2WF8A

Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, glucose-1-phosphate and beryllium trifluoride
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near attack conformers dominate beta-phosphoglucomutase complexes where geometry and charge distribution reflect those of substrate.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 79
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf8A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf8A01
3QUBA 1U7OA 2P69A 3GYGA 4G63A 2JGAA 3QU5A 2IOFA 1Z88A 2YJ3A 1L8LA 4BBJA 3NAMA 4UU1A 3NALA 5AM4A 2I54A 3ZUPA 3K1ZA 1T5TA 2G06A 5AVYA 4UAUA 3N8GA 2R8ZA 2IA5A 4AP9A 2I7DA 4Y2QA 4CF4A 1Z4PX 5ALRA 2ZBFA 1SWVA 1RDFA 2MSNA 3QYPA 3S6JA 3ZWKA 4KYTA 3W5BA 2HOQA 1YJ5A 2PR7A 2I55A 3FPSA 4YIKA 2BDEA 2YJ5A 1QQ6A 1RRCA 2G08A 5ALWA 3WK6A 5AI8A 1LTQA 5ALZA 3OCYA 3ET4A 3MPOA 4BKMA 2GO7A 2C88A 2AH5A 3ZVMA 2ZOSA 5A3SA 3L0CA 3KBBA 1KYTA 5IT0A 3N1UA 5AI4A 4RESA 3WKAA 5AKYA 5AVQA 3KZXA 1VJ5A 2IOFK 2Q5EA 1EK2A 3ESQA 4H1WA 3DDHA 3AR3A 3W5DA 3OCVA 3MN1A 1S2OA 2ODAA 3L8EA 4CNQA 2YJ4A 3D6JA 3ONNA 2R8YA 2VKQA 1LVHA 3MMZA 4UMFA 1YNSA 2QLTA 3NASA 4HGPA 3SF0A 3PGVA 5AW2A 3A1CA 5AVVA 1TJ3A 2OBBA 3PDWA 3IB6A 2YMMA 5AICA 5AM0A 3N5KA 1RC8A 4NFLA 4OD0A 5AK4A 2FPSA 2G80A 1O03A 3F9RA 1QQ5A 3QU4A 1ZD4A 1Z4MA 1NF2A 2EATA 4OHFA 2NO4A 3E81A 1RLOA 3AR7A 5AVSA 3SKXA 3BA6A 2CN1A 3QUTA 1RMYA 4C4TA 2GMWA 1N8NA 1CQZA 2RBKA 3W5CA 2I33A 4MWOA 1ZRMA 4L6CA 4F71A 3J7TA 4UM7A 4UARA 1J8DA 3PGLA 2P11A 3L0BA 3L0YA 3ZVNA 5AW4A 3L1UA 5ALYA 2FUEA 1RQNA 3ZI4A 3FVVA 1AQ6A 5AW9A 3OCZA 5FP0A 4UMDA 2WHEA 5ALTA 1ZOLA 4DWOA 5ALEA 5AKZA 1T5SA 3U13A 4Y2XA 1U02A 2CFRA 3QU7A 3TLMA 5ALVA 3R9KA 2RB5A 3RF6A 1ZD3A 5ALDA 5AW7A 3SHQA 4Y2UA 1ZD5A 4Y2TA 1XP5A 1XPJA 3QU2A 5ALNA 4RETA 2OYCA 4BX3A 3ESRA 5ALIA 3EF0A 2I34A 3UMCA 2ZBEA 3CZ4A 2IOHA 3RFUA 3AR2A 3DV9A 1YMQA 3AR4A 4JDPA 3BWVA 5AK3A 3R09A 4YGYA 4YCNA 4BX0A 5AVTA 2DQSA 4DFDA 1NRWA 2YFYA 3OPXA 4KX5A 3VAYA 5AM5A 3OCUA 3FZQA 3CNHA 1U7PA 5AW8A 4UM5A 3QX7A 3ZX4A 5AVWA 2CFTA 1QH9A 1VJRA 2IYEA 1ZRNA 1YS9A 2MU1A 2P9JA 3ZW7A 4KNVA 4CF3A 1JUDA 3WK4A 1Z4OA 2QYHA 4Y2YA 4IG4A 1QYIA 5ALGA 5AKLA 2HEGA 4FFDA 4Y3UA 4F72A 4EX6A 2NYVA 5AKEA 3A1DA 4PNHA 4UMEA 3N28A 5AHXA 2WF5A 2JAWA 3B9RA 3AR8A 2HI0A 4Y2VA 2B82A 3SLRA 4AS2A 5A3RA 1Z4LA 4XQ0A 3OCXA 3UM9A 5AKJA 5AM1A 5AESA 2G1AA 2JAOA 4HGOA 3L1VA 1Z4QA 1TJ4A 1RQLA 4C4RA 2HHLA 3DAOA 5AKIA 4Y2SA 3KDPA 1J97A 4ZEXA 2HDOA 4E88A 1S8OA 5ALPA 3QU9A 4UW9A 3QLEA 4NWIA 2HSZA 5AI0A 3ZX5A 1ZD2P 4UAVA 5ALXA 1L6RA 5A3QA 5AM3A 4YCLA 3E84A 3P96A 4OFZA 4FE3A 2WF8A 4NAVA 3SKYA 4UMVA 3SMVA 5T41A 4KX3A 1L7PA 5ALSA 2NO5A 4YCMA 5ALHA 2FUCA 4ZEVA 5AVZA 3U19A 5AK5A 3A3YA 5ALMA 2JARA 3WK8A 3ZU6A 3I28A 3WGUA 1O08A 3ZTYA 1RMQA 3E8MA 2YY6A 2D2VA 3DNPA 2FPXA 2WF9A 1L8OA 4Y2RA 3L5KA 2YBDA 2O9JA 1CR6A 1RLMA 2C8LA 3A1EA 2WF6A 1TE2A 3U26A 4G9BA 5AI5A 4BNDA 3U7FB 1U2TA 1X42A 3ZVLA 2RARA 5ALQA 3B8EA 5ALKA 4QQFA 2I6XA 1L7MA 2AMYA 2YMLA 1WZCA 1F5SA 1RMTA 1Z5GA 3I6BA 4EELA 3N07A 2JAUA 2FPWA 2MU2A 2WF7A 1U2SA 4GXTA 4NABA 1TA0A 4DCCA 2GHTA 5IS2A 5AK6A 3EWIA 2B8JA 2C4NA 2X4DA 5AVUA 3WK9A 3L8GA 4DW8A 4OCZA 2FPUA 2ZBGA 3KC2A 2GHQA 2YMQA 3HYCA 4BEVA 2ZBDA 2Q4TA 3QUCA 2YMPA 2FEAA 2B8EA 2G0AA 5AVRA 1Z4KA 4HGQA 3U7HB 2R8EA 3ED5A 3B9BA 5ALJA 2PQ0A 4I9FA 2RAVA 3I76A 4YH1A 3NRJA 4BNDB 3AR9A 3FPBA 3QGMA 3QNMA 5IT4A 3IRUA 3WKCA 4XE5A 1YDFA 4ZEWA 1T9ZA 1RLTA 4AS3A 1EK1A 3WKEA 4CF5A 2HO4A 1Z4NA 1K1EA 3M9LA 3PCTA 4J2TA 3SD7A 4HGNA 5AKKA 1Z5UA 2G07A 3EF1A 5AW5A 3NANA 2R8XA 3EPRA 5AKGA 4L6AA 3OTQA 5AIBA 3M1YA 4UATA 3MC1A 5AM2A 2OM6A 2OA0A 1L7OA 5AIAA 2HF2A 5AKHA 3OCWA 2G09A 2B1QA 4HAIA 3AR5A 1WPGA 2O2XA 2BDUA 3ZWDA 2HF7A 2FDRA 4GIBA 2C8KA 1Z4IA 4BX2A 3WK5A 3WKBA 2ZXEA 2WM8A 4MUMA 4Y2PA 1VFPA 3QXGA 2EAUA 5AKXA 4I9GA 4YIHA 2WFAA 5ALFA 4C4SA 2B30A 5AW1A 1YV9A 3WGVA 3NIWA 2Q4RA 4QJBA 1SU4A 4KNWA 2FPRA 1N9KA 4UASA 4EZEA 4FYPA 3L8FA 2W43A 2YJ6A 4JB3A 5AVXA 2HX1A 3L7YA 3U7GA 5AI6A 3UMBA 1Z4JA 2GFHA 4EENA 1NNLA 4O8CA 3UMGA 3U7EB 4XPZA 1Y8AA 1PW5A 3HLTA 1SWWA 1RKVA 5ALLA 4KN8A 4Y2JA 4EEKA 3QUQA 4UU0A 4BYGA 2W11A 1WR8A 1RPZA 2B1RA 3FM9A 1RKUA 1Q92A 3KOOA 3I1YA 5ALOA 3NUQA 1L7NA 1TJ5A 4HYTA 2P27A 1MH9A 3W5AA 3AR6A 5AW6A 4L57A 4BEWA 5JJBA 1WVIA 1FEZA 3R4CA 3KD3A 5ALUA 2ZG6A 2AUTA 2AGVA 4CE6A 4XOUA 1RKQA 1XVIA 1ZJJA 2FI1A 3FGOA 5AW0A 5AW3A 3ET5A 1QQ7A 2EARA 3WK7A 4HGRA 2HCFA 1Q91A 3L8HA 2B0CA 3E58A 2PKEA 2C9MA 4B6JA 2CFSA 4IFTA 4NV0A 5E0OA 3WKDA 2W4MA 2BY4A 3IJ5A 4J03A 3ZTWA 1IWOA 5AI9A 4EX7A 1ZS9A 2YN4A
chains in the Genus database with same CATH superfamily
