2WF8A

Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, glucose-1-phosphate and beryllium trifluoride
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Near attack conformers dominate beta-phosphoglucomutase complexes where geometry and charge distribution reflect those of substrate.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 79
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf8A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf8A01
1RMYA 1YJ5A 1Z4MA 2HDOA 5ALSA 3SD7A 1N9KA 4FE3A 3ZU6A 3ET5A 1QQ6A 4EX6A 1RMQA 5AI8A 5AW1A 3NALA 3PCTA 2CFTA 2BY4A 4PNHA 3WK7A 1LTQA 2HF2A 3E81A 1YNSA 5ALRA 3SLRA 1L6RA 1L7MA 1RDFA 2X4DA 5AI4A 3E8MA 3L0YA 4AP9A 3QUBA 4BNDA 5AW4A 1QYIA 4UATA 4CNQA 2FPRA 2HSZA 1SWWA 5AI5A 5AVSA 2GMWA 4EX7A 3AR3A 4KNVA 2NYVA 1SU4A 3L5KA 4KYTA 4C4TA 3QLEA 3WKAA 5AM5A 3OCWA 4MUMA 1Q91A 2BDEA 2WF9A 2W43A 4XOUA 4BNDB 4G9BA 4OHFA 4BX3A 3WK5A 4RESA 5ALNA 1ZD4A 2CFSA 3WGVA 3OCXA 3S6JA 4O8CA 3QYPA 5AM2A 1L7NA 1XPJA 3I1YA 2HX1A 5AVYA 1Z88A 2WFAA 2EARA 5AKYA 1L8LA 3J7TA 5ALVA 4YCLA 2G06A 5AKJA 2PKEA 1ZS9A 2GHTA 1RQLA 5ALQA 2AUTA 2R8XA 4UMFA 2AMYA 3K1ZA 2R8YA 2FPXA 1RLTA 4UU1A 3ZVMA 2RBKA 3R4CA 2FPWA 4CF4A 2DQSA 2IA5A 3MC1A 2JAUA 3AR2A 3D6JA 2I6XA 5ALOA 5E0OA 2BDUA 3U7GA 3E84A 1QH9A 4BX0A 1Z4JA 3NASA 4NFLA 3NANA 2YMMA 5IT0A 1JUDA 2MSNA 3L1UA 3N28A 4Y3UA 3RFUA 1U7OA 1Y8AA 1YS9A 5AKXA 2FUCA 2I33A 4XPZA 5ALFA 3QUQA 5AVQA 4IG4A 4L6CA 3ZVNA 2FPUA 3UMCA 1VJRA 2YY6A 3A1EA 5AK6A 2W11A 2YJ6A 5AVTA 2C8KA 5ALDA 3L0CA 3QU5A 3WK4A 1Z4OA 2EATA 3UM9A 3AR8A 2WF7A 2O2XA 4I9GA 4BKMA 3ET4A 1TJ3A 2YMPA 3N07A 1X42A 4DW8A 2G80A 4I9FA 2HHLA 4HYTA 3FVVA 3I76A 2JARA 4UAVA 4Y2YA 3WK6A 3R9KA 4YIHA 5IT4A 3N5KA 2B8EA 4AS2A 3L1VA 3QXGA 3EF0A 2FEAA 4YCNA 5A3SA 3QU7A 4NWIA 3BWVA 3I6BA 4BEVA 3U19A 3DDHA 3WKCA 1CR6A 3IJ5A 3NIWA 2R8ZA 2CFRA 1ZRMA 4GIBA 3N1UA 3PGVA 4BEWA 1NF2A 4Y2RA 1O08A 1YMQA 2JAWA 2HI0A 1TJ4A 1WPGA 1AQ6A 3SKXA 4EZEA 3ZUPA 3DNPA 2WM8A 3FM9A 5FP0A 2I55A 3W5DA 4HGOA 3EWIA 5IS2A 4RETA 3ZW7A 2R8EA 2ZXEA 2WHEA 4OCZA 2GHQA 2P9JA 2EAUA 4YCMA 1WVIA 3ED5A 4L57A 4ZEVA 2HOQA 3OCVA 5AW7A 3WK8A 3ESQA 3NAMA 4NAVA 3W5CA 3PGLA 4MWOA 1RLOA 1Z4NA 2FUEA 3L7YA 5ALKA 2OA0A 4GXTA 1TE2A 2FPSA 3TLMA 5AM1A 1T5TA 5AVRA 1J97A 1WZCA 2OM6A 4EENA 1U02A 2I34A 3EF1A 4KNWA 3KZXA 1ZD5A 4IFTA 3L8HA 4G63A 1NRWA 1YV9A 1Z5UA 1FEZA 1KYTA 2HO4A 3QGMA 1ZRNA 5ALWA 3QU4A 2WF5A 5AKIA 1TJ5A 3QNMA 5ALYA 3B9BA 5ALEA 5ALPA 2IOFA 2HF7A 2G09A 2FI1A 3WK9A 2ZBEA 3AR6A 4JDPA 2NO4A 3AR7A 4KN8A 3HYCA 3L8GA 3AR4A 4CE6A 1Z4IA 1Z4QA 2B30A 2YN4A 3L8EA 4DFDA 2PQ0A 1ZD3A 3MN1A 2YBDA 1EK1A 5AKZA 2B1RA 1IWOA 4AS3A 5AW5A 2VKQA 5ALTA 2OBBA 2YFYA 3UMBA 1N8NA 4J2TA 2I54A 4UAUA 1L7OA 3MMZA 5JJBA 4EEKA 3ESRA 1RRCA 4Y2QA 5AVXA 3L0BA 4BBJA 3L8FA 3KDPA 4HGQA 5AM3A 4UM7A 1NNLA 5AKLA 2QYHA 3HLTA 3QU2A 3SKYA 5AK3A 1QQ5A 5AW3A 2YJ4A 2MU2A 3ZWKA 2Q5EA 1U2TA 3EPRA 4QJBA 3QUCA 4CF3A 2WF8A 1PW5A 3SMVA 3A3YA 3ZVLA 1S8OA 4Y2PA 1TA0A 2C8LA 3P96A 2B1QA 5AICA 4E88A 2ZOSA 3VAYA 2GFHA 2RAVA 2Q4RA 3FZQA 1J8DA 2IYEA 3SF0A 1EK2A 3SHQA 5AVWA 2RB5A 3QUTA 1MH9A 2G0AA 2GO7A 4UW9A 1Z4KA 3IB6A 2PR7A 4F72A 4HGNA 2JGAA 1RPZA 3AR9A 2YMQA 2D2VA 3W5AA 2NO5A 4F71A 2QLTA 2C4NA 1F5SA 4FYPA 3OCYA 1L8OA 4FFDA 2IOHA 4NV0A 5A3RA 2YMLA 1RKUA 2P27A 3U7EB 3E58A 4ZEWA 4OD0A 2ZBFA 3DAOA 4QQFA 5AESA 2C88A 3OPXA 1L7PA 2ZBGA 2I7DA 2P69A 3A1DA 2CN1A 1ZD2P 2JAOA 3F9RA 2P11A 3ZTWA 2FDRA 4Y2VA 4UARA 5AW0A 4NABA 3ONNA 3M1YA 1T9ZA 2C9MA 5ALLA 3BA6A 4Y2UA 1LVHA 4KX5A 4YH1A 1U2SA 3ZI4A 1RKQA 3CZ4A 3KBBA 1XP5A 2YJ5A 3FGOA 1RC8A 1WR8A 5AKGA 1RKVA 3ZWDA 4Y2XA 1T5SA 3FPSA 3N8GA 2RARA 4KX3A 1SWVA 4JB3A 4UMEA 3U7FB 4YGYA 2B8JA 2YJ3A 3B8EA 3ZTYA 2G08A 3NUQA 5AM4A 5AI6A 4YIKA 5A3QA 5ALJA 1YDFA 3U13A 5ALIA 2G07A 3AR5A 5AI9A 4UU0A 1ZOLA 3A1CA 4DWOA 2O9JA 2IOFK 5AKHA 3CNHA 3ZX4A 3RF6A 3W5BA 4Y2TA 5ALUA 3KD3A 5AIBA 2ZG6A 3R09A 5ALHA 3OCUA 5T41A 4BX2A 3OTQA 4CF5A 1S2OA 1XVIA 4H1WA 2G1AA 2HCFA 5AKKA 3B9RA 4L6AA 4UMVA 3ZX5A 5AI0A 5ALXA 4C4RA 1RQNA 1Z5GA 4J03A 3QX7A 2AH5A 4C4SA 4BYGA 2ZBDA 1Q92A 3WKBA 2W4MA 5AKEA 1K1EA 2AGVA 2ODAA 2OYCA 5AW8A 3QU9A 3PDWA 5AVVA 1RMTA 2B0CA 5ALGA 3GYGA 1RLMA 3MPOA 4HGPA 4B6JA 3M9LA 4Y2SA 4UM5A 3U7HB 3KOOA 2HEGA 5AW6A 5AK4A 3I28A 4OFZA 5AW2A 3DV9A 4UMDA 4DCCA 3OCZA 3FPBA 4XE5A 5ALMA 5AW9A 3UMGA 1Z4PX 4Y2JA 4ZEXA 5AHXA 5AK5A 3WKEA 1Z4LA 1VJ5A 3KC2A 2WF6A 5AM0A 1O03A 5AIAA 4EELA 5AVUA 2MU1A 4XQ0A 4HAIA 5ALZA 3IRUA 1U7PA 1VFPA 3U26A 1CQZA 5AVZA 1ZJJA 1QQ7A 3WKDA 2Q4TA 3NRJA 3WGUA 4UASA 2B82A 4HGRA
chains in the Genus database with same CATH superfamily
