2WF8A

Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, glucose-1-phosphate and beryllium trifluoride
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
b'MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Near attack conformers dominate beta-phosphoglucomutase complexes where geometry and charge distribution reflect those of substrate.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 79
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf8A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf8A01
4FFDA 3DAOA 3A1EA 5ALTA 2FPXA 5ALEA 3KOOA 4EX6A 4YCLA 1RRCA 3L8GA 3QUCA 4UU0A 5AW4A 5AM2A 1X42A 3I1YA 3DNPA 3ZWDA 2D2VA 1U02A 2AMYA 5AHXA 2BDUA 3EWIA 5AM3A 2PKEA 2GMWA 5ALVA 1Z4KA 4OHFA 2B1QA 1AQ6A 1YJ5A 1YNSA 4NWIA 5AVWA 2ZOSA 5AK4A 1Z4IA 4GXTA 4Y3UA 3ZUPA 2IA5A 2C88A 4Y2VA 4DCCA 1L7OA 3R4CA 1QQ7A 5ALUA 4BNDA 3KBBA 4Y2YA 2YMQA 3MMZA 2HX1A 3IB6A 3SLRA 2YJ3A 2YMLA 3QLEA 4Y2UA 3SD7A 4UMEA 4KX3A 1XVIA 1L6RA 1L7PA 2QYHA 4UAVA 3SKXA 3QU2A 5ALMA 5AW0A 1TE2A 4OD0A 3ZX5A 2HCFA 3A1CA 4HGPA 3L8EA 1SWVA 4YH1A 1NRWA 3NALA 4YIHA 3PGLA 4CNQA 5A3SA 2FPWA 2R8YA 3TLMA 4OCZA 4UAUA 2WM8A 3IJ5A 3AR2A 3AR9A 3PDWA 5AI6A 5AVUA 2O9JA 4BNDB 5ALWA 3MN1A 1Q91A 3DV9A 3QU9A 1SU4A 2IOFK 3FVVA 3WK5A 4EEKA 3N28A 3QU7A 4HGQA 4L6CA 1XP5A 5AM5A 3QUQA 5ALSA 2OM6A 4ZEXA 3R09A 3WKBA 4Y2JA 3HYCA 3U19A 2G1AA 1U7PA 3UMGA 5E0OA 3AR4A 4CF5A 3FM9A 1T5TA 1Z4MA 4BX2A 4L57A 1EK2A 2R8XA 4EENA 3KDPA 3QGMA 1L7NA 2FPSA 4EZEA 3U7FB 3R9KA 2IYEA 5AKXA 5AW7A 3OCUA 5AKGA 4Y2PA 4UU1A 1Z5GA 2YN4A 4UASA 1QYIA 1VJ5A 3ZU6A 2WHEA 5AM4A 4DWOA 4UW9A 3IRUA 2FPRA 2HHLA 1Z88A 2C9MA 4BEWA 3ONNA 1Z4QA 2YJ5A 3E8MA 1ZD3A 1L8OA 2YJ6A 4PNHA 1RQLA 3M9LA 1L8LA 2VKQA 5AI8A 3U7GA 5ALJA 3GYGA 3MC1A 5AI5A 3U13A 2WF7A 2QLTA 4NAVA 4ZEVA 3AR5A 3E58A 5AK6A 2JAOA 5AESA 1RLTA 2C8LA 2GHTA 3N5KA 3PCTA 3ZVNA 5AW2A 3OCXA 3PGVA 2G09A 3ZX4A 2AH5A 3N1UA 5ALQA 4MWOA 1Z4JA 2O2XA 5ALXA 1EK1A 3ZW7A 5AW5A 4L6AA 3NANA 3UM9A 5ALIA 1ZD4A 2G06A 4F72A 2HF2A 2RBKA 4G63A 5AKKA 3WKDA 3QXGA 4KX5A 4H1WA 5AW6A 5AKLA 4UM7A 2JARA 4Y2QA 2B8JA 5A3RA 2MU2A 3A1DA 1RQNA 4EX7A 1J8DA 5AVXA 4BYGA 1WZCA 1S2OA 1TJ4A 3OCZA 2FI1A 3L0YA 4UATA 5JJBA 3A3YA 1SWWA 1Z4NA 3L8HA 1Y8AA 4AS3A 2MU1A 5AKYA 4Y2SA 5AICA 4KN8A 3WGVA 1WVIA 3ZVMA 2HF7A 3L7YA 4XPZA 4IG4A 4BX0A 2Q4TA 5ALNA 3HLTA 4IFTA 5AI9A 4BX3A 1NNLA 3U7EB 5A3QA 4HGOA 1CR6A 3ESRA 5ALLA 5ALOA 5AKJA 2CFTA 2G08A 2I7DA 2HI0A 4E88A 3QU4A 4XOUA 3L1UA 3OCWA 4AP9A 3CNHA 3ET5A 3ZI4A 5AW3A 1O08A 3B9BA 3WKCA 3NASA 2ZBEA 1NF2A 2GHQA 4UMFA 3OCYA 1S8OA 5AM1A 4HAIA 2FDRA 3P96A 1N8NA 5AVRA 4UMDA 2JGAA 2W4MA 5ALZA 2OBBA 1Z4OA 2PQ0A 1ZS9A 2FEAA 4ZEWA 3ZTYA 2B30A 2ZBFA 4HYTA 3ZWKA 4YCMA 4HGNA 4CE6A 5ALGA 2W43A 2EATA 1RKVA 4NV0A 4DFDA 3WKEA 1N9KA 5IT4A 2NO4A 4JDPA 5IT0A 2WF8A 2W11A 1T5SA 4Y2RA 4Y2TA 1XPJA 5AVZA 3M1YA 1U7OA 3NRJA 4C4SA 4C4TA 1RKUA 3SHQA 3FZQA 1ZD5A 1VJRA 5FP0A 3AR8A 5ALHA 5AVYA 1CQZA 3SMVA 4XE5A 4UARA 5ALFA 3AR3A 2IOFA 1TA0A 4DW8A 3W5CA 3CZ4A 3WK7A 3UMCA 2HO4A 2HEGA 3E84A 2ZBGA 3QU5A 3K1ZA 3RF6A 3WGUA 4KNVA 3NAMA 2P27A 1RLMA 2C8KA 1YS9A 2HDOA 1YDFA 4HGRA 4MUMA 3L8FA 3N8GA 5ALDA 5AI4A 2B0CA 5T41A 3W5BA 1J97A 4UM5A 3SKYA 4BBJA 3QUBA 4I9GA 2I6XA 1IWOA 4RESA 4G9BA 1RMYA 4NABA 1WR8A 3VAYA 2AGVA 1QQ6A 5ALYA 3ZVLA 2P9JA 2ZBDA 4BEVA 3U7HB 3ZTWA 3KC2A 3KZXA 2B1RA 3QNMA 3OCVA 3L0CA 3DDHA 3F9RA 4C4RA 2EARA 1KYTA 2Q5EA 1F5SA 5AVSA 1VFPA 2C4NA 5AVVA 2Q4RA 2EAUA 2I34A 4BKMA 2CFRA 2YY6A 2RB5A 1U2SA 2FPUA 1RPZA 2YFYA 3NIWA 2X4DA 2G80A 4YIKA 2I33A 2P11A 2GO7A 3WK9A 5AIBA 2NO5A 2HOQA 5AK3A 3OPXA 1T9ZA 5IS2A 3EF1A 1RKQA 3EPRA 1ZOLA 3SF0A 3FPSA 3KD3A 1WPGA 1Z4LA 2G0AA 3ESQA 3J7TA 2WF9A 1TJ5A 1JUDA 1YMQA 2WF5A 1ZRMA 1ZRNA 2ODAA 3AR7A 5AK5A 4B6JA 1MH9A 2ZG6A 5ALKA 2IOHA 4OFZA 2JAWA 4YCNA 3ET4A 1QQ5A 3WK6A 5AW9A 5ALPA 1LTQA 2CFSA 1RC8A 2WF6A 4QQFA 3B9RA 3S6JA 2R8EA 2GFHA 2BY4A 4GIBA 4J03A 4FE3A 4YGYA 2PR7A 2OA0A 4J2TA 3BA6A 1YV9A 4NFLA 2YJ4A 4O8CA 1LVHA 2YMMA 3L1VA 3OTQA 5AKHA 1RMTA 3EF0A 1U2TA 5AKIA 5AIAA 3UMBA 4F71A 2BDEA 3B8EA 1L7MA 2R8ZA 3L5KA 2ZXEA 3FPBA 2WFAA 3BWVA 3N07A 2RARA 2FUEA 1K1EA 2B8EA 3WK8A 1RMQA 4CF4A 3I6BA 2JAUA 1O03A 2CN1A 2I55A 4RETA 1RDFA 2YBDA 2I54A 4I9FA 3NUQA 2OYCA 1QH9A 4EELA 3WK4A 1Z5UA 1ZJJA 3W5DA 2YMPA 4KYTA 2DQSA 2HSZA 3ED5A 3U26A 3D6JA 3QX7A 5ALRA 3RFUA 1Z4PX 3W5AA 3E81A 4FYPA 1Q92A 1TJ3A 3MPOA 2B82A 4UMVA 1RLOA 2AUTA 2FUCA 2NYVA 4JB3A 4AS2A 5AVTA 1FEZA 5AW1A 5AKEA 4XQ0A 4KNWA 3WKAA 3I28A 5AVQA 5AW8A 5AI0A 3L0BA 2MSNA 5AM0A 4QJBA 3QUTA 2G07A 3AR6A 4Y2XA 3QYPA 2P69A 5AKZA 3I76A 1PW5A 4CF3A 2RAVA 1ZD2P 3FGOA
chains in the Genus database with same CATH superfamily