4QIHA 4G0OA 4L16A 3DCJA 4KWIA 4MP3A 4W5JA 4M1KA 1TU0A 2NZ8A 2V1XA 3B5JA 2PH1A 2QJRA 2HCBA 3EPPA 1ZK1A 1C3LA 1M72A 4MQMA 4H6PA 5IVDA 2IYZA 4LV5B 5TMBA 2DTDA 2WU1A 2LDBA 1GPH1 4LBZA 3GV5B 2N1MA 3DHVA 4FMDB 4MQFA 5SYNA 1VBKA 1WA5A 3WFJA 2Q2NA 1Q0QA 4CKCA 1QGOA 1VBMA 2DQZA 5FIUA 1U9LA 2AZ4A 5LSAA 2CLDX 2DPHA 2NSLA 3RIXA 4A8PA 4K6KA 5KYXA 1AMNA 3E7PA 3DL2A 3M4YA 3H8VA 3TLBA 4F91B 2PJUA 3GNTA 1DAHA 4WXHA 2GZHA 5B7PA 2BEWA 3KYJB 4Z9FA 1RE0A 3NIFB 1NI3A 3B2EA 3HE3A 1REQA 2JFFA 4NEGA 3HDQA 1KAQA 3AESB 1PT8A 5DMXA 4KV7A 3JPQA 4RVOA 2IU0A 2R6DA 4WA8A 4IJMA 5BR7A 6CHYA 1PUXA 5L1IA 1RE1A 5GV8A 2QG6A 3IO5A 3B1XA 4BVJA 1UZUA 5BNZA 5KWSA 2HJWA 4QG3A 4G65A 2ISCA 1YMVA 2YNMC 2ZPTX 4MINA 5KNCA 3DDZX 4B6OA 1BOOA 3HP6A 2MTBA 2WJVA 2FWIA 3ZW8A 2UXBB 1FZTA 3PFWO 1TYAE 2Y71A 4F9FA 2PJRA 4N3NA 1B42A 2JIZA 1YO6A 5BSKA 3UXEA 3L0CA 4Z8XA 2YV2A 1FDRA 3PUVA 5CA1A 5HILA 2GJAA 2AFRA 1RXEA 3PFIA 3V9PA 5KS2A 5IT0A 2JFBA 8ICXA 1GRVA 3BYZA 4D0LB 5LM3A 1F7UA 4YT4A 1XEXB 4KTQA 4QM7A 3EQ7A 2ZR7A 1Z26A 3PGMA 5IEBA 4P4NA 4ECUA 3IAAA 3UJNA 2YOGA 4BKPA 2JG3A 4CODB 4H1WA 1CRXA 5CVDA 3LL4A 2YIMA 2YS7A 2ZLBA 2QN6A 3ABIA 3CMCO 4JLKA 4W1QA 1JDVA 3W5DA 2PS1A 4JASB 5HUQA 1YFZA 1R5NA 3CX6A 1RU3A 4YUAA 3QF4B 4FJ2A 3SS8A 1ST2A 4L28A 4A15A 4ZVPA 2CNKA 3QMPA 4UUBA 3OM1A 2GJSA 1KI8A 4IX1A 3ZHBA 4AIIA 4WNYA 5EKDA 1VBNA 2DXIA 3V4PB 3T79A 2EQAA 4DLVA 4FYXA 2YL2A 5TR9A 4CEIB 1I4TD 4RL6A 1HEYA 2JH8A 3PGVA 1X7DA 4TV8F 1P2BA 3EIQA 2NM0A 3F67A 4Q7JB 5G0VA 3ZLBA 4LF7B 4IRDA 1S76D 4UXHA 4QG7A 2YJTD 4XEHA 4P86A 4N6GA 1Q7EA 4RACA 4W9NA 3JD3A 5E3JA 1L1EA 3OAAD 1P3JA 3VO8A 5BV1A 5K8IA 1LBEA 3ECAA 2SNIE 2CVQA 2QRJA 1UWKA 3QKRA 1T3HA 4HT3B 1G1MA 1GITA 1SGWA 3A9TA 3PWTA 1VE6A 2IHKA 2W2VA 4NJMB 1E7QA 1X9SA 2EDAA 1CUHA 3FUVA 3LHKA 5CLQA 4N6NA 2BEVA 3AJDA 3SBDA 5LQJA 1JB1A 1PNTA 4DL5A 2YS6A 4M6WB 3LCMA 1KJZA 1O6GA 2NRZA 1QB8A 2Q4BA 1ZC4A 3AY3A 2I1VB 4G0ZA 1J23A 2B7LA 5F76A 2V4QA 3N7UA 4E33A 1RI4A 5FUVA 3TCKA 3AU9A 1I9CA 2WINI 4YMHA 8ICYA 8ICLA 1P4HA 2UZ1A 3BXXA 3K0EA 2GM4A 1EDOA 3V80A 1NQVA 3IUYA 3PVZA 1HUQA 4G5OA 1IEVA 2VDNB 2UXDB 5L1KA 3E3OA 4RKWA 4RIHA 1BPDA 4P38A 2ZYVX 4YBRA 3RYHB 4D9HA 1E20A 5CB6A 5LN1A 3M33A 1G66A 2GBCA 3O8RA 3QSYA 1X7WA 1OFUX 2XMSA 1ZD9A 2Q2VA 5AHWA 3BA1A 3IGFA 4IGIA 1L4KA 2A5FA 5J2HA 3EISA 3OE7D 2ATVA 3ORSA 3GIIA 1SVMA 5KAFU 2ASDA 2Z1DA 2DPIA 1Q46A 1PQPA 2AFHE 5CP2A 2BF4A 1S4QA 2FFQA 2TMYA 3KHRA 1WU7A 4I8IA 2P2SA 4JC5A 2E5WA 3ZWMA 2A7XA 3UAOA 2PGIA 3FTDA 1VL8A 1Y3FE 3K5PA 3RGWS 3VU0A 2AJLI 2B2CA 3BK2A 1ST3A 4R2KA 7MDHA 2QB5A 2VDQB 3MWYW 3VHQA 4C4XA 3DDNA 3F6CA 1FS5A 2F76X 2RHMA 4BFLA 1JR6A 4KZPA 2B94A 1DJMA 2XCUA 3U4HA 3SE7A 5I01A 2NUAA 5KFWA 4JKOA 2X7XA 2OCAA 2O2DA 1QO7A 2JLYA 3OOHA 5B12A 4Y2UA 4IS7A 4QEKA 3UJ9A 4Z4EA 1WEKA 3LHDA 1A96A 3JWHA 1OTYA 1P19A 4EQZA 4C6TB 4BX3A 1XEXA 2XRFA 3D4IA 4RH1A 3RU7A 1WTAA 4I2NA 1OH6A 2FZEA 3BH7A 2DBVO 3AMVA 4O3RA 4WKCA 4JYPA 5BN1A 1I24A 1JQ3A 2P2DA 3DEHA 2WAAA 2A4MA 3G2LA 2JLZA 4BNHA 4ARIA 3KU1A 3M6IA 3UWMA 3PSPA 2EKBA 2P5YA 4KB5A 5CFOA 1PEKE 3KPUA 1Y5RA 3I2KA 4QTYA 2AR9A 5IILA 2YFYA 3SYKA 4KX5A 2DQYA 3UOWA 1BKYA 5ENVA 1WV1A 2XYVA 3C3WA 4U3JB 2R6GA 2GK7A 4MKHA 4MPRA 3O9MA 4G0YA 4OQPA 3I09A 1E1CB 1N5OX 2WU3A 4LHYA 3C8MA 2R8KA 1J7JA 4LYJA 5BQPA 2YJNA 3IDSA 1A04A 5JS7A 3THYB 1P2SA 1YS9A 4QFCA 5GOTA 1JEOA 4G24A 3OFJA 3PQ8A 2R2AA 3NNSA 3IEPA 2KOBA 2FPIA 9ICMA 3BF8A 3KT8A 3O9VA 3R20A 2IUUA 2VT3A 1D2MA 4CLRB 4W5RA 3M2TA 2ZKLA 3HDYA 5KYXB 5ALGA 3GH3A 3TDNA 2RRDA 5JDIC 5C8VA 1W93A 1D1SA 1OGIA 4NBTA 1ID8A 1NBOA 2Y0SF 2NYVA 1PLKA 3DLBA 3P0EA 2DUUA 4ZVUA 1JPVA 1T8TA 2HADA 4MQFB 5HQ3A 1XS9D 4TYYA 2WA2A 1L2TA 1U9YA 2W0MA 2ZB3A 2O0MA 3V6LA 1PI3A 1QLNA 1MRNA 3VDMA 1EUCB 1DV1A 1Z6GA 3SWWA 2E1PA 4AS2A 3BBLA 3CN7A 1SL1A 4HUQB 1DAFA 1ZU5A 5GOZA 2ZJ3A 3IPAA 3FETA 4E32A 4YX9A 1WCLA 3EOAI 4A2QA 1JSXA 2ZI4A 4XPIA 2Z2ZA 4YXFA 1XPUA 2QBYA 1DFGA 2BMVA 3I01A 4Z9AA 1JJBA 3U40A 2J0EA 2W2KA 1KW4A 3EVZA 2WSIA 1O0SA 3CRVA 4J7XA 3B7GA 3PZPA 5B1SA 4U7TB 2LHTA 3S1AA 2BH2A 3U6KA 1NF9A 4GE0A 4RKQA 4A0QA 3HXMA 2R4UA 4FX5A 1N34B 1FX0A 5CJ7A 2XWBF 3DZDA 1QF6A 3HCAA 3IMFA 4J0GA 4RYLA 2JLRA 1PK3A 4BFCA 5C8ZA 1SQFA 2BFAA 2WWVD 4ZYUA 4CI0B 3NWOA 5CEJA 1XBTA 4EIWA 3CUVA 1V71A 3HUDA 3KZ1E 4GR4A 4D3FA 3KTQA 2PBLA 3KOWA 4BO0A 2KJ8A 3OZTA 4DY4A 4E22A 2HPVA 5E9WA 3A4IA 1C30B 4UNIA 2RHDA 1PDVA 4R0VA 4Q02A 3C8ZA 4R68A 4TX1A 1E6WA 4E5PA 3GLIE 3P9CA 4F7WA 3L0SA 5JMOA 4N9WA 2Y0BA 4QW9A 1A97A 1DO2A 1LK7A 4D9NA 1CK4A 1JZSA 2E9SA 4HKTA 5SZHB 1EFLA 2K4HA 1P73A 2XNKA 1WQ1R 3PSAA 4TLBA 1UDXA 3OEWA 4MUYA 3GGCA 2HOIA 2OYSA 4NBWA 4A5OA 3VPXA 1T6NA 1BHQ1 1P3DA 2ZEJA 3F74A 1XA4A 2WF6A 2B1GA 2GFIA 2OFXA 3BAZA 4WY2A 3RRXA 3SZGA 1JIUA 2QF7A 3GG9A 3DD1A 4G9BA 7ICIA 1XOIA 3GLSA 2Q1UA 3U7FB 4RIIA 4KL8S 1ATIA 3C6YA 4CGYA 1P45A 4MB6A 4BVEA 5HS4A 1EWKA 1WOYA 3ENQA 4JR2A 4RNDB 5EGNA 2CBXA 1Z22A 3K5IA 2CLHB 2XGGA 3ORFA 2CZGA 4RSMA 4LJ7A 2QD2A 3TW0A 4D44A 2RHCA 2Y67A 3N07A 2JAUA 3ZV6A 3P27A 1U2RA 3ANTA 1X1DA 2RHOA 3GT7A 4FOTA 4M21A 3GUVA 4HBGA 2ZM6B 2J9RA 1KI6A 4PZAA 1GVNB 1KAOA 2AGQA 3MGVA 4DL3A 2PD6A 1I5OA 1J0EA 4MRRA 3OP4A 1UDCA 3EXHB 1RHJA 4KQJA 4YECA 3W8FA 4DLXA 4EG3A 2KG5A 2BFWA 2GHQA 2XECA 1SKYE 3PIRA 1U9JA 1HV8A 4BDPA 4Q3CA 2AS0A 4G9GA 3VYWA 4UJ3A 4YMUA 1O4WA 1ULHA 3H2GA 5G3YA 3JU3A 1OIVA 4HGQA 1U8CB 1K06A 1RI1A 1Q2XA 1XTKA 4OYYA 3ED5A 4GBED 1CZHA 2COKA 1U2DA 5DKWA 1JW9B 4I9FA 1N32B 2BDTA 4KO2S 1HEIA 2BF7A 1KJJA 1D9ZA 2JJ1A 4RKFA 1SHUX 2QKQA 2GJKA 3FWPA 4C5CA 1ZSNA 1IHPA 1KJIA 1SM4A 2NT4A 3DZIA 4MZXA 1VRCA 1CRWG 4FYMA 1SKYB 1UFOA 4HAZA 1Z8DA 1ES9A 4OHCA 2WI8A 1VL6A 