2WF8A

Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, glucose-1-phosphate and beryllium trifluoride
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near attack conformers dominate beta-phosphoglucomutase complexes where geometry and charge distribution reflect those of substrate.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 79
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf8A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf8A01
5ALHA 3EWIA 4BEVA 2CFSA 3QU7A 4Y3UA 5AVQA 3WKAA 2B30A 2ZXEA 4L6CA 4EX6A 3UMBA 2G80A 2R8EA 3SHQA 3A1CA 5AVYA 3L1UA 5AM2A 1RLMA 5ALJA 3N8GA 2W4MA 5AHXA 1RMTA 4BNDA 5ALUA 3TLMA 1AQ6A 1ZRNA 1KYTA 4MUMA 5ALFA 4FFDA 1Z4PX 5AW9A 1NF2A 2O2XA 3KC2A 3QUCA 5ALSA 2RAVA 2RBKA 5AVUA 4CF3A 2JAUA 3BA6A 5A3RA 4UARA 2FPUA 5AK5A 2G06A 2HEGA 2WF9A 1YDFA 4MWOA 4EX7A 2YJ5A 3UMGA 2HX1A 2R8XA 5ALRA 4ZEVA 5IT0A 2WM8A 3NASA 1VJ5A 5AW7A 4UMFA 2YJ3A 1Z4LA 3KOOA 3R4CA 1XPJA 2JAWA 4BEWA 1YV9A 4OHFA 3AR5A 1SWVA 1RDFA 5AI5A 2HOQA 5AKXA 2WF5A 4CF5A 1IWOA 3L8FA 5AKZA 2AH5A 5AM5A 2Q4TA 3OCXA 4IG4A 5ALKA 2BDEA 5AESA 4C4TA 2AGVA 4KYTA 1Z88A 3KZXA 3OTQA 3WGUA 2W43A 4KNVA 1VFPA 4YCLA 1TE2A 3OCZA 3PCTA 4HGRA 4J2TA 3QLEA 3ZU6A 2GHTA 3ZX5A 4UW9A 2FEAA 2GHQA 4CF4A 4NFLA 4UAVA 5ALVA 5AVWA 3NANA 1Q91A 1ZS9A 1RQLA 1RQNA 4BBJA 2MSNA 2HHLA 1J97A 5AKYA 1T9ZA 2EARA 3U7EB 3RFUA 5ALEA 5ALWA 3AR4A 4YCMA 1YNSA 1L7MA 4UMEA 3WGVA 2B82A 5AI4A 2I7DA 1Z4OA 5AW6A 3SD7A 3E8MA 2HDOA 2HCFA 3NRJA 2ZBFA 3FM9A 2C8LA 2NYVA 3ZVLA 2AUTA 3WK9A 1S8OA 3OCYA 3DV9A 1YS9A 3I1YA 4NABA 3W5DA 2WF8A 3QUQA 1S2OA 1TA0A 3MN1A 5A3QA 2ZBEA 4UMDA 3IRUA 3R9KA 3A3YA 3QGMA 3QNMA 3RF6A 2ZBGA 2FUCA 1RMYA 3U7GA 1ZRMA 2O9JA 4KN8A 3WK5A 3ONNA 1WR8A 2C9MA 3IJ5A 4HGQA 3I28A 3ZWDA 4Y2RA 3FVVA 3OPXA 2IOFK 5AM3A 4BX2A 5AM0A 3FGOA 1QQ6A 5ALPA 3B8EA 4YIKA 3PGVA 1QYIA 3FZQA 3A1DA 4Y2UA 3SKYA 5AKKA 5ALGA 5AKLA 2HI0A 1WVIA 3OCVA 4GIBA 2FUEA 2HF7A 2FI1A 5AKEA 2YY6A 3QU5A 1ZD3A 5AW1A 3SLRA 3AR6A 1L6RA 1T5TA 3EF0A 3OCWA 4G9BA 3L8EA 5ALIA 3QUTA 2Q5EA 3CNHA 3WK6A 3WK8A 4Y2YA 4I9FA 5ALXA 3WKEA 2ZG6A 3QX7A 2DQSA 1X42A 2YMMA 4Y2QA 2CFTA 2NO5A 5AK4A 3KD3A 1RPZA 3J7TA 2I34A 1MH9A 3WKDA 3E81A 4F71A 2P69A 3B9RA 3L1VA 4XPZA 1PW5A 1U2SA 4BX3A 1TJ5A 2YFYA 3ZTWA 4B6JA 3F9RA 5ALDA 5ALYA 3ZI4A 4I9GA 1Z4JA 1L7NA 4L57A 4UU0A 5ALTA 4HGNA 4Y2VA 3N07A 2OBBA 1T5SA 4BX0A 2Q4RA 3L8HA 5AVXA 4EZEA 3L0YA 4OFZA 3E58A 3QU2A 3A1EA 5AW4A 4J03A 3N1UA 2WHEA 1O03A 3I76A 5ALLA 4AP9A 1YMQA 2G07A 1F5SA 4UU1A 2R8YA 1RRCA 4CE6A 3QU4A 4UASA 5E0OA 4H1WA 5AKJA 3U26A 5AVZA 1Z4KA 4EEKA 4C4SA 4ZEWA 4AS2A 3OCUA 3FPSA 3IB6A 2OM6A 1QH9A 3NUQA 2C88A 3M1YA 3ZTYA 4JB3A 4QJBA 4BNDB 4UATA 2FPWA 3U7FB 5IT4A 5AM1A 2B8EA 2G09A 2I6XA 3ZVMA 3N5KA 3ET4A 1RLTA 1TJ3A 3WK4A 3U19A 3VAYA 3QUBA 2C4NA 2PR7A 3AR8A 3WKCA 1EK1A 2FPXA 1RKQA 3SKXA 3U7HB 2B1RA 1ZOLA 3SMVA 2B8JA 4Y2XA 4YCNA 3W5AA 3QU9A 3AR3A 2YMLA 3UMCA 3NIWA 4YIHA 3DDHA 4L6AA 1ZD4A 5AI6A 4KX3A 1U2TA 5JJBA 4NV0A 4QQFA 1L7OA 4XQ0A 2NO4A 2IA5A 2GFHA 3AR9A 2WF6A 5AKIA 1L8OA 4BKMA 3L5KA 4YH1A 3K1ZA 2G08A 5AIAA 2W11A 4JDPA 4OCZA 5AW5A 2I33A 2BY4A 2GMWA 4CNQA 4UM5A 4DW8A 5AKHA 3ED5A 1RMQA 3L7YA 3KDPA 3MMZA 2EATA 5AVTA 2D2VA 2RARA 3UM9A 2JARA 2PKEA 2YN4A 3S6JA 2EAUA 2CN1A 4F72A 2IOHA 2FDRA 3FPBA 2BDUA 5AI9A 2R8ZA 4PNHA 4UM7A 4EELA 1YJ5A 2P27A 1TJ4A 4AS3A 5FP0A 5AVVA 5AW0A 3D6JA 3W5BA 4UMVA 1RC8A 4BYGA 2ODAA 4YGYA 1Z5UA 3ET5A 2QYHA 4HGPA 3ZW7A 3AR7A 4EENA 5ALQA 4UAUA 4HGOA 4DFDA 3CZ4A 3E84A 1RKUA 2X4DA 1NNLA 1Y8AA 3N28A 1FEZA 2P11A 5AI8A 3ZX4A 1RLOA 2I55A 3MPOA 2PQ0A 1JUDA 4RETA 5ALZA 1WPGA 3AR2A 1L7PA 5AW8A 4FE3A 3B9BA 4HAIA 2HF2A 3BWVA 3MC1A 1J8DA 3L8GA 1ZD2P 5AKGA 2P9JA 3ZUPA 5ALNA 2GO7A 5AK6A 3NALA 5AI0A 3PGLA 2FPSA 3WKBA 3U13A 4ZEXA 2FPRA 1SU4A 3KBBA 1ZD5A 1Z4MA 1XP5A 3EPRA 4DWOA 2I54A 2IOFA 5AW2A 4RESA 4O8CA 3QYPA 4G63A 4Y2PA 1K1EA 2G1AA 4FYPA 4IFTA 5AW3A 1QQ5A 1CR6A 1EK2A 1Z4QA 2RB5A 2YBDA 3M9LA 5ALOA 1RKVA 3QXGA 3SF0A 5IS2A 3WK7A 4Y2SA 3L0BA 3EF1A 1U7PA 1SWWA 2YMQA 4GXTA 2ZBDA 5A3SA 3ESQA 4HYTA 2IYEA 3NAMA 2HSZA 1L8LA 3PDWA 3HLTA 3HYCA 4DCCA 4OD0A 3DNPA 4KX5A 3GYGA 1N9KA 5AVRA 2JAOA 1U7OA 4Y2TA 1LTQA 1NRWA 2G0AA 4XOUA 2YJ6A 2MU1A 2B1QA 1LVHA 4Y2JA 3R09A 5T41A 4E88A 5AIBA 5AICA 1Z4IA 2OYCA 1N8NA 3ZVNA 4XE5A 2YJ4A 4NAVA 3W5CA 2WFAA 1ZJJA 2VKQA 1QQ7A 4C4RA 3I6BA 1O08A 2AMYA 2MU2A 3DAOA 2CFRA 2YMPA 5AVSA 3ZWKA 5ALMA 2HO4A 3L0CA 2OA0A 1WZCA 2WF7A 1XVIA 2C8KA 2JGAA 5AK3A 1VJRA 5AM4A 2QLTA 1Z4NA 2B0CA 1Q92A 2ZOSA 1CQZA 3ESRA 1Z5GA 1U02A 3P96A 4KNWA 4NWIA
chains in the Genus database with same CATH superfamily
