2WFBA

High resolution structure of the apo form of the orange protein (orp) from desulfovibrio gigas
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
120
structure length
120
Chain Sequence
ASHMQRIAVTAEGPGLDGLVDPRFGRAAGFVVVDAATMAAEYVDNGASQTLSHGAGINAAQVLAKSGAGVLLTGYVGPKAFQALQAAGIKVGQDLEGLTVRQAVQRFLDGQVPMAAGPNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN ORP
publication title High Resolution Crystal Structure of the Apo Form of the Orange Protein (Apo-Orp) from Desulfovibrio Gigas
rcsb
source organism Desulfovibrio gigas
molecule tags Biosynthetic protein
total genus 37
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2wfbA00
1P90A 2YX6A 1EO1A 2KLAA 2WFBA 1O13A 2QTDA 1RDUA 2RE2A 1T3VA
chains in the Genus database with same CATH superfamily
5C15A 4BG8A 1ZBLA 3RMBA 1GOAA 5GADP 4BG9A 3VQPA 3L2UA 3LDSA 1NBWA 2Q97A 3A5LC 3VQBA 4WCEL 3GDQA 4OPAA 4AHRA 4H4OA 1GOCA 4AM7A 3EY1A 5C2FA 3DAWA 3TAEA 4Z4FA 2XY6A 3ZSRA 1NK6A 1J9AA 2FBTA 2AP1A 1NJWA 3ZX3A 5AZIA 4DWIA 3KD1E 4DV1K 3F73A 1VQNN 4MDAA 1CLQA 4E89A 2PYLA 4MQ3A 1OVQA 4FL9A 5AQKA 4FJKA 4K0KK 1RTHA 3M8SA 5AQUA 4IXCA 1J53A 3DRSA 3AVCA 4DTRA 4IDKA 2HOEA 3C6AA 1X3NA 5EY4A 4DQRA 4PUOA 3HL8A 4M3YA 5DK5A 2KFZA 2QEXN 3I56N 1WBBA 3VETA 1V4SA 2KFNA 4GV3A 5HL7L 1BL3A 3KHYA 5F2RA 1GLLO 2VGMA 4JI1K 3L3UA 2UXBK 1EXQA 3AVNA 3DOLA 3VF6A 1CXQA 4H8KA 4BE0A 2GUIA 4CK1A 4AILC 1ZBUA 4YOTA 5HRNA 1QZ6A 3N4QA 2YJFA 2FBYA 2E2OA 3F9KA 4CGHA 3QEWA 4CZKA 4GNIA 3DLLL 3D2EA 3IG1A 3VESA 3J7AP 3KTQA 1NJYA 2HBJA 1T05A 3PLAA 2B4JA 2BH1A 4GVMA 4CJLA 3SZ2A 3AGKA 2VCPA 3VQQA 1XQSC 1DLOA 1U2VA 5FRNA 3NH2A 1N5YA 4YOVA 4HUFA 2QKKA 2QWLA 1T44A 1HR0K 4ID1A 4DF8A 1Q82O 4N41A 4B9QA 1B9DA 4CJKA 5J2NA 4M3ZA 1ILYA 2FLOA 3PIOL 4FZZA 3C0BA 1HNXK 3U9DA 5FPEA 4F8RA 4O5BA 2E4LA 3TR8A 4JHDA 4NO7A 4DR1K 5KRSA 4BR5A 4CEBA 3UB5A 4BY9C 1T3VA 1RBUA 4PHTX 3CQYA 3HP9A 1JCFA 4DG1A 1KLMA 4FM2A 3LM9A 1IG8A 1QQOA 3OY9A 2J4RA 3BZCA 1TKDA 2VQEK 1FW6A 4BRMA 3D2FA 2P9SB 4JKGB 2IDOA 4FSVA 4YOUA 3QESA 4DQPA 2WONA 4KH6A 3NCIA 4KHQA 3OYGA 1WNSA 1T03A 1X9JA 4CEEA 3RRGA 1S3XA 1NK0A 4FLXA 3SI6A 4N47A 3E9LA 2ZJPL 2XRIA 1KVBA 2E1YA 3AVGA 1E4GT 3B6PA 5KTQA 5AQZA 4B1XB 3DLBA 4RCHA 1HNWK 3AVIA 2F4VK 3L4QA 4MDBA 1NKBA 1REVA 3QEPA 2QWOA 1HQUA 4U67L 4H5NA 3VEVA 4FPBA 4U7BA 1WOQA 1I3AA 4ZTJA 1NGFA 2V7YA 4CFDA 5JVHL 5EX5A 1M1KO 4LH4A 4HHTA 3ZETA 2VG5A 3MEGA 4I9LA 2E6MA 4GMJB 4BE1A 2XY8A 4IOXA 4FLUA 4A5AA 2HBMA 3MXIA 1U47A 4ELTA 1UOCA 1FXXA 2Z1IA 3ZSOA 3LWLA 2KLAA 3RRHA 1VQMN 4M7XA 2F96A 1KAXA 2NUBA 5LMNK 4CCHA 2O8CA 1LWCA 1DT9A 4JS4A 3MMVA 2YX6A 2ZWHA 5T7BA 4BR9A 3SQ4A 4V19S 3CCJN 1R0AA 4JI0K 3HOTA 3UKUB 3R3LA 2ZM6K 4DTUA 2YHBA 2GEMA 1VQ9N 4KFBA 3NF8A 2HHHK 3WXKA 3CJAA 3T3FA 2QI2A 4O8KA 4M7YA 1TK0A 1RT5A 4JRPA 1NJIO 4FJ7A 1DGKN 3SMPA 4BACA 3AY9A 4O4GA 1KQSM 3CQXA 2D4WA 3W3DA 4FJHA 4CZIA 4DU4A 4ELUA 4C8OA 1D8YA 3DRPA 4RW9A 4A2BA 4CIGA 3L6QA 4YNQA 3TI0A 1L5UA 5BN9A 4HVJA 4IWVA 3WXMB 3SBTA 4FJXA 1C0MA 1JCGA 1NK7A 5GIOA 1XNRK 2F8TA 1VSIA 3NF7A 1WSGA 3A5MC 3C6HA 3LDQA 4JKCA 4Z4IA 1C1BA 1RBRA 4FJ5A 3IRXA 1VQLN 1GOBA 3QMLA 2GV9A 1K8AO 4RW7A 3ZSQA 5KGWA 1RDDA 2D0BA 3NDKA 3NH1A 4LFCK 3N4PA 3HSTB 5M1NA 1S22A 1JKHA 3PX6A 4EZ9A 2IAJA 3RR7A 3BGRA 4KBOA 1RBVA 2F9WA 3HJFA 1FKOA 3CJCA 3D6RA 3UKRB 1NM1A 1W9HA 4JD2B 3DWLA 3TARA 2ZJQL 1WAFA 3NGZA 4XH1A 2D5RA 4K42A 3RMCA 3RMAA 1VQ7N 2FF3B 1TGOA 2IVOA 4W5TA 5M1PA 3IMXA 2ATQA 4IG3A 4K25A 2FBVA 2XO7A 4CJTA 3I0RA 4B3MK 3VQ7A 4FLTA 3BF1A 3GBTA 4LSLA 3IAYA 2ASPA 4DV7K 3HO1A 2GWJA 1HJOA 1KFSA 3FGUA 3CIPA 3TABA 4IFYA 4YORA 4CFAA 4B3RK 5C42A 3NH0A 3FZKA 1SZ2A 1KRPA 4DV2K 2KTQA 3KD5E 2P9SA 4JKGA 4X66K 1L3TA 3NBPA 2OPPA 1O13A 3MEEA 1HKBA 2G8WA 5BREA 4OKJA 1OH7A 4BC2A 3QEIA 3C7NB 4QOZB 2QWNA 1CZAN 3SPYA 4WE1A 3OYMA 2HF4A 3CCQN 4DR6K 2HNDA 3H08A 4WFNL 3TSUA 4E7LA 3AVKA 3QNNA 4DHYA 1WUAA 1HMVA 5HRRA 1Q9XA 1NGEA 5AFUH 3S3NA 1N33K 1JLEA 4AM6A 3HVRA 