3CUKA 4U6QA 1IPHA 1PNTA 3PDIB 3T5JA 4NK4A 1R5JA 4XGQA 5I3ZA 1TZ2A 1F4PA 3I9V1 2BCQA 5ALVA 2RGRA 4ENRA 2ON6A 5I8WA 3I6QA 1REQA 4WK2B 4JXKA 3V6KA 2AEJA 1RM5A 3AEKB 2QTRA 4MIYA 4B1FA 1Q1EA 2GXQA 3H3JA 3RKUA 3N8HA 2ZREA 5KNLA 1DCMA 4BZQA 1KSJA 4ECXA 4BMSA 4ZARA 2PUBA 1N0HA 1OFUA 5AJHA 4YYZA 5BXQC 1ZIYA 2BMEA 1NSFA 2CW5A 4UTVA 4EB6B 1QK4A 3S70A 4XIGS 4HSGA 5BW4A 3EF3A 3T54A 2JGDB 4LW8A 3V46A 2Y3IA 2ZITA 5JYEA 4ACBA 1RLUA 2H1OA 1Q12A 3K0HA 4DSKA 4BGEA 3C45A 2H57A 2YX1A 4HFNA 3QPBA 1Q0SA 3LTEA 3UXYA 3C16C 1GEGA 4OEHA 3NGDA 3DEIA 3AVXA 1JQLB 3WICA 2C2YA 4F2DA 3T9AA 3IELA 4OQXA 1ODJA 4N3CA 3GRVA 4M21A 5A02A 1V8OA 4B0OA 4NENB 1F3LA 5FCDA 3EVDA 4URUR 3GUUA 4ZOLB 1MOPA 4ZVSA 1H5NA 3GT7A 3MXOA 1W35A 4ZRDA 1IVSA 1U3TA 1NLYA 1EFDN 2FUNB 2Y9TA 3DONA 1QOZA 1YR8A 4NNOA 2CVHA 2QZPA 3TIFA 1BSVA 2VP6A 3THVA 2HBKA 3O5AA 3RAFC 4LCBA 5BPCA 4HGOA 3GDXA 3G6XA 3BS4A 1PZMA 3NVWA 3QW4B 3H8VA 4QPPA 3K1AA 4WH0A 4C08A 4CCYB 4KJZA 1NF2A 2I1WA 5D85A 3F3SA 4E1BA 2YYSA 3PSTA 3I1FA 2PH7A 3I42A 3GDGA 2IBTA 1M2VA 3AW8A 3L0IB 4BXOB 2XY7A 1ITZA 2FCRA 3B1JA 3O8CA 1RYYA 3O8QA 4PCVA 1D5WA 3L6CA 2R97A 5ALHA 3ZHRA 4GUDA 4UBNA 4P2GA 3SVTA 2DBRA 2C0QA 1V8ZA 2HTEA 3TTYA 2YDXA 1VOTA 4UVEA 4WLNA 3SQMA 5BN3A 4KQFA 2GXSA 3EXHB 2W93A 1UP4A 2Q4OA 3K2QA 2Z30A 3ROFA 1SG9A 4D9GA 2CCKA 3GJ3A 4BU1A 1BIFA 3DB1A 2DZDA 3NG1A 4QYSA 3JD4A 3GLTA 5BUQA 2HN9A 3U1VA 4O2AA 5CR9A 1Z5WA 2B2XA 2AOVA 4QBTA 1RPZA 1PWXA 2G80A 2UYYA 5FOVA 1PJBA 1KZ1A 3RTAA 1S0UA 4C8MA 4ZH4A 2W2LD 3TBKA 5L51A 1KAMA 2J6TA 2OBYA 1N2IA 2E8MA 1QP7A 2Z2IA 1XLTC 4PW0A 4TYYA 4RH1A 3GLUA 2J6CA 3GHHA 4PYMA 2QTLA 1HDYA 2WF6A 5GWXA 5EIBC 3H8WA 3BQ1A 2PR7A 1AKVA 3LUBA 2GH1A 2CHVA 2ZBQA 3VR1A 5DP2A 4ZT3A 3X1MA 4F9TA 2QQ0A 3CONA 4ZU1X 3MRVA 3EPGA 3RBZA 4A2PA 3WK8A 1OA0A 1X40A 3O4FA 1C1XB 3V1UA 5L4NA 3FWPA 4IRXA 1GZSA 3S5JA 1D8LA 4LJ4A 3TUIC 2ZJ4A 3R9XA 1XXLA 4BZXA 3EGOA 3ZDDA 1YULA 2JI8A 4KPUA 1ZXLA 1G0NA 3K72B 1SD2A 1ZAKA 4R2JA 1ZQVA 1OILA 1I01A 4PCUA 3B2QA 2FWRA 5CLQA 1EUDB 2GSWA 3BORA 4IS3A 4B48A 5JJ5A 1KEEA 1FTQA 1QH1B 4ZVMA 4RQTA 5KB3A 3QUCA 4MNTA 4RUKA 4DB4A 2QQEA 3RK0A 4J49A 3KLBA 3N2EA 2X8LA 4AWXA 5FR2A 4N3GA 3ROQA 1OGIA 4JHXA 1WKBA 3CRRA 4ZZ3A 3CX3A 1QOQB 4WZ6A 3NRBA 4JYBA 2NG1A 3KFLA 4EGFA 4QBHA 2IPAB 4G97A 5J0SA 4YR2A 2B4KA 4RPJA 1G20A 5GOTA 3TN7A 3ZTTA 4FBLA 5JROA 4KBFA 4HH1A 4MVJI 1ZN2A 3FUXA 4KE7A 3MNFA 4H1VA 3EH2A 1G6KA 2XY5A 4OCZA 3Q2KA 4KN6A 3TINA 1ZQ9A 3VI3B 1EYZA 5AI6A 2GKSA 2HCBA 4KLJA 1XYYA 4N65A 4H3KB 3EG5A 2XUZA 2HIMA 5KFUA 3JATA 1N75A 2WAXA 3WYGA 4U7HA 3Q1KA 4Q44A 3D3WA 3FBTA 4F9FA 5E7MA 4RIGA 3G1TA 5J2UF 1PL7A 3HJUA 4BAGA 1BTOA 2FR1A 2WP0A 2XADA 5KKNB 4BMOB 1R0SA 3T61A 4PXSA 1ULSA 4RDHA 1J09A 4B6SA 1WXQA 1QSGA 1L8LA 2PKYX 3OMLA 4FFRA 4QECA 7ICEA 1OU0A 4PSDA 4JGIA 4XDGA 5ALQA 3SEQA 3IALA 3WY9A 2AD1A 1NVVQ 1AU9A 3C3AA 4ERXA 1FFAA 1E2LA 1UKEA 5K3CA 3OX1A 4IZOA 3U1BA 4AUKA 3FZYA 3K09C 2R5WA 1B6GA 4RVDA 5H81A 1QSLA 3T5PA 5ADHA 2HF7A 3QFRA 3DPSA 2ZJ7A 5K3BA 4AO8A 3CZMA 1RBQA 4M8KA 5DHFA 4NCJA 1E2HA 4JXZA 4YMNA 4AP9A 5FYQA 3CNHA 2Y1WA 3F6EX 1IHUA 4BO8A 3JSAA 4P0PB 2C4MA 1CYDA 3RBDA 2OXEA 4GOOD 5L7TA 1VHTA 4FFBA 3TNDA 3TK1A 2MSDB 2W70A 1LXCA 3HJBA 5HZGA 3PIRA 1YB2A 4M7WA 3TYXA 1QMPA 1G9SA 1Q1AA 3Q85A 4BO7A 1KH2A 4MQLA 2X4IA 4FI3C 1ISSA 3M6UA 1YRYE 3MT7A 2HV9A 2DFNA 1TQDA 3GFPA 2IGBA 2YFQA 3SBOA 3KNZA 4YD2A 5DK4A 2HDOA 2VT7A 3FRIA 4JB0A 2WJ4A 1JDBC 2XQVA 2CXXA 3CEHA 2F3UA 1OFVA 5KOYA 2ZYRA 3HU2A 2UVRA 3RU9A 1L7QA 2CL5A 2X0DA 5A0FA 2QIPA 1NKTA 4DILA 1KO4A 1VLZA 3C7AA 1NJFA 1AQYA 1GL6A 3JWPA 2Z1NA 1H6BA 3FSGA 4A8TA 5BR8B 1A9RA 2C96A 3C7TA 4I3FA 4MQEA 2QX7A 4DYVA 4Q34A 3PFBA 4YFYA 4PE5B 4IIEA 4Y1FA 2C2RA 4M9QA 3QIAA 4P3OA 3A28A 2YJ4A 1K5DA 1DPGA 1T9GR 4OHYA 3GIKA 2DAPA 4Q4JB 1AT1A 1C3LA 5KSZA 1SCJA 2V3WA 3HB4X 3DAPA 5F52A 1PK3A 3ZLUA 1NBOA 6REQB 2I54A 3VU0A 2R18A 3ZU3A 4EM6A 1H1LB 4D9FA 1QOPB 5KFXA 2JI6A 3BXPA 5DNUA 4I81A 1Z4PX 3AF3A 2HHJA 5BRJA 2A3NA 4WZBA 2B82A 5IH7A 5EZSA 3CF4G 4FLMA 3C4JA 1SIOA 3B9QA 3K0BA 4X85A 1ULUA 2VWPA 2BCRA 1LBSA 2Y1EA 4DC9A 4I4TB 1RAHA 1G2OA 1TM2A 2ZU0C 5BOSA 3ZXUB 1Q6ZA 3MINB 3HVIA 3EFHA 3L8GA 4Q9AA 5DKWA 3Q3EA 3HM9A 5K3FA 4G1MB 4LXGA 3F47A 9ICPA 4UFPA 1X70A 4B2LA 2XRMA 2C88A 3SFVA 2ZIXB 2AKYA 5DLGA 4BLQA 3T34A 4UJ3A 1M6YA 5SYAA 2VJKA 2NVWA 5A2QA 3KUUA 2WSSD 2XMBA 1DBVO 2OV2A 4QAJA 3CR8A 4F86A 4YH1A 3U3ZA 4EITA 4RANA 4AXBA 1FXSA 2FGKA 4OSEA 4WJLA 2ASJA 4CR8A 4H3SA 3M81A 3K9QO 2ZT8A 2B34A 5DWDA 5K4HA 3K09A 1EFKA 2DETA 2LYHA 5FH9A 4F6RA 4BFTA 3VTAA 2JEFA 1ECLA 3MWKA 1SCIA 3D2SA 2ATIA 3TCKA 2PUJA 3K5PA 2VAXA 2CNBA 3EZ6A 4ECRA 5EFZA 1JKIA 4L28A 5KOJA 4QM7A 2UYCA 3ZBQA 1A5AB 1UT5A 2KJ5A 2Y0DA 3WYFA 4TVOA 1ZUWA 1I33A 5CGZA 3NHBA 4BP1A 2A57A 4RD0A 4EA6A 1A8UA 4XA5A 1AH2A 2AR0A 2J08A 3GRUA 3K9HA 3K30A 2AN3A 5D00A 1ONOA 2IP4A 3AHHA 1VBKA 3AOEA 4E11A 4OJOA 1KQGA 4YDHB 2E4WA 5HMMA 1C3VA 3Q7IA 3DMYA 4N5HX 3GLGA 1R00A 2XDWA 3IUJA 4HO1X 1V97A 1Q77A 2P9TA 1XFAA 4G9EA 2Q1WA 4F2PA 1G3MA 3B2NA 1XSNA 2K4MA 3DTVA 4ZYWA 1IPEA 3STTA 4MLCA 2CSXA 5FL7A 2H2IA 2K2QB 5I7RA 2O7RA 3FYUB 3CZCA 2BFFA 5IFLA 1L4YA 4CG1A 1TCBA 4UFNA 2WU8A 2X1HA 1AK1A 4UQOA 2ACVA 1K68A 3S55A 3UXPA 2HA0A 1E1CA 3B7GA 1H4TA 2NTEA 1FVFA 3OZWA 1WDKA 4QUEA 2YIDA 1IRIA 3DLCA 4LSMA 3BE5A 2BZFA 1BPBA 3X2EA 1JEJA 3X43A 1B3RA 1F48A 2ZCJA 3BQMB 2GEBA 3C7CB 1I32A 5ALFA 4MR9A 4WHMA 4N5IX 4S24A 2EYUA 3SP1A 4BRSA 2JIDA 2PIAA 1HYHA 1U1IA 2BM8A 2J3DA 4TS9A 3MWFA 2NXCA 3PW7A 5IEBA 4MKGA 4F9EA 4EKNB 3OT5A 3BKWA 3IDFA 5ESWA 1ECWA 3ASUA 2CHGA 4KJXA 4Q6BA 4YBZA 1H65A 2J0SA 2OD7A 