2R6R1 1HUOA 1GQQA 4B83A 4F4KA 1GV1A 2JAQA 3PDJA 3RHFA 2IHVA 2DECA 1C7YA 1N36B 3QE0A 3C6MA 2WKQA 1VLHA 4JHXA 3WBKA 5AVQA 5E4JA 3MJRA 1CZHA 1UM8A 2B30A 4DQ0A 1AG9A 2ORIA 2OYRA 3E7FA 3C3PA 1IXYA 5CDFA 4DLLA 3IPYA 1CVLA 1ZEJA 4Y6RA 1TVKB 4NAUA 1I3CA 3V7FA 4Y7CA 3WB9A 2CHEA 4GS5A 4MYDA 3UPDA 5T8KC 5FPYA 3DKPA 1N2CE 1UK6A 2OYSA 3GFTA 3N8GA 4G84A 1X7ZA 1EXVA 2PUHA 1DIBA 5LNK1 3TG2A 3THXB 2JBHA 1AQ6A 3CX6A 3G1TA 5FEUA 1YH3A 2D74A 2I65A 3INGA 4LG1A 3ZIUA 1C20A 4H16A 5E3JA 3RV4A 1LZKA 3JV7A 1NF2A 2XE6A 2GN8A 3D4LA 3PQ6A 5DRYA 4YRGA 2XT0A 1F0KA 1PN3A 2YZKA 3BGWA 3BSSA 3KAQA 3QUCA 4R81A 3PUKA 4CL8A 5BSFA 3ETLA 1HT3A 1VPWA 2O8FB 4UBJA 3DMTC 4Q7KA 2DCMA 4D4IA 3P2MA 2EZXA 1GUFA 3CFYA 2W7OA 4HZUA 4LRQA 1KVSA 4MEJA 4A2QA 3OZUA 5L9AA 1Z0DA 1QYDA 1UR5A 4WADA 2YJ5A 4BQSA 3UXMA 1U99A 1RXWA 1QP7A 4I2JA 4D9MA 3LG2A 3T94A 3IILA 1B1AA 1WDKA 1Z4LA 4WTOA 5CGQB 5CLIA 1VP9A 1CD5A 5TQ2B 1TA4A 1L1EA 3V7NA 3FLMA 4PZYA 1PK9A 1IWOA 1C1DA 3NKFA 4H15A 4TTSA 3W2GA 3W4IA 3CSDA 1CUAA 4GOLD 3LFUA 2Q4TA 4UHHA 1Z5NA 2Y1GA 4BTVA 1FMJA 3FGPA 4RJLA 3U2QA 1Y4AE 3WAGA 1J21A 2FSFA 4Q3AA 3UJ7A 3TZKA 4MLDA 2AGVA 9ABPA 1XYGA 1TI7A 3MQFA 3ASYA 4MVJM 4P0QB 1ZJMA 1EFCA 1W47A 1DTSA 2FWBA 2ZWVA 4IICA 4RK4A 3U81A 3ZDQA 1T4CA 3WB1A 1LW6E 4KNVA 2ZIUA 7ICOA 3RVRA 2Z8XA 1AT1A 4AO7A 4UZEA 3UK1A 2BR4A 4CV3A 1KH2A 3C4QA 1MPTA 1N7IA 4IEEA 3V34A 2ODNA 2Q5CA 3VPAA 2I67A 1U2DA 2WJIA 2XCIA 1UQTA 4Q15A 4QXRA 4DZTA 1E61A 4E51A 3UPTA 5AJYA 2N3ZA 5JH7B 1IY2A 5EVJA 2DQNB 1HUZA 2PQ6A 1OR8A 3DA8A 2GDZA 1HMYA 3R6WA 4IWNA 4RVUA 1NVWQ 2YWXA 3V4LA 1PI3A 4IJ5A 4BP9A 2OKCA 4KLCA 4JI7B 5H02A 4X6YA 1JHAA 3W05A 2XDAA 2AG0A 4L5CA 5KQRA 4XPIA 1JBQA 1JSXA 1E9SA 3WGVA 3DP7A 2PD6A 4O59O 4QJ5A 4RYDA 4HDSA 5EKDA 5GONB 4E46A 3NP9A 3RJMA 2WQ6A 2QN2A 3OICA 2WAMA 1YSCA 3BS5B 3FUTA 5DE3A 2NVUB 3JAMA 4UHEA 1S2NA 4D9CA 4AG3A 1UPUA 3D2QA 2YJTD 3CKMA 4MV8A 2Y1EA 5FYQA 2YFKA 4QL3A 2CVFA 3QBJA 1KVUA 1B74A 2QIPA 3MWDA 4IGIA 4V0MA 4EFMA 4FZRA 5BR1A 1R4NA 1ZXLA 2D2EA 1MABA 2WZBA 2HIGA 3LKVA 3I1YA 1JPNA 3L1IA 3TSZA 4POOA 3FR7A 2QP3A 3F1LA 4MZDA 7YASA 4QNRA 9ICSA 4EB3A 1SZDA 2EHJA 1WU7A 2UUBB 1RZTA 4Z6FA 2Y77A 3IV7A 3NBKA 3A27A 3ENNA 5CDHA 2X5KO 2AR7A 1GGMA 1PJRA 4O3QA 2HA7A 2QMHA 3FOZA 1UJ4A 4HEJA 3TOXA 4A2WA 1IHXA 1YQEA 1OHHA 3P4YA 2H17A 3NDIA 5B4VA 1U3FA 1FDOA 2PXAA 1Z07A 3KKLA 1W8DA 5KG6A 4F4IA 1IOLA 3Q11A 4URZR 4UU7A 4DABA 4LX0A 1ZGCA 2AC7A 1MAHA 1YS7A 4RDIA 2WVGA 3DMDA 2L18A 4H6VA 4PSAA 4K6CA 1EH5A 1SV4A 4UBCA 1K66A 2WU4A 2YL2A 3FTQA 4MFAA 2DPJA 1DAMA 2PEYA 4Z54A 5ERYA 5JYEA 2IIQA 4X7MA 5E7JA 4JFAA 1IAQA 4D25A 1PVOA 2UV8A 2Q6IA 2QARB 3RRHA 1S0VA 3BRSA 3E9YA 4MR7A 4QTYA 4YMIA 3JQ6A 1EUDA 2KHVA 2JJ1D 3P2EA 4BTLA 2HI0A 1ZOIA 3C4VA 3OQIA 4DR2B 5DF1A 4TZ6A 1BGXT 1A3CA 5FUWA 3C5VA 1L8XA 1TQ8A 4U6SA 1ZYUA 4FDVA 2PX3A 4M38A 1ZD3A 1XA0A 5AW1A 2VZ0A 5ULLA 3GLQA 3S81A 2IITA 5I7UA 2GA8A 3MYYA 2EFDB 3K9NA 3PMLA 1GG9A 2A5GA 2CNOA 1U5CA 2KQUA 3DEJA 4JH0A 4LZAA 4WZZA 4Y6OA 4IO0A 5ETJA 1LNZA 3RJHA 5HKOA 5CM8B 5HW0A 3WK6A 1Y0BA 3OPYI 3VUFA 3HL0A 5T4HA 3QG5A 4XB6B 3LIIA 4EHNA 4GXRA 3GLFE 3ECAA 3G6VA 4J9PA 3B3FA 3QFHA 4R16A 4UEQA 4ESVA 3P7MA 5PGMA 1JPJA 2W0MA 2OXIA 3HHPA 2OK7A 3ICXA 4P22A 4AULA 5J2UA 3WU2U 1R1DA 2NO5A 3AEKA 4P32A 5JTUA 3J7TA 1TM3E 4ZZ0A 2GXAA 4PEVA 4L27A 1ZC4A 1U5BB 1VG9B 2W5UA 1FPMA 2XODA 3BKWA 3G6XA 2MSCB 4UAZA 4YCAA 4CW7A 2E8PA 3K94A 4WOCA 4DV7B 2QS9A 4WJLA 4ERXA 2GJ8A 1MV5A 1WUHS 4LXUA 3TQIA 4EG4A 1XMJA 1SD1A 4RE6A 1SOWA 3QKRA 2ZUFA 2XCQA 1ANKA 1U4NA 4MVJE 4WY8A 5ALDA 2HU2A 3GC6A 4KV9A 5KO2A 2CDAA 3BK7A 3W8EA 2I29A 1E2JA 4LECA 4PGMA 1E79A 2OE2A 4MA0A 1C7QA 1EK6A 4AY5A 4DE5A 3FY4A 4JGGA 1Q1AA 3AO0B 4E5MA 1EBBA 1ZZGA 4F96A 3HUUA 4I2BA 1J2RA 2NU6B 4Y2VA 1K63A 2WAXA 3N07A 2XB2A 2Y0BA 4X63A 5DP1A 4ED7A 2REBA 4BMDA 4IJWA 1F7VA 5L6LB 2GJKA 3L0YA 5T14A 3DEYX 4BVFA 1KDPA 3CUYA 1QHFA 3THYA 4H60A 5COQA 5CD9A 2FZCA 2R48A 1FL9A 4IO1A 4MMZB 1WMFA 2A9KA 2PXHA 3E1SA 4TWIA 1JQJC 2QLMA 4WBNF 1R5NA 2YJGA 1CQJA 5TGTA 5A4JA 4YAFA 1VL1A 2O3UA 1Y88A 2ZJ2A 4AJNA 2ZE6A 4FWTA 5EMKA 1KQ3A 2AQ4A 3GFOA 4GLJA 4LPSA 5EFOA 2QRQA 2X4LA 3PDUA 4FEAA 3PE6A 1ZM4A 4RTOA 3OQNA 1P29A 2VS1A 5LMNB 4ND3A 4TKVB 4PRZA 1EIWA 3TECE 1H22A 2Y2VA 1T2DA 2KE7A 2VLIA 4KTVE 4OQZA 2EL9A 1IK4A 3QVVA 1GPAA 2WM2A 3JYQA 3I5MA 4JYMA 4OBXA 3ZG6A 3MGIA 4BNNA 2OD9A 5INTA 1LY1A 2P2YA 4CXMA 4WBSA 3JQ8B 2FF7A 2HK7A 3AESB 3T3DA 9ATCA 4DR6B 3IR5A 3DB1A 2FKNA 5ARDA 1Y3DE 3CY6A 4BNWA 1DKLA 3LUBA 3DZHA 4LZWA 4UATA 5EN4A 3RJZA 3U4CA 2VJMB 5CAEB 2KSQA 2CGEA 3EFOB 3RC1A 1Y9AA 3QX8A 4R9RA 3AY3A 1YZGA 3IAHA 1SBIA 4IVNA 2QNIA 4OGKA 1JBKA 1BNOA 1U0OC 2JEIA 3DDCA 5CA1A 1PSZA 3EWSA 2O5VA 3TLCA 3ET4A 5KFPA 1Z83A 1PNTA 2JJ1A 3M2PA 4FINA 1AQUA 5DHQA 4BOYA 5K99A 4K9NA 1RHQA 3H97A 5IC6A 3SR0A 2OLKA 3MJFA 3VJMA 3L8ZA 4QYIB 3VX3A 2IS4A 1A98A 1QKKA 3A7EA 2EBUA 3CPSA 4MCIA 1L7RA 4OA8A 1BXGB 4W99A 4AMYA 4EL0A 5LSAA 1W0JD 2B8JA 1V6CA 5DLDA 4A27A 2X4GA 1GDTA 3CWQA 5E7IA 1JWLA 3TIVA 4WNAA 2YMLA 3ZTTA 4NCBA 3KSDO 4NFHA 4BO2A 4E6PA 4NXMB 1GPYA 1YZHA 2VTBB 1RRFA 1LI7A 1V35A 1QV7A 4QQFA 4TLMB 3EVZA 4XCXA 4M1WA 3ZBUA 5CB1A 4JEIA 5EYPA 1AKRA 2V58A 2QX4A 4EJFA 2AMVA 2V5UA 1T3QA 1KMNA 1VE5A 4E5NA 4D4LA 2ERXA 4KO1S 4X00A 3CF4G 3L8DA 4EPWA 3N8IA 1JWAB 3HN6A 3NBAA 4LBYA 4H31A 3KDSE 4AJPA 2Z9DA 5FWNA 3AL0C 1NW6A 4BFWA 1KEUA 3PX6A 1B93A 4FZMA 5AW5A 1R9GA 4AY6A 4M87A 3DJYA 4ZOQI 1W581 2BGGA 1VHDA 1X80A 4CNQA 1JFFB 1XZPA 2QAGB 2R97A 4MYSA 3SP1A 1L3IA 4HUTA 1YK1A 2Z3WA 3MIIA 2HTFA 1L5SA 3BQ9A 3GVXA 3HBNA 3T4XA 3TVTA 3W34A 3WJ2A 3ZHBA 2HK9A 3ETCA 2ZT8A 4ZV9A 3ZIAA 2C94A 1ECCA 1PWEA 4Z99A 