4GKKK 2W6LA 3CJ9A 4BC5A 4KPYA 1X1PA 1OH5A 1JLGA 4CHOA 1NGHA 4DU1A 3V9UA 2P9NB 3I8BA 4KREA 3FZHA 2IS3A 4YFUA 3HT3A 3OYDA 2PZSA 4KAZA 1Q18A 4DR7K 5FDLA 5AFUA 3K5NA 3TWHA 2YKMA 2FF6A 4K8ZA 1HKCA 4KHSA 3VEWA 4CGGA 5HRPA 4DQQA 3VQ8A 4IFVA 3NF6A 3HBTA 1YJNN 5KI6A 1Q8IA 4H0OA 3CC4N 3F9MA 3MXMA 2HHSA 1JJ2M 5M1QA 3D0PA 4AHCA 1HJRA 5C2DA 3WNEA 2E2QA 3AA3A 4NXMK 3U3YA 4N76A 3QDKA 4CEOA 4BC4A 3OS1A 1BCMA 4HWIA 2OPRA 1RTDA 3EZWA 4JAXA 3UKUA 4CZMA 2Q31A 5FLXO 4JK8A 3OYHA 1LAWA 4Z4EA 3QIOA 4JRQA 1BWFO 4CZEA 1U45A 5IT9O 1OH8A 1BQMA 2PAVA 3QBXA 5M1OA 2NLXA 4CZLA 3ZT3A 4JKHA 1HYVA 4M3TA 4X64K 5J2MA 1EWQA 1XHZA 4NCBA 4B1YB 4DV6K 4CEDA 1YVUA 3SV3A 3P83D 4DTJA 3ZLJA 3EL2A 4OGCA 4DS4A 4DSIA 4O8UA 4EHTA 3MX2A 4KV8A 3SBGA 1Q7YO 1CZ9A 5AQOA 5HRSA 2OZSA 3CCLN 3VGMA 1HKGA 3OJUA 3KLHA 1VQ6N 2BTFA 2GELA 1BUPA 3VQ4A 4DTMA 3TANA 4DFKA 5J1EA 3O9QA 1IJJA 1SV5A 5CY4A 1DKGD 4BRPA 1QTMA 1FK9A 1JLQA 2I7NA 2GUPA 4IZ9A 4KB1A 1GLAG 3QETA 4O5FA 1VRUA 2NRRA 5ADXH 4CESA 3WNGA 3OYNA 1HNZK 1MA9B 1T6DA 3CHWA 1QS4A 4FLYA 4LC9B 3WXJA 4FZYA 2UYTA 3KK1A 1LWFA 2E2NA 4MO4A 3PO4A 4DR5K 4FWQA 1NGCA 3AO3A 2KW4A 3H6EA 4CBUA 4FOIA 2VG6A 4FOEA 4H4MA 4BGAA 4BVPA 4CZGA 4ZTFA 4JD2A 2NRHA 5C25A 4PL8A 4DTXA 3V6DA 1NWKA 4J2EA 3EE9A 2DPNA 4QS8A 4A61A 4Y1DA 5C0YA 3VPZA 4DSFA 5M1FA 2O8EA 3O9UA 1KFDA 4M3WA 3SAFA 4AHUA 3P4IA 1N34K 1W0HA 4KTWA 4JKFA 3AARA 4JHDB 4DLGA 1NJXA 4CHQA 4OJRA 3V9WA 1G99A 1N32K 1RCHA 3H3NO 1KC8O 2ZE2A 3ZSZA 2GTDA 4FVUA 1NJZA 5FPDA 4IBNA 1TL1A 4CF9A 1WSIA 1BI4B 2G8FA 3AV9A 4BRKA 1T8EA 2V7ZA 3TTCA 3SMSA 4LF6K 3C7NA 3CXCM 1OH6A 3OVNA 4NLBA 3K57A 4WQ5C 1Q9YA 3MX5A 4MLEA 1SL0A 2VG7A 2W42A 3KVGA 4WQ5A 1KSPA 2H3GX 2EWSA 2JLEA 2F8SA 5SWMA 4JEPA 4PQUA 1RT3A 3AO1A 2V52B 1QQCA 3F2KA 4B1WB 3ATUA 3JSMA 3LDOA 2G8UA 4B1UB 2P9NA 4RW6A 3K58A 4GY2B 1JLFA 1QQNA 2LSNA 3HM8A 5E41A 4KKOA 3I55N 2YJEA 2NNWA 1NOZA 3OHRA 2DFFA 2O8BB 3CMAN 1TV6A 3O5BA 5BR9A 4CZJA 3VF2A 1D9FA 4PL7A 2O8CB 3QEVA 3MWPA 3QFPA 1HUXA 4DQIA 1HYZA 1LW2A 3HI0A 2OTJN 4BRCA 4JK7A 5LJVA 4ILGB 3PUFA 3TTDA 4CJVA 3HTVA 3FLCO 2YV0X 1VAZA 4FYDA 4KHUA 1B9FA 5AQLA 1SL2A 5AQWA 3THVA 4KB0A 5LMUK 1HLUA 3KK7A 1D5AA 1J6ZA 2W6KA 2HHXA 4G9ZA 3QINA 1QVFM 1IKWA 1QHAA 3IDHA 3P39A 3AVHA 4BRDA 4CK2A 1YT3A 2CGJA 4IO8A 2P9UB 4UY8O 4FJJA 2GBZA 1VQPN 5H1SQ 4CGJA 4Z4CA 3TTFA 3NVKA 1X3MA 1XUPO 2UUAK 2NZTA 4B9NA 1TAQA 1E3MA 4DB3A 2WOMA 3VTIA 3L2WA 5AQRA 3SLCA 3L0QA 1BO5O 1HNIA 3LP3A 5KPZA 1GLDG 4A2AA 4CECA 3O6WA 3IKMA 4LFBK 3AO4A 3LDNA 4FK0A 1D9DA 3DLHA 1IKVA 2D0PA 3T19A 1EKEA 2HNYA 4HTUA 4C8LA 4H5TA 1XNQK 3ULEB 4M42A 1ZC6A 3CCUN 5EU7A 1JL2A 3AVJA 4RTFD 3CJBA 4OGEA 1SKSA 1Z25A 3G0ZA 1TAUA 3H1QA 2E6LA 1HQEA 3D45A 3V9XA 4BR4A 4FM0A 3S3OA 4QAGA 1XMOK 4PKIA 2JWKA 1BI4A 3QFUA 4GVEA 3THYB 3LDPA 2QWQA 3BDPA 3J81O 1RT2A 1S6PA 4FWRA 1EQYA 3EN9A 2HB5A 1XC3A 2VYPA 5KPRA 2A3ZA 3FFKB 3DLGA 5JLHA 4IEEA 5AQXA 3J7YP 4FJMA 3HSCA 3CMEN 3V9ZA 5KPTA 3QB0A 2IVPA 3C94A 5FROA 3ZSWA 4IKFA 4B3TK 2NRWA 4OLBA 2QXFA 4BDPA 3OS2A 1BHLA 2X78A 3O80A 5AQFA 3AO2A 4CF8A 2P9KB 3DJCA 5AQTA 1TYQA 2Z1GA 3DM2A 3IFRA 3FZLA 2A1RA 1HX1A 4AQYK 1RGIA 4FWNA 4ISGA 1S9EA 3SK3A 4PWDA 4CFBA 4BREA 1BA1A 1YHQN 1JLCA 4X62K 3H3OB 1VQ8N 3BP8A 4JKEA 1ATNA 4DKWA 3OYJA 1QE1A 1NGIA 3V1QA 3O4QA 2O8BA 1IO2A 5GAGP 4FWLA 3PSFA 4UQGA 1NGJA 4QCLA 2D0CA 4H0YB 5HOOA 2OANA 1NOYA 2YKNA 1SAZA 1NMNA 2E88A 4BRGA 4FM1A 2ASMA 2JGUA 4B08A 4CJEA 1YAGA 3O4WA 3K9JA 1NKCA 2I5JA 3TAGA 2UXCK 3SJHA 5E26A 4R5PA 3T1AA 2OTLN 3MN5A 3GOIA 3SV4A 2BGGA 2A42A 3IUCA 4E1NA 5AQJA 4DFMA 3EEQA 3QLHA 1NNEA 4CF2A 1YXQA 2D0AA 4ISEA 1SKWA 3QERA 3NVMA 4CJUA 4DFPA 4KHWA 3KLEA 1SS6A 2O8FB 4WYBA 4HCCA 4C1NI 3SAGA 4DR2K 1BISA 2P9UA 1NK4A 1Y97A 2O4IA 3ENOA 1NK9A 1V4TA 3LWMA 1YTAA 1K73O 1WBDA 5SZTA 2XY7A 2Y1JA 3LM2A 2DFEA 1EETA 4RG8A 3E66A 1LCUA 2Q0UA 3LL3A 3CCEN 5DMRA 3OYEA 5CR4A 4BRAA 1L3VA 1MU2A 3B8AX 5CYMA 5C24A 4H5RA 4CIEA 4B9MA 4G1QA 4BQZA 3CG7A 4ILJA 3O9SA 2VWJA 2YNIA 