4PBTA 1MNQA 3U3JA 4S1PA 1ZZGA 1PK7A 4I0WB 1A2OA 1WDMA 2JFZA 1DEAA 4QELA 4MWZA 2FMPA 1SC3A 1Q16A 3VR4H 4W5OA 3NYQA 4RZSA 2BEWB 5HK8A 2AI2A 3T8YA 4GOMD 3PJGA 3TL6A 1ST2A 2CXSA 3X2FA 3EB9A 3OJFA 1GPJA 1ZD4A 2DOKA 4N3BA 1JAXA 3W06A 1UOEA 3HUDA 3VZRA 4J9OA 3VOSA 3IP3A 3GZJA 4X61A 1L8LA 3E6AA 4J0EA 4NNJA 3W7VA 2EWVA 3T6KA 1TUEA 3MILA 1N34B 1UF9A 3OLQA 7REQB 4FMCB 3RCBA 1FSZA 4OO1J 5L45A 2PVPA 1QKKA 1JFFB 4LNHA 3BT7A 1RE1A 4NBSA 4NYJQ 3HPQA 1D9XA 1XTKA 4EUSA 1L3IA 5TVKA 3U61B 3DL2A 1NL3A 2ZJ1A 4F5DA 3PRYA 3DTVA 3TBKA 4O4JB 3WGNA 2PRIA 4ONEA 5AVOA 1AKNA 3E9MA 2I3GA 3L6RA 4RZHA 3TUZC 1UP4A 1ZN7A 2J0SA 1XMPA 4B3HA 2GLEA 4WX2B 2JAWA 2PS3A 1E2UA 4KO3S 2A9RA 1E3IA 4JK3A 2O8BA 1UKAA 5F4ZA 2XW6A 4R4JA 2HMYB 2NXWA 2XUOA 4ZTUB 1LKYA 4KE6A 2AYZA 2OV6A 3Q3JB 4JLUA 4BVJA 3A4MA 1QH1A 1MB3A 1NPDA 5JMPA 2V6MA 2OA0A 5IDXA 2QUKA 2BF4A 3OZIA 1F4LA 4MMZB 5KQLA 4CM4B 3G82C 3FN4A 4BX9A 4HD8A 2XQJA 5I7SA 2JGLA 4E7PA 1U2GA 4PGQA 5IT5A 3QU4A 1V48A 3T3OA 1HZJA 3A4TA 3MYRA 2WK1A 1ZQBA 3PFCA 1CVIA 3N7PD 3DC7A 3DCIA 3OX1A 1T2DA 4FKMA 1QVVA 5E7MA 1XTJA 3RYFA 1JSXA 3D02A 3P27A 3JQ8B 3BQTA 4AKTA 1NVWQ 1VPVA 4KFUA 1SKYE 4Q4CA 1U3DA 4GP6A 2FE4A 1RLUA 3EYZA 1KKMA 3MSCA 1PX2A 3U1BA 3OICA 5ES3A 5JH7F 1Q1BA 1JF8A 3QEAZ 2HLDD 621PA 4G4SP 1E1CA 1TA0A 2JHGA 1CZLA 1ADBA 1T8SA 4I6JA 1OGJA 2RJOA 2H31A 3QFHA 5L9AA 1BMQA 2P2DA 1KY2A 1OFIA 2HHQA 2VWQA 3PCXA 2CV1A 1P2FA 5FFNA 4BJQA 1QOQB 5A4KA 4QAQA 1VE9A 3KAKA 1EQUA 1J8VA 5JBQA 4DOBA 5DSZA 3D4NA 1YZLA 1PSWA 1IZ0A 4A73A 4MQUA 2C82A 1GP2A 4F2PA 1ORHA 5D3KA 1PD0A 2D4HA 4JGIA 4Z3KA 2QTNA 4JJGA 3KLNA 5J5AA 3ZLVA 3SS9X 2E0IA 3MWDB 1AQJA 3K53A 3GQBA 3WTCA 3HN7A 2YHBA 5KTYA 4DWOA 1U1DA 4F86A 1GRVA 1PG0A 4ZGBA 4Y2TA 4AMBA 2Q07A 1Y4SA 1BA3A 1KPHA 4DG9A 1F4VA 5KTRA 2HCFA 5AI0A 1YQ9A 4PR3A 1U2GC 4X92A 4Q44A 5I3ZA 2PH3A 3IS3A 1FSFA 2KMLA 4P2HA 3DB1A 2R6GA 3DTNA 4ED3A 4C5AA 1EFVB 3MWLA 5ITZB 4KLFA 3IBCA 5EL0A 2XMPA 3WMWA 2JH1A 4KLLA 1CY6A 4IQGA 1UKBA 2FEMA 4EAAA 2OUKA 1LB2B 5AOBA 4B6RA 2QROA 3VZDA 3DQQA 2YBEA 2YQ4A 3DMDA 4DM3A 4KQ6A 5CEJA 1J6UA 1I2ZA 2QDXA 2Y1WA 4MEBA 3KQMA 1OXBB 5IBRA 2YJZA 3QPUA 1PVQA 4PZOA 4NPCA 3GUHA 3I5MA 4JVLA 4QDXA 2HSZA 1J0BA 1LSUA 2W6OA 2XBLA 2BWJA 3BRWA 1W4RA 4CM1A 3FUWA 3OU7A 2EJVA 3AF6A 2FSVC 1KTIA 3TZEA 4DZZA 5LDHA 5J0QA 3VH4A 1Z88A 1DGJA 4BLTA 4YCLA 2FPGB 2IZ5A 4PYQA 4D8WA 3CBGA 5EJ5A 1XC9A 3CN9A 3L0IB 3ZVMA 1JLKA 1QLHA 3IYLW 2JK1A 2JIBA 2JGMA 3ABIA 3H0KA 5E0OA 3J81k 3JWIA 1ORRA 1GL3A 4XAQA 2K8BB 2QMQA 4B31A 3FDIA 5HOEA 2WAQC 2F90A 3ZCQA 2FV8A 3H1PA 4HDSB 3KJZA 2G9UA 3D2LA 3QE2A 2KJ5A 2UVPB 4F6CA 1MAVA 3WIUA 1ZETA 1VLQA 1VYUA 5DASA 2MTBA 2L2QA 3QBVA 2PXXA 3BQ2A 5DB7A 4NDNE 3H1BA 1H1LB 1DHTA 3MBYA 3O03A 1EXVA 3WGMA 4FN5A 3KQOA 2N1MA 3WBJA 2FG7C 4FFSA 3EIXA 4Q43A 1ETUA 4KO4S 3K9QO 4FLMA 4BC1A 1ZCFA 4WINA 2HN9A 3OQBA 3LTNC 4NL9A 5ELLA 4XD7D 2WIBA 3O1IC 3LYLA 3QSGA 4GOLD 2QB0B 1Z68A 1C30A 1KORA 2FR0A 1FX0B 3QBTA 3EXAA 3UK7A 4R2XA 1XMQB 1S8FA 1R27A 5KCZA 2AL7A 2R00A 3DOEA 4Q21A 2Z4TA 1DAPA 1IEQA 1YFLA 2IYQA 1JVSA 3VH2A 2XMDA 3ULKA 2RHTA 4OXRA 4AJOA 4BPRA 1HRDA 3IT2A 3KXPA 3RIHA 2B30A 4G5QA 1VKHA 2E5LB 5AKZA 4AS3A 5ITWA 1J20A 1B23P 1UIMA 2GZHA 3CLUD 2NU9A 2ZU6A 2E1PA 1QX4A 4DIEA 2Q9BA 1CP2A 2OSVA 3NGDA 3ZWVA 2H59A 1G2QA 4DR4B 3IBYA 2FQWA 4LUCA 4LJXA 4IDEA 3GMIA 3OSZA 5K8JB 3E2EA 3FZEA 4DMRA 3EWAA 1J09A 1RBQA 1IOVA 2BYTA 4OHWA 4MWGA 1K0FA 3RGGA 1YZFA 2VWGA 2JI4A 3LJKA 1GG5A 1Q57A 1XB2A 3ICXA 4KUEA 4YJHA 3PIRA 5A3RA 4QDKA 2ZTVA 3VR0A 3PQ8A 1NU6A 2XDQB 2QB1A 3A3OA 4HS9A 1DWPA 1Q83A 4J9RA 3R40A 1XS9D 1SIBE 4IDOA 2WFLB 4WBSA 5TQ0B 3MS4A 1V0JA 3ZDYB 1IPFA 1EBFA 1YQGA 3ZCRA 1MU0A 4ODIA 2XE4A 2XDAA 3LL7A 4I5FA 5BUZA 4PYNA 5ARCA 4AN0A 1VDVA 4RVDA 3WDMA 3WWPA 1G66A 3ZC3A 5BN4B 1N6RA 2XVZA 2GJAA 3JD2A 1W4LA 4XEUA 4YY3B 2Q0SA 2J0QA 2XUDA 4F5WA 1RAHA 4GLLA 3K3PA 1MJGA 4Q0MA 4MW0A 4W4TA 1VCIA 2LHTA 2V7BA 1XTSA 5HIKA 3SK0A 5ALMA 4CU5A 4S05A 4WGGA 2WF6A 4YHHB 4FCTA 1DQSA 1DKLA 3IAS6 2O3TA 2XUZA 1KZ9A 5E38A 1ECWA 1GA6A 3HJBA 2WJPA 4GVXA 4LYEA 2I1WA 3ABRB 1WF3A 2A1TR 2QD2A 3P9RA 1H1TA 3CLTC 1N2CB 4XD2A 3LUFA 1F4PA 4R83A 3VR2D 4WY8A 5CA0A 1WXHA 1QYIA 2GBCA 5BOVA 4BNZA 1GZHB 3QWBA 2IUYA 4UE6A 2FQ1A 4IV0A 3BS5B 5DEOA 4N5MA 2FPPA 3HLYA 1WW3A 4AQDA 5JS8A 1RP1A 1CF2O 5M34A 1EFUA 2ZVQX 4L8FA 2X77A 1S1CA 5KHAA 5AVYA 2EARA 1DBQA 2AGOA 1RQLA 1WCYA 4W8GA 3PE3A 1KEZA 5HIMA 3SJBA 1IB0A 3RVMA 3KZKA 4LJ4A 1FNNA 3D6JA 3ZNQA 2I6UA 4JQCA 4NPHA 4OSEA 4Y1RB 5JRJA 1GAJA 2MSNA 4C78A 3L1UA 1C4OA 3BEDA 1OX4A 4TLDA 4TLEA 2G9RA 1QZTA 3BD8A 5CA7A 4OI2A 2ZSFA 4BLUA 1FJXA 2SHKA 1DKUA 3CV3A 4A6XA 2JRCA 4KLEA 3SHOA 4IM7A 2RH5A 1FDUA 2B1GA 2FWPA 4EQZA 2V9CA 1YGPA 1TAQA 1M34B 3DNMA 1AA6A 4H1HA 1Y8CA 4UB2A 3W77A 3FBWA 4P81A 3V6KA 1N2IA 1G8HA 5BYBA 4G5HA 4HUTA 5IDWA 2PMEA 2GHQA 5D1HA 4CLDA 2Q1TA 4D0RA 4OQDA 1THTA 3GRZA 1EFTA 1NW6A 1YFZA 1Z6GA 3K1YA 1DFHA 3RUHA 2FPSA 5J0XA 1FK8A 4WKBA 2C5SA 4KLUA 7MDHA 2REXB 4BAUA 4FD2A 4C7OA 2Y0DA 1U2DC 1WW2A 2AIRA 1S02A 4KKVA 3FMFA 2R47A 1STOA 2PLRA 1UC8A 3EC1A 5DTMA 1ESNA 4DFMA 1NRXA 2P62A 5J0RA 3PEUA 3FB1A 2EVWX 1FP4A 2LCIA 5FTNA 1TK0A 4H7JA 3MUOA 2VDOB 1G3UA 2AUNA 3PZBA 4TYWA 1K63A 2I54A 2VXCA 3P9IA 4Q7LA 3MNFA 3A11A 3H1GA 4J0CA 5AK0A 4X97A 3IDZA 4HWPA 2Z58A 1ONOA 2OG1A 1JHMA 4G84A 1UUFA 4HAWA 4Z1MA 5BWLA 1BGWA 4OL9A 4UCWA 4MS3B 2B61A 4B3SB 3QNWA 2BMDA 3EAQA 1MTOA 4KAFA 2BPGA 2WI8A 1T3SA 4PNZA 3QQPA 4LCEA 3E9RA 1MH9A 3QWAA 5EWLA 3EPJA 3GEEA 2ZUSA 1KEEA 2DKXA 2Z83A 4L4YA 1GRNA 3AESB 3FW1A 2X13A 3RW9A 1H69A 3KQVA 2V7WA 2P27A 3KPUA 3EVAA 5EWGA 4QQFA 4U8GA 1YB7A 2PWAA 3DGFC 2GZ1A 4Y18A 4M7PA 