OAP1 4WL0A 2NP6A 1JPNA 4MZDA 2I7DA 3JD4A 4N0MA 7ICJA 2QM7A 1NYTA 2VPYA 4I8XA 2ALJA 3PS9A 4ZCQA 1R6UA 1PNVA 2BKUA 4UDNA 4YECA 3M4ZA 3L92A 1N9GA 2PLAA 1ESCA 4D3DA 1KZ1A 4D99A 5CFPA 1AG9A 1LZLA 1Q20A 1YRBA 3OJXA 4YB8A 3ZDXB 1SXIA 3KXDA 4HJXA 3MFIA 1G6Q1 3CZCA 2B4QA 3IQHX 3NHZA 1XEXA 5AWFC 3D02A 2BYTA 1L3VA 4IIJB 5KPJA 5AVXA 1NW7A 2IHVA 1GITA 5K3EA 8ICTA 3DMNA 2VTEA 2PZAA 3MQFA 1VHTA 1SL0A 2DTXA 3A1UA 4LZLA 3GZJA 2Z58A 1AU9A 3IEIA 4DGSA 3W2GA 2AGOA 1ZQ9A 1Q7CA 2XMRA 3PE4A 4OAOA 2ZI3A 4TTVA 5C9ZA 3CV3A 4IJ5A 3C3DA 2BZ0A 4EHAA 5J8YC 1H2EA 2FQQA 2KOBA 2FXVA 2N42A 3A6JA 5DHSA 3ASVA 4BJ5A 2J33A 2XTAA 2X58A 4K8RB 1G42A 5BWBA 3R9XB 4PXYA 3LUHA 2KKVA 1ZOIA 5JQGF 2IH4A 2AKAB 4JQZA 3KHGA 4Q7EA 3W5DA 2O54A 2C20A 4JAVC 5EG5A 3R9IA 2I99A 4ECSA 4QZVA 4MF2A 4O4LB 1W29A 2H4XA 4ENTA 1ONBA 4HAWA 3HFJA 1AH2A 4P6VF 3V7FA 1EVIA 1OX6A 5C31A 4O0LA 3TQFA 3UANA 4LF4B 3U39A 2X7XA 4GWGA 2VDMB 4UBNA 5K0FA 3ENWA 4O4JF 1CJUC 2P5TB 1C9JA 2H4HA 1ST2A 4JBYA 4TTIA 3PUXA 3RIGA 5JCPA 2UXCB 2D5IA 3LBNA 3W9BA 2HDWA 2XWSA 3MA0A 4ZRNA 4AQ7A 3NDJA 4G07A 4ZYYA 4IMRA 1D0SA 3VQTA 2PLFA 1NKVA 2FN7A 3RT1A 5A4IS 5KX5A 1H2BA 1DEOA 2W2VA 2PKYX 2WUVA 1ZUWA 2K4IA 1XTBA 3AILA 4DDHA 1OD6A 2PSHA 2V1XA 1QQBA 4NJMA 4CF6A 3KPUA 1AS0A 3P9CA 2Q0ZX 3ECSA 4ZVUA 3UK2A 3CRVA 1L7XA 1XZKA 2GVNA 1T5HX 1ZN2A 3KYBA 3L6UA 5T4BA 4EY7A 2QB0B 1KY4A 2PTHA 3B6JA 3OMXA 3OZVA 5G0UA 3TCXB 1WLSA 4DMCA 1XC7A 4RPHA 3ECAA 4QBGB 1FRZA 2HF8A 3M1YA 1SUDA 4ZO9A 3CZMA 3ZE7A 4N82A 2QTLA 3JQGB 4OREX 1Z07A 3JAKA 1E59A 1JLSA 1M33A 1TM2A 2A5YB 4PZYA 3MTJA 4WUVA 4XW2A 3EXAA 5EJ5A 4XWWA 1SKMA 1WXWA 3CKYA 1JFTA 1XEAA 3GOQA 5GMOA 1H0SA 3RFCA 4WZBA 4Y2YA 3AFHA 3HL4A 3I5UA 2EZ9A 3KAPA 5DSXA 4CKBB 3NUGA 1E5XA 1TUIA 1T3GA 1SIWA 2HHAA 5DXAA 1MO4A 3AR6A 3C48A 5F98A 3EZ7A 2P68A 2ZVJA 4HH3C 3R75A 2QY6A 4GI1A 1ZSNA 5D85A 4CKCB 3GNQA 1MXHA 3O8OB 4W8GA 2PMFA 4EPVA 3LWLA 1YMUA 3FRHA 3BBLA 3UHPA 5ALYA 1KGDA 2QB5A 1U9IC 3OLZA 3CEMA 2ZXIA 3G8AA 3ONFA 4JLMA 4X92A 5FD8A 3T94A 4W9NC 5BT9A 4QIHA 2DU8A 3RIYA 4QBKA 1SA0B 2L19A 2FZ4A 4GMGA 4FDAA 4N6NA 4S1NA 1TF7A 4UHBA 3PD1A 4X60A 3KPVA 1HG0A 4KN4A 1I2MA 1UC5B 4DQVA 5ITZA 4PE5B 4QUDA 4TUQA 4Y2SA 4J16A 2TMDA 4NJEA 4U2BA 2ZYHA 4TKUA 5HS6A 4CR8A 2FNAA 3GLIB 2CFRA 1JJ7A 1G7CA 4FE7A 3F6YA 1QGOA 3BMQA 4L76A 5HIKA 2PS9A 3AJRA 4M22A 2A5DA 4HWSA 2HMVA 2ACWA 4DT1A 2W6ZA 2V74B 4ZT4A 4LNHA 2BMDA 3KC2A 3EWSA 3OFJA 3X1YA 1K9VF 3GMTA 5JWHA 1ZR4A 1WQ4A 3HXTA 1GYRA 2QJRA 3IO5A 5JZBA 2Y71A 3WRYC 1NOIA 1XTUA 1GPH1 1UMDA 2FQWA 4KO2S 4DC1A 1AMUA 1KYIA 1VCMA 1YKGA 2WEKA 3O1HB 4BMVA 2XKJE 3RTEA 7ICSA 2D2EA 3KK0A 2Z1MA 4DJDC 1I6MA 3E1KA 3SE0A 5CR0A 2CUNA 3W3AA 4EZ6A 4RJKA 4PZZA 5LDGA 4C2AA 4URXR 3RUPA 4UASA 4N3BA 5AM1A 1P2TA 4MYHA 3IBTA 3T35A 3JQ6A 1KAMA 3SPXA 3IESA 1GG8A 1V47A 3I72A 4X6YA 4ND8A 2CDAA 8ICBA 1JSCA 1NUAA 3F7TA 5FUXA 4G4JA 2ZJ6A 2JI9A 3LVRE 5AKXA 1DBSA 3QKWA 4A91A 5JZVA 3S7ZA 3RIEA 2G28A 4MP8A 1X7GA 1RAEA 5KQGA 3ECCA 2WU4A 2QG9A 3LGSA 4KN8A 4O63O 4FGKA 2VDLB 1EBBA 3KHHA 5CEJA 3VU0A 5JAMA 1YO6A 2HYIC 4RY9A 2O1SA 5EIXA 5B36A 1UFRA 4MR7B 1KEKA 3GJRA 3DHVA 3TDKA 4I1SA 2AG0A 5ALZA 3JQ8B 5DIFA 2IITA 1P33A 4MROA 1D9DA 121PA 4CV0A 2J48A 1E66A 1VIDA 3C43A 3EVCA 3M4XA 4Q37A 3AL2A 3QLVC 3OJWA 2ADOA 1W4CA 1Z39A 2C77A 4EA9A 3WLRA 1ZQFA 3FDIA 4MVJF 3IOMA 2PSDA 4YCSA 3HC7A 5SV2A 1KFTA 3FOBA 2C22A 1JFVA 1VCHA 4NF2A 3HO8A 3TKAA 4R0MA 3TTTA 3T1NA 3GUZA 5THXA 