3ASMA 3QICA 3T7ZA 3D7EO 3TPQA 1NG9A 2P5GA 4NLCA 3LANA 5AQPA 3T69A 4I9QA 5K14A 3ZT1A 4WFBL 1O1WA 4DV4K 2HBLA 1G15A 4DV3K 4JS5A 1C0GA 3ULEA 4DTNA 3S3MA 2Q3SA 4B9LA 2O8EB 1IKXA 1C0FA 2KKZA 5AQGA 1Z05A 1S72N 5AQMA 3MDQA 4YOWA 1K8KB 5LL6Z 4LF9K 3BUZB 3G25A 4BRFA 1YI2N 1RBSA 1RT6A 2EX3A 2CH5A 4JKAA 1BGXT 1KTQA 3AVAA 1TKXA 5FPMA 3THYA 4DTOA 2JWLA 1SKRA 3M5RA 2G8VA 2YHAA 2HVIA 4E1JA 3ISNC 4BWMA 4JYAK 2HF3A 1UA0A 4BGBA 3CCMN 2ITGA 2P9LB 2KQ2A 3V4IA 1QHTA 3LP1A 2HHUA 5AZJB 1BQNA 2DFHA 4GV6A 2XY5A 1RT7A 2YHWA 4CI6A 3F5TA 3KZBA 1DEJA 2NRVA 4IG0A 1Y64A 4QS7A 2VWBA 3KLFA 1VQKN 1OKJA 3DXKB 3PSIA 1RTIA 2PFUA 2AJQA 2P9KA 5AQNA 3ZSVA 4J2BA 3GE1A 1QVGM 4H0VB 3CM5A 1RDAA 1BCOA 2G8IA 3O9TA 4WFAL 2X6SA 4ZHRA 1WB9A 3L4IA 3VGKA 3OYLA 3AVBA 2YNHA 3VQAA 3HYFA 4DTPA 4CJFA 1S1UA 4AH9A 3ZT0A 5EXWA 1FKPA 3WXLA 4FW1A 4J2DA 1T7PA 1VK0A 1NGGA 4CF1A 2KHOA 3BF3A 1VSKA 4BE2A 4PY5A 3LDLA 1WSFA 3SUQA 4CHPA 4B9VA 3HOSA 4FWSA 5D3GA 4F2SA 3VQEA 4BRLA 1MDUB 4BR7A 3OW2M 4LF5K 3V81A 3OTOK 3AGRA 1YITN 3ZYYX 2XHBA 3VEZA 1NU0A 4A5BA 3M8RA 4RW4A 4IJNA 4H0XB 4CJQA 2F9TA 4FPAA 1EO1A 2Q2RA 3CI5A 4IOCL 3G71N 1CZBA 4L8RB 4JI8K 2O8FA 2OZMA 4ICLA 4W5RA 4JK9A 3P38A 4NB4A 3OYKA 4M45A 4E3SA 5IWAK 3LZJA 2CH6A 3A5NC 3O4NA 2YHXA 4EZ6A 3PIPL 5AQYA 2ZGYA 3AVLA 4HTLA 3DI6A 2Z1JA 4XEIA 4MFBA 3RR8A 2UXDK 1WN7A 1S1TA 3MECA 4BR0A 4CERA 1XWLA 4C8KA 1YUWA 1UA1A 2ITMA 2OPSA 2Z1HA 4H5VA 1X9SA 5AQIA 4BVOA 4CE9A 4W5QA 1N36K 3TAMA 4JV5K 3ZT4A 4KI4A 4B1VA 3J80O 3S9HA 4CEFA 4Q5VA 3WT0A 2F7TA 3ENBA 1VQ4N 3HVTA 3J8AA 1J5OA 3TAFA 3DMJA 4N5SA 3NGYA 2FXUA 2NRTA 4E7KA 3SUOA 1IBLK 1J54A 5GAEP 1KAZA 4HUGA 1I39A 3KWGA 3LALA 2RN2A 4BR2A 5JS1A 2PYJA 3OYFA 3NFAA 4CEQA 1JXBA 4ID5A 1K8KA 4N56A 3ZEUB 3U3GA 2HVHA 4OPKA 1XMQK 4B9TA 1B92A 3KKRA 3KIOA 4KTZA 4FWMA 5BRFA 4CJ4A 1YTUA 3FZFA 3THWB 1LWEA 4FJLA 4FJNA 4FWOA 3VEXA 3DYAA 3C6UA 3QIPA 3O3FA 2OCEA 4F2RA 4J8FA 5AQSA 3E9OA 2ETJA 1WSEA 3NAEA 3AA5X 3J7ZO 4CBWA 4DMNA 4LFAK 1KVCA 2P9LA 4C8MA 3CFPA 2W41A 2A40A 1KD1O 3R6MA 2BDPA 2UUCK 1U04A 5BRDA 3A2FA 1NK5A 5AZJA 2P1JA 5FPNA 3G10A 3ID6A 3SQ0A 4EHUA 1VSJA 3IS9A 1ZXOA 1LW0A 1OVYA 4Z4GA 4M3RA 1RNHA 3CYMA 4JI4K 3DXKA 4OKKA 3RMDA 1TYQB 3I33A 2YNFA 1KXPA 3MCAB 4LH5A 3FZMA 5TKYA 3LAMA 1BG3A 2ZGZA 4FO0A 4AHSA 4DSKA 2OPQA 1C1AA 3DLRA 2RHKA 3HRGA 4FJGA 4BDZA 2KZMA 3WEEA 3PO5A 4O0JA 4FJ9A 5LY3A 5GINA 3W0LA 1U48A 3JXUA 1A5XA 5JS2A 5TKWA 3L3VA 1X9MA 4DF4A 4QS9A 3PV8A 4DCHA 1HPZA 1HNVA 1Z6RA 4L3QA 4DSEA 5A2QO 4OLAA 2FBXA 2HHVA 2WC9A 3ATVA 5BR8K 2YI1A 1RDWX 4DUYK 1RDCA 5DM6L 2RE2A 2HMPA 3QBWA 3TAPA 2HBKA 1VQ5N 5GAHP 1NGBA 4DLEA 5KQ8A 3SAHA 3U6FA 2QA4N 1P90A 1ASVA 1YJWN 2ASOA 3LAKA 3MAQA 4PKHA 2WUSA 3VQDA 4MO5A 2O8DB 1VQON 1IV0A 2RF2A 5BPLA 5KGXA 5C12A 3HK2A 4B1ZA 1ESVA 3PX0A 2OYQA 5CHIA 1XI1A 2HHQA 3GL1A 3ZT2A 3DLEA 5AQVA 3DXMB 3L8BA 4CHZA 3QNOA 3Q7BA 1LV5A 3VOVA 5BPNA 1WSHA 2RPIA 1C0TA 1A5WA 1YF5L 5CE3A 4DU3A 4NCAA 4FJIA 3WXIA 2Q36A 3KK2A 4KH5A 3LPTA 3E1YA 4E7HA 1QZ5A 3U9ZA 1GLJO 2A1SA 3RTVA 1BU6O 4F3TA 3KLIA 3AAPA 1SQKA 4R79A 1ASUA 4F3OA 3VGLA 3OYAA 3UIQA 2P9IB 3NF9A 3O3GA 4EP4A 4M63C 5EOYA 1U6ZA 3BEXA 4W5OA 3CC2N 4DSLA 4KRFA 4W5NA 1L3UA 1RT4A 4OO1J 2VWKA 4EFHA 1RFQA 2IGIA 4JI3K 3ZEUA 1Q86O 4IEIA 4CD1A 1YJ9N 1UAXA 1VSDA 1W2BM 3TSPA 2A41A 2QTDA 4H03B 4B8CA 2FSJA 2G8KA 3T1HK 3THWA 1VSLA 2D0OA 4YDUC 3SUNA 5B8HA 2WFBA 1IKYA 4B3SK 3A8YA 2IC3A 4FW2A 3AA2A 4YDUA 1S1WA 4CVNE 3NE6A 1S9GA 3R1XA 2ZD1A 4FK2A 2A6AA 2HHTA 1ZBSA 3HPOA 4XIUA 1TUUA 4DR3K 3O08A 1N6QA 4BQLA 1KAYA 4DV5K 5BPMA 1BIUA 1DTTA 4O55A 3ENHA 1TUYA 3GG4A 5C10A 3ULDA 4ELVA 4BC3A 3VTHA 2VGNA 2QWMA 4ILHA 1RT1A 3CFRA 4KTQA 1EP4A 3O8MA 2WBNA 3OYIA 3V9SA 1ATSA 1GLEG 4H5WA 3VA3A 4KHYA 1TVRA 4K41A 3CPWM 4CGIA 4DFJA 1C0UA 5EVZA 4JI6K 1LAVA 4I6MB 4FLWA 1FJGK 3HPHA 3EYZA 4CJ3A 2P5OA 4E1MA 4FWKA 3LP0A 2BUPA 1W97L 2HHWA 3O1BA 2QKBA 5BRHA 4LSNA 1CXUA 1UWBA 3H45C 3S41A 1VSMA 5I42A 1J5EK 2QM1A 3DLKA 5KQDA 2P9PB 