3M6WA 4N3GA 2H2AA 4TUSA 4R1MA 3RF7A 1SXJE 3LGXA 4NRDA 3KTOA 4AD8A 2AFHB 2ZQ5A 1NF8A 4XDGA 1QGYA 1CZUA 4I3HA 1TTPB 5KU7A 1V9LA 4CKYA 4CV3A 2ZRGA 3QV1A 2JA1A 3DOOA 2CXOA 2PKCA 4KLAA 1HOTA 2PJZA 2WVAA 3WP0A 5DGAA 3GGOA 4ZVRA 3D8TA 4GOKA 3UCEA 1IBSA 3OLCX 4HDNB 5K3DA 5CA0F 3MOSA 5KPDA 4BIMA 1YASA 4E5NA 4OI1A 3D6MA 1AZSC 2OENG 3CFYA 2PMKA 3FZGA 3BJRA 2OO5C 4WSOA 3PEYA 3TRHA 5BNZA 5DHAA 1FB5A 4MW5A 2XQFA 4GGPA 2P1RA 2Z2ZA 1Z0IA 5KFUA 2WICA 3F8TA 4ENPA 1QYCA 4GGMX 1I32A 4CU2A 2I3AA 2CUTA 4O6VA 4MB2A 3K2IA 2AR0A 2B98A 3CXRA 4LGYA 2ZS9A 1E3MA 4KN5A 5E9WA 4N54A 1ONNA 5DCWA 4CXMA 4X6YA 3ZCTA 2HZBA 3NEPX 2Q3HA 1IBCA 3EEYA 2XWPA 3QKSA 3D4OA 5JD4A 1Z0JA 2GN8A 1IEXA 2B92A 2HWYA 4JITA 2HCRA 2KVCA 3DMNA 2L17A 4DJ5X 5FUXA 1QG0A 2PU7A 2ISOA 1SXGA 2O8DA 1ES9A 3BJYA 2ID4A 1IIRA 1JQLB 4G2TA 1SG6A 3WV5A 2XNHA 1SVSA 1U6KA 4W8HA 2A0KA 2VUIB 3JWHA 4NZNA 4G5OA 3IQWA 5JD6A 2PKEA 1FYWA 3B6IA 4DMFA 4F2SA 3DXFA 1M8PA 2B25A 3K1ZA 4Z4HA 1YOVA 1GCAA 4J3NA 2WZBA 4U7WA 4I29A 3M5DA 5KNBD 4CL3A 1V11B 1ZYUA 2XUJA 2KPOA 4RHYA 1RAGA 4ELVA 3L01A 5K99A 1KMNA 1WD7A 4BKRA 1KSPA 3A4IA 4OGFA 3GJ8A 1RI4A 3GY0A 2OFPA 2OK7A 2ZJ4A 1TUGA 1QG6A 4DLPA 4HT3B 4F5QA 1DT3A 3M6IA 5JUMA 3JD4A 4L76A 1L5WA 2MYUA 2Y9PB 2DQKA 3ICPA 1QR2A 4FGLA 4GC5A 2FW0A 1VMDA 1G2OA 5CLLA 2AFVA 4OHVA 3QQ5A 3H17A 3X44A 2R6HA 4XUSA 3OHPA 5JW6A 5JSYA 1PX0A 4M8IA 3JY6A 3G6KA 5B6PA 3OUTA 1TVMA 3ORYA 1TYEB 1ZUNA 3R41A 3SBEA 4RH3A 1T5LA 3KOXA 1ML3A 5BN1A 4KP7A 2ZE5A 4BVGA 3S1SA 3LZCA 3UWKA 1LQ2A 5LYJB 2OC4A 4QWMA 4P3NA 4WA7A 3VUFA 2Z8YM 1SCQA 4GRAA 1GXSA 5HZHA 5C5EA 3FSEA 2EKLA 4QZGA 4REQA 5GP1A 2E8MA 4JKYA 1XMJA 4E4TA 3AHEA 2W8BA 2AB0A 1QWSA 3I34X 5FI0B 1CERA 1W76A 2WDZA 4MDYA 5K2OA 4CIAA 2P5SA 3WL3A 3VBEA 3FKSD 1ZL0A 3FRJA 1AQIA 2JASA 2ZIGA 3EWSA 3UXEA 5E4FA 1RWBA 1A76A 3INRA 2W8ZA 2A1AA 1SQGA 4BVHA 3ZS9A 2IXTA 2J31A 5BPFA 1X2IA 2F48A 2OM2A 4MQLA 2BZSA 1R16A 4LYJA 1X8JA 1ZXIA 3RFAA 1WXEA 2Z5VA 4DCGA 4M76B 4IR9A 2ACEA 4NAHA 4YLYA 3O84A 3U5ZB 2HSEA 1R7RA 2XAAA 1Y42X 5EXXA 4J9NA 3PD0A 1LJUA 2DJ5A 1IN6A 3UQZA 4UVIA 4CM8B 1EE2A 5CHYA 2ZUVA 2HXGA 1B15A 4ZV9A 2LBOA 4XUCA 3TX2A 3Q15C 4ZVKA 4DJAA 1SHJA 1OKKD 2FF5A 2QAGA 2WWFA 4BVEA 4CFSA 3I2KA 2PHZA 1XPOA 2ZDQA 3CMMA 3T1QA 4OJMX 4QJIA 2JC3A 4P7KA 1EG2A 4S1WA 4D7AA 1V2HE 4Z2YA 2Y1EA 5ECDA 1Z7WA 4MUIA 3ASZA 1W87A 4E1BA 2E5WA 3DZHA 1F9AA 1N5WA 4H7HA 1GEGA 1W2GA 2Q5FA 3K6RA 4KGVA 2FX2A 1YDGA 2AR9A 2G9QA 4QD3A 3TTTA 5KL8B 4PQFA 3LAWA 4LW8A 4U3JA 1N0HA 1MABB 2CCJA 3WKEA 5IW8A 2OZVA 1H4QA 1S9HA 2XHEA 4YR0A 2O8FA 3THOA 1MXHA 3OX4A 1O0CA 2GKSA 3H8JA 4YJKA 1G20B 4M0PA 4HY3A 1KFSA 4AJHA 2GZMA 5JWOA 2WTAA 5AI8A 4GL4A 1N32B 1JHAA 4MLCA 2OVBA 5FV4A 4MEXA 5AUOB 3F67A 5CDTA 3IODA 4OUDB 2V97A 3M1IA 3GLGA 2P77A 4RT3A 2VK1A 3PNYA 1KK2A 2G25A 4NI5A 3GV7B 5FDFA 4K6HA 2IBSA 2AFRA 4MV4A 2FHPA 3N59A 1RWKA 2ZI7A 2C4KA 2NTEA 4TUQA 2HRDA 1N2OA 2ZJZA 3RTEA 5EIXA 2JLXA 3OP4A 3C3AA 4C01A 5BYJA 1LPMA 4LWOA 1LNZA 3TLYA 5FYDA 4RVSA 4FP9A 3H3XA 4RAQA 3K4QA 2CYBA 4E09A 1XZDA 3TI7A 4PCUA 4BTVA 4Q12A 5B57C 4BNGA 2ZS8A 1BKYA 1MHTA 3E8SA 1Z0FA 3LKVA 4PSVA 2PRKA 1UT8A 3CJQA 3W9BA 1K1QA 1Q21A 5IM4A 3URMA 3UKJA 3DULA 4MS1B 3BULA 3N7AA 1Y6QA 1UPXA 2WKRA 1IOWA 1YQEA 3O4VA 1J0EA 4K1XA 4Q7KA 3F2VA 2XA9A 3ZDAA 1XOIA 1ZHFA 4Y0AA 4J2HA 5EUQB 3P0IA 2ZRCA 1RWXA 4N40A 1P5RA 2GAOA 3DEIA 4ZV7A 3UK0A 3BQ9A 3B1VA 1TCAA 5I9IA 3PIIA 1T24A 3KKZA 5J1SB 1JDBC 1K66A 3JASB 1EU1A 4GXTA 4PYRA 4QOGA 5KWVA 1YAJA 1KQOA 1U31A 4MYDA 1ZK4A 4RPCA 2PZGA 4A5SA 5M3BA 4Z9YA 2CHVA 2H08A 1JMVA 1J8YF 5HMLA 3CCFA 1ZOIA 1LTKA 4US9A 4FYKA 4UCQA 4F11A 4RU9A 3GMSA 1E1RA 5EQDA 3WP1B 1YBFA 4YJ3F 1A9XB 3D6FA 6AT1A 4DFDA 3ZDRA 2QM3A 3V1MA 2ZUFA 2WOOA 4I2FA 3V46A 4AUNA 2CWDA 3DLCA 2Q2NA 1GV0A 1B2RA 5FLXA 3U49A 1V3UA 5JQGB 9ABPA 1V71A 1K75A 1CJCA 4B47A 2C2YA 4UNPA 5LOVA 5KKNB 4OQXA 4FT2A 2Q5JA 1OTYA 2ZANA 3WGKA 3F2DA 1JDZA 3PSAA 4GOJA 3AIKA 1TIPA 3E0XA 4MVYA 2JI8A 1NLYA 1P2GA 1V7PC 4EH1A 3X1YA 4FYWA 5HP4A 4R8UA 4RDHA 2GEFA 3PZPA 4NM2A 3MLBA 5KG1A 2W4IA 1Z29A 1O0SA 4F3CA 2VF4X 1HDRA 1X9GA 5KCMA 3I8OA 1CYEA 1NQWA 2MA1A 5KT3A 2NO0A 3B78A 5LP1A 4NJEA 4R0NA 2BP7A 3AF4A 2DBRA 3G8BA 3KXLA 4G1VA 2QN1A 4W63A 4AYTA 1RI1A 1TC1A 1QRUA 1S1MA 4UUOA 3QE0A 4PZNA 4LJKA 2PGNA 3PLRA 5AI9A 3LXRA 4IFBA 3RSGA 4C80A 2IHTA 5JJIA 5CUQA 3RF6A 1GL6A 3AU8A 3OY7A 2H1RA 3KQQA 2V59A 1GD1O 3MTEA 2G1AA 2QHXA 1SKBA 1PK9A 4BMVA 2WAAA 2WU1A 2W4MA 1DTWB 1BX1A 4FW8A 1J49A 4QGFA 2DECA 3QVTA 3EXFB 2QV7A 5H9WA 4GXJA 1B73A 4U4AA 2HEGA 2V5AA 1DDOA 3TLJA 1KQGA 3K0KA 2GA8A 1S0UA 4JL8A 4KTTE 1BX0A 1M33A 1MHPA 4GMHA 4LOHA 3U6KA 1R8JA 1W49A 4G0OA 2O59A 2ZWAA 3GLFA 3KXDA 1H9BA 1U80A 3ESYA 4KZKA 3DHYA 1JG2A 4DLGA 3QTTA 1CR2A 1ZEJA 3D0QA 2REOA 1WS6A 1NM5A 3GV0A 2HPVA 4HDKA 4OFWA 3V1KA 3FG9A 4ZQFA 5KNLA 1T2AA 2PX3A 4O0MA 5LJIA 1MZVA 2PZEA 3KWLA 5EMJA 4EFNA 3WGGA 3P2MA 9ICQA 3WRXA 5IM4F 4MW9A 2PSSA 3AL3A 2JPDA 4DB4A 2C5AA 1BPYA 1I7LA 1B6RA 1A69A 2W43A 3TG2A 4URUR 4BN4A 4DSEA 1GSAA 3Q9SA 1ZUHA 2X0JA 3OPMA 4NXZA 3QYPA 4PX5A 1F2TA 5CW2A 1INLA 2F62A 1KFTA 2CXNA 2EBUA 1V6AA 3QLJA 4YQYA 3VV3A 3MF4A 2B6NA 