2V4UA 3URKA 2QXTA 3ZE0B 2ZZNA 3F5MA 4LDAA 2QX9A 4INZA 4LC1A 5HUJA 4UPVA 2IXAA 2WG0A 3GEEA 1WEKA 4J1NA 1TYDE 1F44A 2Z0MA 3PW7A 5FNZA 4PGMA 1AZLA 4V39A 1EWVA 2WMYA 1C9YA 1PWZA 2FMXA 3DZHA 4MW1A 1CUSA 4Z8XA 9ICWA 2V7QD 3NONA 1R0XA 2ZIVA 4NY8A 2VJPA 3IURA 4MA0A 4AZ0A 2CSUA 4TLAA 5B1EA 5L3QA 4BQFA 3QYAA 4S05A 4GXJA 4C8OA 3KKEA 3GRYA 3JRXA 2XI4A 2GAOA 4H7DA 2DPGA 2HLHA 4I5DA 3A31A 1RJGA 4CKEA 4NK4A 4BNDB 4QE3A 2DGZA 3DOHA 3RODA 4DSFA 1Z5WA 3GFOA 4B9VA 4ASUD 4DANA 1FF9A 1WYGA 1G4UR 1K27A 2O3QA 3JATA 5BOLA 2GAIA 4ND8B 4PPFA 2BWJA 3K05A 1RHJA 1CQWA 1KLNA 4ZCLA 2C5EA 1X0XA 2AYXA 2UUPA 1MAWA 3VZDA 2VNIA 2VJ4A 4R54A 9ICCA 1LQTA 3TRJA 1VBFA 1VLQA 2J5XA 4K05A 1T8YA 4KL8S 3CW2A 1PR1A 2H8GA 2XQJA 3H4VA 2AS0A 3OO1A 3MRTA 3JX9A 4WQMA 1O94D 2CYAA 2PEZA 1E2IA 4L08A 4R8MA 3RAGA 3RC9A 2FA9A 4X1KB 3CH4B 1HA3A 4ISBA 3C5WP 5IC6A 3K0BA 1WOMA 2WJZB 5C5JA 1Q6YA 1TM7E 4HB3A 3CE9A 2EARA 1JWAB 2GA9A 1RPJA 3OZUA 4Q44A 3HKBB 3VAZA 2I71A 4UBIA 4M37A 1FFXA 2B4TO 1P7YA 2FFBA 4MKRA 4CPDA 1SBIA 5CPFA 1QAMA 1R0RE 3QX3A 4C78A 3CW8X 4IV5A 4ZT5A 5KMGA 2G0AA 1ISMA 3NBZC 4IHAA 5BVHB 4O33A 1L0BA 4EUEA 2LM4A 2W6IA 3AYXB 3ONEA 2NUPB 4LAFA 1WF3A 3RH0A 3RBAA 1S3FA 4PYJA 3EW9A 1S2LA 2D6FC 1WWKA 2AUNA 1Y9AA 3BN3A 3FI9A 4F71A 4AYXA 3NH6A 1K98A 1A5SB 4GXQA 4BLWA 3ER9A 1MIHA 2GJ8A 4ID9A 4J7AA 4PBSA 1WY5A 1X8KA 4DLEA 1N1EA 2GEVA 5BNWA 4ZRMA 1N7HA 1KYXA 3A9WA 2OV3A 3CO5A 4EG4A 5BN3A 5K0BA 1TMOA 4IL6U 1XRLA 4M60A 2GXUA 5FUQA 3SFTA 2YHIB 1QFJA 1J1IA 1JH9A 3IYLW 3ZJUA 1OV6A 5J63A 4EKNB 3CT4A 3IMFA 4HRAA 3OZBA 4AL4A 3JATB 3QIAA 5JQGA 3F9CA 3QSGA 2ZSIA 3GBPA 3ZIAA 1ZL2A 2HRDA 3Q3HA 4PSAA 5CNJA 3O1LA 1Y9ZA 3TXAA 3DBHB 3MN1A 4L0CA 5KSOA 1TEXA 1XTZA 2BR0A 1EVQA 1E1LA 4UMVA 2ZJ7A 2EKPA 3UF0A 3R76A 5A3JA 2QQFA 5JY6A 4Z7OB 4EYHB 2WJGA 4AFNA 3VM6A 2VZ0A 3AEUA 3JPNA 1X9HA 1JH8A 2JLQA 2Y1XA 1V8OA 2HJWA 2QMZA 3UICA 4EX6A 4JUFA 2ZPTX 3HG7A 2RSLA 2Y0BA 4J6EA 2I4TA 2PNJA 1H3NA 3CNEA 1KJWA 3JAWA 1K0UA 3PR4A 1FTNA 2VSFA 5IRCD 3QPWA 5IWAB 4F3TA 4BNNA 4M7RA 3GUVA 4W6QA 4HPWA 5KYKA 2OA0A 5GTDA 3WLPA 3VMMA 2I4LA 3DMTA 3M6VA 4JR0A 1Z34A 4MQUA 3U44B 3C8UA 4HVLA 2WM8A 2JLBA 2R751 1DUVG 1PJSA 3A4VA 4XEHA 4B8ZA 4E33A 5EJ8A 3Q72A 1XKTA 5FLEX 3SM3A 3RFXA 4E5MA 3SXJA 1P0PA 4K81B 2ZYDA 1F2UA 2QG4A 1XUOA 1ZINA 3U9TA 3CKMA 1MJNA 1EWYA 5CB4A 3VKGA 3NTVA 3L04A 3GY0A 1ZD4A 1V5GA 1C1XA 2JGIA 4RPJA 4E21A 5LMUB 4CLRB 3H2JA 4AO8A 3S0JA 4YYEA 1FLAA 2NNWB 4PCVA 4QA9A 5DWDA 3PIIA 4ETWA 2VH5R 1H05A 3D43A 5C3UA 2XZLA 2QARA 3NRJA 1USIA 3GLGA 2R8HA 1QIJA 3NKLA 3R5SA 4CKBA 1CUDA 2P65A 4ED3A 1FP6A 3BGVA 1TKDA 1BC5A 1GFSA 4IGAA 1X7YB 4TUSA 1L4YA 2CVOA 1QMPA 5EOZA 2GPNA 1JEYB 2GUWA 2XY4A 4BWVA 3MOIA 3EG9A 4OB7A 1TK3A 1NR1A 3BZWA 5AUOB 2W8LA 3IR7A 5BPHA 1KK2A 2DH5A 2PZEA 3WZ2A 2B0CA 2ASEA 3KEQA 4AMGA 3PQEA 2H0AA 4KH1A 1TVKB 1D5CA 3UK7A 1ZQDA 2E1PA 3FWHA 2A9OA 4I7EA 2K87A 4LSMA 3HDQA 4BY9E 2PR7A 4AJIA 1FJGB 1KZ9A 3JXEA 5K45A 3GQBB 4PZCA 4ZYVA 3IAFA 1ZKDA 3JASA 5JASA 3MR6A 1OWLA 2AFIA 4IH4A 4WD3A 3WRWA 1XG5A 4WJZA 1NXWA 1EZZA 1QCCA 8ICPA 4YA6A 2AJ8A 4KFCA 1P7ZA 3FTPA 1HM5A 5KSYA 1VECA 3UQ2A 2V9ZA 4NYJQ 2DB3A 3ISDA 5EZ6B 4EDFA 4YRIA 3SV3A 3M8SA 4LJLA 3F6RA 2ZTUA 1PUIA 4PJ0U 1IUPA 4I1PA 2ZJ1A 3MCZA 4BN5A 2QUKA 1XZBA 2ARKA 1W4ZA 1PFKA 3J81k 3AVWA 1LD3A 3C8ZA 3JV7A 3B1YA 1TPYA 3GPIA 4PX9A 4LZDA 2PIAA 1OWOA 1L4LA 4Q5IA 3K20A 1QLWA 3I2JA 3ZQ4A 1XIVA 2J7KA 3LY5A 2XNSA 2XT0A 2JLZA 2XOEA 