4H18A 3ZDZB 2X8JA 3GT4A 3IS3A 4ARBA 4H08A 4GMFA 3UPUA 5GJWC 2QTRA 3N2LA 1BD3A 2B98A 1NP7A 3VUFA 4U7DA 2AMJA 3D6UA 4LPKA 2I87A 4TYMA 5AOBA 5BPFA 3GG2A 2EOAA 1YJBA 4ZREA 5AW5A 4IQWA 1R0BA 4LY3A 4ZCLA 5DN9A 4ZT3A 3X0DA 4OJNA 4P36A 4AYXA 4LMAA 1HZJA 2Z43A 3NEYA 3QLVC 1UDAA 8ICFA 1CY6A 3L8MA 4ZXFA 5J2UB 3M6FA 3STTA 1GP2A 3WLEA 3WQRA 3M1YA 3RB4A 1U0SY 3LDHA 3I32A 5KMGA 5KJ1A 1TGVA 2YTUA 4IQGA 1TD1A 3BHMA 1A4IA 3WTBA 2VDUE 3MJ4A 3A6PC 3OCWA 1I14A 1QUFA 1MUUA 4H4DA 3WHPA 1OBVA 2XMBA 4ZTBA 1V5EA 4JV2A 2V5UA 2BCQA 2V6IA 3Q2KA 4O63O 4IQTA 6AT1A 4A16A 1GAXA 4GIBA 2XBLA 3C98A 1EEHA 1T9BA 3DTVA 3N6RA 5G2OA 3QPAA 3UOGA 4ECWA 3TTXA 2HV9A 2HCRA 2WM8A 5DK4A 1NJ2A 3NONA 1TQ8A 3M5PA 1NK9A 3V8RA 1HH4A 2I4TA 1P7ZA 1L6IA 4GPAA 3CUUA 5H83A 2XVMA 3HK2A 1T0HB 2AXQA 3NVMB 2O8FB 3LYLA 4DLYA 1O94D 4CKBA 4EI7A 5KKCA 5KSWB 4L95C 1X92A 2GHRA 3DEZA 1IFXA 2A9VA 4EYEA 1UFVA 3JYHA 2RGRA 2X2PA 2F6RA 3EZ7A 4FS1A 3JQGA 1K6JA 5FF9A 1N6HA 2VYVD 2FAXA 2ZXIA 4KLOA 2A35A 3H0RB 2HWKA 3A7EA 2H2GA 1UPBA 3G0GA 5G53C 3UT6A 1CEXA 1SQ5A 1TFRA 2R1TA 2QL5A 2ZCJA 2QSJA 3D9QX 3IBTA 2G88A 2E49A 1R18A 3DB2A 2ID9A 1AKTA 1PWXA 3KZIU 1ITZA 3ZW9A 5BUZA 1ADJA 1XCPA 2GTIA 2Q8PA 1UKZA 2FE4A 3BB1A 1USIA 3GK3A 2W9CB 2HVHA 1TKBA 2HC9A 2NU7A 1BNPA 3QW2A 5KTRA 2QQGA 5I5EA 4I1OA 4XLZA 5L3SB 1BE1A 4P58A 3LT4A 2RKBA 3TDKA 3UCXA 2F43B 5KQSA 2ON6A 1J09A 1UPFA 1ZQ1A 3G9UA 4M8NE 3W7AA 5L4LA 2XWPA 3MBYA 3LPLA 4RIFA 5EWMA 3SFZA 4D97A 2N47A 4PYQA 4QREA 2GEBA 2XB8A 1EJ6A 1H2ZA 2XTMA 3I9FA 2KSOA 4IGEA 5AVJA 4F3NA 1FRNA 1T8UA 3RSOA 2WSBA 1IDN1 4KGVA 3FWHA 2GZMA 4QUAA 2EYQA 4HNVA 4HS9A 3LW8A 2GXUA 4ISBA 4M1TA 1R3DA 5JALA 3TSAA 2FZWA 5EJ8A 5ECYA 5KFSA 2H29A 5DX1A 2BFDA 2RG1A 3KQKA 2DJIA 3LBFA 2VUHB 4FFNA 4H7HA 1VZ2A 3DYIA 1XC7A 1ZK2A 2H54A 2HRRA 3WIDA 4CFZA 1XXHB 4B47A 1C8KA 3GCZA 1CDEA 1H0RA 4FGZA 2HA6A 4Y6PA 2ZWMA 1CRPA 1TX4B 3WYCA 3P4UA 1YF3A 3M1LA 1GWNA 3EARA 1NVEA 2FX5A 5GZ1A 3ESBA 5KFFA 3R41A 4HZIA 4P54A 1U63A 1NVVR 3CLRC 3F2IA 4K6HA 4EKIA 1VRWA 1MO4A 3PE6A 4HQOA 3G5LA 3SAHA 1MHPA 1NBAA 2HCFA 1KFSA 2XZTA 4K3VA 2B0CA 3C21A 4N7RA 3DVAA 4NS1A 2A9PA 1RAFA 4UUPA 3RJMA 1L5KA 3SX2A 1EM8B 2FMQA 3TKYA 3WKDA 4MP6A 1JHVA 3VDNB 5L7TA 3F1LA 3WGZA 4GYYA 4E6EA 1J1UA 4HDQB 2VDMB 2ZR0A 4WXMA 1ID1A 4F1JA 1IWOA 2H52A 2O7QA 2X8BA 4CQLA 3RJ9A 1VHDA 1MVNA 1KQNA 1RQRA 3AONB 5CDHA 5L3QA 4ZQBA 5IP5A 2D5IA 1PNVA 2P2NA 1FE8A 3QU5A 3HJEA 4PXAA 3WWZA 5E95A 2HMSA 3EYZA 1EFKA 1PS8A 3C5HA 1NW8A 4EYQA 2PSHA 1MJNA 4O08A 5BVHB 1WB6A 2OCIA 3B0YA 1R0XA 2QUIA 3NALA 4ERNA 2E6UX 1ZNQO 3QVSA 4E1AA 1Y33E 3BH6A 3C5EA 5CDFE 4UREA 3KCNA 3UMYA 2BHTA 4AN0A 1SBYA 5I4KA 1RAIA 1ZC3A 3F53A 2PV0A 4EGJA 1ZQFA 2OESA 4I46A 1TQHA 1KZHA 5JY6A 1HDXA 2RBEA 4I2FA 5IVHA 3F78A 3IYLW 5K6RA 3HM9A 2WKRA 3KTFA 4ECZA 1WDKA 1OIXA 1WS6A 4D4KA 3ZWWA 3UMSA 4AFNA 4AP9A 2O8BB 3V72A 1NKTA 3AL2A 2JEFA 3EDMA 3R3ZA 4GF5A 1A4XA 1L7BA 2FNAA 2HM7A 4OAQA 2PU7A 4R9SA 4EOGA 4F4ZA 2V7VA 2XRZA 1RDFA 1BIFA 1X7HA 3GARA 1A9YA 1C0IA 4L9WA 2BW0A 3H6KA 4W99A 3REQA 1GPBA 4GMXA 3ZWKA 3FZGA 1O9GA 1Z39A 3D3WA 2ZJ1A 3NOQA 4YRFA 4DQIA 5KFZA 2AV6A 3MGBA 9ICNA 4US0R 4H17A 4EHAA 2W3RA 1LV7A 2IHNA 3CQ9A 1QGUB 4KN7A 3DKIA 2IK8A 1M34E 2WWRA 3KTDA 4FIDA 1ZIXA 3CNEA 4UDYX 3VHLB 3KEQA 1EE9A 1U0NA 2I6TA 3G1TA 2W42A 1WUDA 1L3CA 2G1PA 4WFIA 2ONZA 3E9MA 3F4BA 2B1IA 5LA6A 3IG5A 2XSZD 1QRTA 3M1IA 3CNNA 3RTAA 1VMIA 5AI4A 1EI9A 3HO8A 2KK0A 2XUIA 3AI3A 4MYDA 4ZAWA 4ZZ2A 2VIIA 4ZI3A 4J76A 3UXYA 1PFKA 4NAUA 2A6PA 2G36A 2ODEA 9ATCA 2BPFA 2B5OA 3WGGA 1G5QA 5HG0A 2C7OA 1ZIPA 2FHPA 1Z37A 1BROA 2FUG1 3U9TA 3V8BA 1A88A 1YQEA 3QWBA 4R9VA 3GFKB 2YJ4A 1TM3E 4LHEA 5C4GB 4AUEA 4JEMA 4OGWA 1JKFA 1ZQDA 3R3HA 4AKEA 3GLFA 1XZLA 4QQNA 3M9MB 3I5YA 1WKBA 2PLFA 3QFRA 1X77A 4DA6A 4YS6A 5KFTA 2VYCA 1KR2A 4AZ0A 2H2IA 2AL7A 4HLUA 2IVZA 4DG8A 4I08A 5AW2A 1JI3A 4CDNA 5HCNA 1Z63A 3OLCX 4QAQA 3NTOA 4C76A 2H4ZA 1V9SA 4IXMA 4Q19A 3W77A 5B36A 2D7JA 3SAFA 5KFNA 1LI5A 4KIGA 4PG7A 3WVNA 5MGNA 1AZWA 3HDGA 4PANA 4KODA 3ZIAD 2XIQA 4XQCA 5FLEX 3F3SA 2ZJZA 5CT6A 3FNFA 3AI2A 1ZQIA 2F59A 5I9TA 5FOQA 3NMUF 4L15A 4PAGA 2FMKA 3DHYA 3MGHA 4MUNA 4HX9A 5JARA 5IVKA 3HKZC 1EX7A 4HAXA 4J29A 1Z5NA 2MYNA 3FMIA 5FT9A 3BA6A 4RQBA 5HDQA 3UWSA 5IXJA 2DX7A 2VWGA 4FYYA 4H7PA 3ZWPA 1Q7TA 5D5PA 4Q4JA 5HCUA 2D6FA 4RUCA 4GUDA 1C7QA 2X5KO 3R3YA 9ICBA 2IHBA 3ZIAA 3WGHA 4G0NA 1NONA 3PY8A 2IGTA 1JTFA 1PSZA 2G25A 4R9NA 4D4JA 2XDQA 2I33A 5K8TA 5EZ6B 3GLUA 3GFBA 2V8BA 4B7ZA 4O1MA 1UJ5A 4TUPA 3J7TA 1CB7A 2GPWA 1CUYA 1V7CA 2REOA 3EY9A 4M0PA 4QPDA 2YZMA 1Q11A 3JRWA 3S55A 2VKTA 5HKKA 1TT7A 2QLMA 1KEUA 1H94A 4X8OA 3TF5A 3W6UA 1T5DX 2QN2A 4BPBA 4ECRA 2YICA 4NH0A 3VCBA 2OKGA 2OO7A 4CM6A 1LNZA 4MTLA 3H1PA 4PZ9A 4UMDA 4M0LA 3S8EA 3WHKA 5G3ZA 1EGHA 4F4DA 1XL1A 2A8YA 3H5LA 5LQCA 2UAGA 2VDOB 3BIFA 3EY4A 3ZHTA 4R8UA 5DB4A 1EVQA 5CBPB 3RYCA 3ZXUB 5LXTF 4PPYA 4N7JA 1GKYA 4FGUA 4UBKA 4AKGA 2VRBA 3QE0A 4B8YA 5ALDA 2VQSA 2FW8A 2JCGA 3N8HA 4XARA 2YWGA 1XTUA 1QCYA 1V8FA 3DEKA 4L0CA 4NK5A 4Y2TA 1J33A 4BN5A 3P9SA 4TRNA 1VDZA 1XPJA 3M6WA 3AJRA 3TQFA 2BCRA 4JUFA 1PL8A 2V7WA 1D9DA 3HN7A 5P8WA 5IPFA 