3LQRA 3MWFA 1V5GA 4MTCA 3P9PA 721PA 2EZ9A 4IOKA 4TYQA 3H5IA 3WLKX 1RXCA 4RVCA 2ZR0A 3ZHXA 1MGOA 4GAEA 3TW6A 3TSOA 1RQGA 3PFFA 4QJFB 2FKNA 4RULA 3C8DA 5DI9A 1K4MA 3UGJA 3THVA 3LVFO 3UH1A 3F46A 3RB3A 1EFRA 4YP9A 1H8HD 2NX2A 2PNJA 1JDBB 5H68A 2P9GA 1JR2A 4WKCA 3NMUF 4C0QC 3MS7A 2V6BA 4S3MA 2ZYTX 2EEPA 3ZD8A 3OCVA 1QCYA 2R25B 6ABPA 1E2PA 1U11A 2P3OA 4MKFA 1J56A 4E0DA 3HY4A 1P7VA 1PBTA 2PI5A 2HA6A 2V7GA 2RHLA 3FSGA 1P0QA 1G63A 1JT2A 2C7VA 5LOVF 4BQEA 4RHCA 2BFEB 2I29A 1P9RA 3A2KA 3MT9A 4AG6A 1BVYF 1D0SA 3E82A 1T13A 4QIWF 2ZTDA 4FIDA 1S3GA 5EZQA 4HDAA 4AZ3A 2OQ2A 5I4CA 3TRJA 4N65A 1CUFA 2HU5A 3TIXB 2Q6VA 5DTIA 4JLMA 2VAWA 3MMZA 3PP8A 3GB9A 4IWNA 4U9UA 1Q7EA 3AFIA 1ZQSA 4RKWA 3AVQA 2ZE8A 3LVWA 3DVAB 4QJBA 4LYAA 3SIPA 3RYHB 2WPNA 3B6JA 1JWAB 4LJ7A 4OV6B 5C34B 3IEXA 1DU4A 1NQTA 1Y3HA 5BSEA 2RB5A 4A1FA 5EE3A 1PD1A 4C30A 3EIFA 2I2CA 1L4MA 4JUFA 1TUBB 5C46F 1B22A 2F9LA 1S77D 2CSXA 1ABBA 1QP8A 5LDGA 9ICIA 3M1YA 4C87A 3TNFA 3E35A 4RSMA 5FWYB 2PSJA 1KAHA 1XP5A 2IZ7A 1AKMA 2MSDB 1OFGA 4AZWA 1IVSA 4J7UA 3TTVA 5C31A 1YZKA 3G88A 2QQEA 4EW3A 1CUGA 4HF7A 5LQDA 4J0QA 1SXEA 4AKSA 2H16A 1I3MA 3SF8A 4L28A 4JV1A 1G3QA 1OXTA 3UT5A 1C3OB 2Z98A 1QB8A 4CF7A 1MFPA 4J76A 5FBKA 1DAMA 3LL4A 2D00A 4UHKA 5AHKA 1L8XA 1UMBA 3WLFA 3KJIA 3WC4A 5A0VA 2NUTB 4IIUA 4AY3A 3QLTA 5CB4B 5FNVB 2ZYRA 3A14A 3OQNA 4HRVA 3VYVA 3PD7A 1NYTA 3UAGA 4CTMA 2QMEA 1O03A 3DKPA 3VQTA 1FLNA 3AVTA 4Q02A 2H54A 1KMMA 4B74A 4TTIA 3U26A 2X0EA 2YNMA 5GIPE 2QUJA 2FMHA 2Y0CA 4DSUA 2X6TA 2WJAA 2JEJA 4H0FA 3A58B 2J6UA 1YI1A 2MYNA 3ETDA 4H6XA 4RD2A 1JR4A 1XZQA 1SGWA 4WXMA 4GW3A 4OJQA 1O54A 1RACA 2GGSA 3ZLJA 1KDTA 4WESA 2P9QA 1KC3A 3SEQA 2ECFA 3FAZA 4FBTA 1Z5ZA 1UJ6A 5J0WA 3C6XA 2YVUA 2CL6X 3C5FA 1NJXA 4BS9A 1NKBA 4FN4A 2OYYA 3L4BC 4R1SA 3PEVA 1C8BA 1XD2B 2H85A 2WPDA 5NULA 3Q88A 2A6PA 5DCLA 3WS7A 3MPUA 2MINA 2X3FA 4NV1A 1F0KA 3E84A 5EHQA 1QR6A 3RUEA 1A9OA 4KE9A 1KSGA 3LPAA 3WL8A 4F85A 5HRCA 2O54A 1Y82A 5JAQA 4KLGA 5I7VA 1B74A 3PF8A 3HWWA 2G5GX 1HX7A 3BMNB 2YJ6A 3H97A 1DK3A 4KHZA 4KV7A 4MV9A 1ECCA 2NV6A 3EVEA 4KIJA 3OE1A 2W58A 3QELA 5EHNA 2H7CA 3GUZA 2P9EA 1YTLA 5KYUA 4BLWA 4Y2RA 4AN4A 1RWMA 5B30A 2HT6A 2Q5LA 4CEIA 1KMQA 3QLVA 2QYOA 1EA5A 3B89A 5BORA 2DBYA 2P68A 3ICVA 4YT8A 1O6ZA 1H0RA 2GUWA 3OJXA 1CJTC 2RB4A 2HU8A 2FP4B 3O75A 1IONA 1HE8B 2YHIB 1DIRA 4K9LA 1RXIA 2YNMC 5AT1A 3RRJA 4WK6A 4PC6A 4LC0A 1WZ2A 1CEZA 5A4AA 3CRNA 4ZOLF 2BLLA 4DEXA 1Z8FA 3PVCA 4PU0A 3TQSA 3WK9A 2JH3A 4JYCA 1S2DA 4B33A 1ZKDA 4AIIA 2CE2X 4DR1B 4K4GA 1KYIA 4O4IA 4AUEA 2YXEA 3B13B 2IYPA 1L5LA 2XIJA 1SC4A 3WJ7A 5CNIA 5A5DA 5IIMA 1C7EA 4LTDA 4V0LA 4EABA 3SAHA 1XEWX 4WKPA 2WWWA 3DPSA 4F97A 3G7NA 3IELA 3EPRA 1G21A 1J33A 1P1HA 4RJKA 4QODA 3D2AA 4E14A 3IO5A 3KKOA 1NIPA 3DFZA 4NM1A 1BNPA 2WABA 3IM1A 2FVYA 3ISDA 2KZZA 1JKJB 3NHYA 2NLOA 2ZU0C 1P5FA 5IAKA 3G89A 3ZWYA 1X1SA 3AKCA 2C58A 4AZTA 1L5FA 4KFCA 2JJQA 2WT9A 4R1UA 3EZ5A 3K0FA 1VDZA 3OJWA 4RQTA 2JBHA 1T1EA 3FGZA 2AGQA 2JH9A 2CVPA 4UUPA 2J5QA 4UARA 1NK0A 4YAIA 1QANA 1Y6ZA 1Q0LA 2I2AA 5EOZA 5K8VA 1C3JA 1Y98A 4PQEA 2CV0A 5EPUA 5IILA 1NHWA 3FUVA 3UKDA 1Y6GA 1EEXB 3WFZA 1VKRA 4KX3A 5B1EA 5L3VA 2HCBA 3GLUA 5KFHA 5TPWB 4E1VA 3QPAA 4O0LA 5KG5A 3FUCA 1AO0A 4B9LA 3WYDA 2ZG6A 5KG2A 3OTQA 2RHGB 4RCZA 3WBFA 1EK0A 2P75A 1XTVA 1VC2A 4BNWA 3JAMA 2ZIXA 4MI3A 3CIFA 3UV6A 3OOJA 4HGPA 1A95A 3GU3A 2GBPA 2XTAA 3H3FA 4ND3A 4GKAA 1WYGA 2Y1LA 2K2WA 4IVPA 1YDEA 4ACOA 1C50A 5CBKA 2HRZA 4BU1A 5ALZA 4JMUA 2I8AA 1BHO1 2XSZD 5M04A 1WL8A 2H92A 2O8CA 3EH2A 3B48A 4BZQA 1N36B 1WEHA 4QUAA 4OFXA 2FPIB 2HDOA 2WE8A 2DF8A 4EPTA 2PL1A 2HF2A 2MOKA 4MVCA 2VJAA 4D3SA 1GN9A 3IR5A 3CN7A 1DXHA 2AK2A 5H5JA 5IVKA 1GAEO 3L5KA 2C3YA 2DHDA 1L3CA 4D9CA 1PKXA 3NR2A 4KGXA 2ZRLA 5LCXA 2CMDA 3JTEA 3WRVA 2FSFA 4KPFC 3I1YA 1KHTA 2VTDA 4OH7A 1QAOA 1J2YA 4TS9A 1M74A 3F7OA 2XLBA 4M1ZA 3RO7A 1A77A 1WXWA 5D49A 2IIPA 4HEHA 3K15A 3DPIA 5JFTA 3KLPX 4KPUB 2PGJA 5F5LA 2XY5A 4A2CA 3A0UA 2BZ1A 2GYUA 3QUQA 1SBHA 5JTIA 1C0KA 4CUJA 2ZS7A 1L5OA 4ZMBA 5HQ3B 5HEKA 1KJNA 4LMBA 1ZLXA 2C31A 4A5OA 2CXUA 4MVJE 2PLNA 2PIAA 5KKAA 3NFRA 4F3YA 1T0PA 4LJYA 5J3JA 8ICEA 5LQKA 2PBLA 1ENPA 3A3NA 1TX4B 2VOJA 3COZA 4PLZA 3OPYI 4AN1A 4TRNA 2H4HA 1N61A 4F50A 3W3AD 3ZE1B 2OZLB 3OUZA 1ZXLA 4MVJG 2JIMA 3NGXA 5BW5A 1DHRA 1U8XX 3B6KA 1O6BA 4C20A 3WK8A 2BGRA 4X66B 4KJZA 3INTA 1RPNA 1Z73A 3HJCA 1MC8A 1CFZA 4C0ZA 1V45E 2ZJ0A 4CL0A 3D31A 5DXJA 1ISMA 2LGJA 4HQKA 4A8HA 4DF3A 3W2HA 1FPQA 1O89A 4UM9B 5JAUA 2Z9BA 4DUYB 3WX0A 5KTMA 5F9LA 3G7SA 1ZRNA 5K9ZA 7ICKA 3VZSA 1Z5WA 3DKRA 2VF2A 3VR4D 4NCHA 1U65A 4YXJA 3Q6MA 3C2LA 1J06A 1JI7A 4B5KA 3DMYA 3JQ7B 3C3XA 2QL6A 3G2MA 3KL2A 1PWHA 4OQYA 1U1FA 5FV7A 1GU0A 2AOVA 3EYAA 1WDLA 2VHCA 4BX9C 2I87A 2XX3A 2W37A 5EKXA 1LLQA 2W00A 1D6MA 5JR3A 1MC5A 4YONB 1CG6A 1UDCA 2YZ7A 3PKZA 1R0BA 4GZ3A 5JI2E 1P73A 3ZVLA 3JS5A 4UNRA 4F4YA 5I48A 4JGBA 2ZYVX 3TVDA 2LKYA 4DTCA 3OESA 3B1WA 4DTIA 1J2NA 2WLSA 2EANA 4RTJA 2X86A 5IMBA 2UZAA 4RJLA 4YLEA 1LBSA 5EE1A 3V48A 1W25A 1NQVA 2KLHA 3E7FA 2WRZA 4EUHA 5HNKA 2PRZA 3DXYA 5DH9A 5F1YA 3RWBA 1W5FA 2VYVD 1KMHB 5B7NA 2WFZA 