5IVHA 2EFGA 4HY3A 4EI8A 3PUWA 5K8JB 1D8TA 2RAFA 1JLKA 3FFXA 3SF0A 3JTMA 3HJAA 5DG8A 4ZOCA 4YP1A 5DSTA 4JB8A 1LW6E 1NAIA 3NWOA 4L75A 4GR9A 4KZKA 2Y0PA 1W75A 5JOQA 1IHPA 4GXRA 2AZMA 3FCAA 4XLTA 5ILGA 4YPFA 3BH6A 2VSQA 3CLRC 1T6XA 4RGVA 2IEIA 3KSZO 3HK2A 3GGSA 2WJGA 1PT8A 2H4HA 2XBMA 1KK2A 2ACWA 1K63A 4C5BA 4KIGA 3HN2A 1YHYA 3P9ZA 3ENWA 5BWBA 3AJEA 3ONDA 3TG2A 3R3HA 1DAGA 2WT4A 3KAKA 3WSTA 5FWXB 1RWWA 3WGZA 1MHTA 2HJSA 2WQ7A 2GJSA 2W6ZA 1ZD2P 1KLNA 3D8TA 1Z16A 2X1VA 2FFJA 2C4VA 5DE3A 2OZKA 3D4NA 1SC9A 3RSFA 4QZAA 4H7HA 1G8YA 4IIFA 4GHWA 4CRXA 2WJVA 3Q8PB 1M6NA 4YP0A 4DCCA 1DG3A 1OX6A 1DZIA 1BVSA 1ADYA 1M2OA 4TWZA 1CUFA 1J9EA 2IXEA 5EJEA 1XZQA 7ICVA 2GBCA 3ZD8A 3SE7A 3TAXA 2J3EA 5DIZA 4ATNA 1ZK1A 4L0QA 4QZCA 4HGPA 4YT5A 1FTYA 4WZAE 2NZVG 4FQ5A 5DW0A 1XO1A 1E1NA 2OGTA 4DDUA 2QPAA 3JPSA 2B7LA 3AWIA 3L0SA 4Z4QA 5BT8A 4BWYA 3VYRB 3M6IA 2FWMX 3TO5A 1PJ2A 1NQVA 1GPAA 4QZEA 3WK5A 3ICOA 2H31A 4JWTA 4TUPA 3R7BA 3HZRA 4G1UC 1I2ZA 4M9CA 1S9FA 3JPOA 3HCCA 4W6QA 5HKAA 4H08A 4B2PA 1NNEA 3JQGA 3R9KA 1XQVA 1ZY2A 1ZQWA 8ICYA 1QLWA 3E9ZA 5EG5A 2OCDA 4EYKA 2W83A 3Q7QA 4WMLA 4XZ3A 1TKRA 4JL8A 1NXSA 1AF7A 1YACA 2W8LA 4RMIA 4R98A 1KS9A 4A8EA 3P2OA 4BGDA 5CXQA 5KHLB 1AK2A 2AVDA 3PXBA 4DIKA 2GAAA 4YRQA 4M6WA 3OOEA 1M54A 1NOIA 5DBHX 3IGFA 1RWBA 3AF0A 1W85A 1MAAA 4LRXA 1U0HC 2EQBA 3QG5A 3G1WA 4KH1A 3MGKA 2DUYA 4DJDC 2GN9A 4GQBA 4XVHA 2XUHA 4P08A 1OLOA 4L27A 4ZOQI 3HLYA 4GKAA 3A1SA 1WCYA 2C4WA 1Y9DA 1RI1A 3SM3A 2GPWA 2OXOA 4BUCA 1MABB 1GQ2A 2VYFA 4QOSA 5DHRA 5AO9A 3K9CA 4P84A 2FPMA 3RNLA 5AOAA 4BECA 3V8RA 2Q2VA 2EFHB 1ZVQA 3LE8A 2O8CA 1COWA 4DMRA 2Q4DA 2WVAA 2Y2UA 2JJYA 4WKCA 2FZCA 2DUNA 4TRNA 5A5EA 4AVYA 3ZPXA 3DGEC 1DC7A 2F9MA 3ICPA 5CCEA 3D4IA 1T2UA 1VB3A 3VKHA 1G0OA 5CXSA 4NBVA 1H0KA 1U4SA 3C8HA 4P3KA 2KG5A 2IT1A 5KQGA 1Y8RA 4DSUA 4ZQEA 3UMYA 2G5IB 3HMQA 3BIJA 4J4TA 1GD1O 3K0SA 6YASA 3RIGA 2DT8A 4UUQA 4NJEB 3O26A 2P6PA 2E3JA 2HVIA 1TV9A 3PWKA 5IILA 4C0HA 2OXCA 4U6SA 1QF6A 4R9SA 1JP7A 5C3UA 3D6NB 5FADA 4IC9A 5ENVA 4KFRA 1SHTX 1KGSA 2PZ8A 2GWSA 1OFUX 4M9LA 2LHTA 1AQIA 1G7SA 3TFOA 1N6OA 3F5QA 1U0NA 4YN3A 2ZM6B 4U7DA 3SN6A 1XZLA 4TXMA 1QQ5A 1MIOA 1CJKC 2E2WA 2ADOA 4E12A 2DERA 4HNGA 1ZXBA 2JLVA 5K0TA 2IHKA 4RT2A 2JBWA 1L7MA 5IZCA 4OX9Y 4LE0A 1XI2A 1D4AA 1Z25A 2RG7A 1R4NB 3DBIA 1W8IA 5DTQA 3WBBA 1DKRA 2BEJA 2J6SA 1K7CA 2WFZA 1WULS 1M1NB 2DFTA 2PEZA 4MO9A 3OU2A 1XTPA 1RQ2A 2W00A 7YASA 1M66A 1QIMA 3CPEA 3TTVA 3KALA 2VJPA 2IU4A 1ECCA 5KFFA 4EKYA 3P5SA 5BWCA 1EGMB 2IZ0A 4YCXA 2IHBA 4X00A 3LS2A 2YB1A 1ADGA 5IDVA 1BKSB 5CP2A 4PLPA 5JYDA 2VDRB 3QVGB 3UHJA 2OCGA 1HWYA 3BZWA 2V6GA 3Q3JB 3IUPA 4C3VA 4Y2VA 5EJ7A 1BG6A 4F1KA 2ILVA 4EHHA 4TVSA 2X15A 5H3HA 3A31A 1B74A 2NUAA 3EDMA 3KKOA 2G1KA 4BVJA 5ECWA 2J5RA 5EVJA 6ABPA 4J9LA 4IDEA 4O5AA 1FBNA 2B1JA 4J1SA 4ZT2A 3FR8A 3DV0B 4PLFA 3H1PA 5EGSA 4E15A 1LU9A 1UFQA 4RYDA 2BEKA 3DFIA 1NVGA 4RTRA 4PN3A 2VDJA 4P7BA 2GYWA 2OZLA 2FRXA 5E0OA 2QWXA 5KTKA 2VAMA 3BIOA 4EG0A 1EXMA 3JYLA 4GSLA 4BWGA 4G09A 2NU9B 1WXIA 5HUJA 2VPPA 2QUHA 3FVRA 4O3NA 3FF4A 3HKCB 2CNKA 1VHDA 4U6PA 3ZE9A 3CBQA 2P62A 1JAXA 3ORQA 3SZMA 3KLNA 4PR0A 2FMXA 1NVEA 4C6SA 1RM3A 1TF7A 4TRMA 1UMBB 3FWNA 3DHNA 3SR3A 3TE7A 4DFJA 4RA6B 4MVJF 3HL0A 1U0JA 2HWKA 3HCOA 5CXUA 3L8DA 3ROPA 2QN6A 3IPRA 5LOVF 2H1SA 5HR7A 3U4DA 1DHTA 1UXHA 5EIBD 3ZE6A 2AOUB 3BRWA 1KEVA 1RTKA 1FJHA 1ZQMA 2R47A 1KFSA 2P41A 2RJOA 2CF6A 3ANSA 2NX2A 3DFUA 3L7CA 4QEKA 3HX0A 3O75A 4JUDX 3QJGA 3EVCA 4N47A 3QFFA 3FPLA 4BB5A 1WXFA 4ZYYA 1K4MA 1VLVA 3H5IA 1DBSA 3OT1B 4WOCA 2QTCA 3Q7EA 3GJ8A 1KMHB 1R18A 3U44A 5CFZA 1KVTA 2VQSA 1POXA 3EFOA 2PJDA 5IIOA 2X22A 5BSKA 2ZUWA 5JAMA 4Z3OA 4QNRA 3JW8A 2BF4A 3QUAA 5F9MA 3FSGD 5FA5A 5JMOA 2Q7XA 5B2FA 3JD1A 5KYNA 3R5KA 1P39A 2Z43A 3GVXA 2AX3A 3ACDA 4EG6A 3W5CA 2CLKB 3MUOA 3UC5A 1O9GA 2I7CA 3CSDA 5KT4A 1T1IA 3WGUA 4OJLA 4KNVA 4ES6A 3OFVA 5H7XA 5F51A 5TT0A 3THYA 1GFSA 1MC1A 5LWQA 2QM8A 4JK1A 1YDMA 3ORYA 2EKZA 4EKDA 2SNIE 5CRXA 5JASA 4P4NA 1HXHA 1U1CA 5EKTA 2H2FA 2XMSA 4YQYA 2FLLA 3K92A 3WLPA 4IDBA 4QZ8A 4ZRMA 5AIBA 2CUTA 3I2HA 5IABA 1U7UA 3EHDA 3ESQA 4DLWA 5BVGA 1IG0A 1PK9A 4QT4A 4OFZA 2B5VA 3E9EA 2X6RA 4NONA 1LTQA 4GICA 4ED7A 4YMVA 3V32A 2QTVA 3MLAA 2I4IA 1RFGE 4IRKA 2RHFA 4YXFA 3L5KA 5B3AA 1OKKA 3A6KA 3L82B 1TD1A 3QHQA 3Q7SA 4F45A 2XCSB 4ECSA 1DI0A 4OMFG 3WWYA 3RLIA 2IXFA 2XXJA 5CD9A 1E69A 2QXUA 4UAZA 4Q66C 3I04A 3F5EA 3MJFA 1DKOA 4R69A 4AG5A 4NLGA 3N4MB 2FR0A 1T8EA 3WIVA 3TB4A 3WWZA 4GKJB 5A5VA 5L1JA 1YJ8A 1KC1A 1JBKA 4GVXA 2PWPA 3QYPA 4FKBA 3LBNA 5M7EA 5ADVA 1XAJA 1V8DA 4EJSB 1NKSA 3NJRA 2QD2A 3I72A 2L19A 2Z04A 3EEYA 5IANA 1UR5A 5AM3A 1JQ3A 3JQPA 1S0NA 2AN4A 1IUKA 5DSXA 1TYEB 4LOHA 1RHJA 1M83A 10MHA 4URWR 1JWAB 4BNDA 3JQBC 4WCFC 3KXDA 4PLGA 3THOA 3RO7A 4JC8A 1L4KA 3QU2A 1SWVA 5HF5A 2PUVA 4QRHA 4C14A 3C1YA 3G5MA 4EGCB 3IA2A 5A6SB 3OJCA 1OROA 3DMPA 1D5CA 2ZJZA 2I3ZA 1T91A 1Q22A 4DDHA 3G9TA 4COKA 4KGDA 5FA8A 2XCAA 1GTG1 3TAQA 2QN7A 4LGMA 3EODA 1LZKA 3KKMA 1LNQA 5DQGA 1L7NA 3DTVD 2MSCB 4S04A 5K0CA 3PX3A 5FL7D 1B7GO 4BTEA 1OWOA 1JDSA 1NU6A 1CFJA 1UKZA 3QUSA 2NYRA 4I5IA 1KL7A 