3D5QA 4D4HA 3GEDA 3VO9A 5CFMA 3CQ9A 1MG0A 5BUCA 1YWGO 3LQ4A 4ZVTA 4TTAA 1NVBA 3K4PA 1Q1GA 3VDRA 1XR3A 1U0HC 3O94A 1U9IA 3FTQA 1JHYA 2DJIA 3HVHA 2XD4A 2WYHA 4C14A 4CMKA 5FLXA 3NBKA 1SBYA 3GLSA 4ML3A 1KZ7B 1M2GA 3D4LA 3MZ0A 4FZ5A 5IXSA 4JQCA 1QHHA 3BQ2A 1T4MA 4ZAYA 4D8VA 5J47A 4U3JA 4MJXA 3ZW9A 3KZIU 1TK9A 2VYCA 3X1KA 3T34A 2OK7A 1DIGA 3ZOKA 3GFQA 3FHOA 5ALVA 1TCCA 3Q2IA 4LCJA 3U5TA 1BDBA 3TD9A 4JI2B 1QNLA 4U9IS 5E9QA 1USUA 1QC5A 3OWXA 4I50B 4BTEA 1T3ZA 3V7WA 3QLTA 1Y7IA 2W58A 1MG5A 5DRYA 1PT7A 2XE6A 9MHTA 3A7EA 4OIMA 2FP3A 1V3TA 1IK6A 1R1DA 3PEUA 4LGVA 3ZWMA 5CU7A 1TM3E 2VJOA 3O83A 1R0BA 1RKBA 2ZZKA 3JQPA 3PQ4A 4JY7A 4OJMX 6PFKA 4RNNA 1N77A 1CR0A 4C0AC 5LP6A 4M6WB 1I3OA 4RQ3A 4RVUA 5DPMA 1AQUA 1Q17A 1RWWA 4BNTA 3M6FA 1JDBB 4EMTA 2C9YA 2WQZA 5JAPA 3IG5A 4P35A 2VR1A 5F78A 5MGNA 2R7MA 4HNAA 3M0EA 1E64A 1HLDA 3ZBQA 2IBTA 1MQ9A 5C32A 4MWCA 4X5VA 3NVKI 1JPJA 4YPOA 3TEMA 3HFRA 3L2OB 2RH9B 1GU1A 1MJGA 2YJNA 4H0FA 4TWZA 2QHXA 3R7NA 3VR5D 5EUMA 2B9EA 2JCXA 2Q4EA 3BCSA 3I9KA 4IM7A 4LYHA 1LVGA 4M7OA 4YJ3A 4YRLA 4C0SA 3K96A 1TOAA 3AR4A 1YRHA 3NT4A 4ZO7A 3WK5A 1UWVA 4DR6B 2IDMA 4BASA 1BXKA 3PJDA 1JHRA 5JVDB 1ZL0A 4RMJA 1Y3FE 3A6HA 2WM3A 1ZNYA 3FPBA 2JCSA 4P81A 4BV9A 3KQVA 3N7UA 4YGYA 2PAFA 2D3DA 1QCKA 4QZFA 2PPVA 2GSWA 4ZK2A 1SN7A 1TRKA 2CJWA 1RJEA 2I65A 2YY7A 2KK0A 2B6NA 4HGRA 5TPZA 4JI6B 3IVAA 4KN6A 1SFRA 4L4XA 3OSNA 1ZQVA 2EZ8A 5JG7A 4ESEA 5F3WB 2C04A 4IEEA 3IUMA 3CKKA 3SFVA 1F0KA 2W7OA 4AZSA 1KFJB 4D3ZA 2DWCA 3H1PA 1PVPA 1JR3E 1N7IA 5CDSA 2JD0A 2VVTA 4FYHA 1DQSA 3AF5A 2QLJA 1X8XA 3CZ5A 4LVNA 4C7OB 5BSVA 1Y9EA 4IVNA 3TRFA 2XC9A 3KQQA 4MLCA 1E9AA 2FFRA 4UAZA 5F4BA 2FEXA 1RR6A 4HFNA 3GUCA 2W6JD 1MF7A 2R6ZA 5LP6B 4P4MA 4WGFA 3THWA 1QS0A 4HT3B 4QBHA 4MHTA 2I8CA 4YP9A 4PPXA 1PR3A 4D3XA 2IUTA 4A8JA 3R3UA 1BD4A 4L4YA 4I4CA 3W2HA 3CVXA 1JIXA 4M2LA 2W8ZA 2B36A 2IZ6A 5JDCA 3M89A 1QZUA 2QTZA 4M7WA 1KORA 4Y2XA 9ICFA 3SY8A 4XYGA 2B1JA 2H3IA 4GC9A 1JHVA 3BF8A 4E70A 1CJSA 2JGDA 5I8PA 3R0QA 1WL8A 4ARZB 2VDUE 3CJRA 1JJIA 4XWAA 2DXIA 2XXAB 3JVIA 5KAIU 4JNKA 2QMUA 3FJ1A 4KC0A 4WERA 4UAYA 1X7XA 1FFYA 1J24A 4MF8A 3RQSA 1JA9A 1ORWA 1SXPA 3UPQA 3UAGA 1F5SA 1QNFA 5EE1A 1R8XA 5HTKA 2E48A 2KMLA 3B3JA 4N0QA 4UUMA 3UFXA 4BFCA 1KOFA 2V6GA 4GPAA 1RRMA 1SM4A 1HDCA 3KZXA 2CLIB 2HHSA 2G1AA 2BKVA 2QMYA 1ZAYA 2XMDA 3MR2A 1P4JA 3I4FA 1U6KA 2JH9A 3BZBA 1F6DA 2IFTA 3DDCA 1ZIXA 3HWRA 5KCMA 3WHKA 4EKIA 5IXYA 1SBNE 4D9IA 2CD7A 3WRYA 5LQMA 1DTEA 4YXWD 1C3LA 3DQPA 3GJ8A 3HKEB 1A82A 4LRXA 3LLSA 1LB2B 1D04A 2AMYA 1WMAA 3IBFA 3KEOA 3OE7D 3GRFA 4XQ9A 4EA8A 4ZVPA 1ESEA 3HR7A 4PQRA 5CB4F 1I36A 1QF9A 5A0TA 3GP5A 1ZD1A 1N61A 3BXGA 4OMFG 5BV0A 3S2SA 16PKA 1QONA 4H16A 4TMVA 1T1JA 2Q4RA 4HYQA 1XDWA 2VL7A 4JJFA 1Q92A 2SKCA 1GT6A 5LVAA 3THWB 3FBTA 4IG4A 1YJ5A 4FMCB 5H9WA 5KU7A 2VA3A 1M66A 2A7XA 3A25A 4LSWA 4Z49A 1R4MA 1T9KA 3HDYA 3AHDA 1VFNA 2XNJA 3AEZA 1JVBA 3K94A 3IR5A 3PXDA 4PGHA 1TQDA 4RD1A 2BPFA 4QLAA 4TWIA 4RPYA 1IJKA 4N5LA 2BC9A 4L57A 4W5NA 2W2KA 2H3HA 4MVCA 1L1RA 5EE0A 4NG5A 2CCGA 2WPDD 2CPRA 4BRZA 4R6XA 4IUDS 4OUDA 4WLVA 4C8MA 4PPYA 1O6ZA 1KMNA 2WZCA 4NVRA 4UE2A 1OXXK 3QLVA 1UBKS 3OP4A 5D3MB 1SXJA 1O0SA 4Q34A 5F4ZA 4TQSA 2H1RA 3HPRA 4ZU1X 5AP9A 4MJ3A 3OE7A 4WVLA 2PJRA 1BPZA 1ML4A 3QUCA 1U98A 1P60A 1WWVA 1SKQA 2A0UA 4O3NA 1S2NA 2JAUA 3BRWD 3B60A 4LFBB 2JZOA 4XJVA 1YDFA 2ODPA 3B7WA 2JI7A 5IVDA 2FPMA 2W9XA 4I28A 3C3EA 3LAWA 