2P69A 5KFGA 1SCIA 3NWPA 5LFAA 2XUFA 3WNQA 4OAQA 2QORA 4XSVA 2ZIVB 1ZFNA 3LC7O 3IEIA 4NK5A 3KHHA 3F4KA 1TTHA 2QKYA 4W5RA 2H17A 2AN4A 4AU1A 2XMRA 3KZMA 2R2GA 3T38A 3T1TA 3ELWA 5JH7B 1T4GA 2JEFA 1PIWA 1JX6A 2ZJ5A 3DVSX 5EQFA 4KLZA 5E3IA 4L8LA 2ZRIA 3T7AA 1RCFA 5ALUA 1IY2A 4GSYA 3GI1A 3R9XB 2VJCA 3B6EA 1ZNQO 2OXEA 3LH5A 1CRLA 1PTKA 1J42A 1DX4A 4V1CA 4GL2A 4WECA 4DGSA 1OH8A 5DN9A 1AS2A 3NS1A 2GETA 2Y1CA 1Y8RA 4HLCA 3HO1A 1JXMA 2XXAB 1O95A 5KQMA 4M1SA 4BXOB 3E9QA 4TWJA 4QTYA 4MHVA 1VXRA 2Z56A 3I01A 2JRZA 1ZNXA 4PANA 1SHKA 3RSCA 4B9UA 2OCIA 7AT1A 1J2RA 4L4XA 3K6SA 1LBHA 3JPTA 4FSHA 2JZNA 3TZLA 5JLAA 4IXTA 5FR2A 4NHEA 3IUMA 3LW7A 2VHVA 1J9GA 4YJGB 3LPCA 2FLWA 2A5GA 2FCAA 1VI5A 1F14A 5KAMA 5AW4A 1E2BA 5B5SA 1QXSA 3Q0EA 2XUPA 3OEWA 1V38A 1CY4A 3CRQA 3UG6A 5REQA 2IYFA 2EDCA 1VJCA 1J0CA 4R81A 3FKJA 5DBGA 1A6SA 2HJ9A 3CGGA 2EH9A 1ODIA 3NZEA 1A50B 4PHFA 1JFSA 4U2GA 4ESVA 1QIEA 2EBHX 3GWZA 3K09A 3P9QA 1GTJ1 1RJ9A 4AI6A 1B0UA 5BT8A 4FQ5A 1TDJA 2X0KA 1P0IA 1PP4A 3IFSA 2QX8A 2BDUA 1TK2A 3R6WA 4H1VA 3CR7A 2H3HA 1L5YA 5BVHB 2E48A 3N28A 2AS0A 4EO4A 9ICJA 1HETA 4CN9A 2HBZA 1KQFA 2PVCA 4ZU3A 1D6NA 3PNCA 3RRYA 3RVKA 1WTAA 1QYRA 1Y6JA 3FE2A 3LY9A 3ENQA 3CUUA 3L1VA 2FEAA 5KT2A 4QU8A 4BP9A 4CWAA 5IANA 3RS4A 2AQ4A 1YIAA 1E7SA 1GZ4A 3GCZA 3GRAA 2NADA 3H5RA 3L43A 5AW7A 3IVGA 1MMFB 3NUZA 4RA6A 2XNSA 3O4JA 3SP1A 2O8BB 2F76X 2FX3A 3WYEA 5CTJA 3KYCB 4H7KA 1OBFO 1V8FA 2RGYA 4J1SA 2WTNA 3RVPA 1VYVA 1QH1B 2COKA 3VSBA 4FTWA 1WMFA 2J87A 4AW9A 1HEYA 4C7VA 3L3FX 1E59A 4GICA 4A7PA 2GZSA 2J59A 3N2IA 3FMPB 2AUMA 3FXAA 2XJ9A 1I3KA 3D3JA 3M6MD 1B0XA 4NL9C 1B6GA 4HN2A 1KVRA 4CQMA 1MJFA 4PQGA 5LZ8A 2JA2A 4DLVA 4KVAA 2W6PA 1MN6A 4IUYA 5K4LA 4JB8A 3RYFB 4FHFA 4PY2A 2R00C 3FPKA 5E6SA 4C2BA 2CUZA 5EXDA 4I1VA 4X62B 2QTLA 1GADO 3V7LA 3MJSA 1EI9A 4NAUA 4CMJA 4BNXA 4MEAA 1GRCA 4LTNA 3ADPA 3GNLA 3DQPA 1E1CB 3A7EA 4BU0A 1LSJA 4X20A 3OQPA 2KI5A 4KVZA 3AVPA 1M73E 2HA2A 3B85A 3GGJA 5DNUA 2D7JA 3HKEB 2VR1A 1GUZA 3Q12A 1WY7A 3NATA 3DYIA 3OPXA 2E18A 2R11A 4JJZA 4LXQA 1BMTA 3GLSA 4P93A 3TQHA 4OOEA 1K9VF 4HO1X 4DDMA 5LIPA 3F5SA 5JPIA 4WJLA 3TLKA 2HMUA 4UJ3A 2DFNA 4AY4A 2R6CA 1Q1ZA 4PC3A 2HTFA 1CIPA 3ETLA 4D42A 3W04A 4EY3A 4LMAA 3IN5A 3M9MB 3N87A 1IM8A 4EA6A 3KT8A 3ETJA 3ZI0A 5B1SA 3AUSA 4ZCRA 5HTKA 2AKEA 3K73O 3CRZA 1VCNA 5TQ2A 4OUKX 2XOKD 3LI2A 2EP8A 2BMEA 5KREA 4U7DA 2Q8QA 1E6EA 2H8KA 5AJHA 1ZINA 2BR5A 3OWHA 3C8UA 5B53A 1NR7A 5E7JA 3HJNA 4JI3B 3HXTA 4A92A 1GNPA 3TOVA 4YT4A 3PNSA 5LMZA 1EE1A 5AXAA 1YRYE 2Z4RA 4OQ4A 4FKBA 3BIFA 5COQA 2ATVA 1FFCA 3LVBA 2A33A 2VG8A 5CLIA 5C9ZA 1JVNA 4RPGA 5EVJA 4MRPA 1R15A 1YRHA 3BUSA 4Y30A 5D51S 5DGIA 4LGCA 3OOHA 4UTOA 5KTTA 2HFJA 1JIHA 3ACBA 4MX8A 5EZ5A 3VR6D 4U5QA 5FLYA 2QMYA 1I7DA 1IRIA 3A3KA 1TLTA 3CO0S 2DYKA 5FWNA 3ND8A 5CNJA 4YQWA 3ND6A 4ZRMA 1BFDA 1K8YB 3DQZA 1TQ2A 3TD9A 1UM9A 4YV2A 5JI3E 4A26A 4D9FA 3ONDA 3VPCA 1SVKA 5H82A 2BR0A 1XKLA 1R6VA 5JCZA 4G0PA 4DQ0A 1N60A 1RYNA 2XVTA 1L4EA 4OQLA 2CEKA 2H2GA 3H2ZA 1YCHA 3KB1A 4BX0A 2M6LA 3R5KA 4BBAA 2OFWA 1B6SA 3HVIA 4CHTA 3DBOB 1GTVA 4TZKA 1THGA 4JN6B 3CZ9A 4L6CA 5DV9A 4XCVA 1U0EA 4EO9A 3RRNA 1RXEA 2X2FA 4ESEA 1L3TA 2VXOA 2QLMA 5IK2D 1XELA 5DFAA 2J7KA 2K4IA 5FBQB 3GAZA 2P9TA 3HCCA 4V0SA 2YW2A 4L72A 2J9GA 2J9YB 4QEDA 1R9JA 4EYQA 2F3SA 3AV3A 2Y8EA 1XDBA 1PV1A 2QGNA 3R7LA 1C7FA 4WNIA 2EC5A 3CURA 1ZG3A 4UBLA 2A0WA 1AKWA 3QA3E 1U81A 3HI4A 1WCIB 3C3JA 5F3RA 5HILA 2R7MA 3I2GA 3BJZA 5HYVA 3AY3A 3IKTA 2AVNA 3WI7A 1K5HA 3IIEA 5LQMA 2FSHA 3O9MA 1S3FA 4A6DA 3PRKE 2WQ7A 1QFJA 3UMSA 3ZV5A 1NOIA 1UOOA 1PEAA 1C30B 3G5AA 3DM5A 1RQ7A 1EWTA 1JX4A 1KEPA 4DMCA 5JJCA 1ZIDA 2F1OA 1ONSA 2NSHA 2PMCA 3MN1A 4RNCA 1KZYC 1I1NA 3IHKA 3QPCA 4RQ7A 3QXJA 3K70C 3E3AA 4CDMA 4DSIA 2EEZA 3OP1A 4MWDA 3NM4A 5D8DA 3FCAA 1WHTB 3CIOA 2CB0A 3OZCA 4ECZA 3B6MA 2B34A 4J7XA 3W4KA 2IYAA 3LYUA 4C0WA 3SMVA 2QIPA 2XC9A 2GPWA 2AHRA 2ZSJA 2VHUA 2G67A 3P5SA 1JQEA 2AJCA 4TGLA 4YCCA 1V7ZA 2OL4A 1WMAA 5DBCA 1VCOA 2IKSA 5JD3A 3QWFA 1NTRA 2HC9A 5B66U 2NZXA 1CUHA 1O7JA 4ENTA 2VC2B 3AFHA 4K8RB 1SL2A 3GH3A 2HBKA 4DSFA 2O5RA 8OHMA 5AYVA 1P0PA 3H86A 3REQB 3QMPA 4HEQA 4YJHB 5IJ0A 1I13A 4M7OA 3Q5GA 1WBDA 3ILHA 1DJLA 2MYPA 9ICBA 1II8A 4WKGA 1SMKA 1T3LA 2IUTA 3MJ4A 1CUDA 2IOQA 3CM0A 3O8QA 3IEMA 3U60B 4PXSA 5ALHA 1QFZA 2EWWA 1HLFA 4HWRA 4MJXA 1DDIA 4AF7A 3SZRA 1RQNA 1S9FA 2ZBDA 2VUTA 4G26A 4LIPD 1FBTA 9ICEA 2DT5A 1ECGA 2VNIA 1IH8A 3IAHA 4BMSA 1MENA 1XHFA 4AF8A 3VTFA 3SDBA 1P31A 4DR5B 4BLRA 4DQSA 3I2IA 2C3MA 1XYVA 4E03A 1SUSA 2WKQA 2WIAA 5DBOA 1EX9A 5DYWA 4EG6A 1QGAA 2CRXA 4M60A 1SBNE 3ZE2B 4UASA 5HDBB 4BASA 2GNOA 1W94A 1ZWLA 2XA2A 2HBRA 1M8FA 4I4CA 5H9VA 4DKXA 3ESDA 3BWEA 1FZTA 3QEKA 1G7TA 4YP3A 4JR0A 5C4MA 3L1IA 2W6NA 4HVCA 4DB2A 4UD6A 5I9MA 3LF1A 8ICGA 5ARBA 3AUXA 1L7QA 3RBDA 5CA0B 2KN7A 4HXFB 5FULA 1KO5A 5DN6A 3VDRA 1E94E 4FS2A 3RTGA 1RRFA 1DXOA 5C51B 3RU9A 2FPPB 4BWYA 4I2AA 3UQ0A 4TMYA 2L0XA 3FDJA 1JVBA 4NZMA 1C1XA 3BMQA 5G4KB 4ZIRA 2HJWA 1XU4A 4Z8YA 3G1UA 3WISA 1ODCA 4F9TA 1KNQA 1GNQA 4RQNA 5F98A 1S3SA 2NWQA 2B8TA 3GQCA 2HHHB 3CVJA 4AP5A 3ODGA 4LVOA 2BGUA 2DU8A 