3LX5A 3FOAA 3NBFA 4LVNA 4FMPA 3DL7A 5AUPB 1A72A 2VNIA 3A9WA 3D4LA 2CXYA 5J8YC 1N3BA 3E4CA 4HAYA 3BD9A 5SY4A 1MJGA 2VF8A 5B3AA 2JAXA 1QHNA 2TMKA 1QE0A 2QMHA 1T4CA 2NYRA 5HVNA 2H1WA 2FWPA 1UMBA 4GC5A 1CRQA 4KQXA 2CV0A 3RF9A 4FHGA 3KPVA 1OWPA 1MZPA 2V5VA 1DWPA 1O95D 1GG5A 1YGYA 2R8RA 1PDWA 4D02A 3QELA 4CM9D 4JLJA 4E03A 2C1ZA 3QX7A 3U56A 1N60A 5JSUA 3ND8A 3NIGB 1F6BA 3KAJA 3TO5A 3WLTA 1C7YA 1C0LA 2FLKA 3OEYA 4PLTA 2QM7A 3THXB 5D87A 2OGZA 4W5HA 1H69A 4RK7A 3AUKA 2AJCA 3MTAA 5JAMA 2KI5A 4HF7A 3G0CA 3IJEB 2O7RA 4FNAA 4KYIB 5JO9A 5JADA 5CYOA 3WLMA 2C3UA 3GUZA 1PAUA 2WIGA 3F5QA 4W1RA 2IZ6A 2AUMA 3AXTA 4JLNA 4XDYA 1DRJA 4QNNA 1J2MA 5EHIA 4AURA 1KK3A 2E6KA 3U4GA 2DKFA 3MTBA 4FHFA 2WF5A 1O6ZA 1V3UA 1W29A 2NZVG 3MM4A 1JEQA 3TD2A 3LT1A 1ZCBA 2PFKA 2ZTEA 1SO8A 2Z9DA 3VOSA 1EIWA 4ENSA 4RX1A 4KR3A 2HI0A 3AVVA 1JN0A 4ARZA 3Q8WA 4KO8A 4P0PB 1XZMA 1OPXA 1S89A 1XEWY 3R3UA 1VLHA 3O74A 5ULLA 5D1NA 2HOFA 4F6LA 4JK1A 5KG5A 1SG0A 2PRYA 4FZVA 1QRAA 1X7YA 3VR5D 1I1NA 1SVKA 4G81A 3DL0A 2OV2A 1FDVA 5TE9A 3QWIA 2X0NA 1GDDA 3CB4A 2VXOA 4NL4H 3A32A 4HDRA 2VPIA 4F5PA 1JBEA 3UFBA 2HHLA 1IU9A 3CH4B 1JE0A 5FWAA 1N62A 3IRVA 2BGUA 4ITVA 4M1OA 1HWYA 2J9ZB 3A04A 1Y3CE 2QYSA 3NTLA 3FFTA 2HDHA 1S8OA 1A71A 2JJ2A 3P19A 3PEFA 5J2TB 4EF5A 2IS2A 3OHAA 3GEMA 4HB0A 4BGIA 4D43A 1Q15A 4WDQA 3THRA 3HWRA 1Z45A 1QVAA 2Q5JA 1Q3KA 1W1IA 4RANA 4ECYA 4U5XA 1GIAA 4QDOA 4KGXA 2BGRA 3IT3A 5EY5B 3WYFA 2CV1A 4A23A 3P96A 5A6VA 1I6KA 1KXJA 4CNBA 2EKZA 4EG1A 5K0GA 5CK4A 3TEMA 3C5VA 1EUDA 1K2VN 1C9NA 5JTIA 2GSWA 3VU8A 1TKRA 2R5NA 2WOJA 9ICIA 2P6UA 4MEXA 4DLKA 1I6WA 1XQXA 4LW8A 4AJKA 5FOTA 1MN8A 3H3JA 1SG9A 1YS6A 2JJ2D 4PTYA 1JALA 2A5JA 2GILA 5TB5A 4D6XA 4YRQA 4KZKA 4REMA 5GWXA 2XVXA 3T0GA 3SEZA 2G67A 2VSYA 1VSQA 5EVCA 5J5VA 3WYBA 1TMGE 3LDGA 3GEBA 3D6NB 5EIHA 3AGQA 4B32A 1IXRA 5J3JA 3K8QA 3LI2A 2Q50A 3K2QA 1TLLA 3CX8A 4ZJPA 2E85A 3WMWA 3A2NA 3UHOA 5HS6A 2QRGA 3QEMA 2VQDA 3LUFA 3UT5A 4EEZA 1EHIA 4J6FA 4CKYA 2Q5OA 5EJ7A 3RH5A 1FOEB 1BCSB 4KQEA 2DFNA 5FBHA 1CIVA 1G6Q1 2LW7A 2C7GA 1EX1A 5LZ9A 4X5OA 2A9FA 3MMNA 1LFDB 4DL2A 2ZRPA 4LXQA 4NIMA 2OKCA 2BOVA 1FIQA 3E3LA 5JAUA 1EGVB 2A0WA 2LWIA 1VG9B 1IWPB 1QIGA 4G4SO 4ZTZB 3SEIA 1KNXA 8ICNA 1R0LA 4RQMA 1Q0ZA 3HBMA 3OPMA 2IZ1A 2IIPA 1NXPA 4N7BA 1NVDA 3V2IA 2YRXA 3RW9A 4AJIA 3H86A 5HRAA 3H5AA 1J2YA 1GKLA 5JOQA 2ZRAA 4YD1A 2GHTA 4RPGA 3KLBA 1T1GA 1XCOA 3UANA 1MJ5A 2P5SA 4X91A 4A0GA 4I6EA 5LLTA 2Y0EA 2X4DA 1K6EA 3HL0A 2NRWA 2NAFA 5JLAA 4V38A 5EFZA 4B40A 3H0KA 4JKYA 3L8GA 4LIPD 4Z53A 2AGPA 4NG4A 5J0WA 1VGRA 2O7VA 3HYCA 4NZ9A 5KFIA 4BUGA 4JA2A 3AW9A 1JN3A 1UBNA 1LSUA 2Z1NA 4PGMA 4AICA 3N58A 2JZCA 4ACAA 1ZGGA 4B44A 4BRUA 3GOHA 1QOQB 4ECTA 2HMVA 2XE8A 9LDBA 2YXBA 3FB1A 2FVYA 3ONWA 5FTWA 3AVUA 1M1YE 3Q72A 1XHEA 1XEWX 2H0RA 4GL4A 2H1VA 3WLNA 4MV1A 1CHDA 4FD3A 3TLGA 4BNDB 1CUUA 2OHXA 2OZKA 1TT5B 2FPOA 2Q2OA 2C4KA 3TFOA 2ZUBA 2GN2A 2DC1A 1YRYE 2CLIB 2OHVA 4GI7A 5LQUA 3KWMA 3EYAA 3UJAA 1T13A 2N9UA 4DUPA 5KZMB 3L4PA 2XCIA 4UB8U 4HXGA 5GQSA 4FB5A 4YCBA 2YX8A 2HSWA 2D74A 3RSLA 1ZM4A 1EJBA 2QHXA 3M49A 4CF5A 1B93A 1QFXA 2A1UB 2R79A 3LNCA 3ZHZA 3MB8A 3M9LA 1T5OA 3HNOA 2HHAA 4QPPA 5AKKA 4CR6A 2WT9A 2O7SA 1Z2CA 4CL2A 3EPRA 3D2LA 2KS6A 1GGMA 4FEYA 2WPNA 3K1TA 2J0SA 4Q1CA 4B43A 1PJ4A 2IHVA 4DLBA 3V6HA 1RHKA 3IT1A 3RS0A 1BNCA 4TV8A 2WHPB 4R3UC 5IKEA 3F8SA 3ZJVA 2OA0A 3FPFA 3W8EA 1NW5A 4IDDA 1WZUA 1YT5A 2GJ9A 3CINA 3TXYA 1QU3A 3P26A 3I9V6 5DB8A 4E13A 3W3AA 3EXHC 1EFRA 4F60A 2O2XA 4IC9A 4GC7A 1PV1A 1MN6A 1K8QA 2XNSA 1QIMA 4KXXA 4MQLA 3FCEA 5CXXA 4EHIA 4ZYZA 2I91A 2PA0A 3WKBA 4C88A 1ZWLA 4V1CI 1PVPA 4A6EA 4YHBA 3HJGA 2EFJA 4W1SA 1JHAA 1AKWA 5C46F 2VNAA 5G0TA 3IR6A 1II9A 1TJYA 2WTMA 3NATA 3V7JA 4LN1A 5U1PA 2A33A 3B3GA 3JCZA 3NDBB 1OLSA 3WGVA 1B3BA 1FFHA 4L9SA 5CBKA 1F1JA 3ONVA 3PEYA 2IE8A 4CKEB 1J4AA 1SU4A 2BKUA 4FILA 2IA6A 2ETVA 2LNDA 2H5IA 1H1TA 3OESA 1VCOA 3LYSA 1X2EA 1RSZA 3FIJA 2OHOA 4OLBA 2GCOA 3MUFA 4UDXX 2QARB 4ZIRA 3MPUA 4MWZA 3KYCA 1YMUA 3B1JA 2GWSA 1LX7A 1QRRA 3NHRA 1XPOA 3CISA 1U0EA 1HUOA 2IFTA 2PU5A 3HYSA 1X19A 3NIBA 2Y68A 3K4HA 4ZCQA 4DIOA 1IIBA 4NH4A 3HLTA 1IJKA 1JG4A 2E8PA 1TUBA 4OATA 9ICLA 3TIXB 4NI5A 2GH1A 2QL9A 3K4PA 7ICUA 4Q7KA 4EG4A 3KFUF 1X1RA 2ZITA 2VJOA 3FUUA 3PD0A 1L3VA 1DG9A 2G63A 5CTAA 3UKDA 5JR3A 2I78A 3PUKA 3HU1A 2DPJA 1KGSA 4HYTA 1RZRD 4EB6A 4X61A 2JS7A 1WD7A 4KLCA 3TR6A 5I6DA 1ANKA 1H6BA 3SEQA 4ND8A 4BEWA 4E2WA 5JJBA 4YQZA 1ZVJA 4D0GA 1Z6ZA 2CBGA 1Y9AA 2JGJA 3BMQA 3OFVA 2VHCA 4INOA 1U1CA 4LCJA 4KKXB 4KPYA 3T5GA 1K8RA 2H5LA 3RR2A 3BZBA 5DO9A 2LCFA 4KQCA 1ZH0A 1C1DB 3ZK8A 3MRVA 5D7NA 1I4DD 3QIVA 1L3BA 4PBTA 1SUSA 2L5YA 2A0KA 3FNQA 4REQB 4ZCPA 3FZYA 4JT8A 4QE3A 2Y05A 1YJAA 2ZRQA 1ADGA 3GJ5A 5KG2A 5C80A 1GD1O 4YPOA 4UB4A 4MV7A 4FC6A 1SURA 1YOVA 3DUFB 1MB4A 4HH1A 4YUYA 2ZJ8A 1GFSA 5D46A 3NRZA 1MQ3A 3IX7A 5EHXA 2HHUA 1Z3CA 5BUCA 3E48A 3KNZA 4FMCF 4B6JA 2X2FA 3ZDRA 1NUSA 2P8JA 5C52B 3PHJA 1J24A 3Q9UA 3A4VA 4JEHA 5F73A 4GX5A 5DYTA 2ZBRA 1F4PA 4PZ0A 3VPFA 5JY1A 4YT2A 3F5SA 4R1TA 1P5HA 5B30A 3HFGA 3HJRA 2ISOA 3PSIA 3GBSA 2F90A 1E63A 3AFMA 2P69A 3H75A 