3QGMA 1Z29A 4M0UA 2OXIA 4V3BA 3ZLVA 1W76A 2OSVA 1M1UA 1LPMA 1N5IA 2D0DA 4PBTA 1GPKA 5J58A 4QOFA 2D54A 1V6CA 2HC9A 3C7KA 3TQRA 4FUQA 3ZWWA 2B7BA 3JQAD 1T1SA 4D44A 2XBMA 4KRFA 4LOHA 3RRNA 1OXTA 1V2GA 5DWQA 3FNHA 2OEHA 1LZKA 1A9PA 2VH1A 1DTWA 1L3BA 2CXPA 4IDQA 4JBNA 1OXMA 3EDRA 4L0QA 1OZAA 3MWDB 3RB3A 1N6HA 4TXMA 5EXPA 2AZ4A 4ZIRB 3EAGA 1XZLA 3V2IA 5JATA 3FWZA 1YDWA 1PW7A 2EOAA 1MT3A 1RYYA 3F5DA 4I2NA 4DPLA 1XALA 4XZ3A 1NIPA 2CLHB 4UUNA 2CZCA 3U81A 1YJXA 3DLTA 1J22A 3Q3CA 4J9SA 3C7DB 5AW1A 1UT8A 1UXGA 1B2LA 4I2DA 1J99A 3TLAA 1CFJA 1P1FA 1GTG1 3L7CA 1TZ2A 1LPPA 1ZD8A 3D6FA 3WK6A 3EXFB 1PFVA 1F2TB 4RO0A 1H22A 1YUNA 3V6MA 1Y6JA 3GVHA 1QO0D 2QXUA 2OLJA 1KYZA 3RVRA 3OOWA 1O9BA 1TU4A 5EYPA 3SIXA 3EF3A 1Y80A 2BCVA 4OFWA 1LDMA 4RD6A 2NTYC 5TVKA 3RFTA 2G36A 3JVUA 3WGQA 5IC5A 3LW7A 2ZUDA 4WNCA 3A4NA 4TQUS 1FNBA 3L7AA 1DFGA 4RE5A 3CX6A 4CCHA 1QHYA 4G5QA 3FKSA 1DARA 2WSYB 3QF4B 4AKSA 3W8EA 4HS4A 2LDXA 3OFNA 5TGZA 1UK7A 2Q0HA 4RQ0A 2Y8EA 3I6BA 2R6CA 1W4BA 2B8JA 2Y0EA 1EKXA 4OG2A 3KX2A 3IQIX 5F1PA 1QE3A 2IS1A 3ENQA 4L9SA 4A82A 4J9NA 1E58A 1TDJA 4GLJA 2KJ5A 1HBJA 2R8JA 5GOTA 2ZRHA 3WWEA 1WDKA 2NOAA 2XGOA 4Y0NA 4AVYA 4LXQA 4BXOA 3G8BA 2YYYA 1DKOA 2C2OA 2W2TA 4RHYA 2WG2A 1NT4A 1VP9A 4I6EA 2YRXA 3K4QA 1FYDA 3KDSE 2QLNA 3MINA 5BR1A 2PS1A 4LYAA 4RMHA 4C0BA 3TADA 4BNIA 3PGVA 3GVXA 2JFBA 5EWEA 1F8UA 3MYYA 4BQSA 2EGHA 3LQQA 3D6MA 2A0YA 3AP3A 2A4KA 3QH4A 3UV3A 2COUA 2W6JA 2B82A 3H2KA 4WLNA 4XIYA 4XVRA 2OYYA 5KZMB 1G3QA 3GP3A 2IP1A 4G2NA 3WKAA 4U0JA 3DHNA 1TUEA 3P32A 4G24A 4YCDA 3T0GA 1W44A 1TLTA 5B3JC 3V5NA 4PX3A 4DUGD 1WCYA 3PX2A 4C1NA 3GIWA 1LPSA 1MB2A 3HCWA 4MV3A 3G9UA 1U04A 2ACEA 5GGYA 4F6RA 4S0ZA 3CRNA 4G6ZA 1DDOA 4LMPA 3B6ZA 5C18A 1BDIA 4HEA6 4RLSA 3DVAB 3G85A 5DYNA 2JLXA 3A10A 4P84A 1HT2E 2GOLA 2LGJA 3ESDA 5FI1B 4IFTA 3WIVA 4BMNA 2DUMA 2DE0X 4ND7A 4RIFA 4PZ0A 2ONKA 1F4PA 1CZUA 4WCVA 1OZFA 2I80A 5A7GA 3ZI7A 1G20E 2I1QA 2C88A 3ISVA 4IWYA 4NBVA 5JE8A 2ZIGA 3LKVA 3RE1A 2EFGA 3ZCPA 2ESRA 3OCJA 1QGUA 2HJHA 4Q3CA 1WW3A 4YJ2A 1YQXA 4WEOA 5J0PA 1GCAA 3IP1A 3OQIA 3B2NA 3PUYA 4FZNA 1GNVA 3L8DA 4K86A 5JD6A 3SG0A 2J0EA 2DETA 1UKAA 4BQIA 5KREA 3JD2A 1J0EA 3TECE 4XYBA 4C7OA 2ZYTX 3L93A 3ILSA 1DRGA 3RH4A 5E2AA 2FMSA 3MMXA 1ECBA 1CE8B 4HADA 4DLGA 3HJRA 4OL0A 4R7GA 1NK9A 1H8HA 3TAQA 1FUIA 2DGDA 2FEMA 2FR8A 3FPAA 1L5GB 3FC4A 1W5BA 1W25A 1RPNA 4L4RA 1NXPA 3LKBA 1O5OA 3BJIC 3PHGA 4RUKA 4DDUA 4ZI7A 1SBZA 5E1BA 3S8EA 2WAQC 1T8UA 2JLAA 1IZYA 2C1XA 3SAHA 3DTVA 3E05A 1VM6A 3G0CA 4H0CA 2PUEA 2YIMA 3OOYA 3GHHA 4E03A 2PSEA 4FZRA 5JH7B 5IILA 3N2KA 3RRJA 4B82A 2KFNA 4UDXX 1OB5A 3KQYA 2AX4A 1FP4B 3Q3JB 4CEIA 4TWBA 4QUKA 4J1QA 1GADO 2ZBUA 1M8GA 2RGWA 1T36A 3AF0A 4V2IA 5JCJD 1SKYB 2CYCA 1XV5A 1CG6A 5TF0A 4AULA 3H4BA 3JD0A 4MEXA 1Z6XA 3LF2A 4ITUA 1UR5A 2G71A 3JZIA 4C80A 1OFUA 1VI2A 2CGEA 2GCGA 1CNEA 2J31A 4J1TC 2GFQA 4H15A 2EG5A 5I7AA 4D6XA 4ZT3A 4ESVA 1JQJC 4UCQA 4RQUA 1ZNQO 9ICXA 2C2WA 2DJ5A 1MOSA 1IONA 1MA0A 4TXHA 1LNQA 3LVFO 4JHXA 4RENA 2QN1A 3JQBC 4P4OA 1MNQA 3GLRA 4DTCA 2WU0A 1P74A 3PYLA 4XB6B 1ZQOA 1C9KA 1JP7A 2XE7A 3CMMA 4HQLA 4C7VA 2VHCA 2WA1A 3LZCA 4C21A 5ITSA 3LYLA 3NNNA 4BDSA 2OH2A 4P5DA 5CIYA 1LF5A 3PVXA 4EYSA 3FUXA 2YMQA 1NMQA 2XJ4A 3FFBA 2JCGA 3QFCA 3TNYA 3ZLUA 2F17A 5IM5A 1KIAA 1KO8A 3IR6A 3OHMA 4LJ9A 3KOXA 1XF1A 4MV6A 6YASA 5M7EA 3RGWS 3F5EA 1YZ7A 4GOJA 4FJ1A 1P0IA 1N1GA 4KN7A 1VXRA 2X13A 3GA0A 3HBAA 