1BCSB 1NUAA 5DGHA 1W35A 2GK3A 3K7EA 3KEFA 2CK3D 1OX4B 2G76A 1TADA 5CAEB 4Y2YA 4X64B 1E89A 4MRVA 3ZDCA 4X5OA 4JQZA 3T54A 2YVAA 4ARIA 3TR6A 3QU7A 1ZCJA 1B1CA 4DZTA 2Q6IA 4Z54A 4O1IA 2WKPA 2LVBA 3TS1A 2WZDA 2Y2UA 1WB9A 3WGTA 4FKZA 2OH2A 3P71T 3WLHA 4O1HA 2PGIA 1KMIY 5LQAA 1OASA 4BO5A 1QKIA 3NAMA 5L7YA 5D85A 1WO8A 4C8NA 1XN1A 1A9RA 4IIVA 3LUHA 4G56A 4GS5A 2GJSA 4K5QA 1Z1VA 2GPJA 5AO9A 5HCUA 5C8DA 2P9CA 1J97A 4UB8U 3LG2A 4MRAA 2DCMA 3G2PA 1OYWA 2AX4A 3GC6A 4US2R 3CX8A 3ZXXA 1XZPA 3K70B 3KJFA 1PJQA 4H3KB 4B3GA 3A37A 4GR9A 4Q4HB 4B17A 5KYNA 4JOSA 3H6GA 2GYVA 3BTOA 4C7OB 4LFBB 3RAEC 2PZKA 4PF1A 3PX4A 3UOAB 4QYSA 2WJ4A 1EGQA 3SX0A 1VLVA 1L4FA 3EY4A 2OBBA 4B6FA 5JXWA 1YD7A 4EW6A 3MEQA 1P91A 3HXKA 4BV2A 1FP4B 4UBBA 1Y3IA 4BO0A 2JEYA 2BHNA 4I5GA 2SKDA 5C37A 1RVV1 3KM0A 1Z82A 4KQIA 4XJTA 4HDRA 1OC2A 1RWQA 2G0AA 4EBFA 3EDMA 4FINA 4Z3OA 3BCSA 4DSLA 1R4NA 4YP0A 3OOYA 4W82A 1VE3A 2YTZA 3R44A 2ROQA 3O90A 3ZEAA 2PUHA 1FYXA 2VSQA 4WZ6A 3AM9A 2ANBA 3KVNA 2XF8A 1I36A 4F92B 2JB9A 3X2EA 4ADSG 4BFWA 1RKQA 4NMMA 1E69A 5FT9A 2RGEA 1DB3A 1UQUA 5HWSA 2ID8A 4KN6A 2IVZA 2Y0EA 5LQJA 3B0YA 3GJ0A 1YB2A 4PRYA 2O7SA 2X2EA 3BL6A 4PX9A 5KL1B 4ZI3A 1G8YA 4PFKA 5DZSA 3GJ7A 2GRUA 3INNA 2RGNA 2ZW9A 4KBFA 5LSAA 3A4VA 4YYEA 2PD3A 3H9UA 1Y88A 2CZQA 1SNYA 3CNOA 2FLVA 2QAGC 2BPFA 1XRRA 3LNCA 1IJKA 1JU9A 3HJAA 4I2EA 1L5RA 4KLQA 4ZT6A 5U4QA 4TS1A 1DV2A 4XYEA 5BNIA 1UBFA 2J0VA 2QVBA 1SL0A 3WGUA 1SCBA 4BN5A 4JEHA 3OOEA 4TMFA 5IKMA 3V7JA 4ETMA 2C1ZA 1NMZA 2RGGA 2GZ3A 1VLZA 4DCNA 5CCBA 8ICZA 3AL0C 3VYUB 1VOTA 3M4YA 4DY4A 5JC1A 2E82A 8ICFA 3OM8A 2CYAA 3RD5A 4JLVA 3TI9A 4X8HA 4HX5A 4YT5A 3LHSA 3QKSB 2IVFA 1N2GA 2OAEA 4X00A 4HB2A 3HSSA 3STYA 1BEUB 5CEEA 2PUGA 3OZTA 2P4SA 2O8DB 4IGEA 2RHDA 1VYTA 4ZAFA 1UJMA 4JP3A 3L6OO 1SV4A 3JR7A 5FLKA 4EMTA 4WHMA 1LPBB 4QZAA 2OWDA 1X7WB 2ZXFA 4P80A 1MOZA 1IXZA 1YOVB 3RFUA 1CF4A 3IQEA 5I3CA 2J3MA 5CVUA 8ICLA 5D46A 6CHYA 2QK4A 5KWJA 4TSRA 1VLHA 2O4CA 4CTJA 4OHZA 4ER3A 2R68A 4CT4B 5AJVB 1KDVA 1EB9A 1YE8A 4M7RA 2BEJA 2ZWIA 2ACWA 3QXGA 1N5RA 2Z09A 4FX2A 4ARVA 4Z9XA 2BKLA 4MWEA 3NGLA 1RRVA 1FIUA 3SKXA 2W9BA 4IJUA 4DLAA 3IPAA 1G8FA 4EKGA 4KXUA 5IVDA 3DAFA 3JPOA 2WMOB 1KAMA 4V2UA 1DO0A 3QJ5A 1V37A 2D3DA 5A1TA 5MN4A 1M2OA 2XWBF 2I71A 2WAYA 1ZUNB 9LDTA 4DV3B 2OGZA 4IIDA 3K9BA 3CLRD 4R54A 4X8MA 1IPHA 1PK1A 3GV8B 1WWUA 2ZB7A 4DWVA 5LNK1 1G7RA 1OB5A 3RS7A 5DBEX 1EVEA 1GNRA 2BEUA 2RK3A 4FFPA 3NUGA 1L7AA 2K6GA 3TQ1A 4Z0TA 3KSUA 4REQB 2H5EA 1KO7A 3T3PB 1SXIA 2NACA 2PT9A 3H5OA 4J9QA 3D8HA 1Z62A 4BVBA 1C7ZA 4XX0A 4DA4A 2W8BB 2M6SA 2OQIA 3TEJA 4WNCA 4J1NA 2FZ5A 4D3ZA 4JLKA 2I6QA 4RELA 1GYQA 3PQ6A 5J23A 1MOSA 3V5NA 1OH5A 4KREA 4EWLA 1DARA 3IQHX 4Q7MB 4X7BA 5P21A 2V1XA 1XXLA 1HT0A 5H83A 3PIDA 3PUKA 3FWHA 3NOOA 4L8VA 4B3CA 4BQOA 2NVUA 3EF3A 1WMSA 4K9NA 2HRBA 2OFFA 4YJ3B 4KQJA 3HDJA 4D44A 2UZ4A 3NHLA 3QFRA 4HJXA 2FHSA 3TLGB 5JNUA 1VRCA 3FHOA 1U3CA 1V6CA 1XP8A 4YH1A 3UYLA 1S3IA 1SUPA 2BEKA 1L5GB 3CPEA 4QIWC 1M6NA 3N2LA 4MCHA 3I2YX 1UBNA 1GTSA 4CJXA 3PUHA 3Q7SA 1F6WA 1M2KA 1A5BB 4XDHA 3GIKA 4BO9A 1VIAA 1J70A 1K8ZB 3LDHA 4C21A 4LWPA 4YRPA 4BMCA 4YRJA 5K3BA 4JY7A 3LRTA 5AW6A 2WLTA 4QGBA 3S7TA 3MJTA 3FLAA 5ED0A 2X4IA 1PTJA 4JBLA 2VJPA 4W5QA 1JFTA 4R2KA 2H2WA 5CD1A 4RM2A 4TL8A 1BJKA 2XEXA 3OOSA 3DKVA 3MQFA 4U3JB 1PGOA 2DWUA 3KU4A 3ZGVA 2R8IA 4QKQA 1UBLS 4NFSA 4NKRA 3RRFA 3ZOZA 1JR3E 2QP9X 2QZPA 4AJJA 4CRXA 1EGHA 4WXYB 4X41A 1DUIA 1ZSVA 1N9GA 3QTLA 4ARUA 7ICMA 1I4OA 3WMXA 5IKEA 4E4YA 6REQA 2QZ9A 3TXYA 3JQQA 7ICJA 4G97A 5SY6A 1XMOB 4C14A 1EESA 3OZSA 1UZUA 1U0RA 1T5HX 4LECA 3GLGB 1AKUA 5U1PA 1QMGA 3RS5A 3KZVA 1PWXA 3BBLA 3BE8A 4JSRA 1KO1A 2O3QA 1D2NA 1NM5C 5FR1A 3NCTA 1L5SA 1KO4A 1E6CA 5BNTA 4RIIA 1JFLA 2DGDA 3RV3A 1BXGA 2FWRA 3WRXC 5T5QA 1VZ2A 3LBHA 1MX5A 1OHHD 3BIXA 3BQNB 2W2NA 2CVQA 1U3TA 2PMZC 4KXMA 1P3JA 3EZGA 3OIGA 2QRHA 1F3LA 1L4BA 2EKDA 5LKRA 5EIBC 1GG8A 3AZOA 4I4TA 2M2IA 1XCOA 3BWBA 4I1OA 1NNEA 1QK4A 3WXBA 3V6MA 2Q6KA 4N6GA 3PHGA 5KTNA 3R5XA 2HMVA 3AW9A 3RH0A 5D5QA 4QXRA 4PZUA 3PUZA 1SUWA 13PKA 3L4EA 1MOQA 3PEWA 5J4KA 2R1VA 2UV8A 5AHRA 3ZW7A 3CLSD 4HMQA 1NHGA 4ND1A 4PYKA 2B83A 1LRKA 1MA7A 4MROA 2KEYA 4OQFA 3RSLA 5BUQA 1T5TA 3ZXUB 3HJFA 1NRWA 2FUG1 4WOCA 3OPNA 3L7MA 2RHCA 3KS9A 2NRZA 5B7PA 1WSDA 4IIGA 4RS3A 3THRA 3A70A 4L5BA 3RR2A 1Q0HA 3EOZA 3UJPA 3KZCA 2G0TA 3QKWA 4DO9A 3PJEA 4PZEA 4IZ6A 5KFQA 4DR2B 2NU7A 2F17A 1KPGA 3JR3A 1K68A 5GPBA 3N7TA 4CYMA 1HSOA 3WRYA 3ZJVA 1VL8A 3DXZA 4L50A 1OB2A 3O38A 2X1MA 1E62A 3AONB 4D3XA 1L9XA 2ADFA 4TTTS 5TNXA 3M5WA 1H3NA 3H11A 3HLTA 1B8VA 1HEUA 2CBZA 2AXEA 3D5QA 1Z7EA 1T4CA 3RPEA 5TMBA 2PMZF 1JJFA 1N3IA 1Z08A 2YWJA 4DR3B 4IZIA 2O3JA 4JL5A 4BFVA 4GX5A 2AC2A 3M6XA 2EFJA 1VECA 3IBFA 1OLXB 5LOVB 4NLBA 3EYWA 4DIFA 2ST1A 4QG7A 3B1JA 1X7GA 3UK6A 4WUTA 2GN9A 1FU7A 3RTBA 5FUWA 1C7YA 2YY5A 3DZIA 4GXKA 1SOMA 4XXHA 4Y6GB 4NENA 2Q7DA 2CN1A 2NYAA 4R2LA 4CLRA 3VV2A 4R8UB 2NUBA 4Y2UA 1ECFA 3I53A 4G8CA 1FUIA 3M9OB 1SWVA 2Z30A 4MTLA 4DDWA 1DTSA 4NJEB 4F46A 4O0IA 4C4ZA 2BP7B 2M32A 2M98A 1E2QA 1X9WA 4RKRA 5JJ5A 3DTTA 3MIZA 3F96A 3BKXA 4WLFA 1I6WA 