2GN6A 2BPOA 4JUZA 3RAGA 3S6JA 2VI5A 1EGQA 5LZ5A 3UF0A 3SX2A 2DR0A 1ZJ4A 4OYRA 1XDDA 3N53A 4EDFA 4ZJYA 2QN3A 2BDTA 4E14A 4ER6A 3L8MA 1Z6GA 5CCXA 1FQKA 3SX0A 2HHJA 3IVGA 4I1YA 4NSNA 4EM6A 1R5BA 2EOAA 4IR7A 2XMRA 4KLQA 2L5YA 3N4MB 1A77A 2CLIB 1FW8A 2M6RA 1IZYA 1UAGA 1K6XA 2BJVA 2C5EA 2ZI3A 2DWOA 3OOJA 4M55A 3FYCA 3I4FA 2QYHA 3GWGA 4UTZA 4IDOA 3RB4A 4QG3A 4XX0B 3ZV4A 4DFMA 1PD1A 4C88A 4DAOA 5KNDD 2BBTA 2CDBA 2IYPA 3BGSA 1QORA 4MUEA 1Y8AA 1U4OA 4BQQA 4NH0A 3HKCA 4NZYA 5CLFA 3QWIA 4ZQEA 3TW0A 3B52X 2AC4A 4FHCA 2I76A 1QO9A 2GB4A 2V74B 3GGCA 4MP6A 3TDNA 3UZUA 3ZXIA 4E5SA 4CEJA 2X9GA 3HJHA 3AJ9A 1IPEA 3D0KA 2Q3MA 1JDNA 3H1PA 3T6KA 3V1LA 4J9UE 2CNDA 1U0SY 4QWCA 1W96A 3I9KA 1KU6A 1QAQA 3UUGA 1YR3A 1MN8A 3FWHA 4UBBA 4KAAA 4X60A 5GADl 4QZVA 4MEAA 7ICLA 2Q46A 1FUEA 2LR0A 1SIUA 4NBWA 5UKDA 5ALNA 1UODA 2VWPA 4XA5A 5GM1A 1ZCAA 5JECA 3BL6A 5L7YA 4LF6B 1NQTA 2A67A 4IDDA 4I55F 4WN3A 3VH2A 3ONEA 3TSCA 2QJFA 2XOXA 4OBEA 2UZ4A 2OCLA 2Y93A 1RU3A 4GPD1 4LBWA 5K3FB 1ZD5A 3DUFB 1FFYA 3ZH9B 3ACBA 1KK2A 5JY1A 5FTLA 3IJPA 3O73A 1XP5A 4OLHA 1JAIA 4X97A 2EL7A 4UZSA 3EGVA 1GSIA 2GJ9A 3QIVA 1KZ7B 3GFSA 3NEYA 4UCWA 4X90A 5AW2A 4HBZA 4QZGA 4JWMA 5KS2A 4IFTA 3FOAA 5CVTA 9LDTA 2ZU6A 3DVAB 4LMPA 1FS4A 1H94A 4JJGA 5ERXA 4PYJA 2P35A 1SHLA 5EXTA 1N2JA 5FBKA 3MB5A 4PLGA 3UKDA 3CZ9A 4TSFA 2Q0XA 3SHTA 3H3JA 4XWKA 1MW8X 2FWAA 2IUEA 5LLTA 3WK7A 3A3NA 1ZQYA 2IEDA 1OYWA 3PNQA 4M6WA 1E1CA 3UFBA 3VI3B 1F9AA 2IEYA 1OFUA 3LQKA 1TCAA 3HP7A 2REXB 3ABIA 3Q85A 2XY4A 5L8VA 3D8TA 5FBZA 2C03A 4V38A 1X80B 1C7FA 3YASA 5FPTA 3G1UA 2HSZA 3IR6A 1PZGA 3OQJA 4L2IB 4OHMA 3G17A 2P0AA 1GA1A 4C3ZA 4D92A 3T5AA 1G6OA 1L1FA 3OIWA 5KTPA 1EHYA 1P17A 1TF5A 4WKOA 1YFJA 2ONCA 5D8DA 1MPXA 2FUG1 4CV0A 1TF2A 1VKJA 1G1AA 3TL2A 4ZKDA 3HB7A 4ZEMA 5I8PA 4GM0A 1A9ZA 3AC0A 2J3HA 5DTIA 1DKRA 1X7WA 4G86A 4Y6PA 1JRPA 4CGYA 2CNNA 4Q8FA 4LS3A 2G5PA 3V9PA 4D0RA 1H2YA 1AKYA 3HP6A 1ZIXA 2FX3A 3RIXA 4K9PA 2HRRA 4PG4A 4KLRA 1AOXA 2YJ4A 1Z82A 4HQLA 1A4UA 1K98A 4F3YA 2PGIA 4QQNA 4TUYB 1NJ6A 3GOQA 4RCYA 5EAIA 2HEIA 3HM2A 4NOJA 5FWXA 3RWMB 3PD0A 3H5RA 4GU5A 3RO7A 3O4FA 3QLUA 3E3MA 1G55A 4ODIA 1G5IA 5M34A 2VBGA 4LIPD 4TUQA 1S4QA 1J33A 5IDVA 3M7IA 2GFQA 2EXXA 3HVKA 4I4LA 4HAVA 4P3XA 2QLTA 1Z4NA 2JEYA 4NLZA 4XIJA 1ULTA 1NG1A 2OESA 3TAPA 2CWDA 2CVZA 1CQZA 2I1WA 3JYLA 3L8CA 4IFBA 2A59A 1Z5GA 3EXFA 2M1ZA 1SHTX 3DTNA 1HEYA 4E5PA 3ECCA 5AWFC 3ENZA 4BO3A 4DS3A 1COWA 1AGXA 1FY2A 2VVTA 1L3UA 1KPGA 3WRVA 4IYRA 2NU8B 1N9ZA 4LE2A 3NAZA 1FW6A 1L7DA 4GKVA 5DU2A 4J7UA 2MYUA 3HK2A 4CUJA 2HFJA 3P20A 4Q7EA 4RMIA 1YBFA 1JEOA 2VR1A 5DASA 4GOJA 3I12A 2Y6VA 4WJZA 3ADBA 2ZRJA 1ZGHA 3ABSB 4MI1A 1MLDA 9ICIA 1H0HA 1OGYA 1KYIA 2PN1A 1TV9A 2WK1A 3L0OA 2HZ7A 5FHQA 2AFHE 5I9MA 3BXPA 2BFEA 5KTYA 1K06A 4F11A 3D8UA 5AM2A 1VJGA 1WU8A 4HLUA 1RZVA 4LN1A 2GZSA 1QRSA 3CPJB 1JVNA 8ICHA 5IZCA 1KJQA 4YQEA 2X5OA 3IHQB 2WPDA 1I9GA 4EB0A 1YR9A 4EZBA 2RDIA 2IX9A 1ECBA 2FPOA 2P3LA 3O21A 3IIJA 4GDMA 1V8BA 4FQ5A 4U7HA 4ZVPA 5DDMA 3O94A 2WVAA 2H1LA 1U4BA 3OZBA 3VR4D 2VJYA 1CUCA 4R1OA 1DQPA 3SC6A 4E4YA 5B1YA 3MAGA 4CIWA 4US2R 2HBMA 1M7GA 1TA9A 3BIFA 4IVRA 4EATA 1HEIA 1GG5A 1E2QA 1UXOA 2C9DA 1DAEA 2CB9A 2JKZA 2HDNB 1DTEA 2PXXA 1RRPA 1N7JA 3GZJA 2IC5A 4MPRA 4OJTA 4PQFA 5DZSA 5FBWB 5BRNA 3VR3A 4G1MB 4FDTA 3QF4B 2H0QA 3PFHA 4UUOA 2Z9BA 5FCDA 4B46A 4UMFA 3TQSA 4LZLA 4C76A 2JIDA 3RE1A 2HMVA 3T5DA 4ZQHA 3PC3A 3EY4A 3RUAA 5EJ9A 3GWZA 1TAMA 1U8YA 1RDFA 3I53A 2EVWX 3KR9A 3R7NA 4CU5A 5DPMA 3PUWA 1LTKA 2IZOA 2CDNA 4R51A 4RQTA 3SBEA 4AYTA 2Q5JA 4OQLA 3NW9A 2ZS8A 1DDOA 2I78A 2I3DA 2NVOA 1NXQA 3MCWA 5H7XA 1U7HA 1LKYA 1Y5RA 3AYXB 3CB2A 1BDJA 1US8B 1YIOA 2B5OA 3UJ3X 1QO0A 3ST7A 5AUPB 2GLXA 4M3NA 4ZU6X 3S1AB 5KSWB 2WWXA 3ZY4A 1J49A 1KJZA 2H16A 2VJDA 1ATIA 1QE0A 1ZOSA 4M83A 1JIHA 3TW6A 2OXTA 3SLGA 3WWYA 4K4GA 2GM3A 3GH3A 1DZ3A 1ZIOA 2LZ0A 2P30A 2PZJA 4QT4A 4V0KA 2OUKA 2XHZA 2JHPA 3R9WA 4DSLA 2C9ZA 3OPYA 2WAQF 1JG3A 3OE5A 1UQUA 3ELWA 4WK6A 1SCJA 3UQ0A 4QU9A 4CF4A 3DPUA 3ZCRA 5E3HA 4CMKA 4PVCA 3IA7A 5ALVA 1DG1G 4M0AA 1DO2A 2D0OB 4KQWA 1JEJA 1V1RA 3PQ7A 1KI4A 2F59A 4BP1A 1QV9A 4UPDA 1JLSA 5KFOA 3G0OA 1OTXA 5T4FA 1T9ZA 3DLIA 3U7EB 1RHKA 3LT5A 3T3EA 1E3SA 3T9AA 4JUBA 4HZUB 1JJVA 3EEFA 4IILA 5KYWA 4B6RA 3RHSA 3RT7A 4EITA 4KPUA 1ZK1A 2LKYA 3JATA 2P77A 3G82C 2HDOA 1N2SA 2I80A 4FT2A 4I4TF 4G37A 1XSNA 5J2CA 4EPVA 1KOJA 5D3QA 4ASUA 1ND6A 2XMCA 3RH6A 4EVRA 2AWNA 3NS1A 2OWEA 1DC7A 4KMRA 1NZFA 2IYYA 1QUEA 1VSQA 2X15A 2VZLA 4Y0AA 1EJ0A 2VT7A 5LVAA 1U49A 1P5JA 4YJGB 1KWKA 4DIKA 1S9FA 1CY8A 1X1CA 2CHQA 3D3QA 5EPEA 3N0WA 3UHJA 5KVSA 1JEDA 4BO0A 3P94A 3JQ9C 4BJ3A 1K0UA 1YTLA 4TWZA 3RUDA 1PG5A 4QVGA 4W1RA 1G5HA 4KE8A 1L3BA 1TA0A 3QLTA 5A3QA 3Q8KA 1SGWA 3ITKA 4BV8A 1Z1BA 1K3TA 2AQKA 4IRUB 4D82A 2ETVA 3BCHA 3MB8A 4ZU3A 1E3DA 4I4TA 4RSRA 3RJFA 3U7JA 1I9CA 2O7SA 1SK9A 4MDHA 4YRQA 4DCPA 2FN4A 2DKZA 4UB4A 2P6MA 2R00A 4B3FX 4V1CI 1XFDA 3GMIA 4CIXA 1ECFA 2BP7B 3R20A 4M1OA 3AEZA 2IHKA 3T15A 4EB6B 3DHEA 4OQXA 4AMZA 4QWBA 4AZ3A 5JT1A 5MGBA 1LU9A 3DEZA 2FK8A 1UH5A 1AU9A 2FJUA 3BG5A 2D00A 3PKIA 5JAHA 3IXQA 4GUAA 1WCLA 