5A3JA 3O8DA 5IFKA 4RHFA 3U3KA 4L5BA 3VU1A 4LBZA 1UBOS 5HF6A 3VU8A 2CDNA 3T8YA 2CZCA 1I3LA 1USIA 4GGPA 4C7OA 3IAHA 1Y1PA 1ZD4A 3ZZMA 4MR8A 3QXGA 4DN6A 3AHGA 4IXWA 2XTMA 1CV2A 1PYGA 1DV1A 2OB2A 4REQA 2ZCUA 3D0RA 1W93A 3TANA 3L8HA 4CUKA 1L4NA 1RBMA 3UZUA 3HKDA 5MF6A 2KN7A 4IFTA 1XDUA 4LC1A 1WY5A 3G0OA 4WACA 2YY7A 1YB1A 3RC2A 2G76A 4YMUA 4HT3B 2UZ4A 1BZYA 2OLJA 3KK0A 4Z0NA 5B2ZA 1BVYF 4RABA 4F4UA 3GCDA 3NWJA 1D07A 2F8SA 4FZRA 1N8NA 2NTNA 5H9VA 2VPZA 1H1DA 3T79A 1EK6A 2HFJA 4TYNA 4UPEA 1AQUA 2MTBA 2PUEA 4YC7A 4ALLA 4RCYA 4O0MA 2ZDQA 4F8RA 3I2JA 1JIVA 2ZSIA 2V9PA 1F0NA 3CRQA 3H5OA 4IYJA 1CUYA 1TW2A 2Q2OA 2QDXA 1HI9A 2O2EA 3K1ZA 3RF6A 1QVAA 4C7XA 1P29A 3PSIA 3FPKA 5A4FS 2XZLA 4AU1A 3C0KA 2RK4A 3KV1A 5H59A 3AP2A 3GRKA 3TIIA 4N5NA 4JXXA 1SRRA 2FZGA 4C4RA 1HYQA 4Y18A 1KJQA 3U39A 2CFRA 3S2FA 3GGCA 3FNFA 3M49A 3HCDA 2YIVX 4TWRA 4HS4A 4YIKA 5ICGA 2HU2A 1IM4A 2QW0X 2RKBA 4F4IA 3OPXA 2EEZA 5LBTA 1AA6A 1OPRA 1P2TA 2BKAA 1SBNE 2AHOA 3HTXA 1E3DA 1LVUA 2TMKA 1SL0A 3BD6A 1Y3IA 3IP8A 3F4KA 2OTCA 3S44A 4H6WA 3KUXA 4EHDA 1NBEA 1QC5B 3JQBA 3LLCA 4WCFA 1K6EA 4E1VA 5EE1A 3BDVA 3OZUA 2WIKA 3A9SA 1P2UA 1M2HA 2XWBF 1A98A 1XB2A 5AUQA 5H4HA 2XXAA 1FNCA 1I1QB 1QWOA 3VPFA 4DQSA 5J0TA 4Q24A 4RZUA 3DOOA 3JYOA 1Z00A 2XMCA 3I6YA 5EPOA 3SICE 4LG1A 2W9CA 4QWBA 1FP4B 2WUFA 4DCVA 1JF8A 1TU3A 1XSEA 1X13A 4I4CA 2C2GA 2H1VA 2WSSA 1P2DA 2R1TA 4K9MA 5KYXA 1EUZA 4MDHA 4JLOA 1UK7A 2KPOA 4ZC1A 1W29A 1OE0A 1K8QA 2HHUA 4D9NA 1LDEA 5F7JA 2XT6A 4R41A 5DM0A 1UKYA 1E3LA 1EAMA 4OJMX 1JQDA 1IEXA 5IHPA 3UK0A 4DSAA 3ABIA 3C2MA 2GA9A 1E61A 1A0OA 5K4LA 4A0SA 4FTWA 3IULA 3WBFA 3DM5A 5IW8A 2KLBA 1EVLA 1OASA 3FIJA 3Q5DA 3W9BA 4KKXB 1MR3F 1JHXA 1JU4A 2NUBA 4F11A 2HPHA 5IJ0B 3WYEA 3EZ7A 3BB4A 1GUDA 1XCJA 4BQRA 1J24A 2X2EA 3HCBA 7ICUA 4OTZA 5JNUA 2W6QA 4I2AA 3B9PA 3DO6A 5E7QA 4RQ5A 3DHEA 2ID7A 2ZT5A 4MS3A 4NDNE 4A82A 1DQSA 2BPGA 2D0DA 2QUAA 3TG8A 5BURA 2FUG1 4R2LA 2P5YA 4OGWA 3UT5A 4CU2A 3UO8B 2FN3A 2OB1A 3FCOA 4LC9A 3DVAA 2FEKA 5BVHA 4FNGA 3T5CA 4WDRA 2EVWX 2QMEA 2R8OA 3L3BA 2JCSA 5HMLA 5JCOC 4K87A 1CRXA 4DGSA 1COWD 2ICAA 4PXAA 1OGYA 4GSKA 2BDPA 5E2IA 4D9JA 3ADCA 5DBAA 2FWAA 3URKA 1ZD8A 1S1MA 5FFFA 2FRDC 3UM9A 4J7CA 1Y5MA 1QFSA 1U8YA 3T7CA 1H3NA 3B3FA 3NBXX 5AVXA 1Z1VA 2YWBA 3FHJA 5K8UA 3U4QA 4TN1A 2PZBA 5FLYA 3CLRD 3A3YA 4UHKA 4PQRA 5EP1A 3SC3A 4C0KA 4WVLA 4HWSA 2GJKA 3OAAA 2AJCA 2GPTA 4WESB 3QI2A 3EUB2 2I03A 3GP3A 4IDAA 5IYZB 3H05A 2CHFA 2PLWA 2PDAA 4WNAA 3VC1A 4WW0A 2ONZA 5TARA 5F1KA 5A7FA 3RV3A 1HLDA 4F7DA 3CGWA 1ZEJA 4MO2A 2FEAA 1NW4A 4D4JA 1QIEA 4RY2A 2AS0A 3GJ7A 3ZCSA 1X1AA 2RQ5A 1X7DA 1PQ4A 4LK3A 2F7SA 4C05A 3WQBA 1N0VC 5CDFA 1EFHA 3LRPA 3ZV4A 3GVCA 4B9NA 3GDWA 1MPXA 1Z6YA 3HL4A 1JSCA 3B3QA 4RJTA 2YHBA 4DMKA 5G4KA 4QGAA 4R8LA 4QVGA 4UBKA 5TEVA 1JDZA 4TN5A 1X1CA 3EUEA 3JASB 4I9GA 2QE7D 4LOIA 3UENA 4ROTA 3R77A 4E5SA 4KIJA 3EPKA 2N47A 3EZFA 3K5HA 3SQWA 1G3QA 4RY8A 3RTDA 2PWBA 4TKZA 5IZ4A 3KKKA 4QUJA 3KLPX 4HDCA 2ZI9A 3W7AA 1RM6C 2J67A 3O9ZA 4V03A 3DC7A 4OYLA 3WMWA 3RGWS 4MJLA 3LCCA 1TVAA 5DISB 3LA6A 2RH4A 4MHVA 3GELA 4IZIA 3CJTA 1RC8A 4N3BA 3TI0A 4K8RB 2E5LB 4Z2AA 3B9RA 4AROA 2F8KA 2QORA 3RASA 4G0YA 3KR9A 4FFNA 3U5ZB 1QYRA 3E0QA 3I2IA 2IHNA 3EF0A 4QPZA 1EDOA 2HBQA 4DJJA 9ICQA 2HBJA 1MENA 6CHYA 4F56A 4PQFA 1NK0A 1IZZA 2WKSA 3LY7A 1ZOIA 3JPWA 4TV9B 4Q4AB 1OTHA 1VLMA 4Z0TA 3QTBA 2B2CA 4U9HS 1AC5A 2FQXA 4GH5A 2LKYA 3CW8X 5EIXA 2J8ZA 4LKRA 3TQTA 3H1AA 3W4IA 2F3PA 2ZLBA 4ER7A 4DLNA 4DV2B 5AKEA 1U65A 3C15C 1VLBA 2FYTA 2VXOA 2CRXA 3GUYA 2BZ0A 3GRYA 3LQFA 2P5SA 1G8FA 5E7IA 3UOGA 4MIOA 4HAVA 2EBHX 1NC3A 4L7VA 4IGFA 5AM2A 1YZUA 4CL3A 3SZOA 3W34A 3KSRA 3BCUA 4J3JA 1XZ8A 1UPFA 1K1QA 5JCOA 1RFLA 4RGQA 1A5ZA 5TQVA 5I9IA 5B1IA 1L7OA 3IUBA 2QG9A 1MVNA 4P7FA 3HO1A 3GLRA 3K05A 3R3WA 3GHYA 2VNIA 2PRSA 4Y9SA 3NOOA 5C5DA 4AJ9A 1NATA 1BMQA 1JZTA 4J16A 1XL0A 4Q9IA 4GI1A 4UAUA 4PL1A 3WGJA 3F6YA 3UMRA 3T99A 4MMYB 4R1QA 3ZJ4A 4RULA 1GOTA 1NJGA 1SN7A 4ZKDA 1KQNA 2WWRA 3V97A 2QD1A 3BRWD 5LQRA 1KI1A 5ALSA 2BFBA 5G5GA 1QNFA 1PR9A 3N39C 1LC3A 3DYIA 1FCJA 4QDUA 4P4OA 5KQSA 5KFKA 3GN2A 2IYEA 2NVUB 3GT0A 2HTFA 3THWB 3SJUA 5AOVA 4ZYTA 4FBGA 4PX9A 4DWOA 4KMUA 3C23A 2VTBA 4B6GA 1VG8A 3H0LB 1F7VA 3E8MA 2PMZF 5FNVA 3MC1A 2R2AA 2C78A 2QLTA 4QOFA 4MAMA 1U2GC 3ZHBA 2ZYTX 2AEFA 3H2IA 4RNDB 4G07A 3PGVA 5EKXA 2A0XA 3H40A 1N2HA 3KKEA 4RPGA 2O05A 3V72A 4KX5A 1W1IA 4LDRA 2IXGA 2O54A 3G2OA 5ILOA 3VDRA 3N6RA 3G6KA 2SECE 2UZ1A 4CDGA 4JQYA 1XBTA 4KAFA 1JGTA 1CJTC 4ZO8A 1LSOA 2D8AA 4RPHA 3HB9A 1L3VA 2DH6A 4YCCA 1ZGJA 1W46A 3I0ZA 2DWQA 4FW9A 2GCOB 4EG8A 4GPEA 3TEMA 1KAQA 4US8A 4EBCA 4DL9A 3WP0A 2VCHA 3SXJA 2I5HA 2JMGA 4RZ3A 2QA5A 2G5CA 4CN9A 4HAIA 3PVXA 5AVRA 4DCOA 2D5CA 9ICGA 4BNJA 4A36A 2A6PA 4I4TF 5E6UA 3WWEA 4UB5A 2D1RA 4NHEA 2E85A 1WUDA 4ZVNA 1RKVA 1U2QA 2QZJA 5B3JC 3CVXA 1SC6A 3D1LA 4QJIA 4Z6EA 5TQ2A 4QO7A 1JQEA 4IIDA 1X77A 4I36A 4XE5A 2IP1A 3WIOA 1GNPA 4B75A 4GZ5A 1DOQA 3RR2A 4H15A 3RV4A 1LZLA 3NFRA 1SKYE 3BE4A 1OKKD 5DHQA 3V1KA 2ZWAA 3TR6A 4J76A 2ZBDA 3RWBA 4XIFA 2RI6A 2PA0A 2QMOA 4LJLA 1YZKA 4NY1A 3U4IA 4Q7KA 5JZBA 2I3AA 1U9JA 