3L4EA 3NCTA 4UVGA 5LMCA 3MG9A 4BVAA 1JKXA 1XZEA 3L49A 1JEEA 3QYPA 1E3TA 1H9AA 1JTVA 3L8FA 4EHHA 3K9HA 3AP2A 4DOAA 3FPEA 4ALIA 1W35A 1QYVA 3NR2A 4JT9A 3MWEB 3QZUA 3SS7X 1GUAA 3RYTC 2VPQA 2P2SA 2PD6A 1DBPA 1SPBS 4OI2A 1P2SA 3LTEA 4OBEA 2ETXA 1HSZA 3E9CA 3FF1A 1XDDA 1ZOOA 5CB6A 3G2KA 5KT5A 1SH7A 5AVOA 4CIDA 3ET5A 3FTEA 5KAPA 1SQ0A 2A92A 1GXSA 1YL5A 3KV3O 3OIWA 7ICHA 5L8VA 2B94A 2Z8YA 5DNWA 3UXOA 5AW7A 4LZWA 3R5JA 3DMDA 4FBUA 2B8EA 4FYYA 2C2KA 4DL7A 2C9ZA 1TK0A 3IEKA 1MFZA 1QZTA 8ICXA 1NBEA 4K87A 4EY4A 1COZA 4A0HA 3F96A 3GFTA 3HB7A 5IVKA 3C3BA 3OJ0A 3KU1A 1NLUA 4JBLA 1SKAA 2C94A 2NSYA 2WJPA 4C7MA 4PLWA 4PNEA 1TKRA 3BPSA 1JIIA 5CA1F 4UTZA 2B1RA 4FMPA 3IBYA 5I01A 3TLEA 5JXWA 3GRVA 2DTDA 4X45A 4CEHB 1THMA 4LNUA 2DCMA 5LP6C 3UAOA 3ANYB 3WGHA 4M0AA 3PXCX 2Q1SA 3SQMA 4NONA 4P92A 2ZIFA 2JFXA 2HBMA 3F4BA 1KO5A 5JMTA 1EFAA 2KHZA 4L9AA 1WVIA 3HXLA 3JVEA 4OMUA 3EA0A 4HTAA 5A02A 1N36B 1YR2A 2YWDA 3S2ZA 2Q4DA 3P4XA 4YQWA 4DZRA 4Y2RA 2VBCA 2I33A 1HKHA 1RWQA 4KJZA 3SJAA 3HUTA 2J5QA 8LDHA 4KWTA 4AB1A 4FFWA 4RPXA 4QUAA 3H8JA 1D6NA 4DV2B 1S4QA 4BKOA 5CD1A 2KJ9A 1OE0A 2X9QA 2J4CA 2HIGA 3IH5A 3UJHA 4AO6A 3JPPA 4KTTE 3KL4A 5CA7A 2ZUWA 3OJFA 1Z0UA 4BOYA 5KHOC 1FXUA 2WTAA 3W05A 1ULSA 2VK1A 4F8EA 2UYHA 4JS0A 2M9MA 4ELVA 3LA8A 4CQMB 3BREA 4RTNA 1J9EA 1ACLA 3PX7A 2OE2A 5EQFA 1A8PA 3V6LA 2IZ5A 1XWFA 1TXGA 4ABTA 3QW4B 1OUQA 3VKFA 1KOGA 3H5VA 4M76B 2YHSA 4ARAA 4ILKA 4ZEOA 5T4FA 3ZU5A 4F4HA 2BSXA 2ZIEA 4FGJA 1HDYA 2JK0A 3G0HA 3CYMA 1TIKA 3IEVA 2ZU0C 2FSGA 2XR1A 2PSJA 3MT0A 4EG7A 2QGZA 5D51S 3UC5A 1FFVA 3V6JA 1R8QA 3HGTA 4RF5A 2VXYA 4O4JB 2K5UA 4DRXB 1NBMD 5DTQA 3KJNA 4IO0A 2VDOB 1O94A 2QBYA 2PI5A 1F4LA 2I87A 5FL3A 2C2RA 1D5WA 5M29A 1SUBA 4RESA 3ZDDA 5AM3A 3R5HA 4MAFA 1KI9A 1N7JA 1XZGA 1EA5A 1Q0SA 2EHJA 1YI0A 3O73A 2JFZA 2DT5A 2F1KA 1A8HA 1UMDB 1Y5NA 2VPXA 2OHOA 3RO7A 4EVQA 3FYTA 4Z7JA 4I4LA 3WRXA 3H0MB 5CP8A 2BZGA 2IEBA 4G67A 4XXHA 1V37A 1VHJA 2VATA 5ALMA 4DM3A 4JZYA 4BBJA 3F5FA 3ONNA 2GZ1A 2VCHA 3BULA 3HN6A 4QWEA 2PX4A 2QYHA 4B4UA 4BP9A 1AO0A 4XVHA 2P27A 1EBFA 1WU8A 5J1TB 2Y9PB 1E79D 4IX9A 4DNQA 4DLVA 4BEVA 1ZY2A 4C4TA 4RJIA 3SEQA 1RYMA 3T7JA 4F8YA 1CT9A 1U0FA 4QICA 3NDPA 4X24A 1AK9A 2CL0X 2FZLA 1KL9A 2KLBA 3LC7O 3ID6C 4MGEA 4Q3AA 1JNYA 3VAYA 1UFOA 2NZUG 5J0YA 1NW9B 1QVRA 2MYNA 3HILA 2JLCA 3ETGA 3LX5A 4H31A 2VA2A 1NG1A 1Q19A 2AJQA 1FFDA 2UVVA 1B6SA 1NXXA 4WK6A 2WR8A 4YDSA 3D7MA 3GAZA 1XTSA 1NGSA 2OP1A 5AH0A 5HK9A 2X2EA 4INJA 2I7CA 4GGOA 1NUSA 2N0SA 3LUPA 3DXZA 2KTQA 4MB0A 5H4GA 1B0PA 1FUUA 1WQ3A 2CE2X 1KEWA 5G4LA 3TPFA 4E6PA 3FLBA 3DPIA 2Y1EA 2OXOA 2C7BA 1E4VA 1S2OA 2HHLA 2NAPA 2DQSA 4PLFA 1VKZA 1I1HA 3H05A 5A3SA 2D4AA 4HWKA 3P9PA 4D2IA 4YJKA 1PDOA 1CE8A 1YH3A 5CHGA 2C4TA 2B99A 2GM3A 4NK5A 5HRCA 5KC8A 3DZJA 4LDJA 4OXNA 1G2OA 3TLBA 4M9LA 2HBLA 1C4XA 3DR5A 4KI7A 1MQ8B 2C4VA 4RVCA 2EWMA 1LK0A 4LJYA 2Q5LA 5EOVA 2IV2X 4Q9IA 1XJ0A 1MEJA 2C95A 2Q9BA 3V4LA 5TQ0A 4QBTA 3WQSB 1WSBA 3L18A 1PEKE 4HLCA 1LPOA 5JXJA 1ZMRA 3AIMA 1CUVA 1RMTA 1RYBA 3IPAA 1F4VA 3KXPA 4B9AA 2ECKA 4D82A 5LL6P 2NZYA 4ECWA 1BCRA 4ILEA 4QYIB 3UMYA 5HHTA 1PK1A 3RQIA 3DBLA 2HHHB 4JGBA 1XNHA 1U3TA 3RVLA 1UH5A 2PRKA 2C5FA 5ICGA 4JBGA 3E22B 1KVSA 2GH1A 5IFKA 3EPKA 4C03A 4QUJA 1B3BA 3LHDA 2VHTA 4I1UA 5GJCA 2KBEA 1N9ZA 1B7GO 5CH8A 4DWOA 1T1EA 2ZVDA 1ZI8A 2LI6A 4IMIB 2R79A 4KXYA 1QO9A 2QAJA 2R62A 3E0FA 1LJUA 1XZNA 2PA0A 4UUQA 2KVSA 1E8NA 2XI9A 