4NE7A 4PGFA 2ESRA 5DNVA 2J9RA 1AKQA 4FGZA 3RANA 2VAWA 2ZXUA 2H2IA 1QQ6A 3BBPA 3WGMA 4FI3C 5LQUA 2WVJA 4I50A 3ZQUA 1WDTA 5KFVA 1OIXA 3TLJA 4Y2UA 3CTMA 5AKKA 3OQIB 1JKJB 3C45A 4KQFA 4S05A 2H1OA 4A2CA 2FDXA 5BUSA 3HA5A 4ZYXA 3K4GA 4GIBA 1HKHA 1L1QA 3HCCA 2XGPA 4NZPA 4QJ4A 4AZ0B 1Q57A 3FHOA 2R25B 1AQLA 3Q7RA 3IXMA 1G21B 2RK4A 1ZW6A 1T9BA 4H6WA 4GMHA 4QQRA 4HVLA 4RC9A 4RHEA 1CHDA 1T5TA 5EUCA 3VPHA 4QU5A 1YONA 2HH9A 3GLFA 4N9WA 1NKTA 3RYFA 5JG7A 4KLIA 2GF0A 2H9AA 3H18A 3MGBA 4XQCA 1RE1A 3L8EA 1L5WA 3QUTA 2FMSA 3TLAA 5T6MA 4RLFA 5CB4A 3CE6A 5EJAA 1N2ZA 2PX5A 2ZIAA 1X9WA 4I3HA 1SURA 4DO9A 3BDAA 1P0PA 1Y33E 5KMGB 4ARIA 2REQB 2RI1A 4J4BA 1YZLA 4IXMA 3ROQA 4ZOLA 1F2TA 3KD3A 4BNTA 5L7WA 3PVXA 3AESA 3MBYA 1XSEA 4G07A 3ISTA 3Q7TA 4XD7D 1NK6A 2XC9A 3H5WA 4KI0A 5IBQA 1QGOA 3GNLA 4PGAA 5LYJF 4LRXA 4B3XA 4PHAA 1OAOC 1EP2B 1TT5B 5LQAA 3AZOA 3HJCA 3GX1A 4TOIA 3ZGYA 4ZREA 2QUIA 3H8MA 3D7SA 3TD9A 2AKEA 4YMUA 2XYGA 3IP6A 1LRLA 1NN5A 1P8JA 4GPIB 2FWRA 1JLLA 4PC3A 4RTPA 3HO6A 5HBRA 4AKSA 1FLDA 3H2YA 2JIOA 2CHUA 3EIEA 1CJSA 1RPAA 4YCDA 3W3AH 4ENUA 3ZWOA 4IMRA 3HVJA 1BMTA 1X39A 1T36A 2W83A 2WIBA 4I6EA 2PR2A 3FGZA 4HX5A 4ZQCB 1Y48E 1MNQA 1NI3A 3OZGA 1N1EA 2E1RA 3ISVA 3ZHZA 4ZCTA 3V2IA 3ZHUA 3M1AA 5C35A 5K01A 2MAXA 2IH5A 4HAWA 2EW8A 1XGKA 1YDMA 3I5UA 3LA6A 4YAOA 5EP3A 1MVNA 2B94A 4ZHSA 3DZIA 5AVXA 4KXVA 1C0PA 1E7QA 3GUHA 4RQ2A 1EWVA 4TWAA 4X45A 1O95C 3U31A 5ADWA 4F4UA 3H2SA 2RIPA 1YRYE 5EIBC 4WKNA 3B6MA 2PL9A 3GNQA 3C3KA 2OP0A 3CKYA 3I09A 7ICNA 4C87A 4O3PA 1FYEA 3F98A 4L76A 3WYBA 2IIBA 2V6IA 1BKYA 2EKPA 2X2FA 3CZ5A 2ERCA 3TL6A 1OXJA 3R7LA 3OESA 3ZCVA 1TZCA 2RHGB 1HK7A 2PT6A 3H4MA 4OYLA 2QTTA 4RCVA 4WVLA 4AUNA 4ZGBA 1GTSA 3DLTA 2FDCA 2EX1A 3ORRA 4IQ8A 2ZM5A 1ODSA 3MWJA 4AS2A 2BF4A 2KJQA 1Q22A 2BCQA 4L02A 1XJCA 1E99A 5KTOA 3C1YA 1OFHA 1YS6A 2V7XA 3JAWA 4QPZA 4OUKX 1QFMA 2HU7A 2PLAA 5C1OA 4AJKA 1V95A 4DV3B 3LTNC 1I80A 2VNIA 1QZTA 3H9CA 1ABBA 1CE8B 4JIGA 1LK5A 2LCIA 3RBAA 3UW3A 3K15A 421PA 1MX3A 3EXEA 3NBXX 1RC8A 5EKSA 3C5CA 3NKLA 1ZQIA 4I50B 3HFGA 2B7CA 3R3VA 4OBWA 5GJWC 4FOSA 1YUBA 1U8ZA 1LSJA 2RHLA 1I7LA 1RD4A 4BXOA 2NACA 3A4LA 2L0XA 3LDFA 3NATA 4BMZA 4UTVA 2C4NA 3QXXA 5TS2A 6REQA 3HWTA 3AR8A 1MAUA 1KRHA 1YQQA 5C4IA 4EI2A 4AVYA 1VP3A 1ZFNA 1WDWB 3NT4A 8GPBA 2YC4C 3NWPA 1F51E 2EBWA 2GEDA 1UUFA 1IHDA 3OT1B 2N1BA 2Y1IA 1DEHA 1USVA 1XP8A 3PFKA 4ZICA 4IGKA 3UGTA 2QP4A 2ZIVB 2B3TA 2YQEA 2BCEA 4OQMA 4KX3A 3VC7A 4RHCA 4YP9A 4R41A 3H1FA 2R4TA 3PFCA 5B3LA 5FWDA 2A3RA 1T4DA 1BVUA 2ZFUA 2D3TA 3ZI7A 1EUCA 2D7CA 4UNSA 2RGYA 4PR0A 4WLFA 4LJSA 1HWYA 3CM0A 3RREA 3ZDBA 4F4JA 4EZ9A 3WI7A 3OQOA 2YRWA 4EOGA 2YB4A 1RVV1 4YRBA 1V43A 1SUBA 4OMCA 4YH1A 3AEUA 1AK9A 3OIFA 5CGZA 4ZAXA 4OJPA 4EJ0A 2JD1A 2ZITA 3DFUA 4CZ2A 5HRCA 1RADA 2C28A 1PJTA 3DH0A 1LLQA 2IYSA 1J5EB 4JI4B 1JH9A 3SZLA 1Q50A 4LNHA 3QPCA 4UBNA 4UE3S 1G7TA 1DCFA 3KFUF 2GWHA 1G59A 4WXHA 1BRMA 1CJKC 2HF9A 5D6NA 5HF8A 4EI7A 1IHPA 1WUDA 1RMQA 3RR7A 3GXOA 2B37A 2MSEB 3EE6A 2IU3A 1L4NA 4QDKA 1XCPA 3LUFA 2ZIXB 5FX2A 3JD2A 4RTJA 2BKEA 3OA2A 1KTQA 4KLEA 4LY6A 2UAGA 1SXEA 3M5CA 1P0QA 1TQHA 2DFTA 2VXCA 2VNKA 3H7AA 4GI1A 1GILA 5JYDA 1OMOA 4F3TA 2FPGB 8AT1A 3E7DA 1EE1A 1C7IA 3ILXA 1GPDG 3QHQA 5A9TA 5SY9A 1YJQA 3MINB 4IDAA 1KEZA 1JHRA 3U16A 1DV1A 5JMWA 4BMCA 1V11B 2K60A 1JB9A 2EDAA 5L1KA 1GT6A 5DN6A 2PJRA 1MF7A 2FW6A 1CF4A 2C95A 2RKWA 1DK3A 3PJGA 1FTSA 4RFVA 4C4YA 3P0IA 2FSPA 2HNKA 4TT3D 3C2LA 1RJFA 3WXBA 4UAUA 1YQXA 2C0PA 2P9HA 2V54A 2ZE8A 1RCUA 5DP2A 4B5KA 1X7DA 1YI1A 3HN7A 2AR0A 2OP1A 3SXPA 1E2LA 3UMJA 3WZMA 2IHUA 1T0IA 2X4DA 1FE8A 2XHEA 4YFYA 3O0TA 3AF1A 5J23A 2CHFA 2P11A 1SCUA 1L3SA 4OI2A 4HXYA 2I1VB 2KBEA 5KYKA 1SU7A 1ZH8A 4B8YA 4W5RA 2JZBA 3HFJA 2BCRA 3ODGA 4YRNA 1OAOA 3Q15C 2CZCA 1M67A 3V4ZA 4P0PA 4DKXA 2QTLA 1RI3A 2QT9A 3DCJA 4CN8A 1OLSB 1DK2A 2JCGA 2P2ZA 3I1FA 3B9BA 1ZJWA 2VHYA 4DLUA 1TC1A 2HF2A 3H04A 4CF7A 3ID6C 3RU9A 2KMDA 2ZU0C 5KC8A 4YXWA 3L8GA 3MMSA 1E1LA 3KFVA 2W8BB 5BT9A 3KJHA 3I8XA 4ZCMA 1GL3A 4Z49A 2OD7A 4RUKA 2O2JA 1T5HX 3AP2A 3PGLA 4GC5A 3RJKA 4GLLA 5HKKD 3GLGA 3BIJA 3LT2A 1W0CA 3HSYA 4GZ3A 3WGYA 1ENPA 3LECA 1M66A 4EKDA 1EVQA 3FCAA 1N56A 3OT5A 4BMYA 4MVYA 4DFPA 5JZOA 1GKYA 3NBQA 3AJAA 3CGWA 4FCWA 4NMHA 2AGOA 4G4SP 2X13A 3K73O 1V9PA 2LIPA 3ZIAD 4YUXA 4EQ6B 5F7XA 4TZ0A 4LHWA 3JQAB 3NOOA 2NRXA 1N9GB 1ZBDA 2HLNA 5CP2A 1EX1A 4KQHA 4Y2PA 4MV4A 4PQYA 3RBDA 1T15A 4FYPA 4YS6A 2MSDB 5KAMA 4F5EA 5AW3A 1Z4QA 3AI1A 2YTUA 3JVUA 4FGSA 5ALOA 1ESDA 2ONKA 3L7KA 3JPNA 1T6NA 3HY4A 4WA7A 5JBIA 3EXFB 4NHOA 3KZKA 2HCTA 2OCDA 3IEXA 3IDAA 4RA9A 1KSPA 4Y2SA 2ZCJA 2YVLA 3EF1A 5DLPA 3DPIA 2CF5A 4EARA 3NJ8A 1SWWA 3EPGA 1DPGA 1ENOA 1E9DA 2ZBDA 3DMHA 3P4XA 5A3SA 4HYTA 5P21A 4PVDA 2IYEA 3DKRA 1XZBA 4IX9A 3UOGA 2RKBA 1EP3B 4IDPA 2ECQA 1CT9A 3QX9A 1R6XA 1X19A 4PWYA 3CVXA 4B3SB 2YZNA 1OF1A 1X9MA 1ZXBA 4X3PA 5D5PA 1BZYA 4M1EA 2XA1A 4MUIA 3THRA 4BE7B 2RG1A 4FCVA 1LTQA 3BILA 3B60A 2WAAA 1G7CA 4UTNA 1H1LA 3SE0A 3P5SA 1EPUA 1SH7A 2V7EA 3AIIA 3R09A 2OSBA 4E88A 1JFTA 3DE7X 3O31A 1THZA 2VSOA 4MQFA 1ZQWA 3P9SA 3GJXC 3KP1A 3NXSA 4YJ3A 2PVPA 3TYXA 