3JAMO 3O1WA 2WTUA 2Q0RA 1EX4A 3CC7N 3WUHA 5CYQA 2ZQBA 4OKEA 3FFIA 4Z0UA 4Y0WA 4IFEA 4DR4K 3THXB 4NXNK 1YVNA 1JLBA 3MCPA 2BE2A 4I2PA 4E19A 5AJ3K 5J2QA 1TK5A 1N8RO 3H46O 3L2QA 5J2PA 2Y1IA 2IIRA 1S1XA 3KK3A 4EIAA 1P8ZA 3CJ1A 3U4LA 4CZHA 3HM9A 5HBMA 4CGFA 2W40A 3G4SN 3UE5A 3CCSN 3NGIA 3C95A 3ZSYA 1S6QA 3SCXA 4F4KA 2P51A 3VQ5A 2O8DA 4GV9A 1GLBG 4M41A 3L2RA 4H0TB 5JLFA 1VSEA 5M1KA 4BWJA 4WF9L 2CGLA 1YIJN 2B5JA 4YHHK 4CJSA 4Y1CA 4LD0A 4BDYA 3VMFB 1HYSA 3DXMA 1XHXA 4GW6A 3WNHA 3TSQA 3VN5A 3MN7A 4E7JA 2GX9A 4Z4HA 4RWTA 4B8AB 1MWKA 4JI2K 4CJWA 2PY5A 2NRZA 3RSEB 1ASWA 3HXMA 4JKDA 3OBYA 3QEXA 3MWTA 2DTUA 2QWPA 1E4FT 3VEOA 3P1GA 3K0SA 2BANA 1IH7A 3LPUA 1SUQA 4DQ8A 4CF0A 4A59A 5CZ1A 1BA0A 4AHVA 2P9IA 4JNEA 3CM6A 2X6NA 3AVFA 1BIZA 3K9KA 3SQ1A 1NLVA 3M3ZA 4K8XA 3SYZA 4YOYA 3JS6A 2B6AA 1VRTA 4NCGA 4IOAL 4CHYA 4CIFA 5HP1A 4AHTA 3VQ6A 4FLZA 1S5JA 4XH5A 1IBKK 2UU9K 3KJVA 1KCFA 2E2PA 4CK3A 1TKZA 4C1NK 4YY3K 3C6TA 4JN4A 4JKBA 2HMIA 3V1RA 4KHPK 2HW3A 3HP6A 4B3OA 4WQ4C 3VEYA 1NMDA 3M8PA 4Z94A 4HCBA 4OX9K 3L2VA 4FK4A 1Z26A 3M8QA 3MK6A 3C65A 4YOXA 2G8HA 1W7AA 4WQ4A 3P31A 1L3SA 3ITHA 5AQQA 2YHYA 3ID8A 3ZX0A 1T6CA 3OBWA 3WQUA 1JL1A 3WNFA 4CJPA 3T1YK 3WQTA 4FJ8A 4A57A 4DSJA 4NYNA 2FSNA 4Q0BA 1ITGA 2E8AA 1GLCG 1EWRA 2EHGA 1JCEA 3HPGA 5I9EB 4ISFA 1QSLA 1VHXA 4C23A 4MLHA 4CHNA 1JLAA 2D1KA 4KO0A 3I8DA 1S1VA 4B9SA 3KWIA 1TKTA 4HUEA 3E9PA 4I6MA 4J2AA 3OYBA 3QO9A 4I2QA 2HSTA 2QK9A 4JLHA 5F1XA 2GWKA 5E84A 2IVNA 3WEEB 3AA4A 2I7PA 5F0XA 3MXJA 3U8XA 1SL1A 2ZJRL 3H1VX 3NMUA 4X65K 2VQFK 4IJAA 4FZXC 3CETA 2P9PA 1XC9A 1HRHA 2ZF5O 3V1OA 4TSXA 5AQHA 1C6VA 4CJ5A 4FXDA 3A5OC 5JICA 4FLVA 3THXA 1NGAA 4E0DA 2IOCA 3KLGA 1ZYQA 3TAQA 1RILA 4FWPA 5GIPA 2YCHA 3ZX2A 2QWRA 3CCRN 3CPEA 4OPHA 1M90O 2CGKA 4OVLA 2QXLA 3KKSA 1NGDA 4OPJA 1WLJA 4JI5K 1VSHA 5AZIB 4LF4K 5HROA 5KRTA 4LF8K 3CERA 4O44A 4BRHA 3VQ9A 1C1CA 1WAJA 3MN9A 1GLFO 4NYFA 3BZKA 4E7IA 3CFOA 3AAQA 3O9RA 4M3UA 3MEDA 4BRQA 1IG9A 4IO9L 4M3XA 3ZCMA 3OJSA 4GKJK 4LF7K 3OYCA 2UUBK 1F21A 1U4BA 2Q1NA 3EO3A 1ZBHA 3K5LA 3JYTA 4DQSA 4BROA 2E20A 1RDUA 4DV0K 1H1VA 4JI7K 3RSEA 4IDHA 1BDGA 5JMVA 3RVCA 4BRIA 1I94K 4DUZK 5HLFA 4DS5A 3R8EA 4CEAA 3RWUA 1ZBIA 1QSYA 3OS0A 3AVMA 3EZ5A 5ELZA 4RW8A 4C8NA 2KZZA 3DOKA 3K2PA 1K6YA 1VSFA 4CEZA 3R9PA 1U49A 1BOTO 2FC0A 3ZSXA 4A62A 3D2EB 3VQCA 4AF1A 3UKRA 4KI6A 3EE8A 1D4XA 3VERA 3TU5A 3G6EN 4LY7A 3K5OA 1R59O 1WSJA 5MLCQ 2OA8A 5ADXA 3SUPA 1X9WA 1U2VB 2RKIA 1KLNA 2HNZA 3DRRA 4FCYA 2R7YA 2O4GA 3B6OA 5BN8A 1ZBFA 1QQMA 4XH4A 1NK8A 4I7FA 1MWMA 4CW7B 3SNNA 1RTJA 4KH4A 5I3UA 3SPZA 3NHGA 1A5VA 3A0IX 1RDBA 3AO5A 3O3HA 5LJWA 2A5XA 3BY5A 1ATRA 4K43A 4CZFA 1Q81O 3P5JA 3CD6N 4PKGA 2FSKA 3SQ2A 3D2FB 3VA0A 3ALYA 3I0SA 3Q7CA 2AA4A 4O0IA 1LOTB 3PY8A 1KVAA 3SJJA 3EKSA 3M1FA 4CJRA 1DTQA 1JXEA 4DTSA 3FR0A 1RBTA 3HZ6A 3LP2A 3K59A 3VENA 1NKEA 4CFCA 4CD3A 3FE1A 3E01A 2YNGA 2DY4A 2E1ZA 3K5MA 4BRNA 5DM7L 2E5LK 1IBMK 4EAHD 3LZIA 3M6GA 2NRXA 5JVGL 3CJ7A 5AR0A 3CQ8A 1TL3A 1QSSA 3CCVN 3OA9A 2X74A 4EP5A 4FVMA 3VF4A 4F9OA 3ZETB 1K9MO 2V51B 4CBXA 1TK8A 4B9UA 3MN6A 1HPMA 2PBDA 4CJ7A 3PX4A 4KHNA 4CGDA 2QW9A 3CF5L 5FRMA 5CZ2A 3EKUA 4H0PA 4PA1A
chains in the Genus database with same CATH topology
1HKGA 3VTHA 2HBLA 2QWMA 2VGNA 1C0GA 3ULEA 5C15A 2BTFA 1VQ6N 1C0FA 4BG8A 2GELA 1BUPA 4ILHA 2KKZA 5AQGA 1Z05A 3O8MA 1S72N 2WBNA 5GADP 5AQMA 3MDQA 4YOWA 3O9QA 1IJJA 1ATSA 1K8KB 4BG9A 1GLEG 1NBWA 2Q97A 3A5LC 4WCEL 3GDQA 4H5WA 4OPAA 1DKGD 3BUZB 4BRPA 3G25A 2I7NA 4IZ9A 2GUPA 4K41A 4BRFA 1GLAG 4AM7A 1YI2N 4O5FA 2NRRA 5C2FA 3DAWA 5ADXH 3CPWM 2CH5A 1MA9B 5EVZA 1T6DA 3CHWA 4JKAA 4I6MB 4LC9B 2AP1A 3WXJA 3ZX3A 2UYTA 5AZIA 2E2NA 4MO4A 5FPMA 4FWKA 4FWQA 2JWLA 2BUPA 3M5RA 1VQNN 1NGCA 1W97L 4MDAA 3O1BA 5BRHA 3H6EA 4CBUA 4FOIA 4FL9A 5AQKA 4E1JA 4FOEA 3H45C 3S41A 5AQUA 2HF3A 4BGAA 4BGBA 4BVPA 2QM1A 4IXCA 4JD2A 4CZGA 2NRHA 3CCMN 2P9LB 2HOEA 4PL8A 3C6AA 1X3NA 5EY4A 5KQDA 2P9PB 1NWKA 