4E2FA 4YDQA 1W96A 5H02A 4WUTA 1NFQA 4RELA 3TOXA 2ZB2A 3PFKA 4LECA 2VK1A 4X1KB 1P1IA 3DPUA 3L6BA 3QEKA 3GLVA 4LYYA 3AB3A 5JBNA 1Y8QA 7ADHA 5JCJA 3K1ZA 4UEJA 5ER9A 4JI0B 4UB3A 1T1EA 2JKZA 2H31A 3EGDA 2PL1A 1D2EA 4Q3KA 5I8WA 1WY5A 4Z3OA 4JY7A 1E3LA 3AP1A 5IUJC 4MJXA 2IF0A 1PGJA 4AM8A 1YR1A 2QJOA 3AHCA 1IWBB 1ULBA 3HN2A 1RI3A 2C7BA 3OIVA 1THMA 4TTTS 3VZDA 2I1WA 4YRSA 3U16A 4YCXA 2POCA 3RTVA 1S9FA 2X4GA 4GWGA 4PLGA 3E5MA 5CX4A 3SF8A 4KUGA 3H4VA 4BAUA 1PSDA 3UFXB 2I55A 5JWOA 3QTTA 2YJ5A 1ZGHA 4JJ8A 4V03A 3LFUA 4Q7LA 2JEIA 2ZSFA 2C94A 3ZJ5A 1GU7A 1LH0A 3ET4A 1I3NA 2BGKA 2JGRA 5IC5A 4XTRA 3T15A 2J45A 2BZGA 2JLCA 1O95C 2XE4A 3OX1A 3GV7B 4X84A 3T5LA 2K87A 5JE8A 3SBXA 1N3LA 2B83A 2N0SA 2P5UA 2B9VA 1XL0A 5EXTA 4ZKEA 4DQXA 2DLCX 4KPGA 4PLYA 1G8GA 4EG7A 1MW8X 1WWKA 1U80A 4EB3A 3UUFA 2BIFA 1SHJA 3W1WA 1GNVA 4G01B 4MVYA 2CSXA 2BSAA 1JB9A 4EVQA 4WFKA 1QHHB 4MRMA 3U3RA 3HB7A 2RDIA 5FA5A 4ZOAA 1ZQEA 1VL2A 1WDTA 3K9GA 4PO1A 4QRHA 3NHUA 1JHRA 4FHZA 5IHPA 7MHTA 1GGKA 1ZLYA 5CA1F 1R37A 1RJFA 3DF7A 2EW8A 3NWBA 4KK4A 2WE7A 1AKQA 1JEEA 1VGQA 2FU5C 4IR7A 4KQGA 5EQTA 2C2RA 4AVYA 5IIKA 2BHSA 4AWXA 5B64A 4M88A 4FHDA 1R2QA 1P77A 2A19A 2WVGA 1LVHA 1V41E 1AZTA 2XT0A 3D8NA 3SHOA 4YAKA 4PHGA 1R4MB 2RLTA 4OXRA 4L2IA 1KVQA 3HKZF 2R1VA 3CF2A 3UC5A 1DIHA 2B4AA 2YN0A 4BUJA 1OV4A 2QOEA 1JKJB 1WX1A 4JUDX 4DSOA 2VCEA 3A1CA 3TXAA 1CUVA 3KYDA 4OQZA 1PV2A 4IHJA 4Q03A 4Z2AA 3O82A 4XKJA 5DI3B 5IARA 4JI2B 5C2JB 1A9SA 3SOZA 3CZAA 4UE6A 2FPPB 4FNOA 3V8QA 3E03A 1IBLB 3I9KA 1SEVA 1DIOB 1YU6A 1T0BA 1Z6YA 1WG8A 2E37A 2PGLA 3I6MA 4JQZA 1D4FA 4JELA 4A1OA 2WFMA 1DO0A 3RVBA 2I4IA 2ZJAA 2FFJA 2Q8NA 4AXBA 4PAOA 3GUUA 4RD0A 4L4XA 9ICHA 3IFSA 4PZLA 4LV6A 2OVBA 3U31A 5ARBA 3EX7C 1ODFA 2XADA 4LX8A 4ZCTA 3UPQA 3BX1A 1XWIA 3WIOA 3IURA 3UJHA 5IBQA 3OZCA 1PTJC 5BSRA 4NF2A 4ZDWA 2HK7A 2WSSD 3OP1A 2W93A 1M83A 1H22A 1EUYA 2PZEA 2OC4A 2WZQA 1AKRA 2AI3A 1WCV1 1YU9A 4ZICA 4FONA 3EASA 2NNLD 3EG9B 5EZSA 4D9EA 1W581 3QE9Y 2GFQA 1NULA 2GLEA 5HF8A 5KU7A 4BLOA 5IKMA 3K9WA 2EZ9A 2FR0A 2WAMA 4MUIA 4HO1X 1L5SA 3SV4A 1JDTA 1AOXA 2AKYA 4O59O 4RC9A 3ZNOA 1KZGB 1S96A 1DIGA 1ZKMA 5I7UA 3IB3A 3IVCA 5KUTA 1L3IA 2LDXA 4BLRA 4LBYA 2WJIA 1IQ0A 4Z0PA 5COAA 4EHDA 2AC2A 2P9TA 4FD2A 5H7XA 5IZCA 4LOLA 5K05A 1T3ZA 2UVVA 1WHTB 3GW8A 3N3AC 3FDZB 3AM1A 2JLBA 2VN8A 3IHTA 4Z9BA 2H3HA 1DS6A 2D0OB 3KFVA 4XLTA 1JDJA 5HM8A 3R0JA 3ZI0A 1CVIA 5KYUA 5I4CA 2VSFA 3D7NA 4B81A 7ICTA 1LNQA 4LJSA 2OG2A 1SIBE 3V7UA 3U3JA 3GJYA 1K89A 3B5IA 3MSXA 4Q4AB 2UZ0A 2H0QA 4CIBA 4LJ9A 5H4GA 5LL6P 4D0NA 4AJ2A 3QU7A 3HCFA 2GASA 1KH1A 1W46A 1E9VA 1V39A 4JROA 2GN9A 1CUSA 4ZVMA 1ECPA 3DJYA 3GN2A 2GVDC 1XD9A 3IDAA 1XIVA 1X15A 1HDEA 1MP0A 2YCLA 3IAS1 1XRNA 5B1IA 1XP5A 3BZUA 4RQTA 4AYWA 4LZDA 3EVEA 3TKLA 3KHUA 4RJLA 2BN4A 4RETA 5D00A 1QLJA 3A9RA 4MS1B 4OQEA 4B3XA 1YFLA 3DHNA 3N7AA 1RRMA 5JFGA 3N0WA 5T8KA 3CP8A 2BZFA 1ZN7A 4INPA 1XTRA 2OHHA 3CZ4A 4MUGA 1W6UA 3VBEA 1GPKA 2P2CA 2QD3A 3JRXA 4GD3Q 3KAQA 4Z6KA 2RONA 3EZ9A 4HFMA 4D25A 3TN7A 3VZBA 3ZS9A 4KFSA 3RFVA 3DKPA 5CDTA 5L1MA 2W6JA 1YVDA 3B6ZA 4U2DA 3I5XA 3O9ZA 4OJKA 5ED0A 2W9XA 2FZGA 2EC5A 4YO7A 3ADCA 1DMSA 2X19A 5KTOA 4LZAA 2HT6A 2K5UA 2ZDHA 3P4XA 5FFNA 3U4CA 5K3EA 2Q3BA 3RRBA 1Z6TA 4FCCA 1YD7A 2CFTA 2JGIA 5BWOA 1TA9A 3HKBB 3HR4A 3TADA 5KWVA 1XZNA 3P32A 4JWTA 3G17A 3FB4A 3NIDB 3TFQA 2X0FA 2Q5QA 4BLSA 3S81A 1JUDA 5KFEA 2PHZA 1ADCA 3E0FA 2WPDD 3SBOA 4M46A 1N56A 4EW3A 4CF6A 1DT5A 2WZCA 1MH1A 1KQ3A 1EE1A 4WD3A 5GAJA 5JHGB 1CEYA 2OE2A 3D8UA 1IY0A 4U0JA 2E1FA 4CRXA 1YR7A 4IHKA 1TVEA 1X1BA 3MWDB 5B53A 3WZLA 4AMGA 4N5IX 3LKBA 2HFKA 2AK2A 1BGVA 1C1HA 3UEOA 3ZDXB 3WGKA 1DAPA 1RYNA 2PK3A 5F4ZA 4HLQB 1DUIA 3WWCA 2V7TA 5EJ4A 3B70A 4AMBA 2H16A 4EY4A 5AJVB 1CJBA 3L6CA 4RUAA 2NTYC 3U3MA 1J8MF 3LY5A 5ISMA 4RM2A 1KRXA 1X86B 1JHOA 4OP1A 4EKGA 5ICGA 1Q7BA 2B8NA 1BPZA 1DOAA 2PQ6A 2ZYWX 1J06A 2C28A 9ICXA 4HXEB 4IHQA 3D2AA 4WESB 2X5OA 4OXQA 4QNMA 9ICCA 2PGDA 4A2CA 5IG2A 2G9UA 5IDVA 4X1YB 4DQRA 2VBGA 1ACJA 2VDJA 3PGKA 4H1UA 1I6MA 3V00A 3U4QB 3N87A 3A3PA 4ZU3A 2JZBB 2YYYA 3NRBA 1E2IA 3DOCA 4IIUA 4AY6A 2H2FA 2YNMA 2HLPA 2J7PA 1ZQYA 3ZJTA 3KXIA 1TQDA 1Q2UA 4NCBA 1M8FA 1F4LA 2EWWA 1YI0A 4F5WA 3C3JA 2HSZA 3EAFA 1UOPA 3G2OA 1E8NA 2GPNA 4QYMA 3VKWA 3ZBUA 1F2UA 4ZQCB 1CQIA 3CBQA 4PX2A 1EWYA 3G8CA 1A9ZA 5C37A 3H2BA 3RFAA 4DY6A 4CL3A 4DV4B 3C3BA 2CNOA 3OHPA 5TF0A 2QQFA 2V0NA 1XMOB 4YMMA 1LLDA 3SKYA 1E64A 5KYWB 2RAPA 3H17A 4DFPA 1CD5A 3PXCX 4IH4A 2XO7A 1CX9B 3WISA 2DF4B 2Z04A 4FWBA 5K8JB 4IQVA 2F1KA 4OTZA 4QQ8A 2V7BA 1M0WA 1I32A 3D1JA 3JSAA 1H85A 1I4LD 1UMDA 4PYMA 4CEJB 1CUZA 2CL7X 2LZ0A 3H11B 1DV2A 2B5VA 2GDJA 3CW2A 4LFBB 3OSZA 4RD3A 2KFNA 2DVMA 2ZR9A 5J4HA 2CW5A 2PVCA 3L84A 4QUBA 3IC5A 3HA3A 3C24A 2HU7A 5JWRA 2BFOA 3PIIA 1EA5A 4O5EA 5CLGA 5DXJA 4ENRA 3MRSA 4DGQA 3S2IA 1O9HA 3BMOA 3N0RA 2NZ2A 1Z56C 1DBRA 5EE0A 4EATA 4I5FA 5EZQA 3WNDA 2IXGA 2BMAA 2JJYA 4G5SA 4KJZA 3CZCA 1PFYA 2R3SA 2VUUA 3EGCA 5D3MA 1KSGA 5JJLA 1WZEA 4A5SA 1UBEA 4O3MA 2YMLA 4LPSA 5HJ2A 3RAPR 4TMWA 2YFHA 1GPYA 3HW8A 1TVKB 1T7PA 1GN8A 1AIPA 1PDOA 1B0PA 1FQKA 3I6BA 4R69A 