1SXHA 5JZ9A 3L46A 5BWLA 2OBLA 4MR7B 2JFQA 1DDGA 2EWMA 1CK4A 4ECWA 2AR7A 1T7PA 3V1NA 4EF5A 4DL7A 1PJLA 1T9ZA 1FFHA 5LQDA 1EWYA 1O2DA 1IY8A 2JD2A 4L50A 2CV1A 1LJLA 3AIMA 1NE2A 1GZ3A 5JO0A 2ZT6A 2QYSA 2G9RA 1W52X 5MN4A 1S77D 2FDXA 4ZEOA 5JARA 1KQPA 4FDMA 4CDRA 2BMWA 3D9QX 1K97A 2YVAA 5M29A 1IDN1 1X1QA 4GI5A 4C04A 5T8KC 4ENVA 4MVJG 1XEXA 4WUVA 2X5KO 1RJ9B 4LDZA 2XKAA 3NUQA 5F77A 3U49A 1OLXA 2HA3A 1TYDE 2F3RA 4XCXA 1JPJA 3ZKWA 1Y1KE 4WGGA 1MDBA 3K9NA 3N2GB 1NE7A 2C5LA 4BASA 2Q9CA 1QPGA 4A26A 1TC2A 5AVTA 4WNIA 3H7IA 3LZDA 4K81B 1L4LA 4QELA 4OQPA 5AVQA 1Y80A 4LA4A 1WLSA 1B14A 1ZVMA 4W8OA 4FWBA 4MI1A 2CJFA 3MQ4A 3L02A 5IBPA 4UREA 4IJQA 1SK9A 1ZCBA 3TTWA 3PGJA 4AMVA 2JEZA 4JJ7A 5TNXA 5GV7A 1U9ZA 4I2IA 1J8VA 4MUNA 3FAHA 3E5NA 3MCZA 3LKDA 1RQRA 1J2EA 2OHFA 5B7GA 4KLUA 3P9PA 1U2GA 4RACA 3SIXA 2HPZA 2FFQA 3ST7A 2QAIA 1VFNA 1FXWF 1IATA 3WWCA 3IOMA 3OOYA 5INTA 2O1EA 2D0PB 1WU8A 1TB4A 3QY9A 1JJVA 2F17A 3C3EA 1X1BA 4YAUA 3IAS1 1Q1ZA 2Z58A 4IMRA 3QPVA 1JI7A 1XIVA 1Z7BA 4IDOA 1QYCA 5EWJB 5AM5A 1HUZA 5KZMB 3RIEA 1KJ9A 2JLRA 3F2VA 1XLTA 1PJCA 4DRYA 4NOMA 4D74A 4B3BA 2W55A 1UDBA 3IT1A 1A88A 2I76A 1VJ5A 3I61A 1E58A 1S0MA 3GEBA 5FBKA 2E1RA 3VKGA 3G85A 2F3NA 3WHKA 4JI6B 1C4KA 3CB2A 2VLIA 5B3JA 1BJRE 2XTJA 3HJRA 1ECPA 4DJAA 1FIQA 1WHSA 3GCGA 4OKNA 3WBJA 4J6EA 4DMLA 1ID8A 3IEXA 3IKLA 3NANA 1ZQBA 4S3MA 3PP8A 1CS4C 3WKDA 2AK2A 2C0PA 4RLHA 1PGOA 3AX6A 5A3RA 3FKSA 3QENA 1Z15A 3NMUF 1IWPB 4C4PA 4M7OA 2P6NA 3NJ8A 3C41J 1E9EA 2OL4A 3LOPA 2ZTSA 3L7YA 4IOMA 4ZVRA 3OIFA 4U7FA 4AN0A 2B78A 3TZ6A 4IIVA 2LZ0A 4BGIA 5C46F 1L3CA 3KCNA 3PITA 3OCWA 8MHTA 2J9XB 1Z07A 2R7MA 3C1ZA 1XDDA 3VU3A 3OVMA 5BP7A 4QRDA 1TU4A 8ICVA 4BKUA 3KQSA 4U9UA 2JFPA 2XRYA 4LDJA 1GJRA 1CDEA 1A8QA 3R8XA 4MCAA 2D1FA 1JWBB 1WX1A 3MWDB 3ZH9B 1B22A 5AVZA 4H9GA 1QONA 2GEJA 2EQYA 1DXHA 4O3PA 4ZDIA 4J9MA 2FJ6A 2ATXA 3D7RA 3N8DA 2IHYA 1BCRA 4DR4B 2VT6A 1VBFA 4CM3A 1AA9A 5T8KA 4YRMA 1QKJA 4X63A 1TKCA 4QJ3A 2ETVA 3AQIA 2C04A 2I62A 3GCZA 2VF4X 3CLUC 2EHDA 2A67A 4CEIB 4YDSA 4QNMA 2YB4A 4GPZA 3FY4A 5J5VA 1TIKA 1UAYA 3EIOA 1D1QA 4QGGA 2ONCA 3EAGA 4C22A 1G98A 4ZI5A 1MRSA 1X0VA 3AKCA 2NO5A 4G0UA 3U6BA 3VNBA 5H0IA 4LOKA 2FXIA 1G4AE 4OU4A 1CQPA 1YMQA 4IS2A 2C97A 1T9KA 1XR3A 3DE5X 2D59A 2KX7A 1KAEA 2P1DA 1WA5A 4OA5A 3FZEA 2EDCA 1RZUA 4B9VA 3IT0A 3W4KA 1A9XA 1YV9A 1US8B 4DV5B 3UMBA 4ZD6A 1LRLA 2Q6IA 4YJFA 1Z62A 4PRZA 3LUAA 4K2HA 3TQRA 3IPLA 3I5MA 4UBCA 4DIOA 1PFUA 5DP1A 5JT1A 4KR7A 2A9KA 4DV6B 2Y0BA 4C7BA 3CRVA 1LSJA 1NONA 4MGYR 3P2IA 3R7LA 3P2MA 3GA5A 1E62A 4LBWA 1C1DA 1V6CA 4BV8A 3UK2A 1H93A 2CV2A 5LYJF 2VS1A 2WFLA 4BRWA 2BI4A 3KOOA 2OHJA 1Q0QA 4O1HA 2QPOA 2J9FA 1YS1X 5DM60 4BQFA 3PD1A 5EHQA 3PX4A 1SVOA 2HIHA 2PGLA 2FMSA 3CXRA 1TU0A 1KDOA 2DGZA 1HEYA 3KU4A 1IIBA 1CE8B 4GECA 3QTLA 3D3NA 3PNLA 5KPJA 4KLAA 3M4JA 5GONF 2WB1C 1KNQA 2REBA 3LVQE 2YJ3A 3TXXA 1I1OA 3D8SA 4G0OA 1PLLA 121PA 2AZTA 1E60A 3B1VA 1FB5A 2ADMA 2FHPA 3PDWA 1ACLA 3QVWA 1BOFA 3ROGA 5CB1A 1BWSA 4OHZA 3MN1A 4EHAA 1HEKA 3SAHA 3GT3A 4IGEA 3VSBA 1G21B 2OQ2A 1ZOSA 3VYSB 1FFEA 4JUFA 4NEQA 1ZCZA 4B6EA 4LVSA 4OYRA 4QYTA 3W8NA 3OAAD 5FNZA 1IZ7A 3O94A 3CIFA 1YUBA 2GXAA 1YOVB 4MUGA 2R79A 3PA8A 2QX4A 1X39A 4GL2A 2VWGA 3H8SA 3WDSA 4W5NA 2PRJA 1N8SA 2YH2A 3DR5A 4FGKA 4L4UA 3PXCX 5BSHA 4O2BB 4E3WA 3E58A 2EKLA 3A9RA 2ZYGA 3ZGVA 1XCOA 1P0QA 4EVQA 1E8NA 1Z4JA 1VJCA 2OECA 3MAGA 4DBZA 1N5RA 2QUJA 5DG9A 5LNK1 3PQEA 4LBYA 1XLVA 1R8SA 1GGHA 1CDDA 2CMKA 3QLTA 2QRVA 3SHTA 1MUUA 2VHCA 3TR0A 1L5MA 4DPMA 4TYWA 1SD1A 4KFTA 3PHCA 3G68A 3ZHTA 1XD9A 2XDQA 4DQKA 4KOEC 4MHOA 1RQGA 5JAHA 4X44A 2Y93A 3DBOB 3IE0A 2TRSB 3GLFB 2XUPA 2JV3A 5J0QA 1NG9A 3WNDA 3DDSA 3T1NA 4JN6B 4N40A 3VJKA 4TLAA 2VKTA 3H2BA 3FYCA 1JRPA 1KZGB 4ZHQA 4CL0A 1OC4A 3FTEA 4BO9A 3EBOA 2ZSAA 5F33A 4RD2A 3I6IA 2YXEA 4MPTA 4XQEA 1EH5A 4ZMBA 1QX4A 2C9YA 1J22A 1JAIA 4M1KA 3B48A 3E6AA 3JWJA 5L4LA 3TQ1A 4U2FA 4QBIA 3LCVB 3QU5A 2FH5B 3BTOA 5M3BA 2ZCVA 3WLKX 1WSBA 3E5RA 2BISA 3SBXA 3GJYA 3GH1A 5GV8A 4RT3A 4N41A 4ZWNA 3HA3A 2G88A 1NR7A 1J97A 2ZTVA 1NI4B 1ZGCA 2IWHA 1KMIY 2VHVA 4LRSB 3QEKA 1GNQA 2V7BA 3EAFA 1XU7A 5I4KA 2AXQA 4D0SA 4MRMA 4J9NA 4CGZA 1M2JA 3NU1A 4KUGA 4N1AA 3BQ0A 4X97A 2PRZA 5LU8A 2NTJA 2Z1MA 3EG9A 2ODBA 5JAQA 3L4EA 4UEQA 3TZCA 4U1RA 1U9YA 2FLWA 1FUIA 2G63A 2FSGA 4HZUA 3L1VA 5JCXA 4YI3A 5H1YA 2AE1A 3B8EA 1RHMA 3V6MA 1PV2A 5LSAA 2OYRA 1Q0HA 3AF6A 4JP3A 1QH0A 1A7UA 1D6JA 3CH7A 4JJGA 3G89A 3Q8WA 4CM1A 4IH1A 5F64A 1X2BA 2C00A 1BMTA 4FBTA 3RIYA 3P8ZA 8ICCA 3MQFA 4JL6A 3V8MA 3DF9A 3HKBA 2IS4A 4UXJA 4RJJA 3IG5A 2AUTA 2V65A 3D81A 3ZDAA 3LLVA 2VRWA 5L1KA 3OQJA 1DBIA 2JZOA 1LPMA 1IUOA 3MGGA 1V5WA 2BHRA 5FUQA 5JAPA 4BZPA 3QWAA 4YBRA 3KZNA 4U3JA 3EULA 3LQRA 1OZHA 3EWIA 1WDLA 5EWEA 1ORRA 3PEFA 4XW2A 2N0SA 2H1LA 3I5UA 3DE4X 4BWMA 5JE8A 2HX1A 3BMCA 3LRXA 4WFJA 1SXJB 1LK0A 2Z7JA 4YWJA 5ITZB 3Q9UA 3C1TA 2ZDHA 3ABSB 5BMVF 2OPHA 2Y9MB 2GRAA 5LZ2A 3PJFA 2X8JB 4CKBB 4AJ4A 3V7NA 4EA9A 4C5AA 4U00A 4EY4A 5KFOA 4TLBA 3LXUX 4GMGA 3HVHA 1X6IA 4KW7A 3ON5A 4O4JA 4V3BA 1R4AA 5HX7A 4HGQA 2DR0A 4YMIA 1ISPA 5BYKA 1Z6PA 4QASA 4DV1B 2O8BB 3T3EA 