3G2IA 1IJFA 5EQTA 1M5UA 2Q5OA 3ELYA 3PC7A 5FI5A 4PCAA 3UJ8A 3MB5A 1I1OA 4IL6U 4JBIA 1JEDA 3L6BA 3TOXA 3IA2A 1QHXA 3BX1A 8ICIA 1PR2A 4L85A 2A67A 3L82B 1HT1E 4CVNA 5GINE 1BS2A 2IUUA 2ZFUA 5CIWA 4C3VA 1TRHA 4YGXB 3IO3A 5KFKA 1NP6A 3V2IA 2XCPA 2D0IA 4RKFA 5CB0A 2RGAA 5HG0A 3IHWA 3NBZC 1T0UA 5A05A 3HY6A 1E5QA 3TD2A 4F6RA 1TM7E 2AG5A 2VA3A 3WGYA 3HUFA 3UJCA 1X1BA 3GLFB 4MFFA 2EV9A 3CNNA 3MWYW 3E8MA 3K16A 2AG6A 4M53A 2NM0A 4KXXA 5C4IA 2PG3A 4ICAA 3LQYA 1NZBA 2DLNA 4HDKB 4UAYA 3K0EA 5JZSA 4I4TF 1Z00A 4TL9A 1CZNA 5J4HA 1U8ZA 1CDZA 3I6ZA 3FCOA 1D4OA 1CS0A 5DIFA 3V97A 3P0JA 4CV1A 1WSAA 3PUVA 3T9EA 4MKHA 5IVIA 1F2TB 4BHTA 4AXBA 1ZQCA 5BR1A 4G0QA 3KKQA 2I6XA 5JAOA 1Y34E 3IVRA 1RYRA 3EZFA 5DOVA 2FA9A 2PRJA 4UXIA 1WU8A 3ONVA 4UTPA 4DDUA 2MRLA 4TWZA 2WHPA 2IRWA 2RIRA 2FETA 4N5IX 1QK5A 4MWTA 3E23A 3QVLA 3FOZA 2NP7A 1UKEA 2PKXA 1D1QA 1PEDA 1ENOA 5JXIA 2JKVA 1S6YA 1N62A 1OE0A 5JAZA 3L8MA 2BH9A 1LSOA 1JSCA 3DV0A 3IMGA 2XOEA 4I3FA 2QE7A 1OLSA 1ZH2A 4G85A 4DMLA 4HDMA 4LYHA 4A8JA 2GM3A 1YMQA 3LBYA 5H80A 5LNK6 3NRCA 1ZN9A 2XZDA 1Y4AE 1MRNA 3S5UA 3A2NA 3ZE8A 4S1VA 4EFMA 4EP1A 4WNYA 1MO3A 1OQAA 3HWTA 4E13A 3ZGZA 1RADA 1WZCA 3W9UA 2G0NA 4OYLA 1E9DA 4B6GA 3ZV3A 1UBSB 1UMDB 2DKOA 3A6DA 1E4OA 3UO8B 3E0FA 2Y0PA 4V0NA 3QLVC 2IHNA 5GGYA 1SBCA 2NO4A 4C4PA 4M6WA 4ID9A 2X9GA 4IVRA 3QHAA 3T5KA 4PPGA 1HYGA 3KHRA 5I47A 4PN3A 2YFQA 2ZJ6A 3BKWA 5KMGA 3D3QA 4AZ3B 4MIKA 2X2OA 4ELUA 1OXUA 3QEJA 4UM8B 2EERA 4HI0E 2EW1A 3H9EO 2W6ZA 3PX7A 2C07A 3GMTA 3F3YA 3KQYA 5KSWB 1ODLA 3JQRA 1IZ7A 1GJRA 2ETXA 1H5UA 1E6LA 2JFPA 3FPGA 4TTPA 1K2VN 2F1RA 2EYUA 3LX6A 3MFYA 4RTNA 2B4QA 2VTBA 3TLAA 2AD1A 1XZCA 1G6Q1 1TQ4A 1JTVA 2BMJA 1FX1A 4MQ6A 4D80A 2PBFA 4OGKA 4ATNA 4ZOLB 3L7BA 4A15A 2QTWB 4YXMA 4G4IA 1OA1A 1OT3A 2B4AA 3DDCA 2IOHA 2FSUA 2Z6VA 1GSHA 2J4FA 1DV1A 3LHDA 4QTUB 1U0FA 4ZI5A 4AURA 3HCDA 3OJ0A 1OXSC 3ITKA 3KUDA 9ICKA 4YJFA 4MQBA 4GQBA 2JLQA 3RAFC 4WKOA 1QKJA 4K6KA 2AQHA 2AEEA 2FW8A 2O1WA 2P5UA 4YCDA 1X1DA 4YN3A 1CQIB 4EQ6A 1AGXA 2UYGA 3GFRA 3C15C 2BC9A 1UKCA 1ZP6A 2ZZKA 4C1BA 4KMRA 1DFGA 4QARA 4B71A 3AR5A 3GJRA 1E2LA 5GJWC 2A5LA 5K0JA 4BKUA 2RKBA 2IOFK 3CEPB 3HGMA 1GPBA 2W9CA 1CWUA 4IYJA 2I4NA 3VNBA 2OCBA 1I2DA 2Q3EA 4G3XA 3LUKA 4YP7A 3LO8A 3LUBA 1WRBA 5CJPA 3OZDA 4OJLA 3ROQA 2XNDA 3ZX5A 1Z5PA 3KUUA 1ZEMA 4FYYA 3AVXA 2OD9A 4TWAA 3UT5B 4GX2A 2B69A 2W93A 3DC2A 4CKZA 5BRJA 2N47A 1XMSA 2VYCA 3Q7IA 1E66A 5CU7A 1T1RA 1ZCZA 4PYMA 221PA 1F6DA 3D59A 4ARSA 2E8PA 2VWHA 2J0EA 2PT5A 2X4GA 1WBJB 3AH8A 4EELA 1JHZA 2IXDA 3G49A 3LLUA 3WLIA 2JD1A 1L7DA 1BD4A 4KHPB 5DPMA 3ZE6A 3SGLA 3VU3A 5IXSA 3ECSA 2B7BA 3SOPA 3ZDQA 3DE6X 4A3SA 3HB0A 1LTQA 2BSAA 2OD7A 1MA0A 2JIPA 2FLLA 4O4IF 4UHHA 5CK5A 4ENVA 1PGNA 4ISCA 2WUEA 3AIOA 4ZHSA 4XUDA 1K9SA 1E4YA 4PC1A 2PEZA 4LDRA 3IP7A 4CQNA 2BFBB 3SZ3A 5C0YA 2PLAA 1NVAA 3FGPA 1BGXT 5COAA 2BMFA 5HBGA 3I05A 4BMYA 3BXPA 2H0RA 4OX9Y 4D4IA 3F6EX 3IOMA 4AJLA 1CLUA 5H4GA 5TEVA 1BRMA 3KYBA 3DAPA 3OIDA 2W0MA 3UW3A 3IOBA 4RMIA 1Z18A 3HSYA 3AIIA 2GHIA 5E6RA 4MA4A 2O20A 3K0CA 3HRKA 4M1OA 1TC2A 2YVQA 3A4YA 4J94A 2ZULA 2MINB 1ZQFA 3GCWA 2IQ5A 2Q5IA 4ZAVA 3E70C 2EATA 5MF6A 3F8SA 1KWGA 4QZBA 1XQYA 4D8UA 3MT7A 2GN4A 3S8EA 4P36A 1WMEA 3EQZA 2FUG6 1D4AA 4FGJA 2E21A 1DAGA 5F5NA 3LOPA 2A5JA 4WZAB 3VPXA 3MTJA 4MRMB 4BOYA 3QELB 2OR3A 3IG8A 2GPBA 2REQA 4MLDA 4D26A 5KYUB 2GB4A 4HLNA 2XV1A 1PN3A 1Z22A 4A2PA 5JO0A 3RKSA 1Z83A 1NAHA 2C96A 3RSQA 1OW3B 4TM8A 3PGJA 4CEIB 4V24A 3UOGA 3PMLA 4UAGA 2OGUA 2I34A 3PHJA 2CJYA 2Z57A 1FVXA 1VG0B 1RYEA 1T1IA 5EJ9A 4BZZA 4QYTA 2FPKA 3NAZA 2Q29A 3BJEA 4EVIA 1QP7A 3A1SA 4TKVA 4IH9A 4MYHA 2NNLD 3GLQA 2RGWA 3ZOKA 5JZMA 4EGCB 5E4YA 1FUEA 3SAJA 3UTDA 3A9SA 4RYDA 2YN4A 3ZW8A 2EAMA 1D1SA 3W5JA 10MHA 5EJ2A 5DNVA 3J80A 2QD1A 5H2FU 1L7OA 3L1HA 1DXQA 2O1EA 3YASA 3ST7A 5G0VA 1U0JA 1KRXA 3IUPA 3WLOA 4C0LA 1HFKA 1FU4A 2GOYA 1KS2A 1R64A 2HVHA 1M72A 3CZAA 2NUAA 1G21B 5NLLA 5TMDA 4HAVA 1EJBA 1MB0A 1Q15A 2VAMA 5CYGA 4I5DA 3HVHA 4JELA 5ABPA 3TTSA 4LRTB 4FYPA 2QRZA 1ML4A 4HXGA 3U7EB 1VSBA 3OA2A 4R3UC 2JFGA 4NFHA 4KAXA 2O7RA 3OT4A 4NQRA 1BQ3A 3DV2A 4WL0A 5CURA 4DF4A 3WLLA 1NQOA 1Q7BA 2YWXA 1YH3A 2FSGA 1USVA 4TLMB 3LQ1A 5L9XA 1ZQMA 4QWDA 3IAAA 2GT1A 1U3GA 2GSWA 1LPPA 3DZJA 1XJ0A 2LPEA 3RFCA 1A9ZA 3WWOA 1F2UA 4RDIA 3VMMA 2EIHA 2CCGA 4M9SA 4DL6A 4TN5A 4XIFA 2G07A 1KJZA 3N76A 1FQJA 4BGUA 4HLDA 3V4VB 1YZGA 3TG8A 3RJ5A 2HHVA 1MLDA 2IPLA 3M4ZA 4EYEA 4Q9NA 5A2GA 3HEAA 1JDNA 1KJYA 1JG4A 2KBFA 1XNQB 4OXQA 3RASA 4ESHA 4F3KA 4DMKA 3Q4GA 1JNYA 1JNXX 1ZJYA 4E2ZA 5CRXA 3KV1A 5DHUA 1AS3A 4BP8A 4RUCA 1R74A 3X43A 2E87A 3OJEA 2ZIXB 1PT8A 2X9NA 4AYXA 8ICSA 2EIXA 1SZDA 1NXTA 2Y3IA 3PUJA 2DUJA 1BHJA 4LF5B 1X9MA 3M4XA 4M0KA 3FTQA 3OE7A 1E1LA 3W6OA 4JBWA 4K9DA 3RS0A 3SD7A 2I6TA 2R87A 2O5EA 3DTVB 5TSDA 4FW9A 1KSJA 2HAEA 1JIVA 4V0MA 3AQIA 1O95C 1RDFA 3PU6A 3OFSA 1XA0A 1NMEA 2H0AA 3IQXA 4QVIA 3GJ6A 4C2TA 3W34A 3QFFA 4LDZA 3KKKA 3O26A 4NLZA 4XGNA 5M2QA 2GEJA 4XWYA 2DBZA 2A58A 1LKYB 3QXHA 3D2QA 4H31A 1UP6A 3DT8A 1UKZA 3Q6IA 4ZCQA 2H18A 3V80A 1O9BA 2HA7A 5C1IA 5LWQA 3TKAA 2IYWA 5ALOA 1JLSA 3HA5A 3OQIA 