3WJAA 1QK4A 3KB1A 3WMRA 3RFTA 2VTBA 1R64A 4EZ6A 2IHJA 1K5GA 2FQ1A 1N5WA 1DDGA 2G4LA 4KAJA 5SY6A 4L4YA 4RD6A 3RUIA 3TI0A 5ITZB 1IRIA 1IV8A 1VHWA 2I4MA 3JRNA 3SHTA 3ICWA 5K4AA 5L8VA 1KJ9A 2IP4A 5EWLB 4ZN6A 2RHGB 3PR5B 4LYDA 3CO0S 1OU4A 4K4IA 1F0MA 2GAFA 2HBKA 5J0PA 3GLQA 3IPRA 5BSWA 4KHPB 1AQIA 3ZQ4A 2AW5A 3RIYA 5DJ5A 2PZBA 2QROA 3PDIB 2YMQA 2Y4NA 1QE5A 2VOEA 1UJBA 4IZHA 4LXXA 1B8OA 4ZAGA 4ACBA 3OFND 1VE1A 3IQIX 2H2WA 1SC6A 3HKEB 1MC8A 2WU0A 4AJ9A 1ZSVA 1L5WA 5K03A 2LKCA 3KKEA 3EXIA 4DADA 2P2LA 3W9SA 1CY8A 2VJBA 1ZH2A 1QS0A 4XGQA 2HA4A 3FKSD 3FUXA 1A8QA 5A3VA 4C6RA 1I6LA 2BFEA 2BTQB 4UBIA 5JT1A 3MJVA 1S5LU 3N75A 4PX9A 3J7AC 1OTXA 2G4CA 1SXJB 5THQA 3H16A 3O95A 4MDYA 4MV0A 4MYTA 5B6JA 4DPMA 4DR3B 8ICQA 2P6PA 4O4HA 1R10A 1NBMD 3CJRA 1IIPA 4B9TA 5THKA 3HVRA 1E9EA 3EPJA 1ZBDA 2GK4A 3PYLA 2I99A 5LOVB 1ODTC 4OGLA 1JDBC 1HQYE 1XD2A 4MVJG 1QHEA 1Y80A 3RS9A 2R62A 5BWBA 2J6CA 3F4LA 3N8KA 3OZAA 1T5BA 4JBXA 1ZUNA 4K46A 2FOLA 3REFA 1KERA 4QZEA 1FQWA 1FSSA 3ZCQA 3IILA 1VL1A 1SXJC 2HZBA 5GONB 1PQ4A 1DKQA 4FCWA 1G2OA 4N8SA 1KU6A 2R18A 1MQAA 4M4SA 2J9FB 3TZHA 3VNAA 3KB6A 2XB4A 9ICGA 4PR0A 4Q44A 4XLLA 2N1RA 3K4GA 2GRJA 3K4QA 2LYHA 1EHCA 3PW7A 3PQFA 4PG5A 4CKWA 2NP6A 2WAOA 3WRXA 3L1IA 3TLEA 3ZEIA 4ZI7A 1I51A 3KZMA 1CF2O 1L4NA 1NR5A 1RLUA 2XUGA 4KSCA 2CVPA 2RHJA 3EUEA 3IDZA 4JCCA 2C2HA 4Z86A 4KFRA 4GFJA 1S10A 3LLMA 4YRIA 1CW2B 2P9CA 1P18A 3UAYA 2OEHA 2J4CA 2PI4A 3LC0A 4RABA 5FKJA 2PA3A 4DRXB 1NUQA 5D4BA 2AKAB 1E2MA 3DLCA 4XGIA 4EBEA 3WK5A 4JD5A 4KHZA 2ZXEA 2A1JB 3HFJA 3VNRA 4C87A 1ZRSA 4ZOQI 2DLNA 3ZGZA 1GKKA 4HRYA 3NC1C 5HF9A 3ESCA 1J8FA 2GM9A 1NOIA 3RF7A 3KP1A 5SZJA 5A9TA 1J8VA 2V5AA 3CZRA 5JQGF 4C4SA 4RH0A 5MHTA 1EQAA 2WSLA 4D4IA 1ZM9A 1E2HA 2IKSA 4HVLA 4UM9D 1CS4C 1LC3A 1N7HA 4HCJA 2P68A 4QJBA 5CYFA 4Z99A 3HJFA 2F3SA 3W06A 5LMZA 1UBFA 5K0CA 2H1OA 2AQ0A 1BX0A 1KHHA 4RVGA 1KAEA 1NT2A 2FE9A 1XJCA 5LZ8A 1T4MA 3I8XA 3GNSA 4QT0A 3RI3A 1V37A 1ACLA 2Y1XA 3LY9A 4PYOA 4AWAA 4CR8A 3FRJA 1I01A 4FHCA 1FFSA 3JVIA 4PBRA 5KFDA 3LVBA 3U7EB 3AI1A 2JFYA 2OZLA 3V55A 4TQRA 4DMHA 3AUFA 6LDHA 5JQGA 2JIBA 1RPLA 4HQFA 1C3OB 1ZK3A 1WR8A 1Z2EA 2J9GA 4M47A 1I3LA 3ZC3A 2EBWA 2B1RA 3MTEA 1A7UA 3JATA 4M7RA 2C84A 4C7OA 4FFBA 4ZH4A 1Q92A 1GEEA 1DARA 1MW9X 1VCNA 4IMPA 1EGQA 3EVNA 1KETA 1G2IA 2GD6A 4PIPA 3OQVA 4TSKA 3GNQA 1UDBA 3BRWD 2JAPA 3OLQA 1AX9A 3UMRA 1MH9A 1JIVA 1X80A 4PTZA 3HSSA 4K4HA 3GGDA 4QZFA 1VJCA 4YP3A 4BN4A 4JXXA 3BD8A 1M1ZA 1LV8A 3CLUD 1PK9A 3L18A 3N7TA 4KW7A 2XAAA 4R2HA 3AXSA 4WOCA 3H5OA 1E2EA 1PBTA 1FRVA 1WXQA 3AW8A 2E4AA 3HUEA 1N4AA 3FOEC 4MHOA 5IULC 1CE8B 2DSNA 3L6OO 4LRTB 1YB7A 3IQGX 3UBTA 1J1ZA 4UTZA 3WLLA 1ECLA 2XUDA 4AMZA 2F8LA 1TM1E 2FPLA 2XY4A 3RHZA 3TAPA 1RQXA 1B6GA 1U3WA 3IMCA 3W3ZB 2O5CA 1C3EA 2XD4A 3S29A 1IIRA 4KXYA 5J2CA 1H6DA 1FFDA 3AHEA 4PSAA 3TPZA 2Y27A 2G9VA 1WUHS 2BONA 2SKEA 3FGOA 4RLFA 4YAGA 4P4GA 2GXAA 2OC9A 4XWKA 2MSEB 4NOKA 2UVWA 1GCUA 2IQIA 1TXGA 4G8BA 3R75A 3TR0A 5IWCA 3T54A 1YDWA 4YREA 3NTRA 1L4EA 2GCGA 3ZDCA 1L1FA 1ZRHA 3MNFA 1DKMA 3V2UA 1JXLA 1QR6A 2FEWB 3CT6A 4BB0A 4A36A 1CJKC 2C9MA 1R00A 4Q01A 3BQTA 2C4UA 3EOBI 1N5LA 1CY1A 2A3NA 3EK2A 3J80A 1R8JA 3K0FA 2HRDA 4UPEA 3Q8MA 2C1XA 3OJUA 2K60A 4UZSA 4AF6A 2ES4A 5CMLA 3Q6IA 2ASJA 2IXDA 5E7MA 1RC0A 4IYJA 3IR7A 4EHBA 1UM9B 3IL2A 5EWJB 4JH0A 5A4AA 3IVAA 4EZ9A 2HJVA 4DJ5X 4BY9E 4F8EA 1DG3A 1X0VA 2V7EA 4NM2A 1EU1A 1IPHA 3IAEA 3LO8A 4TZTA 4H7EA 3OHBA 1OUMA 2AIRA 4BNYA 3NC0C 1A5ZA 5CAEA 5MDHA 1HE8B 3ZHVA 2OAQ1 2OCYC 3QYJA 3TD6A 3ZCXA 3FPKA 1HT2E 1GT6A 1K4MA 1SVWA 4WNAA 2CJXA 2VWQA 3ZU4A 3W5IA 1J0CA 2D0DA 5AFSA 3LK9A 1F44A 1J0BA 1IVYA 1OC2A 1AM4D 1XEAA 2EFDB 3QBVA 1OYVA 1W2GA 4L5AA 4TLAA 1OI2A 2CMGA 2B7BA 3DDOA 1SVIA 4UTVA 3E9DA 2WHRA 2A0XA 3TZCA 4Z7QB 3OKCA 4O33A 4F6RB 2CHEA 4DA4A 1CZRA 5BMVF 4W9RA 5DXAA 4P53A 4R5MA 3GFFA 2OK7A 2HOQA 3HCEA 2PXHA 2RJNA 1P80A 4HN9A 1KTVA 3JQEA 3SYLA 3UAWA 3VA7A 2ATLA 4OKNA 1LTQA 1XVAA 2QAGC 4I2IA 4GC6A 1VE5A 2JFZA 4LZPA 2GXSA 2IYYA 1XF1A 1F2VA 3LY8A 1R5OA 2EKQA 4UBNA 5AW0A 4QGBA 4PWYA 1ENZA 3FW1A 3NS1A 1I30A 4BU0A 1IM2A 1U0OC 1U8ZA 4NU0A 3JQ9A 2POQX 2YR0A 4B8WA 1ZBQA 1DHTA 4GI2A 4HMPA 1VKHA 1QIDA 2BP7B 3ZOKA 3MJTA 4I4NA 4MWGA 4NV3A 1I80A 2IOFK 2NUTB 2Q5EA 3C3KA 3WGJA 1E7MA 1SCNE 4Y6QA 3AU2A 4FGJA 2MA1A 4OK6A 4R1LA 4N9QA 3F2VA 4KPEC 2VK8A 3DULA 5LA6F 2IDZA 2OGWA 2QUZA 3OTHA 5C7OO 1JQBA 1XTSA 4B3HA 1UZNA 4NLBA 1YDGA 3ZE9A 4CMBA 4HQLA 1IG3A 2DTEA 1E58A 5IYZA 2D00A 5EXPA 5A0VA 5T3YA 1GGEA 4GRIA 3RUEA 1H2FA 1JWAB 4GOLD 2HPAA 4N6OA 4KLUA 4INJA 3B1ZA 1Z0JA 2UYYA 1JRLA 1SBQA 4C78A 2GPJA 3CZMA 4MVJI 2JW5A 3FNEA 4QXOA 4ZV7A 5F23A 1UKVY 2NAPA 3E8XA 2APJA 4D92A 3DXFA 4MTCA 4CCYB 2C2DA 5CA0A 1K75A 1CDZA 3ZH9B 3K2EA 4LV8B 4LGCA 4ZYVA 7REQA 2V7PA 3HP7A 2YMMA 5AICA 3AIMA 5JQWA 1N2CB 1SC4A 1T9AA 2E1EA 8ICOA 1E6EA 2EP8A 2DCUA 2F17A 2IYNA 2K6GA 1FP6A 2I8CA 2OZPA 1UBJS 4OD0A 5AK4A 3KDSE 2G80A 2GK6A 3KJQA 4Q82A 2P35A 1EWRA 2OBXA 4D42A 4YQFA 1NX6A 1RQ7A 3NGLA 2IWHA 3HXOA 1JEYB 5J2AA 4NBRA 4K9LA 3U44B 3MB5A 3OVMA 4MR8B 5KC9A 1NF2A 2V8OA 2W22A 4EB0A 1RXIA 4HX5A 1AS0A 3H0LB 2WWIA 