1A4IA 2HNAA 1Z3EB 3EGWA 5KTQA 4ZZ2A 2AQHA 2Z2JA 4KK4A 3PR2B 4S1WA 4TUQA 4X95A 3B85A 4EZEA 2EZTA 3R5XA 4B3IA 3PFGA 1JEQA 3NDJA 3PO5A 3WV5A 2Z5FA 2P4EA 5TGDA 5DLPA 1L8OA 1L0BA 2QI9F 1RRKA 3S28A 1TUEA 3BL6A 3RYCA 4ZYVA 1NXTA 4ZI3A 1M1YB 3G7SA 1DRWA 3I37X 4PZZA 3O3NB 4MWOA 2OT3B 4URZR 4R9RA 1DGJA 3C4QA 4CKCB 3CX8A 2PT6A 2HW8A 2KJ9A 3GVHA 3BCRA 1NSYA 4L85A 3LBAA 1G6Q1 2I9GA 1G6OA 1M6VB 4WI1A 1ZAYA 1E77A 2CBZA 3TCNA 3W5HA 4N9WA 2BD0A 4B5KA 4DOCA 1S2NA 4Y6PA 1WHTB 3TRIA 3NYQA 1TDJA 1RYEA 2EH9A 4MV1A 4HDQB 1IK6A 1ZIPA 1Q3VA 4UBMA 1Z13A 4PONA 1F12A 4DBLE 1A8PA 2XA2A 1T2VA 2QE7A 5CG2A 2IYZA 3V7FA 3OJXA 2JF0A 2R8PA 2CMGA 3AU2A 5LKAA 3LQ2A 5EMLA 2RHDA 1X87A 4L73A 2X9NA 1IOZA 4NV1A 1BPDA 1V4BA 5FFMA 1CJCA 3VJRA 4DEYA 1X6JA 1XHLA 4WXRA 3TZQA 2J6IA 1P4HA 3ILXA 4TKVA 3D54D 2BM1A 1YUMA 1ZM2A 4QFCA 2XOXA 3F2BA 4S2UA 3JCZA 4Q93A 4FIZA 1DWUA 4FMCB 4C4OA 5BNTA 9ATCA 3MOSA 4YI5A 1FQOA 3BC1A 3WU2U 4YO7A 1M67A 4FYXA 4F4ZA 1P9LA 3SSMA 3EPHA 4MYDA 4KQGA 5DQHA 3DT9A 4HDRB 3EOAI 3F7MA 3FGNA 3FPHA 3ICCA 4IHJA 3U7IA 2KSOA 3PB3A 4U2GA 4Y6GB 2OAGA 2Q2NA 1QHFA 2AEMA 2PUWA 1EINA 3WL6A 1EGVB 2ZIVA 2ZWMA 5AK5A 3TQIA 4ZVKA 3LO8A 5IUKC 4OXIA 4DMGA 5EQJB 3U0VA 3PZRA 4LMAA 5H83A 4UAWA 2VJCA 2XKBA 1GL3A 1TZJA 3L7DA 4X1YB 4XJXA 2YIMA 1X92A 2FE9A 4WFIA 3AB8A 4MGZR 4AKIA 4BPBA 4XA8A 2WU1A 1PD1A 3DT8A 1DGSA 5J2IA 1IV8A 5EVCA 4J0FA 2NYUA 4IW3B 1ZP6A 1RWQA 1FFXA 4BVLA 5SZHB 5IDYA 4I2JA 3E48A 5HQJA 2DRIA 3ABOB 2QSUA 3FUWA 3INTA 4KAAA 3UUEA 3EASA 3TVDA 5CG1A 1H22A 4CCAA 1Z83A 4ND5A 2FUCA 4YRDA 3TARA 4GBGA 2ILTA 3ONWA 4G8JA 2A58A 1OSNA 3CTMA 1JA9A 1SCKA 1YQUA 2NV3A 4GU5A 3E1GA 4MRAA 1BD4A 3RSZA 1E5DA 2WOJA 4CQMA 2H65A 3N8NA 3DMRA 1R7RA 1HGXA 4G4GA 4M0KA 1J56A 3NVAA 2RHHA 5BRAA 3MERA 4KXNA 5G0SA 3C2KA 2PYZA 3O84A 1QF7A 4R0VA 4R31A 4TMKA 5GMOA 1UXKA 4UMEA 4IPTA 3W4JA 1OBFO 1UWCA 4BBPA 1L6RA 2DFVA 4PZOA 1OZFA 1N3YA 3N9IA 2LDBA 3P5BA 2WE8A 3NALA 1A2BA 1VLJA 4O3FA 3KETA 2KM1A 1UBCA 4R05A 4F3CA 3NYWA 1AGRA 4PO8A 1CS0A 4IIJF 1CETA 1AOXA 2WA1A 3W7VA 3TX6A 3O91A 4LVCA 4RXUA 3ZWOA 5IINA 3FKSD 3AEZA 1ZCAA 5C5CA 3UAZA 4EK9A 2CNWA 1NUUA 4CQNA 5CLIA 4FCWA 1PZXA 4HRVA 2Z8YM 4P5EA 1U3WA 3EYAA 1Y9JA 3E22B 2B2NA 4X45A 3CCBA 3E8XA 2XZPA 1OXJA 4RD4A 2CLIB 5HM8A 1SBTA 1TVMA 1UADA 4PX5A 3T9FA 4IKOA 4OM7A 4FFLA 3ZQ6A 3E5HA 2OMEA 4FINA 3RT1A 3GMTA 1SKAA 3Q9NA 3X2FA 1ZQHA 4PFSA 5ALIA 1PTKA 5AKKA 3I0MA 4JUZA 3EC2A 3QE2A 3WHIA 3WXMA 2ZRCA 3H75A 1SVKA 1DC4A 4LZAA 1CQJB 1I1NA 1ACJA 1DAEA 1E18A 4GQIA 2FX3A 2OXIA 5CH8A 2ZRJA 3WAGA 2CFTA 3PI6A 3Q12A 2XA1A 4RZIA 1P3Y1 1P1RA 1FFYA 1JHRA 1ORHA 3CQ9A 4B84A 4QDJA 1RI4A 1ZYUA 2V96A 1BDBA 3RE1A 1BS9A 3OU7A 2IYQA 3WRXC 3SSNA 1U1GA 7ICJA 1SD5A 2RGYA 3IHWA 5HFJA 4PQEA 5H80A 3M1YA 4DZZA 3WB1A 2VBFA 2Q5JA 1FTSA 4EHKA 5DM4A 3KHTA 1DTWA 2HEIA 2PTHA 4BNNA 4EKEA 4J07A 2GB4A 2Z3WA 3I23A 1IN7A 5JCJA 4TLMB 3RS4A 4AURA 1AF4A 1IY0A 2VNSA 1VZ3A 5B1EA 3K73O 4POOA 4PYOA 2BTQB 4RH3A 4LZWA 5A1TA 4Q7EA 2B0CA 8ATCA 3VNQA 5D5PA 4F0JA 1GG2A 1S3GA 4D9CA 2CDBA 4TTRA 1YFKA 3D5TA 1MGOA 2Q21A 4YV0A 4OBEA 3GJRA 4AKSA 7MHTA 1MAUA 1H05A 1ZU4A 2FZ5A 3GIIA 3G5TA 3T5HA 4DCMA 3TECE 4Q4CA 1YZGA 1CIPA 2UKDA 3NHLA 3NKLA 1QCDA 1TUBA 3ZDQA 4FZLA 1D2RA 1HZJA 4YG2A 2C5SA 4W5JA 3VTKA 1RNLA 3VNAA 3HV0A 4ETMA 3PSPA 3U3XA 2WPNA 2XNJA 3QVMA 2IYYA 1EHCA 1U0TA 2WYVA 3FJYA 1Y8QA 3VKVA 2XZDA 3ZV5A 4WOKA 1N1GA 3GFOA 4ENTA 3COSA 1PL6A 1SFRA 2WSYB 4B17A 1OXVA 3EK2A 3BCSA 3A06A 4G0VA 3PI7A 3H6HA 2FMFA 4F92B 1ZJ5A 3NHRA 4DV3B 1GT6A 3RYIA 5K3DA 4DS5A 1HE5A 2XQFA 2BPOA 3RIHA 3FUTA 2QP3A 1JX4A 1E2PA 1U7XA 1OHHA 5KG5A 5ICMA 1RM0A 3VAZA 2OKCA 3M6LA 4PZUA 3UWPA 2YXBA 3PD0A 4XVUA 5AW4A 4E0BA 1ZETA 4TOIA 1FC0A 4LGCA 5GJBA 5L8VA 3KM0A 5M5BA 4JUBA 5ENZA 4TQAA 2IIQA 4ECVA 4PFJA 4B7XA 3SLRA 3STWA 1E2GA 4DLYA 1PNQA 1DS6A 3UB2A 3UBMA 1JHDA 4N39A 3TXAA 5ISMA 3GQBA 1IBMB 1QR6A 1WTCA 2H4XA 3T41A 4FWIB 3VSDA 4O0IA 2W9XA 5DK6A 1NBHA 4M38A 2ZJ8A 3KSDO 3DMFA 1LPSA 2D1SA 1TGVA 4BKOA 1C3EA 2I65A 3TH5A 3AUFA 5C80A 2ZUFA 2REXB 1KTIA 1GXSB 1HL3A 1IHXA 2WNIA 1BPEA 1WLYA 3CLUD 4RQ4A 2ASEA 3OX3A 5H82A 3ADKA 2DKFA 1BCSA 3BSWA 4FT4A 4ZMRA 3BRSA 2ZYIA 4GPAA 5JO9A 3NTLA 2W4QA 5CFLA 5M34A 3V33A 2HM7A 2EV9A 3WRXA 2PI4A 1FDSA 2QT0A 2WM2A 2C7QA 3P7MA 4OHOA 3JR7A 5T4FA 2WIFA 1ZMOA 2AG1A 4R1SA 2VI5A 2C9OA 2V0NA 5EYPA 2MCFA 2DULA 2ANCA 2C8VA 3T06B 2GZ3A 2PVSA 2C7GA 1S2LA 3TOXA 3GB9A 3EVTA 3W5SA 1L5YA 5D3KA 3P97A 1KJWA 1EX1A 1C5KA 1NVKA 3DDOA 2R4TA 2AOXA 1YRHA 3T7JA 3RC1A 3ZDEA 1DX6A 3KJIA 4BX0A 3ZJUA 4KE6A 2GTHA 1N6KA 1TT5A 2VEOA 2WD7B 1E1QA 3FROA 1JN3A 3TADC 3RPEA 4LGYA 2CPRA 4M1EA 1IG3A 1IONA 2X0KA 3Q6IA 1B8NA 4HXFB 5JXGA 1G17A 2OFOA 4QUDA 2VDUE 4NBKA 1JKXA 2PGIA 2AC7A 3FNHA 5EE0A 3C7DB 1KJ8A 2PCLA 3RAQA 2BFNA 3EMVA 3F5FA 1Z8HA 4CQLA 2GN2A 2CJXA 1DIRA 5BN5A 3ABRB 3DE6X 4CIDA 3QVXA 1MTZA 4KPFC 2JJ1A 3T9BA 2UYGA 3QF4B 4FMBB 3MHTA 1NL3A 4TLEA 2QTTA 4ZOLF 4RZHA 4H6PA 2BSXA 1CUUA 4RQ7A 1DJOA 3UMCA 1I7PA 4ECAA 3KHRA 2AWNA 2L69A 3CE6A 1XCBA 5COQA 5TPWB 2IYLD 1ZD1A 4L22A 2FDCA 2DUUA 3BQ2A 1EUCB 5GADl 1RYMA 4G9BA 4PSCA 5C8VA 2B21A 5EC8A 4BV3A 4QKQA 1VPLA 4NEHB 2IU0A 