3O1WA 5AZJB 3EE9A 2DPNA 2Q0RA 4QS8A 3I56N 2QEXN 4A61A 4GV6A 5C0YA 3VPZA 3CC7N 3WUHA 2YHWA 4CI6A 5M1FA 3VETA 3F5TA 3KZBA 1V4SA 1DEJA 2NRVA 4Y0WA 4GV3A 4IFEA 1YVNA 3O9UA 5HL7L 1Y64A 3KHYA 4QS7A 2VWBA 5F2RA 3SAFA 3MCPA 1GLLO 3P4IA 2VGMA 4JKFA 3AARA 3H46O 1N8RO 2IIRA 4JHDB 1VQKN 1OKJA 3DXKB 3VF6A 2PFUA 4EIAA 2P9KA 1P8ZA 3CJ1A 5AQNA 3U4LA 1G99A 3GE1A 3H3NO 1QVGM 4H0VB 4CZHA 1KC8O 4YOTA 1QZ6A 2GTDA 3O9TA 4FVUA 2W40A 3G4SN 5FPDA 3UE5A 4WFAL 3CCSN 3N4QA 2YJFA 2E2OA 3L4IA 4BRKA 3VGKA 4CZKA 4GNIA 3DLLL 3D2EA 2V7ZA 3VESA 3TTCA 4GV9A 3SMSA 3C7NA 1GLBG 2HBJA 3CXCM 3PLAA 4H0TB 4NLBA 5JLFA 4WQ5C 5M1KA 4WF9L 2CGLA 1YIJN 2BH1A 3MX5A 4MLEA 3AGKA 5EXWA 2VCPA 1XQSC 3VMFB 3WXLA 3DXMA 3TSQA 1U2VA 3KVGA 4WQ5A 1NGGA 4YOVA 2KHOA 2QWLA 1T44A 3BF3A 2H3GX 1Q82O 2EWSA 4B9QA 3MN7A 4JEPA 1ILYA 2FLOA 3PIOL 3LDLA 3C0BA 3U9DA 2GX9A 2V52B 5FPEA 3F2KA 4RWTA 4B1WB 1MWKA 3ATUA 3HOSA 3LDOA 4FWSA 4JHDA 2NRZA 4NO7A 3RSEB 4B1UB 2P9NA 4JKDA 4BRLA 1MDUB 3OBYA 4BR7A 4BR5A 3MWTA 3OW2M 2QWPA 3UB5A 4BY9C 1T3VA 1E4FT 4PHTX 4GY2B 3AGRA 3VEOA 1YITN 3ZYYX 3CQYA 1QQNA 1JCFA 3VEZA 3LM9A 1IG8A 1QQOA 3HM8A 2J4RA 4A5BA 4DQ8A 4BRMA 3D2FA 4IJNA 2P9SB 4H0XB 4JKGB 4A59A 2F9TA 1BA0A 3I55N 2YJEA 2NNWA 4FSVA 4FPAA 2P9IA 4JNEA 1EO1A 4YOUA 3OHRA 2Q2RA 3CI5A 4IOCL 3G71N 3K9KA 3CMAN 3O5BA 1NLVA 3M3ZA 4KH6A 5BR9A 4YOYA 4CZJA 3VF2A 1X9JA 4JK9A 3JS6A 3P38A 4NB4A 1S3XA 4PL7A 4IOAL 3MWPA 3QFPA 3E9LA 2ZJPL 1HUXA 2E1YA 1E4GT 4XH5A 5AQZA 4B1XB 2CH6A 3A5NC 3HI0A 2OTJN 4RCHA 2E2PA 2YHXA 4BRCA 4JK7A 4C1NK 4JN4A 3L4QA 4MDBA 4JKBA 3PIPL 5AQYA 5LJVA 2ZGYA 4ILGB 4HTLA 2QWOA 4U67L 3TTDA 3HTVA 4XEIA 3FLCO 4H5NA 3VEVA 4BR0A 4FPBA 1VAZA 1YUWA 4WQ4C 4U7BA 1WOQA 2ITMA 3VEYA 1NMDA 5AQLA 4H5VA 4Z94A 1NGFA 5AQIA 5AQWA 2V7YA 4BVOA 5JVHL 3MK6A 5EX5A 1M1KO 1HLUA 3C65A 3ZETA 4YOXA 3KK7A 4B1VA 4WQ4A 1J6ZA 3P31A 5AQQA 2YHYA 3ID8A 3ZX0A 1T6CA 3OBWA 3WQUA 4IOXA 4A5AA 3WQTA 2HBMA 4G9ZA 3WT0A 2F7TA 3ENBA 4A57A 1VQ4N 1QVFM 2FSNA 1QHAA 3IDHA 3J8AA 3P39A 2FXUA 2E8AA 1GLCG 2NRTA 4BRDA 5GAEP 1KAZA 2KLAA 3KWGA 1JCEA 2CGJA 4BR2A 1VQMN 4M7XA 1KAXA 4IO8A 2P9UB 5I9EB 4UY8O 4ISFA 1VQPN 1DT9A 4C23A 5H1SQ 3MMVA 1K8KA 4MLHA 3ZEUB 3TTFA 3NVKA 1X3MA 1XUPO 2YX6A 2ZWHA 4BR9A 2D1KA 2NZTA 3CCJN 3HOTA 4FWMA 5BRFA 3UKUB 3R3LA 4DB3A 3FZFA 3KWIA 2GEMA 4FWOA 3VEXA 1VQ9N 3E9PA 4I6MA 3VTIA 3WXKA 3CJAA 5AQRA 2HSTA 2QI2A 4O8KA 3SLCA 4M7YA 4J8FA 5AQSA 3L0QA 3E9OA 5F1XA 1BO5O 2GWKA 5E84A 2IVNA 3WEEB 5KPZA 1NJIO 1GLDG 4A2AA 2I7PA 3J7ZO 1DGKN 3SMPA 4CBWA 5F0XA 3O6WA 3U8XA 3AY9A 3IKMA 2ZJRL 3H1VX 3CQXA 2P9LA 2D4WA 1KQSM 3W3DA 3LDNA 2W41A 3NMUA 2A40A 1KD1O 3R6MA 4IJAA 4CZIA 3CETA 2P9PA 5BRDA 2D0PA 5AZJA 5FPNA 4A2BA 3L6QA 2ZF5O 3ID6A 5BN9A 4EHUA 4IWVA 4H5TA 5AQHA 3A5OC 1ZXOA 3WXMB 5JICA 1OVYA 1NGAA 3SBTA 3ULEB 1ZC6A 3CCUN 1JCGA 5GIPA 4FWPA 5GIOA 2YCHA 3DXKA 4RTFD 3CJBA 3A5MC 3C6HA 3ZX2A 3LDQA 4JKCA 2QWRA 1TYQB 1VQLN 3H1QA 3I33A 3CCRN 1KXPA 3CPEA 3QMLA 4OPHA 1M90O 3MCAB 2CGKA 3FZMA 5TKYA 1K8AO 4BR4A 2QXLA 1NGDA 1BG3A 2ZGZA 2JWKA 4PKIA 3N4PA 3QFUA 5M1NA 5AZIB 1S22A 4GVEA 4FO0A 3LDPA 2QWQA 4KBOA 2RHKA 3HRGA 2F9WA 3CERA 4FWRA 1EQYA 4BRHA 3CJCA 3WEEA 3D6RA 3EN9A 1XC3A 2VYPA 3UKRB 2A3ZA 5KPRA 3MN9A 3FFKB 5JLHA 1GLFO 5LY3A 4IEEA 3W0LA 5GINA 1NM1A 3JXUA 4JD2B 5AQXA 5TKWA 3AAQA 3DWLA 3O9RA 2ZJQL 4QS9A 4XH1A 4K42A 4BRQA 3HSCA 4DCHA 4IO9L 1VQ7N 3CMEN 2FF3B 2IVOA 5M1PA 5KPTA 3IMXA 3QB0A 4L3QA 1Z6RA 2IVPA 4K25A 2Q1NA 3EO3A 2NRWA 2WC9A 3ATVA 2YI1A 4BROA 1RDWX 2E20A 1RDUA 3BF1A 3GBTA 5DM6L 2RE2A 1H1VA 2ASPA 2HMPA 3QBWA 2GWJA 1HJOA 2HBKA 1VQ5N 3O80A 4IDHA 3RSEA 5AQFA 5GAHP 3FGUA 1BDGA 1NGBA 3CIPA 3RVCA 5JMVA 4BRIA 2P9KB 3DJCA 5AQTA 1TYQA 3IFRA 4YORA 3R8EA 3FZLA 1HX1A 5KQ8A 1RGIA 4FWNA 3SAHA 4ISGA 3FZKA 3SK3A 1SZ2A 4BREA 1P90A 2QA4N 1BA1A 5ELZA 1YHQN 3H3OB 2P9SA 4JKGA 1YJWN 2ASOA 3BP8A 4JKEA 1VQ8N 1O13A 1ATNA 1HKBA 4DKWA 4PKHA 1NGIA 3R9PA 2WUSA 1BOTO 5BREA 4MO5A 4A62A 3D2EB 4BC2A 1VQON 5GAGP 