3EX7C 5KG2A 2ZAOA 5IYZA 4M22A 5FO0A 4DANA 4PH5A 4NDAA 2WFAA 1ZJJA 5EMMA 3LFHA 2HBRA 4IDFA 4CKXA 3OUZA 3IULA 4L9AA 4D1YA 3SE7A 1EQAA 2KG5A 2UZ1B 4OP1A 3HY3A 1AM4D 5EIWA 5B1DA 1O08A 1Q1GA 1LDGA 1JXLA 1NUHA 1TL7C 1Y4UA 4H2DA 2JZCA 4NFYA 3TLGB 4CLRB 2D1YA 3BCRA 2JGMA 2TECE 2OLJA 1D0IA 3D8BA 2C5HA 4N4AA 2JCVA 4X5OA 5TT0A 1K3UB 2GKOA 2WNIA 4BO5A 1FSSA 1H93A 2DHQA 2DFVA 5AK3A 3K2EA 5SICE 3QSYA 4FILA 1M0WA 2Q1TA 1KK1A 2ZTLA 1HI9A 5DNEA 1XTKA 5B53A 1QR2A 5K3SA 1TZKA 3BFXA 5SYAA 4PYOA 3FOFC 4CFZA 1UXHA 2CMGA 5FULA 1XD2A 4PN3A 2QT0A 4G5RA 1GEGA 5EKXA 1I0ZA 1TUEA 1XDZA 4FXOA 5ALHA 1J7JA 3EWIA 4Q3NA 4MYCA 3RJTA 2GK6A 3EMVA 3EZNA 5ES4B 3B7GA 3GPIA 2C2RA 3SI8A 1URJA 2HHSA 4JLWA 3M3PA 1HY3A 4DS5A 3QOFA 4PGGA 4C0QC 1B0XA 1DC5A 1M2EA 2N75A 2W6ID 3BJZA 4NAHA 5F76A 5CCBA 1WABA 1BJKA 1U8XX 3RJ5A 4TTTS 3KPJA 3VUEA 4D98A 5I48A 2Q6KA 1RHJA 3E18A 3CUUA 4ZVKA 2JH1A 1DXQA 4PLHA 3D7MA 3HILA 4EW1A 5DQGA 1GTRA 1IG6A 1NM5A 3PLRA 5J2IA 3LPLA 5GP1A 1UT5A 5EE5B 1KYTA 3I32A 1NFRA 3MGKA 4KL8S 2EZYA 3RVOA 2D1QA 2DPIA 3B8HA 1Y6QA 4QZFA 4IWXA 3BQTA 1Z4PX 4QOJA 5HFJA 1VI5A 1L3VA 1JX4A 3OZCA 1C8LA 3L4BA 1KERA 3U3DA 4X1OA 2C77A 4NARA 2PRYA 5DTQA 2WFLB 1TMKA 4PFQA 3I9FA 4EG3A 1OUQA 1W88A 3MK31 2C42A 5K0NA 2UVPB 4HN4B 2P68A 4TX1A 2R1VB 3HYRA 4DMHA 5A06A 5ALRA 4S0XA 5LB4A 5B1IA 1KF0A 2W22A 4KLOA 4MCAA 2GPWA 3F7NA 2PL1A 3CRMA 5A5GA 3KOOA 3ZLUA 4YROA 4GR4A 5J2UF 2B2XA 1LLDA 4HEQA 3FCOA 5ESDA 2D5LA 4KRFA 4EKIA 3GFBA 4BQNA 5BR8B 3BWEA 2AUNA 3EFBA 1U8UA 1OKKA 3HA7A 1U0RA 2GEKA 4JOCA 1XQXA 3ZPXA 4D3DA 3CUWA 3ADDA 2WF5A 1U2PA 2C9OA 5AKZA 4WW0A 1S01A 7ICVA 1YB7A 3F5DA 4ZOCA 1NQOA 4PHCA 2DM6A 3T3MB 2BDEA 1DQYA 2OBFA 3V7UA 2FMTA 5KFEA 1FTGA 5EUQB 4DJEC 1P74A 1UXGA 2PMKA 4ZANA 4RY0A 2FOXA 2P2SA 1ZGBA 2IYOA 2MUTB 7ICMA 1GR1A 1HLPA 2KJ9A 2J5RA 2W43A 1N6OA 1I3NA 5CJ7A 3U4GA 4YCLA 3EGXB 1P2VA 4DL7A 2I2DA 1NW5A 3QLEA 4ED9A 2IDJA 2VH1A 2IYVA 2QD5A 3DOIA 1WZEA 1RHRA 4MPTA 5DHFA 1A7JA 5COAA 3KPYA 3QMPA 5HQ3B 3PW7A 3PB3A 1S2LA 4LQCA 4F4DA 2WIFA 3THWA 2FU5C 4J9RA 4XQGA 3PC7A 4L7QA 3L7MA 3A0UA 5AO9A 3NJ4A 4U8GA 3LQQA 1X1QA 2MSNA 8ICQA 1XZLA 2FP4A 1GPKA 2CE2X 1DHTA 3DL0A 3IOCA 4KVFA 4M60A 5DB4A 3Q3JB 3I6YA 1J9EA 1FRFS 3I1IA 2I03A 3KQWA 5C4MA 1HLGA 5KFJA 4MPJA 1W4RA 4M9LA 3IBFA 3RVNA 2YWHA 2IS2A 4EUHA 3IUQA 5F9NA 3OX1A 1KMCA 1G2QA 3PVCA 3NU1A 3HG7A 1XJQA 3X2EA 5JATA 3HXQA 5JZ9A 2DBZA 2D6FC 3SEAA 4YTEA 3IPCA 5IIKA 4PS0A 1ODCA 5GTDA 3FZGA 1OBCA 2A1JB 1V1MB 2Y71A 3HKEA 4UAWA 3LHKA 4TZKA 4Y9RA 4YT8A 3H0MB 1LFDB 1HDIA 2ST1A 3KAJA 5E6SB 4RT2A 4Z8XA 1F8XA 5FIUA 4Z3KA 3V4RA 3ORYA 1F6WA 3GJ3A 3W2EA 1JDSA 1AF4A 1SXJC 1E6KA 2XOEA 1JFRA 4UUAA 4AZWA 1QYRA 3B5IA 3NDPA 4GRAA 5IVDA 3A1TA 1Z2CA 2VP6A 3RB3A 2WILA 2XOKD 1CI4A 5CFQA 3D1LA 1J23A 2ZBEA 1XMOB 3R9KA 5J0QA 1I2BA 1QSGA 5DLFA 4JBNA 2PMZF 1MC4A 1N57A 1BWQA 4M1YA 4EJSB 4F2HA 4EY4A 3EUWA 2ZPTX 1NVBA 4MWEA 1G5RA 1W34A 1M6NA 2BKUA 3CISA 1KBZA 1NUPA 1YI0A 3O90A 2X6RA 1VBKA 1C2TA 4KZKA 2VYVD 4P3NA 4RSHA 1I5EA 2IPNA 2JGEA 1Z8DA 1YR1A 4AKTA 3QBVA 2F7SA 1JI7A 3LPAA 2HHWA 1LW7A 3N7SC 2IYZA 2GCIA 5HNKA 2QGFA 2QE7D 4Q4AB 1C5KA 2IHTA 2QRKA 4M0CA 4OB8A 3A05A 1IHUA 4Y2RA 2JW5A 4KOAA 4NLCA 4XRRA 4N41A 1NK7A 4PPYA 1PV2A 3S2UA 5BNZA 3AHCA 4WECA 4RBNA 2AE2A 3OPXA 2IYTA 3N2KB 4G5YA 4BZZA 1U1DA 4CG0A 3ZNNA 2DFDA 2ZRIA 1SOUA 1OBFO 3A4MA 1TYAE 3K0BA 4JBGA 4L16A 9ICHA 3ESXA 4Y9TA 2F77X 1P7PA 4N49A 2NSYA 3R7BA 4BLWA 4IRDA 4DEVA 3MEQA 2XBLA 3OX2A 1FNCA 1ORWA 1U6IA 3C3MA 3O8QA 3S2SA 5IFKA 4S1PA 5CB8A 5K09A 2F9FA 4DV4B 3CLHA 4U7DA 2WIKA 2QTHA 2HF7A 4Z4IA 2RI6A 2ZSBA 4H7FA 3G2QA 1GP2A 1CUDA 5IWAB 1CJBA 2GNOA 2QQ0A 3FAKA 5EE0A 3G59A 3TLYA 1AHHA 1CDEA 3EIWA 4HX9A 1SHUX 2WKWA 3D64A 4NE9A 1JAXA 2GVDC 2HA4A 3I5AA 4JOQA 4BBZA 4GEKA 3WLAA 4RT3A 5KYYA 3EGXA 5IJAA 1GIAA 3BTSA 1Q84A 5JJBA 4AW9A 2VPPA 1H23A 3KTFA 2DUWA 3GROA 3TZBA 4XUCA 1ZMXA 4KVZA 4GZLA 4BE4A 3WO1A 4N3BA 2DWCA 4AMGA 1IE3A 3EY9A 1JHZA 2L17A 4JS0A 2V3WA 2YXEA 2HOFA 4BV9A 5ELLA 3LWNA 3U44B 3FR8A 4UTOA 1AKEA 4F71A 5TQ0A 1RJGA 1YK0A 4B43A 2BT4A 2R6FA 4EGJA 3FGNA 4RTLA 3IDSA 4YJFA 3SVTA 3A11A 2FSHA 4D9JA 2C8VA 4RAQA 2YFYA 4GI5A 3C8MA 1HNWB 4RSMA 4UQGA 4JJFA 4P08A 5I5EA 3HJEA 4LJYA 2VZ9A 1JQEA 1USUA 2G83A 5BYAA 2O2ZA 4MKIA 4YN4A 3MWKA 4KDRA 4L85A 1ZW1A 5ALTA 1DINA 2KBFA 3AEVA 1LF0A 3CIFA 4LRWA 2AHOA 2CLFB 1FK8A 5THKA 1LKZA 1W9HA 1C41A 4OMFG 5D84A 1JIQA 2B5WA 1GLVA 2JDID 3LO8A 1P2GA 1KEVA 4BL5A 1XAJA 3G68A 4N82A 5CT4A 2O4CA 4WMLA 3PEFA 1RT9A 3JWEA 4AIIA 1RJ9B 3OU6A 1IH8A 3AM5A 3C6YA 4M0KA 3OY7A 4QOEA 1X7YA 1B4FA 1HYQA 1SVWA 4KJXA 3SV4A 4BGUA 5JPDA 2H06A 4UZFA 1VA5A 4XGQA 3RGGA 4LJRA 2V9WA 1XX6A 3WDMA 1L5FA 3A9RA 3HNOA 3TNFA 5DBFA 2J85A 3F6YA 1GRVA 4BB0A 2HQSA 3KELA 5SZHB 4R69A 3CEJA 1AUVA 2DPLA 2XRMA 3QEMB 2EQ5A 3AF3A 3LY9A 4RAOA 4ED8A 4R8RA 2FFRA 2NT4A 3IVMA 5KJEA 4LRUA 3FVTA 1QH9A 1V6AA 4L8WB 5F9LA 2YUIA 4TLCA 3FH0A 4U6NA 1ECGA 4JB3A 3COWA 4LJXA 2K8CB 4QO8A 4W6QA 4DT1B 3ZLTA 2RRDA 2PBLA 1G98A 3EXEB 3PFBA 4WOBA 1ZWLA 4X71A 4EI9A 5IT4A 3WGKA 1P0IA 2G09A 4LE0A 1ONNA 1L5QA 4MV5A 4ND6A 4A0QA 3A7DA 1M0TA 4DIBA 3COPA 1QNFA 1DU4A 