2P6RA 1SQGA 2WJHA 4BFZA 2L2QA 4BDTA 1Z2OX 1QNLA 1ML3A 1J2JA 4MLZA 4TKMA 2I3DA 1E3SA 1H6AA 4HFRA 3V4OA 3C3PA 3KZIU 1B2RA 3PVZA 3IJPA 4X1IA 3H0KA 1I80A 4XFKA 5LP6C 1OI7A 4JITA 5KSYA 9ICIA 3MIZA 3NTOA 5J2TB 5H70A 5I5EA 1E9VA 1GQOA 3GV8B 3LW7A 4E2WA 1N32B 2JH7A 3LHFA 3WYAA 2R8EA 2XCUA 4MV0A 3NI2A 4LHVA 1EFPB 2C9ZA 4WJZA 1L7EA 3BFXA 2O5EA 1Q7CA 3MHPA 3L7NA 1V3UA 3T1VA 3HCAA 2VZ8A 4H4EA 1GM5A 2GYVA 3GNLA 1E1MA 2J7KA 3IBCA 5IVIA 3KYDA 1V25A 2MINB 3NOQA 4QLBA 5DHAA 1U3FA 4ETWA 4KLHA 2HSZA 5GJCA 1NKBA 5AXBA 2XW6A 2PV7A 1AQLA 3PK0A 4ZIRB 4NQRA 3AB7A 1DBRA 3HNPA 4TXHA 2Q6LA 3ZXSA 5IIKA 1U0SY 2NUPB 4WTOA 1BA2A 3I28A 3MBOA 3OIGA 5GTHU 2ZTLA 3WQRA 4LBVA 3VHRA 4M37A 2KZZA 1SEPA 4W5RA 1EHIA 1TZCA 4HHEA 5AHXA 2V6MA 5J29A 3OLCX 3IKTA 1KE1A 4IDFA 4IQVA 1UZAA 2MUTB 5DGTA 3QKSB 3JQ8B 3HJEA 4DLVA 3JU3A 1PWHA 1LV8A 3GNSA 2YV5A 4ZV7A 3HO8A 3L4BC 4AJ1A 4GPTA 4UAVA 2HDNB 3E53A 4ARCA 4RA9A 4YIHA 4GX2A 3FUCA 4Q15A 4KHPB 2H3EA 2G25A 4URYR 2JFWA 5A2GA 1Y89A 3ENQA 4QTXA 3JRXA 2O48X 4GI2A 3DV9A 1L5HA 1M6WA 5E4FA 1CQXA 4A1OA 4ED8A 2ZQ5A 4N0DA 4II7A 1T24A 2Z2YA 4YFKA 3TADA 1LI5A 4UXHA 1R8QA 3ZY5A 2QR5A 4I19A 4LRQA 5AKXA 1GTL1 3PHIA 1DIBA 3PENA 3PW5A 2DH5A 4DRXB 7REQA 3HI4A 3NHMA 3AXSA 1FDUA 5CAEB 1Z0AA 3H2GA 4NZPA 3M9LA 2DR2A 2VKQA 4AMGA 2QRJA 1VE1A 2ROQA 2A5GA 5J2BA 2QLNA 3SI7A 5MFZA 3FCSB 3PC3A 3H4BA 1VSBA 4XUCA 4Z8XA 1SH7A 4R8MA 4AY3A 4IINA 3CZ9A 2FSVC 4HN2A 5AXCA 2RIPA 4YR3A 3IAM6 2HF2A 3AEVA 4P4UA 4WK0B 7ICOA 1TCVA 1ZBDA 4ZAFA 1OYOA 4LRWA 1YMUA 1T1SA 4XLLA 3PQ7A 1UDCA 1WDMA 3G9ZA 3EZ9A 4NCIA 3HLTA 5JSYA 3KB1A 2LBPA 5IJ9B 2XB9A 1X7ZB 3VJLA 4E94A 1E96A 3WC4A 2I7DA 2CFOA 2KBEA 3RRNA 5K01A 3ZE2B 4DJEC 3BXFA 1PZEA 2G71A 2JIZA 2EQAA 5JS2A 5LP6A 5CH5A 4F4KA 1D6MA 3NEAA 2GEUA 2PM8A 4WK6A 1UKBA 3X1XA 4H16A 2NV2B 2QTZA 2FP4A 2C3OA 3MS2A 2V45A 4TV8B 5H3LA 1XXHB 3HUUA 3X1DA 3GEIA 4HQNA 3HMKA 1EX9A 5IK2A 5CDTA 4DSFA 3S1SA 5T3YA 1XZMA 3STYA 1YIDA 4RIFA 1GRQA 4FN5A 4I1YA 3C3DA 1OVMA 3GFQA 4YCSA 4HAZA 2EFDB 3UMVA 1RMYA 3DZGA 5ALYA 3FMPB 3JQEA 4GLLA 1DX4A 1JIJA 5IU6A 2CEAA 3ZCQA 1ZMXA 3VHXA 3PNCA 3GEGA 5KAPA 1XYGA 1VIMA 2HQ1A 5JD6A 2ZSFA 5AK3A 3GGPA 4YNBA 3W8RA 3LY8A 1W36C 4BNKA 3KXPA 4IXDA 3GDFA 1VSQA 4L8GA 4DG8A 5JY1A 1IU9A 4HDKB 5TF0A 5MGBA 2RG1A 3M4NA 4MUBA 2FRDA 3GOQA 4RSHA 3E5MA 2GFIA 5IT9A 4BU0A 2P6OA 2AI1A 1RMTA 5T4EA 1P33A 5AIAA 3AV0B 4CQMD 4QBKA 3KP1A 4XDHA 1JHOA 3L4BA 4Z6CA 1Z7YA 4TYQA 5CK4A 3K0AA 1R4MB 2B6HA 4EPXA 1ODIA 2QARA 3X1JA 1VJGA 3T12A 4QIHA 5ESRA 4MEAA 2C2WA 3K4QA 3W90A 4M54A 1MT3A 1SBZA 3K70B 1EB9A 3W79A 2HUNA 4DL3A 4HEA1 3WMXA 2UXBB 1P6UA 2PAAA 1KO5A 4YDQA 1NOJA 3ZHQA 4CHGA 1V2HE 2MSNA 4I55A 3AUOA 4KK3A 4MRNA 2IEAA 3N75A 1BGXT 4TLDA 2IPXA 5KMGA 2RHOA 3U5TA 1TX4B 3PRHA 5KDDA 3I9JA 2EZZA 3W7BA 1RXWA 2CNWD 4WBNB 3JQ9C 2IYTA 2H4FA 2GM9A 1NN3A 3O6VA 2HA7A 3GT4A 1UEXC 5I9TA 2SBTA 4GWLA 2W9BB 4B34A 4C1BA 2F9LA 4BNVA 1N56A 1ABEA 5JZMA 3UOWA 5JCZA 3OY7A 2FSVA 3SM9A 1ZWLA 3TJMA 1PGNA 1JHPA 5A7GA 5E9WA 2NPOA 3D8HA 4MS1B 1Q0TA 5KQPA 3I45A 2C5EA 2WKWA 4CNBA 1TMOA 3OWOA 3Q9LA 4ZOBA 1QB8A 3FH0A 4QUIA 3GRRA 2J3HA 4FS3A 3KHSA 3K31A 2RGEA 1P6XA 2OV1A 1VCMA 1OBVA 2VWHA 4P0QA 5LB4A 4ZODA 3GIMA 5FF9A 1D1PA 5GM1A 5B4VA 4N5DA 4B4WA 4FEAA 2BFAA 3NHFA 5HIKA 1IN4A 2MWMA 3LWBA 4ON9A 2MYNA 3KG2A 4FOLA 2QY9A 4ELUA 4N6OA 3FFTA 1I5RA 2XYVA 1YI0A 5A0LA 2WWYA 1NQAO 5CVUA 3HA7A 1KI2A 3ZWVA 5ALXA 3B89A 4IP0A 1G60A 5EHZA 3WV4A 2YTZA 1Z29A 2AT1A 2R6CA 4G63A 2G9NA 2ZUTA 3O4IA 4ODIA 1AXEA 4X71A 5GJWC 4B9UA 3LT5A 1TMGE 5JCJD 3T0FA 1BVUA 3FRHA 3G0IA 2I6FA 3RSCA 3LSYA 3MJDA 4DC1A 1G20E 1PT5A 4BN0A 3QVLA 1KI7A 1MTOA 3DEHA 3MFHA 1IZ0A 4MEXA 3IP7A 4Y9UA 1WCWA 5GVRA 2X8WA 4Q9KA 3L43A 4RFSA 4AJIA 9ICCA 2W03A 4IQ8A 4S1PA 1S8OA 5DLQC 4D5GA 4ZGGA 5DHTA 1PJZA 2CVOA 2AC4A 1L4BA 4MGKR 4TL8A 3RTEA 1WKCA 5TQ0A 1K7SN 4IICA 3PVSA 3ORRA 3MR6A 3QBJA 4TUSA 2BGNA 4LRUA 3ZZTA 1PHRA 3HABA 2PJRA 1MXHA 1SHKA 2P4HX 1II8B 1Z47A 4YP7A 5G41A 4EY8A 2XZTA 1LBIA 3DDNA 3W1VA 4ZAYA 1NQ5A 4FYKA 2VHTA 1SZHA 3PU6A 5AH0A 4JR1A 1A76A 2RGGA 2QNRA 4E09A 2FN8A 1Q83A 2NXJA 4DIUA 4FD2A 4TYMA 2E37A 1T3ZA 1O97C 5C34B 3A1UA 5KFNA 4M89A 4LJRA 7ICHA 2YZMA 3ZEAA 1XD2A 4XWTA 3CF0A 2O0LA 4HWRA 4R7ZA 1NYLA 4RV4A 1JPUA 2RB5A 1O5TA 1W5FA 4QOGA 3T5GA 3K4HA 4CM7A 3QELB 2XY6A 4HUQB 5L3QB 1J6UA 5CNKA 4RD3A 2JHDA 3CRNA 1KERA 5DYGA 3PNPA 4BGVA 1NVAA 3F96A 3MTIA 3JQ9A 4EG5A 2LBOA 4RGYA 1OHHD 2AG6A 1VHWA 4AQYB 2CJWA 5CEFA 5HNKA 1IAVA 1Z0JA 1X1DA 3V1TC 5ICFA 2OP1A 1R0ZA 1XK7A 2YHAA 1IHYA 3TOSA 4GKBA 1RMQA 1SVUA 3G2NA 3IQEA 1RP1A 3RB8A 3RBXA 1Q16A 4L4YA 3UB4A 1NOKA 2ZZMA 2CLDX 3ZXXA 1X7XA 4PLZA 4DSLA 1UDAA 4NE7A 5F1YA 3F3YA 4CCSA 3HRHA 4H1UA 1M7GA 3C3MA 2P8SA 3D2QA 3Q40A 5JCPA 1KJJA 4FHZA 4AECA 4WY2A 3ZKAA 4OBWA 1EFCA 2PFGA 3WL5A 5DTRA 4UU0A 2O3JA 2PKEA 4X7PA 2WZQA 4HYQA 3A6GA 3TDMA 3TTXA 5LOVA 2JHFA 3LLMA 2CL7X 2XI9A 3FVQA 4DXDA 4LYFA 1QORA 3EISA 1SQ5A 2ZIUA 1FNMA 2A9FA 1RXVA 4M0CA 1UQTA 3NBKA 2FPWA 2A8YA 4CBVA 1TMYA 1OWPA 2PXXA 2KLHA 3VH1A 3LXMA 2ZJYA 1XEAA 2ZAYA 3SSAA 3S40A 1U31A 2G1AA 4U2KA 3ICVA 4WCDA 4Q3BA 3H99A 3OE4A 1XTVA 1TYZA 4MB2A 2LWIA 