4UAJA 4E5MA 1Y9DA 3QH4A 1RLOA 3HA7A 4CMKA 5A5EA 2O0LA 5KOIA 5D49A 3UMJA 2HWWA 1XQ1A 1ZKDA 2PLAA 9ICQA 4ZO7A 2Q3FA 3RB0A 5EZYF 1JMYA 3TUIC 1O77A 3WNVA 3G49A 5TPWB 2AR7A 1QMPA 3VTAA 1L4BA 4PRYA 4DBLC 1CQZA 3THWB 4FINA 1DRVA 3DMPA 5KCZA 1WPQA 4BV2A 4YR7A 3W5CA 5H5JA 1EDZA 1P7DA 4RZ2A 3OMXA 4K28A 4UHHA 1ENPA 4IOJA 3QY0A 5T4FA 2P9QA 3FVWA 3P71T 1UBTS 1JIJA 1OY1A 4HRVA 1FYXA 1WUKS 4CW7A 4QWEA 1FFCA 2CNWD 3L1UA 2QVCA 1ZOPA 2WVHA 3DOEA 1Z7EA 3W2GA 4ECAA 4KI0A 1KDTA 3U09A 5CFZA 4QLAA 2GUWA 1X1AA 1NG1A 3AKDA 1JU9A 3EQ8A 5FP0A 1E2NA 4HHEA 4IDOA 1IVSA 1UBHS 4MWEA 1Q3HA 1PV4A 5KINB 4B35A 2V4MA 3NP7A 1NMQA 5I3ZA 3IN5A 1OIWA 3LWLA 2XUZA 2R00A 4EVSA 4J0KA 3ITKA 3WQHA 3Q3JB 4Y2XA 4IINA 4MMZB 3ZPXA 5LMCA 3OEEA 1BKDR 2O0KA 3F9CA 2PUDA 1DWUA 3DDSA 2HGSA 1RQ2A 2ZTUA 4QUJA 4BIMA 5M5BA 5F5XA 3LA8A 2G4VA 2QU8A 4J8PA 3UKJA 2AOTA 2H4FA 3V5NA 5CDGA 4GPIB 2QW0X 2GNAA 3EQ9A 4COKA 4AF7A 4FHEA 4TWAA 3L02A 1CLEA 4HDMB 3KL2A 4Z54A 2OH2A 5FTLA 4GHWA 2EIXA 1AMOA 3NHAA 2PUAA 5IAAA 4MVJD 1TC2A 2JH3A 1GZ7A 2BBOA 4EJ2A 5J4VA 3OEED 1BPBA 2RI6A 4QFDA 3AINA 2XE6A 4NNOA 1XUOA 3NQ41 4CR7A 3O4FA 3EIEA 3F5MA 4HDNA 5E0KB 4F3RA 2Z6AA 4CHTA 2LBPA 3E5NA 1P6UA 3W4IA 2UU9B 5JS1A 3LYHA 4JJIA 2QD4A 3COPA 3CCFA 5E6UB 1UXJA 1CQXA 3EG5A 3KE8A 3T1NA 1CUKA 4KG7A 5AVWA 2N75A 2L0XA 5KVVA 3TK1A 3M6ZA 4TYNA 3GRUA 1GU1A 2F64A 3MJSA 4AY2A 2ZIWB 4EECA 3B82A 2M6KA 4XTCS 3C4JA 2MDTA 4H3HB 2J6UA 2QYHA 3ICVA 4GXQA 4PLWA 5A02A 3KSDO 3GLTA 4L4UA 4TMXA 1Z25A 1JAYA 3QNUA 2OGUA 1V9PA 3VU1A 5HZGA 3BULA 5FAKA 2HR1A 4IMIB 3G7SA 4UNQA 3OX4A 4MRSA 2QB0B 4EX6A 1L9KA 1JG7A 2EEZA 3MA0A 3N28A 2PL9A 3O3CA 4LTMA 3BBPA 3FRHA 3EIUA 4AJJA 2J9YB 1WHSB 5BSMA 1FBNA 2YCBA 5H4HA 1QIHA 5G5HA 2G40A 2O3RA 3VUEA 5JSYA 5FBVB 2HLDA 4E1VA 5BQOA 4X60A 4H0FA 2KIWA 2X42A 1JA0A 2O2ZA 3AF1A 5KJEA 5I3CA 3A3KA 4E31A 5LZ4A 5AESA 1C9MA 2BT4A 1OU0A 2K2WA 4MMXB 5GPBA 2XTNA 3SFVA 2CZCA 2ZVPX 1ZQGA 1PS9A 1UL1X 3H1FA 3TI7A 4JB0A 4BJ6A 1IY2A 3K1RB 4EO4A 1OF1A 1UP6A 1NJWA 1U2GA 1XDGA 3COZA 4RY2A 5H0IA 4ZO8A 1P4SA 4KN6A 3T35A 5JSZA 1JTVA 4BX8A 1ZAYA 1OX6A 5BVGB 3ZE2B 3GRAA 4D82A 4TKVA 3TGLA 1HDYA 4QRIA 1G7SA 1ISIA 5DYWA 2OCXA 2QZ9A 4JL5A 4PXSA 1JLMA 3BAFA 1L5LA 3P9ZA 4ID3A 3UTCA 4P4MA 1W4ZA 4GP6A 3NHZA 4BWJA 3D5EA 3IOCA 4GPEA 2AMVA 1IHXA 4US8A 4I55A 1U7WA 2HRZA 2Z7JA 3WWDA 3BHJA 1DEKA 2Y1CA 4YK7A 5HBRA 3CR3C 2MR6A 2QJWA 2PBRA 4EHKA 1BDHA 2R11A 3OU6A 1SAYA 2WUVA 2XDYA 3BQMB 3ID6C 3JQAB 4Q9KA 2A1TS 1QH1A 1W8DA 1UPUA 3LWBA 4K8RB 3NGXA 5EYPA 4YMOA 5ALHA 1NK0A 4OAPA 2IPNA 3A6LA 4LF5B 2PLRA 4D6YA 2HBZA 4YV7A 4WK2B 3Q40A 2J6IA 4DR7B 1EXMA 1W88B 2QKYA 2ZXFA 4L3OA 1A8IA 4G37A 3SJCA 1DHRA 1VIVA 3NGDA 1JDNA 1G4AE 1N2OA 2UVPB 3QWFA 4MZDA 5JG7A 3GLKA 3M5WA 4U7JA 1E2GA 3L5KA 4IIVA 1A50B 2B2NA 5IJWA 3U3KA 1XNRB 3BQ2A 2I8LA 1TK5A 3VAAA 1RBYA 5DM70 2OFWA 2YFQA 1A8HA 2ZFUA 1ZUIA 4RIGA 5KNCH 1HL7A 4ZAZA 3I58A 1BD4A 3RRMA 3TVDA 2I7XA 3GVPA 1AS3A 5CA0F 1RYSA 1M7BA 3JPNA 2V4RA 2CK3A 4M9NA 2EFEB 1R4NB 1WXWA 5EOVA 3B8EA 2QEQA 2Z58A 4RPIA 1LRKA 4J94A 5KYYB 1JEJA 1FFXB 3C28A 2Z98A 5REQB 4TQAA 3IIMA 5LZ7A 4PONA 4DMKA 2H3FA 3EMBA 4OJLA 3P97A 3BF7A 1YZ3A 4ECVA 1R1DA 4IKEA 4NMHA 5K3FB 3VSBA 3ZXIA 2MU2A 2PL3A 3CNOA 1ONSA 1ESZA 4YB8A 1OMOA 1EVYA 2PUWA 4PYLA 4PCLA 4E30A 2AGOA 3FJYA 4DMRA 1DBPA 2HBQA 1DC8A 3ETGA 2HV8A 1YNOA 4TKUA 3J81k 3CEAA 2H1IA 3QITA 4JUAA 3HACA 4RZUA 4S2EA 3VVLA 1L4FA 4EJFA 4V1CB 3QV2A 3VPHA 3G8AA 5EMNA 2GLTA 4EW2A 5BR4A 4HJXA 5JZMA 1DAGA 3X2EA 4F9TA 2YC2C 4YRZA 4WOJA 4RU1A 8ICSA 2GBPA 5B2ZA 1Z16A 4YASA 4EFLA 3LQ2A 1PUIA 2VP4A 3QUCA 2C04A 5CVJA 1CUBA 4L74A 4YJHA 3IDOA 3K70D 4MVJP 3BKXA 1PQWA 3CB2A 1CIJA 2XPCA 4ZYTA 3PEWA 3HHEA 3LTEA 3H9BA 2H65A 4RMNA 2M6RA 4KAAA 4CU5A 3PHGA 2AYZA 4JP8A 4JYCA 4XVRA 1TF2A 2Z08A 3BZCA 1QVZA 2Z8ZA 1D07A 2P40A 5FBKA 3WLPA 4B6GA 4D46A 5JAOA 4G8CA 4MGHA 4DLSA 4HDOB 1G0NA 1XTQA 2PUVA 4UAYA 5JPCA 3U6BA 1G42A 1MFZA 1M2OA 1QE3A 1OGJA 2HTFA 1EP3B 3LZDA 4U39A 4DSFA 1RYRA 4IV8A 3A0BU 1MABA 3BRQA 4BMCA 2WQ6A 2XICA 2Z56A 4U63A 2G9NA 4EYHB 3BIWA 2R6CA 3JVDA 4PHHA 5HZHA 4HSEA 3ZD6A 3WRWA 3OOWA 4ABTA 1SOWA 3ZNNA 1TZBA 3UO8B 5BMVB 4Q1AA 1NVMB 3RFCA 1SBIA 3GAFA 4HADA 1ETUA 5D6NA 4HPJB 5SZKB 4FTWA 5B1YA 1W0JA 5AIBA 3K6JA 3SS9X 4M1EA 2C83A 3L8CA 4F9GA 4M1MA 4YTEA 4ENVA 2C7PA 3LRTA 5F35A 5B6IA 4PR3A 1C7EA 1RJWA 4QQKA 5JZOA 1HZZA 1E0DA 2NMVA 1D0IA 2G09A 4MV5A 3D81A 2PVPA 4HAIA 3MTGA 3HV0A 4ROSA 1Q50A 4Q24A 1A95A 1T8WA 4J49A 1PGQA 1Z6PA 3I01M 1D0SA 2JEGA 4GM1A 3ML1A 4RA9A 4DRZA 1X9IA 4HB2A 2WY2D 3QPUA 1KYQA 3USCS 4KO4S 1YUNA 1OVGA 4P3YA 1V45E 4W7IA 2JBAA 1FTGA 2IHUA 1SC1A 1K7CA 3PL5A 1C7ZA 4U2FA 5L3ZA 3T52A 3V8VA 4CLXA 4HTFB 5JRJA 1UC9A 4JQSA 5LP6B 3L0PA 2B3TA 3F49S 3OFSA 3SX4A 1G8SA 2IW3A 3MS2A 2NO7A 4PLZA 4K26A 2G8LA 3WS7A 1H5NA 1G5FA 1Q83A 2Q4RA 3H84A 3OT5A 2ZM5A 5F12A 1AE1A 1D1QA 5IAKA 3L8ZA 5EQFA 2NV0A 4YV1A 4TLLB 3TLYA 3PA8A 3HA2A 5K0BA 1T35A 2CFIA 2JB9A 3BTVA 3RS7A 1XWWA 3JZMA 3U49A 4X66B 2Z1MA 4WT7A 2QXUA 1WB9A 2QRNA 4FOPA 4CLEA 4LZGA 3OEHD 1U2GC 3A4NA 3D8HA 4PGHA 3RJ5A 3W2TA 2W2LD 5I7HA 3Q0TA 2XITA 3PFHA 4I1SA 2A1IA 1ZW6A 2Y1FA 