3DXZA 2ZQZA 1JXMA 1QXSA 1WNFA 3M4JA 3KJXA 1EE2A 4MWZA 4RXMA 4TXNA 1CIVA 1CJMA 3GRPA 1J00A 1VB5A 1IMOA 1I3OA 1WXFA 2D1FA 4GECA 1DQZA 3I4CA 4QUAA 4UHKA 1P1RA 3LA8A 4L3WA 2RK6A 1EX7A 3PD1A 4QLAA 4O63O 6Q21A 4PPFA 3W5AA 3ND7A 4ZQGA 2HU5A 3K92A 5I9TA 3IJRA 3MGCA 4ZZ3A 3T7RA 5HWSA 2WYOA 4HNUA 8ADHA 1TEZA 3L40A 3D2AA 5BN5B 2HTEA 3GRUA 4W6ZA 2MYTA 2QZ4A 1E20A 1DQNA 1W0JA 3G9QA 1CFZA 3IAXA 4YRCA 3W6ZA 2JIRA 4ALKA 1JHQA 3DOHA 3A36A 5K6AA 3M6KA 2FUG6 2XCSB 1VPDA 2H1FA 3ROKA 5EMHA 3P2KA 4RHUA 5KJ6A 1A4XA 5LC1A 3UHFA 2CLKB 2BQRA 1D03A 3FG9A 2Z3ZA 3IC5A 4TT3A 4ZDIA 3G5UA 4KDEA 2POQX 1DIOB 1ZNYA 3LI2A 3NG1A 4DOMA 4OJOA 3PNOA 1A1SA 4NBSA 2Q3CA 4YO8A 4UOEA 2OO7A 1DSSG 3E3OA 3M6IA 4WKGA 3JQPA 5FFFA 1BDBA 4X91A 4TM7A 3KB6A 2ET6A 1J8QA 3BE8A 1MIHA 2Z5FA 3DTVB 3CR8A 2X1LA 1U0NA 1NOMA 2HD4A 3DCYA 2VPZA 2E6KA 3L7YA 5B3AA 1KL9A 3C4JA 4QUDA 1ZUD1 3G9XA 4O4LA 4UAJA 3JPYA 4YQZA 3VR6D 4J3FA 1P5RA 1Z7YA 1IHYA 1PLKA 3I34X 4LK2A 4DQXA 3E6AA 5L53A 1ZVKA 5CVUA 4ER3A 2RCNA 5D4BA 5G0UA 3W2HA 1P2BA 1HQCA 4CM9A 3HKDB 1IRXA 3DL4A 1W0KA 2ZWMA 4CBVA 2ZYHA 1X8XA 1SN7A 3U1VA 5FP0A 5CA1F 1AROP 1BOOA 2VF2A 4PIVA 1L3TA 3GUZA 4BJHB 4WXPA 5C7LO 4CLOA 3W5BA 3HXMA 3M82A 3G6KA 3KU4A 3NWEA 3QTBA 1RM4A 1T5BA 4RWZA 1VE9A 4HB2A 4NKRA 4TURA 1O3YA 3FPHA 4BNDB 4FFNA 3P9ZA 4CMIB 4I14A 3N7AA 1L4HA 4ROSA 2A19A 1NZPA 2ZI5A 2AXNA 3HCNA 4ZQIA 1A9SA 1NASA 1E7WA 4C6HA 4CKZA 4PHPA 2AGPA 4FC7A 2EP7A 1JROA 3IUNA 4IZOA 4Y6LA 1FMCA 3OFNA 4KUGA 3QNUA 1C9NA 4E03A 5A9SA 1V5IA 1VTKA 4U5QA 1K6EA 4UUPA 1VRCA 3DEEA 1PV1A 2ACKA 4DLZA 5EE9A 1KOFA 2ZSEA 5AJZA 4CMEC 5JS8A 4YDRA 2C5GA 2P3OA 2R6AA 2R5WA 1A2KC 5JSFA 1ULZA 1WBDA 7ICSA 4FYHA 2W7PA 1CZLA 2BCJQ 2ZVJA 4EZ6A 2NTJA 2VNHA 1H1LB 5KFFA 1L5ZA 1VBNA 3QWBA 3PHJA 4M89A 1P3Y1 2FQXA 2XCAA 2XUHA 5FA6A 3H8WA 4RGBA 4ENQA 3PW2A 1YL5A 2I4TA 3BHIA 4US9A 3INNA 2C92A 2P5SA 2BZSA 2EEZA 2HRBA 3R0QA 4FR5A 2AQHA 3D5TA 5ICGA 3JTMA 2F4VB 5L4NA 1BXZA 3CF4A 1HYBA 1P4HA 2QP9X 1FXSA 3QPUA 2NAFA 4MRAA 2VC2B 2XYPA 3IT1A 2VYQA 3OX3A 1PJ8A 1T8TA 4ZDJA 3R7WA 1ACJA 1R0LA 2ZI4A 5EESA 1PKXA 4TMKA 3TUIC 1DBVO 1Z4MA 2AEJA 4LYFA 4XSGA 1W94A 5BN5A 5JI3E 2KHZA 1RABA 4M86A 4QKQA 1NKEA 2VHVA 1GQOA 3TQ1A 7GPBA 2RH8A 4LFBB 4MO9A 2P6OA 5CX4A 3VHLB 1CR6A 3IUSA 1HFKA 2B5VA 1D9FA 3IHLA 1E64A 1SXDA 1Z12A 3RF9A 1G8SA 4OHXA 4BFSA 4RM2A 2OKGA 3SJBA 4XLZA 3OBIA 1N61A 2VP5A 4TS3A 2ERYA 1QQBA 1E1RD 3NCHA 4IIEA 1PO7A 4HS4A 3KYBA 5FNZA 3TTXA 1MMFB 5FV7A 4ND2A 1DS6A 3CHYA 4XFJA 2ZAMA 2KMLA 4F06A 2D1TA 4DBVO 5DNCA 3VZPA 1N5WA 3HYCA 1CUSA 4P0PB 3DDWA 4RU1A 4OD0A 1RYHA 2I99A 3KSRA 5U9CA 1YDHA 2PLNA 5KFGA 3RVQA 3CG0A 5F1OA 5A62A 3MGHA 4ETWA 2D2IA 2Y67A 1GL9B 4TL6A 3LVFO 5BPCA 1RYUA 5EP1A 2PPVA 5T41A 4F5DA 2C84A 3D6FA 2AF4C 4M1MA 2CLSA 4JT2A 5KFTA 1LDBA 1VE3A 1Z8FA 2MINA 5CX1B 1VYVA 1WSBA 1GT91 1UDCA 1WY5A 1H5NA 5HYVA 3TRFA 3VYWA 4Z86A 1XEWX 1K2VN 1NUUA 1ZONA 2VQSA 4FXPA 2O7QA 5K8LA 4ABTA 4FMDB 3DAYA 3T3GA 5L6MB 1EFPB 4K3UA 4F46A 1P91A 3O74A 2BFBB 3HVIA 3PX0A 2IH4A 4B84A 1KORA 4JOSA 5EXEA 1JKIA 5K0CA 2O4UX 2B61A 2ZUWA 2GBGA 4UTPA 5D6OA 2Z6VA 3UKJA 5ALMA 2XYHA 4EQ6A 3PPVA 2FNAA 2JFVA 2QVZX 4M8KA 5DLYA 5KKAA 3A31A 3JRWA 2I3ZA 4E2XA 2ZATA 1ZQQA 2GM5A 3ESBA 1Z2EA 3K0HA 4DSOA 1Z0FA 2ZR8A 3OJLA 4FFBA 1NLUA 4OOFA 4Y6QA 4R9VA 2GBPA 1DAKA 2ZRGA 4B6PA 4C89A 2LI6A 3CEMA 1LDMA 1UJ2A 3IP8A 3H05A 4ZKEA 1L7XA 1MQAA 2AL7A 2QVCA 4PNEA 1S2DA 2E4ZA 1EUYA 3H40A 3FCSB 3K1AB 2CHVA 1N33B 4HT3B 3EH1A 2BEVA 2IEGA 3CQ9A 1OE0A 2AOTB 3HGQA 4R1PA 3IIMA 5DFAA 3T3NA 2H3FA 2HBZA 5EE1A 1UPBA 5CT9A 1I3LA 1NNEA 3RFAA 1QG4A 1P75A 2Y9PB 4Q1BA 1ZM7A 2ZUTA 3UJDA 4C6TA 4RNMA 2CNWD 4GC6A 3FDIA 4BAGA 5IDQA 3UMBA 1PEKE 1PR3A 3O93A 5J2TF 4F4HA 2PUDA 3ISJA 4QTZA 2XSZD 1D6MA 2QD1A 4MX8A 1B43A 3U5ZB 5B2EA 1QKJA 1NX9A 4HNSA 4S1NA 5CA7A 4HOYA 1FDIA 3HKZC 2DKOA 3AEKB 3KTOA 1CZKA 5EERA 5DLGA 4BMXA 4PAQA 5AHXA 4O0IA 1HKUA 2UYGA 2B69A 3BWXA 3LXXA 4KODA 1RTTA 5DTJA 3W3ZB 4BKPA 3S28A 1A2OA 5CEHA 5L3ZA 1TTHA 1I4TD 3GB9A 4G25A 4V2IA 1HV8A 2GWRA 3KZCA 2CXOA 4Y8VA 5H3CA 4B8WA 4RVGA 2B7LA 1GD1O 2IUYA 4DSEA 2QY6A 3GL9A 1QPZA 1CYEA 1YDWA 3KKOA 4E5YA 2VDRB 3LCMA 2HR1A 2VHUA 1V71A 2QSJA 3K8YA 1UM9B 1LSOA 1GQYA 2RG7A 3ZHXA 4ESEA 3OGUA 3A3OA 5AVUA 3D2SA 3PR5B 3ZV5A 4L1KA 5K8TA 1RQGA 3QLUC 3HCPA 3SU8A 4UQLA 4ZAFA 1UKAA 4AJOA 4WGGA 2WYUA 5A0TA 3PP8A 4RH1A 4QTTB 1GWNA 1VIAA 2DU8A 3PR3A 4EEXA 5KYXB 3N6VA 3CR7A 3KYCB 5K8UA 2VHEA 2A1JA 1BPYA 1XQ6A 2CKDA 1YV9A 3SEQA 3THYB 4KXNA 1SWVA 1ZMTA 3GN2A 4W8OA 5JI2E 3AV0B 3FPEA 4TWBA 2YYAA 4R8UB 3E8SA 3DAFA 1QQTA 3T06B 3QPDA 5B6PA 4MV9A 2LGJA 3IUEA 2J3DA 5KOJA 1M6YA 1E63A 4C0XA 5HFAA 3WLTA 2HMUA 5FOWA 2X8AA 5EHZA 1DMSA 3PQDA 4CIVA 1QO7A 2JIZA 3JARB 4ITUA 2DKXA 4KYTA 5BQXA 4MEYA 9ICBA 3KHGA 1R12A 2VWGA 2WJPA 3MVEA 3PZPA 4RXUA 3N39C 3ZU5A 3ZYCA 1HRKA 1K75A 1REQB 3WGUA 1U9IA 4RQ7A 5KNCD 2CV0A 4MUXA 5BSKA 3X1DA 3LL4A 1WS6A 1CDDA 2PU5A 2J07A 1QFYA 4L2IA 4W5HA 1XZKA 2A5LA 4QICA 4IOKA 4D57A 4QZCA 1M34B 2G88A 3FI0A 3LPCA 2E8MA 3T3FA 3QLVC 1SULA 4PG5A 4F84A 1E1DA 2JJYA 3UNXA 3HJBA 1BMFA 1BN7A 3WYEA 3FMGA 5EWMB 2ZROA 1AK1A 2HV8A 4Z0TA 3V3KA 