2A59A 1FB5A 4OP1A 1WLYA 1J1ZA 4PAOA 4Z7QB 1JFRA 3VX4A 2AVDA 5IX8A 1A8IA 3BX1A 1WHTB 3HRKA 4ER0A 3VGJA 4ZCTA 3SQLA 1QXSA 1ZVQA 2R8EA 4JJ6A 2F3QA 4OKIA 3VVMA 3CIFA 3I62A 1SVSA 2CUKA 4CE6A 2O7NA 2YV5A 2GHTA 1FBNA 3PB3A 2Q5FA 4NZPA 4RH1A 1ZVJA 3LDHA 1CEEA 5J8YA 5DB8A 5DMHA 4ZCSA 2KP7A 1T4CB 2ZYSA 4GICA 4JT8A 5FUWA 2BFWA 2O9JA 4IGIA 1QIIA 3KTDA 3DONA 1M2OA 1RJDA 1SELA 1VRVA 2IY9A 3CLRD 3FXAA 4IS3A 3TWOA 1FU8A 3I9OA 3U40A 3HH8A 2J6TA 2JIDA 3GXBA 4HJRA 4DN6A 2OWEA 5DX8A 2UUCB 1KXZA 4KZKA 5LOVF 1A2QA 1NM5C 1NW5A 1XPOA 3CJTA 3R7SA 1DJOA 2WJ3A 2VYVA 3R4VA 4ZEWA 3VV3A 2W6NA 2AI2A 1L5ZA 2ASDA 3MT8A 2I1WA 1FL9A 3MILA 3A11A 1F8YA 1N8SA 1QDUA 1J2MA 1MOZA 2SKDA 3BKWA 1U2DA 2A2ZA 1JR3A 3TKLA 2JGMA 1PK1B 3CXUA 5IABA 2CV1A 3ESCA 3R40A 1RWMA 2IYLD 1HEUA 1HTWA 2PZFA 3ZQUA 1G3IA 1GZSA 2Y99A 1E3JA 2QW1A 3R1IA 4NBNA 4Z9AA 2IYTA 4A2PA 3ADKA 3FNIA 1UXJA 4LVCA 4UUPA 3KQWA 4PZLA 3FVWA 3LI2A 3ZWVA 1GP2A 2I6XA 4YR9A 5I9IA 4HAXA 3KZ1E 1KEEB 5F7XA 4QU8A 1NZDA 5TEVA 3LRPA 5I7HA 1N0UA 4YMOA 3HDGA 1V26A 1H8EA 4MV5A 1RMYA 1NIJA 2B8NA 1DGJA 3CRQA 5BRNA 2WWFA 2CD9A 1YB4A 3AGQA 4IGKA 2IEGA 4KNWA 1J56A 1VG0B 4QRDA 3WLEA 4CM3A 5IN5A 3EUFA 2IXEA 1D8BA 4X1OA 1F48A 2OSBA 4X6LA 1FRVA 5TPWA 2ZI9A 1OH6A 1NVVQ 5FA6A 2QD4A 3EA4A 1T0HB 4OQYA 3IALA 4JVSB 2Q5IA 3KAKA 3KJHA 4MUAA 1J20A 1AXEA 4KYTA 3CIOA 3H6KA 3U1TA 1DPFA 3M33A 3VJRA 1M6NA 1TKCA 1J09A 1IN1A 1LLFA 2I7TA 4HH4A 3IB6A 3QU4A 3I23A 4I2GA 3DH0A 3I73A 5JBNA 3IL2A 1L9KA 5IZ4A 1ILEA 2B3DA 1B2RA 3ETEA 4IDOA 4KV9A 5KDLA 1JXOA 1MV8A 2OEPA 3M9NB 4I19A 4MIKA 2PKEA 1B1AA 2KYRA 4BNXA 4AC9A 3VKHA 2EG9A 4ZJYA 2H07A 1A2OA 1PSWA 2W0SA 4DWJA 1DEKA 3OICA 2C7PA 3THVA 1H0KA 3ONVA 1ZN9A 3OMLA 1LI4A 3PSIA 1U45A 2B5WA 2QL5A 3KVNA 4V0ME 2BPOA 2GFHA 3DF7A 3FYHA 4MQ4A 3PEFA 2R18A 4RCYA 3W5AA 2FWAA 2KWIA 4XPIA 2C7VA 1GGHA 4EI7A 4DARA 3DFUA 3ZGNA 3WFZA 1E0JA 4MUHA 4BVLA 1ETUA 4BQNA 3OPQA 4QWCA 5KYUB 4F6CA 2X77A 2WHQA 3EPHA 4OHKA 2IEZA 2GEJA 1MB3A 3GMIA 4UB3A 3FPKA 3PV8A 4U2KA 4B7CA 2I8AA 1YR8A 2PFGA 1B3RA 1EFKA 5BWMA 1KGSA 4WGGA 4K5QA 1RI3A 2O5VA 1TVKA 1V11A 2OAQ1 5DCWA 4YJDA 1H2WA 1YZTA 2DKFA 3GT0A 4GNRA 3RIMA 1HDEA 1WUIS 1H4VB 1PLKA 1XPUA 2QRHA 2YJGA 4Y1RA 2W2QA 1KI2A 2Y68A 3X2SA 1A76A 3RAPR 1GNRA 4WKOA 4D56A 3DS8A 3BD8A 2PYDA 1R37A 3ZNPA 1QIKA 4U7HA 4DR3B 3C8MA 5C4IA 2UVDA 1MH1A 1C0KA 1TD1A 1NUQA 1OX4A 1K66A 1N63A 4MEYA 1JE1A 2BFDA 7ABPA 1OH5A 2RAVA 3OHSX 3UMGA 1GQ2A 1AKMA 3FWYA 5ALUA 3IJPA 4DFKA 3CINA 4DQPA 4OM8A 1RBMA 1T26A 4CUKA 2D59A 3O8QB 3RRMA 4YRQA 3NHAA 4J0HA 3SS9X 2QMEA 3UK6A 3ZHXA 4F9FA 2PS3A 3WL5A 3TRIA 1VL2A 2CF6A 1XYGA 3U19A 1INLA 3PW0A 3RF9A 1K8RA 2KIVA 1F1JA 1Z6ZA 2CJFA 5DBBA 4ZQBA 4NATA 5J40A 2ZYUX 4RPCA 3EJ6A 4QAQA 3BJEA 1A77A 1SGWA 1UBUS 3CPHA 9LDTA 4BJ3A 5KQLA 4OHYA 3F78A 3V97A 4LA4A 2JR5A 5J59A 1E1CB 2D2VA 4EYGA 1ZK3A 3JWEA 1GRRA 2J32A 2BM1A 1L4UA 1RVV1 2GEDA 2FWMX 2IYYA 3EGEA 4URVR 1PR5A 3TRHA 3EPLA 5K8VA 1DIOB 2CFTA 2FE4A 4DMLA 1U4OA 2EAUA 3HYSA 4NENB 5D00A 5AUQA 4QGAA 4XPIB 3TR6A 1OX5A 3F46A 4WTOA 3ZTWA 1CF9A 1JG6A 2CCKA 1ZRHA 2E49A 2PMKA 3TL3A 1T3SA 1HDGO 3E7FA 3FGPA 3GW8A 1P0FA 1C7EA 1UA0A 5H2FU 3PICA 4BMOB 2JLSA 3ZY6A 1WR8A 4CIXA 1Z8HA 1WZNA 1ZGJA 2AZTA 4O4IA 3VO2A 1P3DA 1HE3A 3QVTA 3ZYZA 4Q47A 1YGYA 1KZGB 3B9PA 1ZHFA 4P7KA 3HKBA 3SX4A 3TLYA 4M9NA 3KOZA 3WL4A 1DRKA 1Z2DA 3IXQA 3P52A 5DB4A 2NXCA 2O06A 2GZMA 2WU3A 3EGVA 3R6WA 4L51A 4IFBA 1JT9A 1UM8A 1WMFA 