4FWLA 5BPLA 4AF1A 3C7NB 2QWNA 1CZAN 3UKRA 5C12A 1NGJA 1ESVA 2HF4A 3EE8A 4B1ZA 4H0YB 5HOOA 2OANA 3CCQN 1D4XA 3VERA 3TU5A 4WFNL 3G6EN 3TSUA 5CHIA 1SAZA 3GL1A 2E88A 4DHYA 1R59O 5MLCQ 1WUAA 5AQVA 3DXMB 5ADXA 4BRGA 1NGEA 1U2VB 5AFUH 2ASMA 3Q7BA 3VOVA 5BPNA 4AM6A 3CJ9A 1YAGA 4BC5A 1YF5L 5CE3A 3O4WA 3K9JA 1QQMA 5BN8A 4XH4A 3WXIA 1MWMA 1NGHA 4KH4A 2Q36A 3A0IX 3SJHA 5E26A 2P9NB 4KH5A 3E1YA 3I8BA 3FZHA 1QZ5A 5LJWA 3U9ZA 2OTLN 2A5XA 1GLJO 1ATRA 3MN5A 4K43A 4CZFA 1Q81O 3GOIA 1BU6O 2A42A 3IUCA 1Q18A 3CD6N 3AAPA 1SQKA 5AFUA 4R79A 4PKGA 2FSKA 5AQJA 2FF6A 1HKCA 3D2FB 3VEWA 3VGLA 1YXQA 3HBTA 1YJNN 2P9IB 4ISEA 2AA4A 4H0OA 3CC4N 1LOTB 3F9MA 3NVMA 1JJ2M 5M1QA 3EKSA 1SS6A 3M1FA 4WYBA 5C2DA 4M63C 5EOYA 1U6ZA 2E2QA 4C1NI 3BEXA 3SAGA 3CC2N 2P9UA 3FR0A 3HZ6A 3VENA 3ENOA 3QDKA 1V4TA 4CD3A 3FE1A 4OO1J 4EFHA 4BC4A 1K73O 1RFQA 4HWIA 3ZEUA 1Q86O 4IEIA 3EZWA 4CD1A 2E1ZA 1YJ9N 1W2BM 3LM2A 2A41A 2QTDA 4JAXA 3TSPA 4BRNA 4H03B 3UKUA 5DM7L 2FSJA 3E66A 4CZMA 2Q31A 4JK8A 1LCUA 2D0OA 2Q0UA 3LL3A 4YDUC 4EAHD 5B8HA 2WFBA 3M6GA 2NRXA 3CCEN 5JVGL 3CJ7A 5AR0A 1BWFO 4CZEA 3A8YA 2PAVA 3CCVN 5CR4A 3OA9A 3QBXA 2NLXA 5M1OA 4CZLA 4YDUA 4BRAA 4JKHA 5C10A 3B8AX 4H5RA 3R1XA 2A6AA 3VF4A 4B1YB 4F9OA 1ZBSA 3ZETB 1K9MO 4BC3A 4BQZA 2V51B 4ILJA 1TUUA 3EL2A 3O08A 4CBXA 4O8UA 4BQLA 3O9SA 4EHTA 1KAYA 3MN6A 5BPMA 3MX2A 3QICA 3SBGA 3T7ZA 1Q7YO 3D7EO 3TPQA 1HPMA 2PBDA 4CJ7A 5AQOA 4NLCA 3ENHA 2QW9A 3CF5L 5AQPA 1TUYA 3GG4A 3T69A 3CCLN 3EKUA 4H0PA 4WFBL 3Q7CA 3VGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P90 A;  2YX6 A;  1EO1 A;  2KLA A;  2WFB A;  1O13 A;  2QTD A;  1RDU A;  2RE2 A;  1T3V A; 
#chains in the Genus database with same CATH topology
 5C15 A;  4BG8 A;  1ZBL A;  3RMB A;  1GOA A;  5GAD P;  4BG9 A;  3VQP A;  3L2U A;  3LDS A;  1NBW A;  2Q97 A;  3A5L C;  3VQB A;  4WCE L;  3GDQ A;  4OPA A;  4AHR A;  4H4O A;  1GOC A;  4AM7 A;  3EY1 A;  5C2F A;  3DAW A;  3TAE A;  4Z4F A;  2XY6 A;  3ZSR A;  1NK6 A;  1J9A A;  2FBT A;  2AP1 A;  1NJW A;  3ZX3 A;  5AZI A;  4DWI A;  3KD1 E;  4DV1 K;  3F73 A;  1VQN N;  4MDA A;  1CLQ A;  4E89 A;  2PYL A;  4MQ3 A;  1OVQ A;  4FL9 A;  5AQK A;  4FJK A;  4K0K K;  1RTH A;  3M8S A;  5AQU A;  4IXC A;  1J53 A;  3DRS A;  3AVC A;  4DTR A;  4IDK A;  2HOE A;  3C6A A;  1X3N A;  5EY4 A;  4DQR A;  4PUO A;  3HL8 A;  4M3Y A;  5DK5 A;  2KFZ A;  2QEX N;  3I56 N;  1WBB A;  3VET A;  1V4S A;  2KFN A;  4GV3 A;  5HL7 L;  1BL3 A;  3KHY A;  5F2R A;  1GLL O;  2VGM A;  4JI1 K;  3L3U A;  2UXB K;  1EXQ A;  3AVN A;  3DOL A;  3VF6 A;  1CXQ A;  4H8K A;  4BE0 A;  2GUI A;  4CK1 A;  4AIL C;  1ZBU A;  4YOT A;  5HRN A;  1QZ6 A;  3N4Q A;  2YJF A;  2FBY A;  2E2O A;  3F9K A;  4CGH A;  3QEW A;  4CZK A;  4GNI A;  3DLL L;  3D2E A;  3IG1 A;  3VES A;  3J7A P;  3KTQ A;  1NJY A;  2HBJ A;  1T05 A;  3PLA A;  2B4J A;  2BH1 A;  4GVM A;  4CJL A;  3SZ2 A;  3AGK A;  2VCP A;  3VQQ A;  1XQS C;  1DLO A;  1U2V A;  5FRN A;  3NH2 A;  1N5Y A;  4YOV A;  4HUF A;  2QKK A;  2QWL A;  1T44 A;  1HR0 K;  4ID1 A;  4DF8 A;  1Q82 O;  4N41 A;  4B9Q A;  1B9D A;  4CJK A;  5J2N A;  4M3Z A;  1ILY A;  2FLO A;  3PIO L;  4FZZ A;  3C0B A;  1HNX K;  3U9D A;  5FPE A;  4F8R A;  4O5B A;  2E4L A;  3TR8 A;  4JHD A;  4NO7 A;  4DR1 K;  5KRS A;  4BR5 A;  4CEB A;  3UB5 A;  4BY9 C;  1T3V A;  1RBU A;  4PHT X;  3CQY A;  3HP9 A;  1JCF A;  4DG1 A;  1KLM A;  4FM2 A;  3LM9 A;  1IG8 A;  1QQO A;  3OY9 A;  2J4R A;  3BZC A;  1TKD A;  2VQE K;  1FW6 A;  4BRM A;  3D2F A;  2P9S B;  4JKG B;  2IDO A;  4FSV A;  4YOU A;  3QES A;  4DQP A;  2WON A;  4KH6 A;  3NCI A;  4KHQ A;  3OYG A;  1WNS A;  1T03 A;  1X9J A;  4CEE A;  3RRG A;  1S3X A;  1NK0 A;  4FLX A;  3SI6 A;  4N47 A;  3E9L A;  2ZJP L;  2XRI A;  1KVB A;  2E1Y A;  3AVG A;  1E4G T;  3B6P A;  5KTQ A;  5AQZ A;  4B1X B;  3DLB A;  4RCH A;  1HNW K;  3AVI A;  2F4V K;  3L4Q A;  4MDB A;  1NKB A;  1REV A;  3QEP A;  2QWO A;  1HQU A;  4U67 L;  