3FBWA 2HA3A 3DVLA 2A5YB 1UZAA 2CXSA 3Q1LA 1W46A 1XNQB 2ZUVA 3S2ZA 1K8XB 5IIOA 1G9SA 2C82A 4M0MA 1KN5A 5A9RA 3H4DA 3GIKA 1GTL1 1AKTA 5IJ9B 2H2AA 3MTBA 4YCMA 4FR2A 4EG8A 3EPIA 2Z2JA 2A1TS 1RCTE 4KDCA 1A8HA 2EQYA 4FYVA 1FZQA 2OBNA 3NHFA 4RH0A 1Z4OA 1V7QA 1BFKA 2FPIB 5EZ5A 4B87A 1SHZA 2KVSA 1U0EA 3MTEA 3QWHA 3RRXA 3ESAA 3VV2A 4I1PA 4LRYA 4OL9A 4CKWB 2RI0A 3LGAA 5FFMA 1MHPA 2DT8A 4OJNA 1YOBA 3DZCA 4GYWA 1KO1A 1KMHB 2FMPA 3ZVLA 3RAFC 1ECWA 2YYZA 2EYUA 4XR9A 5FLXA 3ZQ6A 4HF7A 3H9JA 4FN4A 4D8TA 4F2GA 3JAWB 1MEOA 2CCGA 1T7PA 3DL7A 4NABA 4PTYA 3VTKA 3ZU4A 4DA6A 1S2OA 3JD4A 3RTCA 5AH0A 1UJ6A 4A8PA 1DI0A 4RQMA 1X0VA 3RB6A 3DBIA 3G2IA 5G02A 3L5OA 2MMCA 4I28A 2ROQA 3QGMA 4E7OA 4LVNA 4RPXA 3TJMA 2F3UA 2BD0A 3I83A 2XX3A 1BEEA 3TUZC 1COOA 1W76A 3LK6A 3T52A 4QJ3A 2RONA 1HXHA 5KMGA 1W44A 1GPJA 1S6YA 4EI8A 2O9JA 4LOKA 2BE7A 2ODTX 1TT7A 3GZTB 4NYIQ 2JZOA 4TLLB 3TK1A 1QYWA 3CLTC 3U7QB 1IEXA 2MDTA 3ZWDA 2XXBA 3H9QA 2GF9A 1Z37A 2C5LA 3Q2KA 4JP2A 5K3FA 4DL6A 4WUVA 3NCTA 3UHPA 4F7DA 3EBPA 1H66A 1N5LA 4YLEA 3U1BA 1TK5A 1B6RA 1SEPA 2JHFA 2F3SA 4M7RA 3MFHA 1P4SA 5CFLA 2HPHA 1YDEA 1M83A 1OILA 4Q9LA 3OH8A 5BRAA 2V65A 4K9RA 5IUNC 1G8AA 1X86B 2JIBA 3OMWA 3UWKA 1GZUA 4AM8A 2P8JA 2ISPA 4UUBA 4QGGA 5AKEA 4RA6A 3EC7A 3EIQA 4MGYR 3D6VA 4QATA 3H9GA 5JD6A 4JCCA 1TYDE 3AF6A 3T5PA 3LM8A 4AMUA 4XX0A 2BSQA 1E2PA 1LLFA 3VH3A 3EXG2 3GELA 5BMVB 4HDRA 2G04A 1ZCJA 3HDTA 5LD2B 2QMYA 1O4WA 2OH2A 1ORVA 1U2GA 2KSOA 4I1OA 1XQYA 4TVOA 4X8OA 4DTIA 1WQ3A 3RH5A 2K8BB 4X1YB 3EDRA 3WMFA 4NK4A 1PD0A 2QW8A 3KKMA 3OKPA 2W93A 3F53A 1Z2OX 4HAUA 3WKEA 4GZMA 1T8PA 1OI3A 1T4GA 3N0TA 4TS1A 1WHTA 5BSMA 4ZGGA 1VOTA 2ATEA 4ZZ1A 1U1FA 1VL0A 1UJBA 2Q1YA 4BWJA 4A2PA 2OHFA 2XPCA 3ZCQA 2K5UA 3AF2A 1NXXA 4DCJA 3TZQA 2ZJAA 1L5VA 2RD2A 4U4AA 2BCGY 2Y76A 1Z0ZA 3WGNA 3CH6A 3W9BA 2PBFA 2H85A 3VR3D 3MSXA 2AN3A 2R9VA 3LZCA 3PBKA 1PEAA 3WHKA 1V5EA 3DO6A 3K6SA 4US0R 1HZJA 1NBMD 1SKAA 3EYAA 3C2MA 4PYIA 1U28A 2DMRA 1YHZA 4YWHA 4WIAA 1M1YB 3ZYZA 3V4VB 3Q5DA 3F2BA 4EF6A 4BV3A 4ZK6A 3KS9A 2UVUA 5JWOA 4G8JA 5GQSA 4I9GA 2RGDA 5K8JB 1IVYA 1BSVA 1XDBA 5SZJA 4F2DA 4IDBA 1HE1C 3SVZA 1OLXA 1YCDA 2NADA 3HDJA 4A10A 5JANA 1QZ3A 3AV3A 3UXPA 3H4VA 3KOMA 4CM4A 2FKAA 3H6KA 1H3EA 3RFXA 3DM5A 3UBMA 3NDRA 3PUZA 4BX0A 1EXDA 1PR2A 4GXJA 3IRVA 4N01A 2I3BA 5IVHA 4QSHA 1JEAA 4YMHA 1A97A 2HFKA 4OAOA 1KZ4A 3NBYC 1Y4ZA 2EKLA 1C0LA 2XV1A 2ZJ1A 2RBEA 1IBRA 3CRNA 3HZHA 4PLZA 4PG6A 1OLSA 1KEWA 4L95C 2CNWA 4AP9A 5DYWA 4HWGA 2PAFA 2YICA 1E1QD 4RQ3A 1KJNA 1XUOA 2AFIB 1OBVA 2G17A 4Y9SA 1D0SA 3GZ4A 4DYHA 4EW2A 1B14A 4JJAA 1P7VA 1WMAA 2ORYA 5FA8A 3CSUA 1OX4B 3AINA 2ES6A 2CK3A 5LA6B 3UV3A 4JMLA 3UKOA 1MIOA 1U45A 3TGLA 2LBOA 2IYAA 3V1YA 2ECKA 3H9EO 3J80A 1Z4KA 5JUMA 3FTEA 2RHTA 1P44A 4IUDS 1JSLA 1I6KA 1LBEA 4WWHA 2H5XA 3G8YA 4B32A 2F8TA 2E87A 2PKYX 3C8HA 3N87A 4R3NA 2OV3A 3E0XA 1JN0A 1KU0A 2DJ5A 4P3YA 3KFXA 5HM8A 4V03A 1LRJA 2TRSB 2ZS9A 7ICHA 1U0GA 1UC9A 5DG7A 2JA2A 3HDVA 4X64B 3HM9A 2PUFA 1GADO 2O1WA 5I7HA 1OZ0A 1MOPA 2P4EA 2VOJA 1S1CA 4UB5A 4F45A 5CAEA 3TZHA 2J46A 4BLRA 3ZHSA 4LJ9A 4OYYA 2BUCA 1JTEA 3UMSA 3IT3A 3IL2A 4RFSA 2CKMA 3ZU2A 3CX4A 2E4UA 1TJ3A 1PR5A 4TMYA 3U19A 4XDHA 3WKCA 3OQBA 2FSGA 3CUKA 1AA9A 2E89A 3ND9A 2ZIXA 4MI9A 2V4UA 4LDQA 1HNXB 5K4AA 1DL5A 3UAVA 5JC8A 3O91A 2AZ4A 3CZAA 1TLFA 4GXQA 4YCNA 1EHCA 2ZSIA 4K0RA 1NKVA 5H9VA 2NP7A 1Y6JA 5D01A 3CH5A 2KSOB 1CIJA 2ASEA 1ZD4A 2HVIA 2N46A 1M5UA 4X94A 4WJKB 4NV0A 2QW0X 3LUKA 4K81B 4UBMA 2GA9A 3R24A 3FTNA 2Y27A 4NOMA 1U2ZA 5EZYB 4C22A 4EHFA 1O9HA 4ZMRA 4PAWA 3SPXA 2N47A 3K4PA 3L49A 5A9SB 1FMLA 2BFEB 1KARA 1K8RA 2A0YA 2PFSA 3L5KA 2X14A 2DHEA 2BCVA 4TKLA 4URXR 3BQ0A 3KTAA 3ZHOA 3T4UA 5FL7D 4CT5A 2GVZC 4POAA 4B2YA 1PK1B 1E1RA 3AY6A 3D1VA 3TKAA 1WX1A 3H2IA 4PC7A 1DFGA 3O4GA 1R5OA 1X7XB 2XNDA 3AXTA 1W6UA 2BF7A 3FPKA 1NPTO 3HU1A 2WUEA 2YNMA 3CLVA 3OJXA 4LMBA 4MAMA 2FOIA 4MB2A 2R4UA 4G56A 1CDOA 1G8YA 1GQFA 4B9VA 1J2UA 4P4GA 4CHGA 5JXWA 3M6MD 3FNGA 4CM9D 3KDPA 1FFEA 1F6DA 3ICEA 1KL7A 3QHAA 1R0CA 3MOSA 4FOLA 4ABYA 1Q14A 2REQA 2WT8A 5SZKB 2E1FA 4F4XA 4D43A 3EVTA 3NT2A 2M32A 3IAM1 4OHUA 1MO3A 4AI6A 5CNIA 2YC2C 3V32A 4LFCB 3DONA 4JVNA 1L7AA 5IK2D 2OFPA 2YHUA 1MT3A 4IP0A 4TYPA 4ZVNA 3RUFA 4BVHA 5H16A 1JIJA 3SLKA 3KWFA 4OHYA 2YUTA 2P5YA 3FPJA 4G5QA 1DEKA 5AVVA 3FDZA 3VNAA 1W4BA 1F4PA 3RKRA 4MWCA 3L7BA 5EE3A 1E6LA 1ZJ6A 2AQ8A 5EQJB 2EX0A 1ZQZA 4Q3BA 3KTQA 2H07A 2VHTA 4JYCA 5CYPA 2QJTA 2UYCA 2C07A 3PCRB 5JQGA 3BAZA 3W06A 2QSUA 4YMNA 3WQQA 1C1XA 2Z57A 5HJEA 4M99A 1B8VA 3E5NA 4PFKA 4EG7A 3B1VA 3DR5A 5CB6A 3KQLA 1RP7A 1U8FO 1ZUNA 1T94A 3TTVA 1UANA 1UCFA 1BGWA 2VDQB 4MHTA 3IPAA 2WD7B 3N28A 3I01M 3BIWA 3H11A 4INOA 3T54A 3WIVA 3TF5A 3HKZF 3WQRA 1KOLA 2HADA 5FYDA 2YIMA 4G89A 4GM1A 3O3MB 3DBRA 4CEJB 3JVDA 1YOVA 4ZK2A 4EHLA 3QE3A 3FPAA 4P7BA 4LSWA 1YB5A 4N0PA 1DWUA 4E7PA 1OOEA 1T9CA 1Y3BE 4NL4H 4FFVA 3D7NA 1XE3A 2H92A 4KXQA 1IN1A 2BL4A 1G5QA 1GGEA 3TW8A 3ZV6A 3D4NA 4TRJA 2OYYA 3II6X 4FUTA 4K6FA 5FOVA 2QUJA 1XVVA 5EPUA 4DF4A 1CS4C 1YB1A 5ED4A 1RYNA 1G8GA 3GJYA 4QELA 4RJTA 4FYYA 4ZEXA 3TS1A 2VK4A 1HC7A 1QJCA 4DCGA 