1WXDA 3NEJA 2RGNC 4AWBA 4NS4A 2YMPA 1IE3A 2O3SA 3BWBA 2VOJA 4Y6OA 3WGZA 5DTRA 5K8IA 4QQKA 5EI5A 1ZD9A 1UBTS 1FP1D 3CN9A 5KTPA 4GZMA 1IDOA 4ZEXA 2IIVA 5EZYB 2AI3A 3MS7A 4X65B 2GSDA 3X2EA 4I5GA 2YB1A 3RJTA 2AMLA 4NL4H 5TQ0B 1BAPA 3F73A 5CDUA 5L6LB 2CY0A 3TK1A 3WIOA 4YQFA 4CNBA 1X39A 3S70A 2B6GA 1DO0A 2FR1A 2GASA 3ASYA 3A37A 3LC0A 3LH5A 4QEZA 4AK9A 1T6NA 4QW9A 2P6UA 1TV9A 4KPGA 3PU6A 3HFGA 1HDIA 1C7YA 2Y0PA 4HDSA 4F5ZA 4YHHB 1RNLA 2AJDA 1ADYA 1M1ZA 5J29A 2P79A 1L5HB 3CR3C 2PRYA 4GSLA 3YASA 1IMOA 1LQ2A 5BV8A 1HQDA 3LVQE 1X74A 4OJLA 1SWWA 2V54A 2PKQO 3LV8A 2WE8A 3G5MA 5KFCA 1N1DA 3I0ZA 3NWPA 3CLUC 5DU2A 2VRWA 3OOHA 3P2KA 4PWZA 1M0EA 1BFDA 4IINA 3D3KA 3ZCSA 3B7GA 1ZK0A 2PU7A 4PSVA 3SEIA 1DHTA 4R9NA 1XRQA 4EHKA 5HZHA 5HMMA 2W8KA 2H3VA 3SV4A 1HT1E 1S7CA 2H1FA 1DKMA 3L6EA 4G5XA 2L17A 3DCIA 2FETA 2G63A 1SQSA 4IUBS 3UHOA 4EJSA 4P93A 1PFYA 2OCLA 3O9MA 4XDZA 3GUUA 4ECRA 3WYFA 2MUTA 3L4JA 1ABEA 2ZDQA 5ENDA 5M34A 1XZHA 3Q85A 1FS5A 3O03A 2BJWA 2GN0A 2ZIUB 2P7HA 2J9GA 4D9HA 4M54A 1E2GA 3BE4A 1KAOA 4MR8A 3KYJB 2MMGA 1L7OA 4G65A 3I05A 4RVNA 4URFA 2X7JA 4K4IA 4M0KA 1QV9A 4IQUA 1UWKA 2QRJA 3E9DA 3AINA 2GLXA 3PNKA 2DHEA 2X8JB 2C29D 5DOVA 1QLNA 3CJQA 1NNSA 5ENVA 1Y1SA 3PA8A 5JSQA 4P4LA 7YASA 1UPXA 4QULA 3PD7A 4YQZA 1L5OA 1SAYA 1T1RA 5HA5A 1YVPA 1TFUA 1NBAA 1W85A 2GKGA 2HWXA 3K9GA 1P1KA 3RSFA 4F60A 4FZJA 4TV9B 3RUIA 2ZJ3A 4KU4A 2LE0A 4UHKA 1ZOSA 1QAQA 3N74A 1FXWA 3I92A 3UW1A 1FSZA 8ICHA 2E4YA 2YUIA 2H16A 3B1ZA 3L1IA 3KUCA 1BMQA 3QNUA 4C5BA 4KX3A 2NVUB 1LRJA 2JAHA 2WOOA 1ZI9A 3HJGA 4HLUC 5ALRA 1JE0A 1U28C 4O2LA 4QGFA 1S1MA 2JH8A 4RGQA 1J9ZA 4RACA 1FEZA 1UCVA 1IYZA 4LVOA 5T6BA 3WWCA 4ZWNA 1JHUA 4O08A 1DT5A 5L3QB 5LMNB 1UT5A 1OVGA 3CF2A 1TJ5A 2ROQA 4QSMA 5LLSA 2NAFA 3R8CA 1F38A 2XT9A 1KIMA 4KSYA 3NT2A 1NRJB 4L9RA 5P21A 2JGDB 2PZLA 2JL1A 2J0UB 1R88A 1APBA 1UJCA 3C5HA 3RUFA 4M0EA 1GKUB 3OECA 2XMZA 1A9ZA 2ZT7A 1WKBA 1X7XB 2AE1A 2EW8A 1U7XA 1E7SA 5AIBA 2EKDA 5CW2A 3I45A 1BWRA 3KB6A 1G7SA 3KZNA 2PRZA 4PGYA 2R3SA 3AM4A 1JXMA 4HXYA 3ZR4B 4X6XA 2RE8A 4DLPA 3T3PB 1CUWA 5BUZA 5DX1A 2JD1A 5FPHA 4NV1A 1ND5A 2J3DA 1DQZA 4NI5A 3RS9A 2OP0A 5ALKA 1NASA 2KG5A 2JXJA 1DCKA 3EEYA 1I0IA 4TV8A 3O6VA 2ZIUA 4KIUA 4XJTA 2R1UA 2FX5A 4D41A 1Q0TA 1HL7A 2YV2A 4K9OA 4J0JA 3K0FB 5DVZA 3I83A 1ZH6A 2VP0A 2WABA 3A0UA 4P3NA 2I78A 2FW9A 621PA 2X4GA 1ISRA 1KDTA 3HRIA 4PR0A 1XCMA 3LT4A 3TTWA 1XCLA 1HEIA 2EKBA 2ZRLA 3UNXA 3KQMA 3V4VB 3W1VA 5IDWA 1G8SA 2IS2A 4DS5A 5KYTA 4BFSA 5IJZA 3S6JA 4PW0A 1VKJA 2HQRA 1SUFA 3EDCA 5AW4A 4B9TA 3HEBA 3K09C 5FAKA 5K0ZA 1EEXB 4KFRA 4RZ3A 4WW0A 4ENSA 4KPFC 2RH8A 1PLLA 1QWOA 4LJRA 1KS2A 3TAXA 3V9PA 1Q50A 3NHLA 5DQGA 3WICA 1GG5A 2BGRA 2HA5A 4ZHSA 3T54A 4DLWA 3SIPA 5E3JA 2O1WA 2YQEA 1Z5VA 3AONB 2ZLBA 2OZEA 3CLUD 4D4JA 3GDHA 4ED6A 3COYA 4HAOA 4K6KA 4IF4A 4YCCA 3GLTA 5K09A 4DUYB 3FYUA 2EVWX 3N07A 1AKWA 3WVNA 2BP7B 4QOSA 1Y89A 2DPMA 1GTJ1 1IB6A 1L1EA 1ODTC 2DBVO 1NOJA 2P1RA 2QR3A 3HVKA 1Y3HA 2F1JA 4JFAA 4ZODA 2ZWIA 4O2BF 5LZ5A 1NVTA 2B8WA 1J5PA 4Q7MB 3ZPXA 1SV0C 4E5SA 2C9OA 2JAQA 4G97A 9ICTA 2HNKA 2FGJA 4WLOA 4CLXA 4P0PA 2C0QA 2P1ZA 5KAFU 3QLJA 4S2EA 3L4KA 1JPUA 3LK6A 3AEUB 3ZV7A 2B1QA 1G55A 3RS4A 1OT3A 1Z16A 3U17A 4JWTA 1N48A 4QREA 1XHFA 3D2QA 1B8PA 1Y6ZA 1T6XA 5KTSA 3O8RA 3EVBA 1QRAA 1JLHA 3OBBA 4LY3A 5DJ5A 1R5OA 3TRDA 4TMZA 3DL0A 3H5TA 3IIIA 1Z1BA 1BPXA 1LW6E 1T4DA 4GKKB 5JAHA 4LTMA 4NLCA 3UMJA 1AC5A 2EJUA 