3ZWXA 1SRRA 2NG1A 3U9LA 5I9TA 5KFRA 1R00A 2HSDA 5AKXA 3PICA 2FPUA 3SIRA 1FUKA 4EKNB 4XVQA 2A5FA 1EHIA 2Y05A 2YYSA 5KINB 3K09C 4F4UA 1WXIA 4MGHA 2YS7A 1I6KA 4QECA 1VLMA 1PFVA 4M46A 4CKWA 2JZCA 2C22A 3GEDA 4UZEA 1V7CA 1C0PA 1FW8A 2C84A 4MR7A 1WPGA 3BGVA 3MK31 3PR2B 1YZ7A 2R97A 2WM8A 4ZN6A 5F51A 2H52A 3DZDA 4RETA 3DWGA 3NVYA 3ZIAA 5CXXA 2HA0A 4JOCA 1KYYA 4OHXA 2B20A 3TQQA 3WGLA 1G5PA 4BB5A 1AKEA 5K8UA 5EZ6B 2BKEA 4U7FA 1E2JA 5L1KA 3GUYA 4UPDA 3MWKA 4JR1A 3LM8A 4J1TA 7ICSA 5B3JA 2R96A 3ZYZA 2CVFA 4TTAA 4OQEA 1AZLA 1H8EA 3UAWA 3KHSA 2ATCA 2ZT6A 2LWIA 2ECKA 1ZK2A 1C41A 1XQWA 2B1RA 4YRGA 1PR1A 3O8NA 2B2XA 2O2IA 1QH8A 3GQBB 3IDWA 3FYDA 1D2HA 1T9HA 3CINA 3E9NA 7YASA 4MDHA 1YB1A 3ASVA 1EDZA 3WE7A 5D4BA 3ASUA 1XAJA 1QQ5A 5GTIU 3A6EA 1ZNYA 1JV2B 2FWBA 1SBQA 3TZBA 3FHTA 3TEFA 3UN1A 4OQPA 3L7NA 5TVGA 4HEJA 1TVAA 2P9BA 4TUPA 3QPVA 1BPZA 3PUYA 1N5OX 3KSAC 2X0NA 1JIJA 3QM1A 1JQJC 5DMXA 2XMSA 1ORVA 2JEZA 4QW8A 3RS9A 4NECA 5BY2A 4L22A 1V4VA 3PTLA 5J2IA 3RVQA 1Z0SA 1ATZA 1T15A 3VR5A 3O95A 4WV3A 3K2QA 1HV8A 4OA8A 3O9ZA 1OILA 3KUCA 1A98A 2OORA 4JXJA 3OLYA 3WMGA 1H1DA 4BO1A 3UTCA 1PVOA 1RBMA 4OX9B 1JIIA 4QT0A 4LBYA 5CP8A 5DGXA 5E2AA 2IDJA 4DLUA 3SQXA 2H1FA 4ALMA 1BXRA 3TK1A 4IMRA 2C59A 2NTJA 5EUBA 4PAOA 4RL6A 1KI6A 1UMKA 1AC5A 1DJNA 2QR5A 3WHIA 1O4VA 4Z86A 1ICIA 3QP9A 3RC3A 1TCUA 2P6OA 4YPVA 4WK2B 5I9SA 3T7SA 3KD3A 3BQMB 5DYYA 3OTHA 4CM6A 3O8OA 2VK2A 2B8WA 4JEUA 5B3JC 1QONA 4ZVTA 3EXHA 4DHEA 1CUIA 3RB8A 1CF9A 4WCVA 4V1CB 3NVAA 3I9MA 4PHEA 1VI6A 1BMFD 3DG9A 3ZJ4A 5CB8A 3D54D 2QX4A 1Y8RB 3LRPA 1XA3A 5EFOA 5JRZA 4KH1A 1PFQA 3AX6A 1KI2A 5EWEA 4BCBA 1QX3A 3K5IA 1IQRA 3I5XA 1AHHA 4FNMA 2HHCA 2VQ3A 4CM3A 1NX6A 3T0GA 2PK3A 3NEAA 3K6SB 4B9VA 4C04A 1YUMA 3OZUA 1QO0A 1U0NA 1ID1A 4EBBA 1PZNA 2HO5A 2VSOA 3NW9A 3M6FA 5EHXA 5SZIA 1EDDA 4U7CA 2VS1A 3FMIA 2XCTB 2Y76A 1URPA 1X9XA 4OAPA 3PDCA 2XNJA 1D2AA 1YGYA 4WKNA 4P33A 3JZFA 5CNMA 5BNWA 4BUZA 2YDXA 3TIVA 4QZ9A 4J07A 1GGNA 1SQ0A 2OORC 3MINA 1B4DA 1SOUA 3MC1A 4L07A 2AGPA 1JRLA 3MD0A 3GRPA 4L27A 1FMLA 1ULZA 2QRQA 2YX8A 1KO8A 2VJDA 1F51E 3WFIA 1R4AA 3PQ4A 1XMVA 1GKLA 1KFBB 2X1HA 2O06A 1BOFA 3L0CA 4B5LA 4QLOA 3A0BU 3SZ2A 1QGOA 2ZRMA 2NU9B 3FAKA 3OSNA 1G5QA 3M8KA 4ZWNA 1G8MA 3R9KA 2QQFA 2B0JA 3VPBA 2HIHA 1F3OA 2H3QA 3VHXA 3ZY4A 5KFEA 1HEIA 4OJNA 4D5EA 3K0HA 3H0LB 2HNKA 1GA4A 2ZE7A 1P8JA 3DNPA 2KIWA 1MN8A 2NT4A 1COZA 4IICA 1DOZA 2LZ0A 3V8EA 3WLTA 4YG2A 5T4FA 5D5PA 3MJEA 1ENZA 1CZHA 1DG1G 2YYAA 3LUJA 1LFDB 5ALKA 1SIOA 1JDSA 2Q6LA 1PBNA 4QFDA 3ESBA 3Q3HA 3L8HA 1NK8A 1Z5UA 2YV1A 7ICTA 1XXHA 5BQXA 3E5MA 5G40A 2PX4A 4E0BA 5ALYA 3OFND 1NVFA 1Z2OX 3KCNA 5DTJA 3U48A 3KAJA 1WIWA 2CXPA 1N2CE 4B82A 3GHHA 2BTQA 2ADOA 2QMUA 3ZW9A 1RBZA 5LM3A 8ICYA 2HSJA 3LFTA 4JBHA 1CC1S 3QYAA 1V9CA 3GIDA 4PLWA 3CZPA 1ZD3A 1T36A 2K87A 4JI7B 4RCYA 3VTAA 1T9AA 3PC4A 2O5CA 1BO6A 1R37A 2BBWA 1G6HA 4WOBA 4CQMB 3AT1A 3M8SA 1AE1A 3ZDEA 1RCUA 1U0HC 2QWXA 3ESRA 5LDDC 3CE9A 1Y8QA 5TGDA 2EG9A 3UJAA 1OJ7A 4HGQA 2EZZA 4AC9A 4OJPA 2QYHA 1CETA 1FLDA 1LLUA 4HV4A 1J22A 3TAUA 4S04A 2HK6A 2FZCA 3G3EA 5E6SB 4II3A 5K5EA 3P9YA 4QATA 2CNWD 5G2OA 1MEEA 1SL1A 2CNLA 1Z4KA 4L5YA 4YAJA 2VJ4A 1BKDR 2FF7A 3P9NA 5LZ5A 5FI3A 3BJIC 2XNCA 1WTCA 1R0ZA 3X1JA 4PZZA 2OLEA 2ZRBA 4X20B 3MTDA 5FAKA 2O2EA 3FTEA 3ZWMA 3EPPA 3KB8A 1MA3A 5T3UA 3O8BA 1JEQA 3A7DA 4P82A 2VANA 1Y81A 3N8GA 4HB3A 1WZEA 4BLPA 2GESA 3GAFA 3VSDA 2ASDA 1XMIA 4H6VA 3VM6A 4L5CA 3RBAA 4UU0A 2Q9CA 4OYYA 4YAFA 1GZDA 4QBFA 1RM6C 1BHSA 1KVSA 4MV8A 4BX2A 1DQPA 2JCXA 3H5NA 1Y3CE 2X7HA 3JAKA 1KFJB 4RY9A 5EJMA 3LCUA 2F2TA 4RQMA 2EW2A 4MVJH 5J40A 4D46A 2AEFA 4K81B 2EL9A 1RYUA 5AVVA 4IY1A 2R5WA 3EA5A 3WO1A 3ZDDA 3HFRA 4R1NA 5AW2A 4AYBF 1P2UA 2QVGA 5TQ2B 1AJEA 3JWGA 3MOIA 3KK0A 3TCXB 1E58A 1C3LA 3BOSA 4OB8A 3QXSA 5CLFA 4ECUA 1XYYA 2OHXA 2Z5LA 1SUBA 1ZIYA 2FN7A 2EZTA 2BI4A 4Q8FA 4HGRA 3R5FA 4ITVA 4DCSA 4JMLA 3U9TA 2G4LA 2C3PA 1EAYA 1Z35A 1XV5A 3LLVA 5JMWA 2XO7A 1XDUA 4XCXA 3DP9A 5A2QA 4IRCA 1JXQA 5KWIA 2HOFA 2BCEA 2PS9A 5EC8A 3I9KA 5AJZA 1QYWA 4A6PA 1JEYA 1ULAA 4C8OA 2E7ZA 2DUUA 1AQNA 4HQLA 3I1JA 3N86A 3JXEA 4YLGA 3CJRA 5H59A 2H4FA 3J7TA 3H6KA 1I3LA 3UOWA 3SM9A 4K9SA 4Z6DA 3N6RA 3G9UA 3KTDA 1UM9B 2EQBA 5DB4A 4JOQA 4G0NA 3IX7A 5FAXA 3OQMA 2C2KA 1PG2A 5B6IA 3QVUA 4ND8A 2ZYUX 2AFHE 5FA8A 1T3ZA 1A2QA 1E2FA 2C03A 3L8ZA 5GZ3A 1Y48E 2PCLA 2SBTA 4QGHA 3OGUA 3HO8A 4F7DA 2JHPA 3AP2A 3A26A 4IXMA 1FJGB 3I9V1 3PG5A 1M7GA 5DLFA 2V6JA 4LWQA 1AN0A 4B3MB 4GPZA 4P4MA 5DT2A 5LKAA 5HRAA 4X85A 2FWAA 4HCJA 4V0KA 5JU5A 4HATA 3Q7PA 3VJKA 3OTGA 4LOAA 4PO3X 3MUEA 4IDHA 1YVEI 2GK4A 1NJ1A 1FVOA 4K6OA 5IJ9A 2NPFA 5EWLB 1H23A 4XWGA 1XHEA 4F8EA 1SCAA 4G89A 1KEEB 2IH4A 2ZRQA 3EG9A 4Y1EA 2CLFB 1K5OA 1RI5A 2Q6TA 3ETCA 3S2GA 2I7XA 9ICFA 3ROZA 4DDKA 4U2DA 1HYEA 4RH1A 5IMSA 4A0RA 4A8PA 3NBYC 5DQGA 2DL0A 5JFGA 4RCVA 4RK6A 4EAQA 3G0BA 2GK7A 2AU0A 1KNXA 4BL5A 4HAOA 1IFXA 5CEHA 2LI6A 3PA8A 1J2TA 3PJDA 4QDZA 5IAEA 4LI3X 2NO1A 3HJTA 3TLCA 1PJ4A 1E0SA 1Q19A 2A9PA 1WUYA 2IZ1A 5M29A 1VL0A 4PAMA 2O52A 5J0UA 2PXIA 5EE5B 3HXLA 1VMIA 4U6NA 3G1TA 5DM4A 5DQHA 4I6GA 3F6PA 3R7FA