1QTMA 3KKAC 4HLUC 1G6HA 4LV5B 3G02A 3VTAA 1ZR4A 1QVRA 2OHIA 2PKWA 3C39A 4RLSA 3WWOA 3C3BA 1D2CA 2BJWA 4G4IA 4L8LA 1O97C 3GRZA 1AKWA 5KQGA 3ZUGA 4GL4A 4RF3A 1MH1A 3A8TA 4TUPA 1PQYA 3LX8A 4NMWA 4WOPA 5T57A 1ZQKA 3ICCA 1JKJA 4HKTA 4UD6A 1F06A 1RQ7A 5HQJA 5IC5A 4AZ0A 2B2CA 2RB5A 3SSMA 4WK2B 2NRWA 3TLGA 4EUFA 1TJNA 2JK1A 2W9XA 3DWEX 4ND4A 2CV2A 4AK9A 3BTUA 3WGIA 3EQ6A 1PK1A 4TV8F 1G3MA 1FU8A 2GNPA 4QWAA 4J7CA 3ZZ1A 2QKYA 4UHDA 5IMSA 2WHXA 3OIGA 5DHPA 3TVYA 3RIEA 1KH1A 1QFJA 1U65A 2IWHA 1GDHA 2VCYA 3U7IA 3H84A 3IXLA 4GRDA 1JJIA 2XVMA 4L4YA 4H27A 5AYVA 4CIBA 5LP6F 2PUBA 4LCBA 4BNGA 3TI0A 2F1HA 5J0OA 2PRIA 5JOQA 2XADA 1WXHA 2QPTA 3FRJA 1E8MA 4KFTA 4MIYA 4R0VA 3BQ7A 5J0RA 3J81k 4HWRA 1SC4A 1C7RA 2RGNA 2RKOA 3LUAA 4E12A 4FS2A 1NA5A 1U3WA 2BFAA 3G2OA 4X0EA 3USES 4E70A 1CV2A 1PG2A 2I7TA 3LNTA 1Q7CA 5EWJA 5SYNA 4DLVA 5DOZA 4FNGA 3FX2A 1VGVA 3HY6A 3DNMA 3SJUA 3WP0A 3PTZA 3OSPA 1UFOA 4N9QA 1Z4IA 4Y9UA 1C3VA 1YBVA 4XE5A 1Q20A 1UZLA 2ZUEA 1YB4A 2GZ1A 2VP3A 2GESA 4C01A 4F4YA 5ESRA 3P9YA 4LFAB 3OE4A 3KO8A 2FSVA 2ZRPA 3K9WA 3C3JA 1UHUA 1YR2A 3K0CC 4JCOA 4TYQA 3DAOA 1J0BA 1FQOA 4RPYA 2XB9A 4TV8B 4CM6A 4CM8A 4XDGA 2JZNA 3K09C 3TE7A 4BWFB 5AJUA 3KUKA 5KSOA 2IEZA 1W5AA 2OBMA 4QYWA 2XKKA 3GA7A 4TKMA 4BC1A 3Q3HA 2D06A 1G66A 4E1VA 4PS1A 3UN1A 2O8EA 4IBOA 4MV1A 5GONF 4OVKA 5LDGA 1FFGA 4CI0B 4PX5A 2AN5A 1X87A 3G6WA 1QR6A 3FYSA 1U02A 2NQ2C 2Z7JA 4G0XA 3SM3A 3VNQA 1FLNA 5TDHA 1OUMA 1JA0A 4HYQA 4TROA 2WVHA 2E5WA 4DGQA 5JTTA 3NBUA 3ZE1B 1W36D 2J6HA 3FVRA 2G9RA 2P2NA 2QL9A 2VL7A 1GO3F 4P53A 2JH9A 3A37A 4R71A 3EUAA 4R68A 1KKUA 4X3OA 5DNYB 4MWSA 1PR1A 4QOHA 5KTTA 3LX5A 4XASA 2ZRLA 2BHNA 1JB1A 2BBOA 2NSDA 3P0EA 3UB4A 1R4NB 4HV4A 2DTDA 1BH6A 3NH6A 5ALJA 5DGCA 3KEMA 4O08A 1MOSA 1SVOA 1CY4A 4MS1A 4X6UA 4DR7B 2Z98A 1A5BB 4QM7A 3SDSA 1HQYE 3F46A 3IERA 4GSYA 3SYTA 3U62A 5JY6A 5DI3B 4MUMA 5ALFA 4BNZA 5TT1A 3ONVA 3KVRA 3STHA 1BVRA 4NE2A 2ZDGA 3H5LA 4HRYA 3TAQA 4GF5A 4Z8YA 1Q0LA 4ER0A 3DLAA 2E55A 4F5NA 4DEYA 4C4PA 1FU4A 4CLDA 1USKA 3QRWA 1DB3A 4B47A 1VKRA 2BFPA 3N2NA 3WQSB 1GR0A 2NUPB 5F4ZA 4F0JA 4IR1A 1UKBA 4O4HB 3GDWA 2VTDA 4L73A 3RAQA 3G7NA 2IPMA 1IJEA 3ZXYA 1QZZA 4GGOA 2ZRDA 4HRVA 3I73A 2VRWA 1CUZA 3QF4A 4DQIA 1GPH1 1U9JA 2HWXA 2QRNA 3CIOA 4IQUA 1CNMA 1EK0A 2FE9A 1TK0A 1GQRA 4S1VA 3PE4A 1L5KA 4DIOA 1QWOA 3LS2A 4WERA 3TFQA 2UZ3A 1QLNA 1PJAA 1UDRA 3OEED 5CH8A 5KOHB 1C0KA 3JQAA 5AI5A 4R8UA 3JU3A 5AKXA 3D59A 4P84A 2QTBA 3X1ZA 2EW2A 4EUSA 1UBMS 2YN0A 5SV2A 5BR7A 5I51A 3P9XA 4RZ3A 5CFMA 3WNZA 3NRZA 4RUAA 4MF2A 1ND5A 5KWEA 4RK5A 2JJ2D 1JYSA 1RRGA 2WSSD 1P6QA 4HH0A 3VSCA 1NXVA 3ZJTA 5TXGA 1RZRD 2ZTCA 4EAAA 2R60A 2FWJA 1JIIA 1GDDA 2XYVA 3MAAC 1XI2A 4GP9A 2G28A 5TQ0B 1KI9A 2ZJ4A 4BP3A 3KHTA 3R7FA 4OQPA 5JW6A 2UU9B 1NY5A 4GW3A 7ICGA 3S1AA 3TQTA 3UJ9A 5JQWA 1Y1LA 4DCSA 5CP8A 2R8HA 4DVGA 2FHSA 1O6ZA 1ONBA 4KMOA 3H8VA 3QFFA 1PUXA 5HMMA 2ZXHA 4LXYA 4AD8A 1PF7E 4KIGA 3ZU6A 3DTVA 1UDWA 3GT4A 2CK3D 4YGXB 2H5JA 1TYZA 2BHSA 1N0WA 4CM8B 4OFWA 4RKQA 1UPXA 1RPLA 2Q5OA 2WICA 2ZBVA 2CSXA 4ED2A 1CUJA 2ZCUA 5LMCA 2PIDA 3L4BC 3MOIA 2JBAB 3RUHA 3DMGA 5D46A 1RYMA 3MINA 1G8HA 3NIBA 2J7PA 3OCCA 4CGZA 2D4AA 2OEPA 3TVDA 1EFKA 1N2GA 1OHHD 2DKNA 3BAFA 3LHSA 4LJ5A 4ZXFA 4X7RA 4M37A 3RDPA 3HU2A 4PHDA 3UJ8A 5CDGA 4IUBS 1RJWA 3GILA 2HK6A 2I7DA 2QUZA 4PYKA 5IU6A 4KTQA 1RG6A 3T79A 5KYVA 2IPXA 4F4ZA 3KVOA 3EMBA 3OFND 4KPUB 3DVAA 2HCFA 4RQ8A 3ZCSA 2A1AA 5IBCA 3ITNA 4NLKA 5T7BA 1Y3HA 1SL1A 4Q7JB 4ZZIA 1QAMA 1YQDA 4M1SA 1BS9A 1Z9BA 1ZKMA 2OAQ1 2OM2A 5DGIA 1FUYB 2NT3A 1NULA 1II9A 2BM0A 3PC8C 4DPKA 1DP4A 1OXVA 3GFKB 1C30A 2EJUA 2Q50A 3I0MA 4JBWA 4YV2A 2GASA 1MENA 2H57A 1RIIA 4NLNA 1T9GR 2ID8A 4YQWA 5C2JB 4YX9A 5REQA 4BIIA 2J9FB 4KBYA 1FP2A 2PTGA 2A1UB 3AOGA 3LZ6A 3NH9A 1DUVG 2WI8A 1EEXB 3VPCA 4L0MA 3WMWA 7REQB 1CFJA 2GN2A 3THOA 3FJOA 1CP2A 3V6LA 4LYJA 3RT1A 4KVAA 4XCVA 1QCKA 2B34A 1E5TA 2BM8A 1K68A 4RDXA 4YP5A 1ECJA 1H2ZA 4ZJUA 1NX6A 2X0EA 1M2KA 5TF0A 3WBBA 4DN6A 2IFTA 2AG6A 4WXMA 2FEXA 1UJMA 1GAWA 1Q11A 3KB1A 2JGIA 4XPIB 1OXXK 5FNVA 4E33A 3OPVA 4CDMA 4P38A 5A0VA 4HGQA 1JZSA 3FNQA 2IIVA 1UPHA 3BXEA 3JQEA 4QPDA 1ZH2A 2I5PO 3FVVA 4J9KA 3NTOA 3U4IA 4U00A 3TQCA 2G1KA 2FXIA 2WT4A 1CUXA 4IDEA 2YWJA 3FGOA 4HYKA 3HEAA 3HP1A 3IURA 4XM0A 4KXFB 1C8KA 4TWJA 4B9TA 1PT6A 1Z2NX 2PSJA 3OECA 4DHWA 2ZUCA 3N7TA 1RAAA 4M8SA 1BMFD 2Q3JA 4KLLA 3MAJA 2O07A 3SKYA 1ZQBA 4M21A 1OJ7A 4OJ6A 4HJXA 3VR5D 4M1KA 2QXTA 1YZUA 1OXUA 2OWOA 5KX5F 1NVAA 4AFNA 1JWBB 3HB5X 2QD4A 4PC6A 3H2KA 1BXGA 1TECE 2RHOA 4P6VF 1QH8A 2FLWA 1MJGA 4NCNA 3N70A 1OAAA 1K08A 1RLUA 2OORC 3DGFC 4YC7A 4LWOA 1P0MA 2AE1A 2ECPA 2IX3A 2WB1F 1TF7A 2XD4A 4TTAA 1FNDA 4HVCA 1K5DA 1T1EA 1Y4DE 3GIWA 3HCFA 3EN0A 4X1KB 2ZUUA 2NRTA 2B99A 4D46A 4DUGA 2ASVA 1JEQA 2C98A 2XE8A 2BGUA 3HN2A 4GH5A 4ZVVA 3W6PA 4D97A 2B7BA 2ODWA 5ECYA 5B5SA 2ZG6A 1IB6A 2Q5FA 2ZLBA 4K9OA 4ND7A 2IA6A 1XR3A 3PI7A 4X7PA 4NPAA 3U7RA 3CF2A 5J4VA 2EJTA 2VPQA 1XEAA 4OEHA 4XB2A 2Y0DA 3UVEA 5U1PA 1AO3A 4DLNA 5IAJA 4C29A 4MW2A 4Q12A 5EIFA 3FHCB 4QNMA 3PIIA 1TVCA 3SXUB 2GETA 5HIMA 1KI7A 2KICA 1P31A 1RP1A 2P0YA 2QJOA