4WPGA 2PH3A 4BFXA 4UFPA 1PL7A 3HCFA 2LV8A 3JPTA 1RHQA 5CK4A 5CT8A 4DRYA 4UHFA 2OV2A 5CLLA 1P73A 2FG6C 4WHMA 4IDDA 2W9BB 5JJCA 1EQAA 4BZQA 2VJMB 4OSOA 4IIUA 2ATCA 2CDCA 1XYVA 1X2EA 3M82A 1OHHA 1Z17A 4OHWA 4OATA 4ANFA 5A6SA 3M7IA 2B2NA 2FW8A 1P7DA 2HHCA 2QZ9A 1C8LA 2PMWB 4JV0A 1T3TA 2PGOA 3C3MA 4NFYA 2O7RA 4O2RA 2AQIA 1XU4A 3QVSA 5DASA 3WMFA 4XD2A 4RY0A 3W90A 4X41A 4DADA 3B9RA 4D4MA 3TINA 1N6NA 5IZCC 3MTAA 4XR9A 2QD3A 1EX7A 2H1HA 1KSFX 2OAGA 3SJBA 1GR1A 4RHCA 2G9RA 3KQNA 4IDFA 2BMWA 3DHYA 4GO1A 2H9IA 3AY6A 2PBFA 4FN5A 4DL5A 4XASA 3E8SA 4F3NA 1LC0A 2A9FA 4O4IF 4Z4EA 2C3MA 2OMEA 4WBSA 1LEHA 4UDYX 1TMGE 4EUKA 5I4IA 2NTNA 1FS6A 1AN9A 4R3NA 1YFZA 5HFAA 1WXFA 2I76A 1OC2A 4RHFA 1YQEA 2E5FA 3SU8A 2IA5A 1Z15A 3ANNA 3UAXA 3ULKA 3V3TA 1GQOA 2HBQA 1Z00B 1BFKA 4GZ6A 1GU7A 2VT6A 4ND3A 4LCBA 1CUYA 3GJ4A 3HT3A 4QM7A 4CGZA 1IVNA 1VHDA 3EZ2A 3HJHA 3R3ZA 3Q3IA 4J43A 3TM4A 3W5HA 3JQAA 4Q9KA 2P4EA 4LZAA 4ZT6A 5L4LA 1DG3A 2EH9A 1C0IA 4ZARA 3VAAA 3G7SA 2BMAA 3OMWA 2DFPA 1W6RA 3JZDA 3BQ9A 1L8LA 1JEOA 1FBTA 5KX5F 4Q18A 2YKGA 1NT2A 5LA6F 2O8FB 1IPHA 4U2GA 2N46A 4ZXFA 4S04A 1VLJA 1M8FA 5FL7A 1TZBA 3O82A 4KQ6A 4TQAA 1QFMA 3NDIA 4KN5A 2NPFA 2PJUA 3TMAA 2ZM5A 1MKYA 3STYA 1BS2A 3BQ0A 5C81A 1DU4A 3TQ1A 3FPLA 3T5TA 1N0IA 2Y1GA 2RDIA 2YX1A 3OURA 5C5DA 5AVTA 3Q7EA 1XMOB 4XYEA 1PQYA 1QHEA 2A1TR 3OOSA 2ZRCA 3OCCA 3LKDA 2AIRA 1VG8A 3WSWA 4DIFA 1V1MB 2GETA 3L0BA 1LH0A 4N12A 1RM0A 2WV9A 4QUIA 2QU8A 2FGKA 4M0CA 4TVOA 3UK1A 3HTXA 1X66A 1Q21A 4OU5A 4PC1A 4X3PA 3A2NA 2JCVA 2NRWA 2H52A 4A27A 3HP4A 4N6GA 3T06B 4EBDA 1W6UA 4Z4QA 1U3VA 1BKDR 1CIJA 1FDOA 2WJYA 2I3BA 2W6MA 1WSAA 3KUDA 2D1YA 1SKUA 1U7HA 2NGRA 4E4TA 1R4MB 4ZI2A 5JZOA 5F2EA 1YZNA 3EASA 4WNIA 4UB6U 1N2ZA 4PS0A 3W4KA 3X1ZA 3FFAA 4GLFA 4UKDA 2ZZMA 4UUAA 2LNDA 1RXEA 5EWMB 1KC1A 2XOXA 1M2JA 3NS1A 2ZTSA 3ICCA 4LBYA 2HOFA 3G1TA 3WYBA 4BQEA 3ZD8A 4NCBA 1EGQA 4F6RB 1SUPA 5KNBD 3QLUC 2VK2A 2FSUA 5LZ2A 1W8IA 2XT6A 1KZYC 2BR3A 4IJMA 3T1HB 4LWZA 3WISA 3QOFA 4DILA 3GV7B 4F11A 1WF6A 6CHYA 3E6AA 5A5VA 2WMDA 4AY5A 2ZM6B 1PBNA 4Y2TA 5AKKA 1AB5A 3V2HA 1E3QA 4RJLA 2ADFA 3DFZA 3V1MA 3A3YA 4F4WA 4BFTA 5JNWA 4GUDA 3OFKA 1J0XO 2Y1WA 5K99A 4A15A 4R16A 4GWKA 3W04A 4MZXA 1C30A 1X1RA 1WB4A 5JFOA 1QZ3A 3P2IA 4O2BB 5JD4A 2DLNA 2C58A 3VVCA 1DOHA 2RCYA 3MHTA 2Q6OA 9ICSA 1O4WA 4RQ6A 3K5WA 3NGXA 4C7BA 4Q4HA 2QG6A 2UYQA 2O8FA 3KD3A 4N39A 4E31A 3E9RA 4PC3A 4X1IB 3RRZA 4Q82A 4R83A 5ADWA 3PPVA 5IDYA 2JIBA 3X3HA 5LQJA 3ND7A 1OLXA 1R6AA 2A0XA 2SECE 5E6UA 2H29A 4Y9UA 2QTAA 2XF8A 3N8HA 4HPJB 2VSNA 3VCBA 1I33A 1Z4QA 5ANRB 2H48A 5K20A 2NYAA 1KKMA 5D5HA 5BQFA 1VCOA 4OGGA 4RA9A 3GMDA 4N4AA 1SD2A 3FCOA 1UZMA 2I4IA 2JF0A 1HEKA 4O3MA 3B5JA 4UAWA 5EGNA 4EEXA 5K8CA 3TMYA 3JY6A 1RZ3A 1D2EA 1Z7WA 4H6WA 1Y4AE 4OQNA 4QPJC 1P1CA 3AFNA 1Q1QA 2WJIA 5DWVA 3T3FA 5E38A 5BSEA 3R6GA 4OO3A 4YRCA 1TMYA 3B7PA 5BWOA 2OV1A 4KCGA 4MVJP 5HBRA 2LR0A 1F2TA 5I4BA 2KE5A 3BHMA 2L69A 3H5IA 4QZEA 1O0CA 2NN3C 1T29A 3ACDA 3PFHA 4P9NA 1VYTA 3NUZA 5BMVF 1ZRSA 3ZE6A 2IPLA 2HHWA 4D92A 2AJBA 1VJTA 2VBFA 2ZRDA 2G9UA 5DLDA 1L3IA 2G5HB 1D0VA 4K6OA 1FMJA 1FDVA 1LFAA 4QNRA 2ZJZA 4IXDA 5AQEA 4V0RA 4Q4CA 4IP0A 8ICYA 2D3TA 4OYRA 2WICA 5E6RA 3CVYA 5DEIA 2NT4A 2FQYA 1RLMA 5H8WA 2BGMA 4UJ5A 2IYZA 4WDRA 4GYJA 4R81A 2ATIA 3N2YA 4M1ZA 3TL6A 2IUYA 2XQIA 3C4JA 3UYKA 1QKJA 1FFBA 4X3CA 3B8EA 2PKXA 1THTA 3BMXA 5F5NA 2BGWA 4R7TA 4IIJF 4PG7A 1K6XA 2BDEA