3FBGA 4S1OA 1WW3A 4DDMA 2Q3DA 3C1TA 4L8GA 3AEXA 4QVIA 221PA 3GFOA 1TK9A 4C7JA 3UJBA 3QJGA 1T3SA 3QUQA 1SKAA 2II6A 4IHAA 4L0DA 1QGED 5CFLA 4RHFA 2GEJA 1UA1A 2M6SA 2RI1A 1J25A 1VSUA 4HATA 4K2HA 5CX1B 1R9MA 4IX9A 1JXEA 4QXMA 3H5RA 1PQYA 5EIFA 3H3XA 3LBAA 3T7KA 3QA3E 3KQPA 4R8LA 1CCWA 1MB9A 2W04A 1J07A 2CL0X 3O6VA 4DV6B 1QZ3A 1H42A 4YUZA 1OOEA 3ICPA 3ZY4A 5C8YF 1DQRA 3K9HA 2UYHA 5C7IO 5BSFA 1KMCA 5IIMA 1NVAA 4D4MA 4E07A 1WULS 1Z8FA 4RVCA 3I9OA 3MEQA 4RD1A 1YZGA 3QOFA 2IX9A 2BKXA 4C8NA 2AUTA 3GPLA 2AGVA 1II0A 1UFQA 4GZ5A 1OYYA 1SUIA 5C1IA 4FNMA 5EUQB 4BO2A 4X9XA 4G67A 1QK3A 3R23A 1GO3F 4IIJB 3AHJA 1NNEA 2J3QA 3SENA 3A36A 3GXBA 3BPSA 1CP3A 4Y0AA 2UVUA 3ZCPA 1XJ0A 3OY2A 2ERXA 3SR4A 3N86A 1NP3A 4IRXA 5EWFA 1NZDA 2ZGVA 2HL6A 3AB7A 1E0SA 4O5AA 3WJ2A 4BQPA 1D2NA 4EKDA 1E92A 1CUDA 5L4SA 4KN4A 5EI5A 4B3DA 1LW6E 2ZJ7A 3BJYA 4UU7A 2RBGA 3ZHUA 3KQOA 1MENA 4QDTA 4UAGA 2ZTHA 1BHJA 4F11A 1P2DA 4Q3OA 4KR6A 4HRXA 4UHFA 2YVAA 3A0UA 1GR1A 4M1ZA 4DQUA 5JJ5A 1R6AA 3DTTA 4NX2A 1GTMA 3IP6A 3ENNA 1BE6A 4P4SA 2X86A 5FI1B 2YN4A 4ZYLA 1U7OA 1X74A 1JR3A 1MJHA 3A4TA 4UB2A 3KK0A 4WEQA 5CIQA 1YRLA 4PH5A 1WZIA 4WLNA 3RFFA 3PZRA 3TPCA 2OECA 2XCLA 2O8EA 1U7TA 3OD1A 1ADBA 1DZ3A 1C7RA 3GJQA 3OWOA 1Y6FA 5KFUA 3IQZA 4BBJA 2B1JA 4CUKA 5KQGA 3LWMA 2ZIVA 5AM4A 1GO2A 3GUYA 5DHSA 5K51A 2W54A 3ZUPA 5KDDA 1EA7A 2NZWA 5IWAB 4EHLA 4GLOA 1FTWA 2C2GA 2XKAA 1UADA 2J85A 3GIJA 3TX6A 3UXNA 4G1VA 1VP3A 4LTDA 1ZNWA 1JKXA 1U8TA 3INRA 4CQMA 1NE2A 1RCFA 3CKYA 4M49A 5IJAA 2KIVA 5BN4A 3ZNQA 1Q16A 3ANLA 3UH0A 2ZQYA 4DSNA 1US8B 3RJFA 1CEQA 2WA1A 3E9RA 5FCDA 1VHQA 3DD5A 5FV7A 4B0OA 1VB5A 1XT6A 2MSNA 3R3JA 4X20B 5J63A 3WOHA 2E5LB 1KIMA 1CFJA 2QB1A 4BXOB 1OREA 1YULA 1W73A 5GONF 5JSKA 4FXOA 4LF6B 5KVCA 4O4JA 2P0YA 2VQ6A 4TQSA 1YVUA 3PICA 3HDHA 1NRJB 1KQQA 1PEAA 2RFLA 3NC4A 4TVKA 3IUJA 1QSLA 4AT1A 4B7XA 3BL8A 3RHSA 4B80A 4HYKA 1NK6A 3OPQA 3UT0A 2DEUA 4Z4IA 5YASA 8ADHA 4HXFB 5EEHA 3GN1A 1E3JA 5LVAA 3UQYS 1U0LA 4YALA 3WFZA 4RE6A 1FC0A 3EIOA 4KRGA 2AH5A 3KJGA 4ZC1A 4DT1A 4QIWF 2FPKA 5A3SA 4GG1A 3T06B 1AROP 1ZQVA 1G7RA 1U4NA 5C1DA 4ER6A 5HRCA 3QSGA 2LKYA 4R2JA 4Q3NA 5AVQA 5IH7A 3HB5X 1J2RA 1Z19A 1QBKC 4NMLA 2BWJA 3FTEA 3H4MA 2FSVC 4RZQA 2WIJA 3GCWA 4DLTA 3MGCA 3B7WA 1IUKA 4QBIA 4QZBA 4D3ZA 4PN7A 3CLRD 3WLJA 4DL6A 4IVRA 5G1OA 3ZZMA 3JTMA 3PGXA 4HB4A 1P7CA 3ZUGA 4OHOA 4PGQA 5JW6A 4WKOA 3W9UA 1U3DA 3PEEA 3A0HU 1BVRA 1EFDN 1KP3A 1V95A 3NJ8A 3R5KA 2XSZA 1K63A 3AIIA 2VWPA 3U0VA 3I3SR 3K96A 5C5DA 1YIAA 3LKVA 3UJ3X 1J70A 2P66A 3NASA 1ADYA 2D5BA 4KBFA 2IZ5A 4KIJA 3SZLA 3VH2A 1X6IA 2V9WA 4YJ3B 2QTNA 3A28A 3CTPA 4ZI2A 4FR5A 4JYZA 3K7EA 1FNDA 4DRYA 3ND5A 3B52X 1G8KA 821PA 3F4KA 1YQTA 5ESWA 1GM5A 2E8OA 4NE7A 3H13A 4PQEA 4EG5A 2ZATA 3D6TB 3NYRA 4ND5A 1NWHA 3FJ1A 4YBZA 2FPSA 4ZVOA 4S2UA 1ZQZA 4UTRA 1QQ5A 3OZRA 3TBKA 4IDFA 1VPEA 1Z4MA 2YKGA 3G0DA 4O29A 4RK0A 1OR8A 4COOA 1DBQA 1UJCA 2QT0A 2VTEA 4ZPJA 3IVGA 4GPZA 1WDWB 1YQDA 3TQIA 2NZYA 4UVGA 1YK1A 2IUFA 3TACB 4C7XA 4MEJA 1O97C 5CCBA 4KFTA 1KFTA 1OWNA 1R0ZA 3ZZ0A 1KAMA 2NGRA 3P2EA 4JLDA 2YY7A 3R7FA 4DA9A 3EBOA 1OZHA 1M6VA 3IQHX 4ITRC 1PD1A 3P45A 2C5BA 3HADA 4BWFB 1TCVA 4JNCA 1YBVA 2AA3A 3QVJA 1QF7A 2Q9UA 1NDUA 4QBFA 4Z7OB 5JRZA 4XEUA 1JSCA 1K6IA 1PT5A 1Z5VA 3CR7A 2F9LA 2IPOA 1D7OA 3OOEA 3N8DA 2A88A 3DMHA 4UM7A 4EW1A 1NSTA 2GAJA 4JYMA 2CXTA 3KB8A 1N9GA 1CKEA 5DG9A 1LBHA 1KDOA 4UBBA 2FLVA 4KGZA 2Y0PA 5AHKA 4KMUA 2B36A 3URMA 3JSXA 2ZTMA 4GQIA 4LY9A 4QSMA 4RM3A 5P21A 1T26A 2JEYA 2VZ0A 2B9EA 5CB4F 2ZRBA 2QXTA 4AY5A 4NLLA 2ZETA 3H18A 4LE0A 1T4DA 3LDAA 1PEDA 1PCXA 2KW5A 1GARA 3A1FA 5I9MA 1I7NA 5JAZA 3UV7A 2YW2A 1N0WA 3ILYA 3F3YA 1EBBA 4F2RA 4R8RA 1C8BA 2GD1O 4XGNA 5AKZA 5D5QA 4IICA 1DDIA 1GQOA 2CMHA 2QSYA 4ED3A 3JPYA 3MCUA 1SOAA 1EFUA 2NU9A 2X1VA 4XQEA 4F4HA 5BV2P 3GBPA 3EGXB 5HKKD 5KFJA 2IMWP 1BVUA 3C5WP 3OPYI 3PCRB 4JK3A 4PYRA 2MINB 4ZAXA 5FNZA 1NJ8A 1UPTA 1NZFA 2WV7A 3PQCA 3A6HA 4CLOA 2VIXA 5TEWA 3HQ4O 1GTJ1 2YFKA 3OBIA 2XXAB 1F2DA 2WLTA 4PLFA 5TQ0B 4UVEA 4CGZA 1IQPA 2RP5A 1GQQA 3DOUA 3AF2A 4RGQA 2HLNA 3TIFA 3E22B 4ZCMA 2OO5A 2RKOA 2GXQA 3ESRA 1JLLA 4GH5A 4HC4A 4HRAA 2F1JA 3G6WA 1QHFA 4KWCA 4YI5A 5EP2A 4PRZA 3VZSA 4AQ7A 1HLPA 2AFIE 1H6AA 4IOKA 1JH9A 3ME5A 5J0XA 1USWA 2QM3A 3AR2A 4JDPA 1GQRA 1W8IA 2BV3A 2VHUA 3BWVA 4BNIA 2C4TA 3EA0A 2O8NA 2M1XA 1DX9A 2PMZC 2D5LA 2Z95A 3FWNA 3OZ7A 3RC2A 4TSRA 3IMEA 3TMYA 4R31A 5JANA 2YVUA 4K9DA 1TYZA 1P6QA 3H1AA 3UWPA 2V1UA 4QTUB 3TTWA 3KVVA 4MDHA 1XCJA 3QOWA 4UM5A 3VU9B 1A9PA 4AJNA 5JAIA 2XUHA 3I34X 2MSKA 1F7VA 4G86A 3KEOA 1W19A 3LP5A 5JMPA 4G0WA 2IYEA 1H2XA 1WW8A 2OMKA 3K70C 3C1AA 2BMJA 4Z0NA 4OH7A 2HQBA 1O94C 1Y3BE 3IA7A 5CGQB 5JI3E 3UQ2A 1JHZA 2J3EA 3Q12A 4RSGA 2DFDA 3ZWQA 2VPZA 4GAEA 3GFPA 1NYLA 3LQYA 1I3OA 2IH2A 4F46A 3BWEA 5JYCA 2IITA 3RYFA 1AQLA 1EJ0A 5AKLA 1Z7BA 1KI3A 1U0JA 2BEUA 3CN9A 3GRPA 1XNGA 4QOIA 3T3GA 1XSNA 4UMEA 2CE2X 4BO4A 1IOWA 3GP5A 3IT0A 2NSHA 3SGLA 1IAVA 4FQ7A 1UKYA 2OHJA 2GWRA 3AR8A 1F9EA 3AF4A 4RTNA 1FDOA 2YHAA 4GOJA 5LOVF 1HMYA 3GQBA 1K7XB 3PMLA 2GI4A 4RVNA 5IAOA 2DM6A 3FOBA 4E5YA 3PR4A 5C1BA 1DKLA 3NM4A