4H5N A;  3VEV A;  4FPB A;  4U7B A;  1WOQ A;  1I3A A;  4ZTJ A;  1NGF A;  2V7Y A;  4CFD A;  5JVH L;  5EX5 A;  1M1K O;  4LH4 A;  4HHT A;  3ZET A;  2VG5 A;  3MEG A;  4I9L A;  2E6M A;  4GMJ B;  4BE1 A;  2XY8 A;  4IOX A;  4FLU A;  4A5A A;  2HBM A;  3MXI A;  1U47 A;  4ELT A;  1UOC A;  1FXX A;  2Z1I A;  3ZSO A;  3LWL A;  2KLA A;  3RRH A;  1VQM N;  4M7X A;  2F96 A;  1KAX A;  2NUB A;  5LMN K;  4CCH A;  2O8C A;  1LWC A;  1DT9 A;  4JS4 A;  3MMV A;  2YX6 A;  2ZWH A;  5T7B A;  4BR9 A;  3SQ4 A;  4V19 S;  3CCJ N;  1R0A A;  4JI0 K;  3HOT A;  3UKU B;  3R3L A;  2ZM6 K;  4DTU A;  2YHB A;  2GEM A;  1VQ9 N;  4KFB A;  3NF8 A;  2HHH K;  3WXK A;  3CJA A;  3T3F A;  2QI2 A;  4O8K A;  4M7Y A;  1TK0 A;  1RT5 A;  4JRP A;  1NJI O;  4FJ7 A;  1DGK N;  3SMP A;  4BAC A;  3AY9 A;  4O4G A;  1KQS M;  3CQX A;  2D4W A;  3W3D A;  4FJH A;  4CZI A;  4DU4 A;  4ELU A;  4C8O A;  1D8Y A;  3DRP A;  4RW9 A;  4A2B A;  4CIG A;  3L6Q A;  4YNQ A;  3TI0 A;  1L5U A;  5BN9 A;  4HVJ A;  4IWV A;  3WXM B;  3SBT A;  4FJX A;  1C0M A;  1JCG A;  1NK7 A;  5GIO A;  1XNR K;  2F8T A;  1VSI A;  3NF7 A;  1WSG A;  3A5M C;  3C6H A;  3LDQ A;  4JKC A;  4Z4I A;  1C1B A;  1RBR A;  4FJ5 A;  3IRX A;  1VQL N;  1GOB A;  3QML A;  2GV9 A;  1K8A O;  4RW7 A;  3ZSQ A;  5KGW A;  1RDD A;  2D0B A;  3NDK A;  3NH1 A;  4LFC K;  3N4P A;  3HST B;  5M1N A;  1S22 A;  1JKH A;  3PX6 A;  4EZ9 A;  2IAJ A;  3RR7 A;  3BGR A;  4KBO A;  1RBV A;  2F9W A;  3HJF A;  1FKO A;  3CJC A;  3D6R A;  3UKR B;  1NM1 A;  1W9H A;  4JD2 B;  3DWL A;  3TAR A;  2ZJQ L;  1WAF A;  3NGZ A;  4XH1 A;  2D5R A;  4K42 A;  3RMC A;  3RMA A;  1VQ7 N;  2FF3 B;  1TGO A;  2IVO A;  4W5T A;  5M1P A;  3IMX A;  2ATQ A;  4IG3 A;  4K25 A;  2FBV A;  2XO7 A;  4CJT A;  3I0R A;  4B3M K;  3VQ7 A;  4FLT A;  3BF1 A;  3GBT A;  4LSL A;  3IAY A;  2ASP A;  4DV7 K;  3HO1 A;  2GWJ A;  1HJO A;  1KFS A;  3FGU A;  3CIP A;  3TAB A;  4IFY A;  4YOR A;  4CFA A;  4B3R K;  5C42 A;  3NH0 A;  3FZK A;  1SZ2 A;  1KRP A;  4DV2 K;  2KTQ A;  3KD5 E;  2P9S A;  4JKG A;  4X66 K;  1L3T A;  3NBP A;  2OPP A;  1O13 A;  3MEE A;  1HKB A;  2G8W A;  5BRE A;  4OKJ A;  1OH7 A;  4BC2 A;  3QEI A;  3C7N B;  4QOZ B;  2QWN A;  1CZA N;  3SPY A;  4WE1 A;  3OYM A;  2HF4 A;  3CCQ N;  4DR6 K;  2HND A;  3H08 A;  4WFN L;  3TSU A;  4E7L A;  3AVK A;  3QNN A;  4DHY A;  1WUA A;  1HMV A;  5HRR A;  1Q9X A;  1NGE A;  5AFU H;  3S3N A;  1N33 K;  1JLE A;  4AM6 A;  3HVR A;  4GKK K;  2W6L A;  3CJ9 A;  4BC5 A;  4KPY A;  1X1P A;  1OH5 A;  1JLG A;  4CHO A;  1NGH A;  4DU1 A;  3V9U A;  2P9N B;  3I8B A;  4KRE A;  3FZH A;  2IS3 A;  4YFU A;  3HT3 A;  3OYD A;  2PZS A;  4KAZ A;  1Q18 A;  4DR7 K;  5FDL A;  5AFU A;  3K5N A;  3TWH A;  2YKM A;  2FF6 A;  4K8Z A;  1HKC A;  4KHS A;  3VEW A;  4CGG A;  5HRP A;  4DQQ A;  3VQ8 A;  4IFV A;  3NF6 A;  3HBT A;  1YJN N;  5KI6 A;  1Q8I A;  4H0O A;  3CC4 N;  3F9M A;  3MXM A;  2HHS A;  1JJ2 M;  5M1Q A;  3D0P A;  4AHC A;  1HJR A;  5C2D A;  3WNE A;  2E2Q A;  3AA3 A;  4NXM K;  3U3Y A;  4N76 A;  3QDK A;  4CEO A;  4BC4 A;  3OS1 A;  1BCM A;  4HWI A;  2OPR A;  1RTD A;  3EZW A;  4JAX A;  3UKU A;  4CZM A;  2Q31 A;  5FLX O;  4JK8 A;  3OYH A;  1LAW A;  4Z4E A;  3QIO A;  4JRQ A;  1BWF O;  4CZE A;  1U45 A;  5IT9 O;  1OH8 A;  1BQM A;  2PAV A;  3QBX A;  5M1O A;  2NLX A;  4CZL A;  3ZT3 A;  4JKH A;  1HYV A;  4M3T A;  4X64 K;  5J2M A;  1EWQ A;  1XHZ A;  4NCB A;  4B1Y B;  4DV6 K;  4CED A;  1YVU A;  3SV3 A;  3P83 D;  4DTJ A;  3ZLJ A;  3EL2 A;  4OGC A;  4DS4 A;  4DSI A;  4O8U A;  4EHT A;  3MX2 A;  4KV8 A;  3SBG A;  1Q7Y O;  1CZ9 A;  5AQO A;  5HRS A;  2OZS A;  3CCL N;  3VGM A;  1HKG A;  3OJU A;  3KLH A;  1VQ6 N;  2BTF A;  2GEL A;  1BUP A;  3VQ4 A;  4DTM A;  3TAN A;  4DFK A;  5J1E A;  3O9Q A;  1IJJ A;  1SV5 A;  5CY4 A;  1DKG D;  4BRP A;  1QTM A;  1FK9 A;  1JLQ A;  2I7N A;  2GUP A;  4IZ9 A;  4KB1 A;  1GLA G;  3QET A;  4O5F A;  1VRU A;  2NRR A;  