3AM4A 4Q7JB 2H6EA 3O38A 3SXUB 3FHCB 1X80A 1SPXA 2YHUA 3BPSA 1E3QA 1E1QD 5JATA 3RSOA 3BK2A 1Y6FA 4ALIA 4WZBE 3E2EA 2WJAA 1SEVA 4DHWA 5IJXA 3SR6A 1QKKA 4YV1A 3OT4A 3ZK7A 1RI2A 4CT4B 1F0PA 3BICA 1ZQTA 3U4AA 4ZRNA 2FV8A 2IUSA 4FYMA 1C9JA 1YRAA 1VBNA 3VUFA 4GWKA 1BN6A 4LNUB 2HJHA 2JJ1D 3KIPA 3PCRB 4FXOA 2ALJA 4PTYA 1ANKA 5JVDB 1H2YA 5EWGA 3ALRA 2QAJA 4LJAA 8ICHA 1ZW1A 4LYJA 1KZ7B 1VRWA 2QF7A 5KYYA 2VDPB 3E9QA 4AJEA 1MVOA 3N2YA 4URXR 3EQ7A 3WP1B 4B82A 3INGA 5AWFC 1JEEA 2ZBFA 1TQ2A 4DLBA 3O4GA 3CLKA 2DPXA 1NKEA 3L49A 3L79A 3CISA 3SZRA 3NATA 1N4AA 3D7MA 4UE6A 3IV7A 2XE7A 3HG7A 2VNKA 1T3TA 3LF2A 3S1LA 4HZGA 2Q5HA 3SLGA 2DVMA 4UARA 5KG1A 4DBVO 3OX2A 4IDCA 4GLOA 4HP8A 3A14A 1KFDA 4EGQA 5LN1A 3V7UA 4CKEB 3GFBA 2PQMA 4XPIA 2V5VA 2F76X 3N8GA 3RTBA 2Q0SA 1QQBA 1F8GA 2WIAA 2BTEA 4JP2A 3PUJA 3N2LA 4GOLD 2Q3FA 5FO0A 3ZJVA 4KZPA 3BGWA 4D4LA 1R6AA 2UUBB 3CNEA 1K08A 1EU1A 2HQSA 4G5FA 1BWPA 4LDNA 1NP6A 1XZBA 1VL0A 3FJ1A 2CDAA 1VFPA 3A6ZA 4PHAA 3W2TA 2ZUVA 3GLGE 2VHJA 3MSCA 4WKOA 4M0LA 3IJRA 3M8KA 5C35A 3ND9A 3BHNA 3D5QA 1CULC 4PHCA 1AV6A 4I1OA 3Q2IA 3CF4A 3DTYA 4LAFA 3OOWA 2IDZA 4JH0A 1FMCA 2J31A 2I0FA 4BMDA 1NPTO 4CTMA 3VPBA 4CMHA 3NZEA 1Z75A 5JS7A 3LO5A 1GGMA 2PWYA 1G41A 5DXAA 1P18A 1K1SA 1Q3UA 4BMCA 4KWIA 4GNKA 2XXBA 3LQQA 2V54A 4IKEA 3N7AA 4D25A 1Y4DE 3DBLA 4R66A 1FJXA 3VNSA 4KO1S 3PR4A 4FFOA 3PJRA 2CMFA 3UG7A 4KYVA 3LVWA 3PYLA 3I1IA 2ZYWX 1Y8CA 3I76A 4ZPXA 2X2OA 1B1AA 4LXIA 3ZQUA 2ODQA 2PL3A 4NBTA 3AVTA 2A14A 3DFFA 2C3MA 4E03A 3T4UA 3GRCA 1RCUA 2OCLA 3RJMA 1NJ6A 3UXOA 1UPTA 3ZGNA 2VDWB 3EXIA 4PGGA 2JHCA 4U0KA 3P52A 4N0PA 1VC2A 3F5DA 4Z4IA 5KFJA 2RMKA 3FPJA 2IS6A 2QTWB 1TEZA 2IBSA 1EK0A 5KC9A 2WAAA 3LUGA 3DKVA 3Q3HA 2HWUA 2XF8A 2VUIB 4JCOA 3NIGB 3KB6A 2R8RA 1QZXA 3GLHA 4OOEA 2UV8A 1YR7A 2IU6A 4J0DA 4PHFA 3I4FA 2C5BA 5CA7A 4ND1A 1FLAA 3D6MA 3TPZA 4Z6DA 5EWLB 2IE8A 3INYA 2I5PO 2N9UA 3LA8A 2OM6A 3RBEA 3IESA 1ZRHA 1ZL0A 1JQBA 3EZXA 3M6FA 4RKFA 4PNPA 1ADCA 1N2SA 3QHPA 3SYKA 1U3VA 4CEHA 1RT9A 1XA0A 2WI8A 4BO3A 4QGSA 2YN4A 1JKJA 2X13A 1R9GA 1G9TA 2VDLB 1DSSG 2EJBA 1Z6QA 3N2KB 3CNBA 2HUPA 3BAFA 3OKPA 3TOZA 3L1IA 5IN5A 2GRUA 3G5AA 3QEAZ 3JD2A 4EABA 1Y6ZA 4UM9D 3NQ41 4V02A 2G09A 1UKAA 2JIZD 1X1RA 1QRTA 3BX1A 5KYUB 5FFNA 2Z9DA 2BGMA 3CWQA 4IF4A 3LKVA 5DNVA 3UCXA 1KBOA 1Z36A 2X4GA 3J81A 1MQ8B 4ONEA 4M4SA 3UF0A 1NW3A 3TI7A 1NYQA 5JECA 2O6KA 1H66A 4TMYA 2BM0A 4Q0MA 4ZAGA 5IK2D 4J0JA 1QTMA 1DHRA 2ZS7A 3IQXA 4RGBA 4CLHA 1SG0A 4ID3A 2WJPA 3H8JA 3GLIB 2FX2A 4AB1A 4GMHA 3QI7A 4EG1A 2PUAA 4RKQA 2JD0A 4ALMA 1OZAA 4Q01A 3TWOA 4B7CA 1HY3A 1WSDA 1YDGA 2ZE8A 1XJWA 4OHWA 4IDPA 3WA7A 5CIYA 3H5AA 4A0QA 1QE5A 1YHZA 4YONB 1QV6A 3WJ7A 4DDTA 3LQ4A 1X7WA 4OLJA 3G7NA 4IFBA 4N0MA 2E18A 3IR7A 1CFZA 4US2R 3ZHUA 4KG7A 2IODA 2FHSA 1ZD5A 1B8OA 5LD2C 4E3ZA 1C0LA 3FOAA 1HFJA 4UCXA 1GG5A 4FMPA 4W9NC 4E4YA 1UPAA 2OK7A 2HEGA 4H77A 4A5OA 3L93A 2NU6A 1NVUQ 3BMQA 3ISCA 1QHGA 4LVOA 5ITWA 1ZM3A 4O4IB 4PRLA 3VH4A 3ZXIA 5MN6A 3GP5A 3IEMA 1NVMB 3GLQA 1WR8A 3F1KA 1LNZA 3KXKA 3PX2A 2IPOA 3TLBA 4YMHA 2ZPAA 4H2DA 1B3BA 4OQQA 4ZO6A 1GAXA 5D7BA 4OUDA 1YVEI 2R5FA 1ZQGA 1CTQA 1T4MA 2A94A 5KX5B 1VP3A 5SYMA 1T3QA 1XZKA 2VO1A 1V3TA 4XX1A 1A9YA 4I2CA 1X9GA 4R0NA 1K5OA 2QG6A 4L7QA 2HRRA 1DDOA 5D6NA 4YCNA 2GA8A 3T94A 1SQFA 4I6GA 5HFAA 1ZI6A 4BLVA 3TLEA 3CMCO 4MVCA 4L5YA 4R64A 3ZOZA 4DT1B 5J2FA 5EXDA 1L7DA 4O6VA 2BUCA 1EP3B 1JMSA 1FA9A 1RAAA 3ZR4B 2O7SA 1NQWA 4DSZA 3HA2A 2VJYA 4P4SB 4IGAA 1K0FA 2JJ2D 1O96A 4PPYA 3SYLA 7MDHA 3O8LA 1WJGA 5F7OA 1J5EB 1SU8A 2PVPA 3GZTB 1UHUA 4YJHB 2G07A 3AR6A 1RI3A 1XSPA 2XNSA 2BKUA 4IVRA 1KC3A 5C8YB 3UCEA 3LHKA 3K3PA 1CRLA 2M6KA 3T7SA 4EATA 2FZ4A 1TF2A 5AJWA 2FEPA 4OHVA 1JLHA 2QXYA 4INPA 4JI1B 4HADA 1NW6A 1V7CA 3H1TA 5FPHA 8ICJA 2IBKA 1RZTA 1DOHA 2XITA 1WUHS 3T4XA 1D1SA 4H7JA 3THXB 2IYFA 1VA4A 5KVAA 1M0TA 3ASVA 5C5JA 1QCKA 3V4VB 4QYIA 5KWEA 2BHTA 1B0UA 5FEUA 1U6JA 4MYSA 2HT1A 1PYDA 3OLYA 4R9UC 2Z5GA 4IX9A 4PAQA 4O29A 3AR2A 3AEYA 1H0HA 2EJTA 3HXMA 1T34A 2OQIA 5EGNA 3O3MB 1M73E 3T3GA 1AM4D 4DMCA 3HDHA 4CM8B 3OQIA 4L16A 3ZCRA 3HJGA 3DLTA 1G5IA 1X7YB 4RLFA 4Z9XA 3WG9A 1EWQA 1JB9A 2YQ5A 2XGSA 3BREA 5AKGA 2VF2A 1N2ZA 3M3PA 5H2FU 1D8BA 4KMOB 3ELBA 5F21A 2H9IA 4C3UA 4DCJA 2BF7A 3UUGA 5HGJA 4HMOA 4LZPA 3IMFA 5B3KA 4PTZA 3OQMA 3AL3A 4A0HA 1DC5A 1W36D 3GEMA 1U1DA 4MVXA 2LIPA 5DASA 3AYXB 1TAMA 1OUMA 1EDEA 5ERYA 2HQOA 1R6DA 1QYVA 1LB2B 3SENA 4OSPA 4NU5A 1SQSA 1NLFA 4TX1A 5JWHA 3S29A 1BGVA 2W2KA 4P32A 1VPTA 3Q3CA 2VJMA 4HWPA 3BFPA 1EXWA 1DJNA 2XT0A 3DM9B 1Q1BA 4S1TA 2CB0A 2FVXA 5TPZA 2AJDA 4NZZA 2VYNA 3IEKA 1JFFB 2HI0A 3MTJA 4UU8A 4EVRA 1Z2PX 1LQ2A 5J1TB 1R15A 4DCUA 2HMVA 1Y6GA 3NWEA 1HDCA 1UAAA 4OFWA 4F4FA 1JIKA 1MU0A 2GAOA 4DFDA 2WICA 5JV5A 1ADFA 2P2LA 2R751 4TL6A 2IPNA 4LI3X 4JSYA 2H0AA 3ITNA 4J4HA 4EW2A 3BJYA 2CLFB 4E1AA 1YRWA 3WZMA 4CL2A 4KRYA 3BMOA 4F96A 4E5KA 3SF8B 4DXHA 1IN5A 2WFMA 2DEUA 1E98A 2OFFA 3HNOA 2PZKA 4QJ4A 1BFUA 1YB4A 3JPQA 2QW8A 4MDYA 4OAQA 4BAUA 2ZTDA 3WNZA 1NQXA 1S0VA 1WG8A 1IEVA 1X3SA 2XB4A 5FPYA 2V4MA 2DYKA 4BNIA 1C7EA 3L18A 3CVWA 3H97A 4IWNA 5FOWA 4DOBA 4B32A 2Z2XA