5ADX H;  4CES A;  3WNG A;  3OYN A;  1HNZ K;  1MA9 B;  1T6D A;  3CHW A;  1QS4 A;  4FLY A;  4LC9 B;  3WXJ A;  4FZY A;  2UYT A;  3KK1 A;  1LWF A;  2E2N A;  4MO4 A;  3PO4 A;  4DR5 K;  4FWQ A;  1NGC A;  3AO3 A;  2KW4 A;  3H6E A;  4CBU A;  4FOI A;  2VG6 A;  4FOE A;  4H4M A;  4BGA A;  4BVP A;  4CZG A;  4ZTF A;  4JD2 A;  2NRH A;  5C25 A;  4PL8 A;  4DTX A;  3V6D A;  1NWK A;  4J2E A;  3EE9 A;  2DPN A;  4QS8 A;  4A61 A;  4Y1D A;  5C0Y A;  3VPZ A;  4DSF A;  5M1F A;  2O8E A;  3O9U A;  1KFD A;  4M3W A;  3SAF A;  4AHU A;  3P4I A;  1N34 K;  1W0H A;  4KTW A;  4JKF A;  3AAR A;  4JHD B;  4DLG A;  1NJX A;  4CHQ A;  4OJR A;  3V9W A;  1G99 A;  1N32 K;  1RCH A;  3H3N O;  1KC8 O;  2ZE2 A;  3ZSZ A;  2GTD A;  4FVU A;  1NJZ A;  5FPD A;  4IBN A;  1TL1 A;  4CF9 A;  1WSI A;  1BI4 B;  2G8F A;  3AV9 A;  4BRK A;  1T8E A;  2V7Z A;  3TTC A;  3SMS A;  4LF6 K;  3C7N A;  3CXC M;  1OH6 A;  3OVN A;  4NLB A;  3K57 A;  4WQ5 C;  1Q9Y A;  3MX5 A;  4MLE A;  1SL0 A;  2VG7 A;  2W42 A;  3KVG A;  4WQ5 A;  1KSP A;  2H3G X;  2EWS A;  2JLE A;  2F8S A;  5SWM A;  4JEP A;  4PQU A;  1RT3 A;  3AO1 A;  2V52 B;  1QQC A;  3F2K A;  4B1W B;  3ATU A;  3JSM A;  3LDO A;  2G8U A;  4B1U B;  2P9N A;  4RW6 A;  3K58 A;  4GY2 B;  1JLF A;  1QQN A;  2LSN A;  3HM8 A;  5E41 A;  4KKO A;  3I55 N;  2YJE A;  2NNW A;  1NOZ A;  3OHR A;  2DFF A;  2O8B B;  3CMA N;  1TV6 A;  3O5B A;  5BR9 A;  4CZJ A;  3VF2 A;  1D9F A;  4PL7 A;  2O8C B;  3QEV A;  3MWP A;  3QFP A;  1HUX A;  4DQI A;  1HYZ A;  1LW2 A;  3HI0 A;  2OTJ N;  4BRC A;  4JK7 A;  5LJV A;  4ILG B;  3PUF A;  3TTD A;  4CJV A;  3HTV A;  3FLC O;  2YV0 X;  1VAZ A;  4FYD A;  4KHU A;  1B9F A;  5AQL A;  1SL2 A;  5AQW A;  3THV A;  4KB0 A;  5LMU K;  1HLU A;  3KK7 A;  1D5A A;  1J6Z A;  2W6K A;  2HHX A;  4G9Z A;  3QIN A;  1QVF M;  1IKW A;  1QHA A;  3IDH A;  3P39 A;  3AVH A;  4BRD A;  4CK2 A;  1YT3 A;  2CGJ A;  4IO8 A;  2P9U B;  4UY8 O;  4FJJ A;  2GBZ A;  1VQP N;  5H1S Q;  4CGJ A;  4Z4C A;  3TTF A;  3NVK A;  1X3M A;  1XUP O;  2UUA K;  2NZT A;  4B9N A;  1TAQ A;  1E3M A;  4DB3 A;  2WOM A;  3VTI A;  3L2W A;  5AQR A;  3SLC A;  3L0Q A;  1BO5 O;  1HNI A;  3LP3 A;  5KPZ A;  1GLD G;  4A2A A;  4CEC A;  3O6W A;  3IKM A;  4LFB K;  3AO4 A;  3LDN A;  4FK0 A;  1D9D A;  3DLH A;  1IKV A;  2D0P A;  3T19 A;  1EKE A;  2HNY A;  4HTU A;  4C8L A;  4H5T A;  1XNQ K;  3ULE B;  4M42 A;  1ZC6 A;  3CCU N;  5EU7 A;  1JL2 A;  3AVJ A;  4RTF D;  3CJB A;  4OGE A;  1SKS A;  1Z25 A;  3G0Z A;  1TAU A;  3H1Q A;  2E6L A;  1HQE A;  3D45 A;  3V9X A;  4BR4 A;  4FM0 A;  3S3O A;  4QAG A;  1XMO K;  4PKI A;  2JWK A;  1BI4 A;  3QFU A;  4GVE A;  3THY B;  3LDP A;  2QWQ A;  3BDP A;  3J81 O;  1RT2 A;  1S6P A;  4FWR A;  1EQY A;  3EN9 A;  2HB5 A;  1XC3 A;  2VYP A;  5KPR A;  2A3Z A;  3FFK B;  3DLG A;  5JLH A;  4IEE A;  5AQX A;  3J7Y P;  4FJM A;  3HSC A;  3CME N;  3V9Z A;  5KPT A;  3QB0 A;  2IVP A;  3C94 A;  5FRO A;  3ZSW A;  4IKF A;  4B3T K;  2NRW A;  4OLB A;  2QXF A;  4BDP A;  3OS2 A;  1BHL A;  2X78 A;  3O80 A;  5AQF A;  3AO2 A;  4CF8 A;  2P9K B;  3DJC A;  5AQT A;  1TYQ A;  2Z1G A;  3DM2 A;  3IFR A;  3FZL A;  2A1R A;  1HX1 A;  4AQY K;  1RGI A;  4FWN A;  4ISG A;  1S9E A;  3SK3 A;  4PWD A;  4CFB A;  4BRE A;  1BA1 A;  1YHQ N;  1JLC A;  4X62 K;  3H3O B;  1VQ8 N;  3BP8 A;  4JKE A;  1ATN A;  4DKW A;  3OYJ A;  1QE1 A;  1NGI A;  3V1Q A;  3O4Q A;  2O8B A;  1IO2 A;  5GAG P;  4FWL A;  3PSF A;  4UQG A;  1NGJ A;  4QCL A;  2D0C A;  4H0Y B;  5HOO A;  2OAN A;  1NOY A;  2YKN A;  1SAZ A;  1NMN A;  2E88 A;  4BRG A;  4FM1 A;  2ASM A;  2JGU A;  4B08 A;  4CJE A;  1YAG A;  3O4W A;  3K9J A;  1NKC A;  2I5J A;  3TAG A;  2UXC K;  3SJH A;  5E26 A;  4R5P A;  3T1A A;  2OTL N;  3MN5 A;  3GOI A;  3SV4 A;  2BGG A;  2A42 A;  3IUC A;  4E1N A;  5AQJ A;  4DFM A;  3EEQ A;  3QLH A;  1NNE A;  4CF2 A;  1YXQ A;  2D0A A;  4ISE A;  1SKW A;  3QER A;  3NVM A;  4CJU A;  4DFP A;  4KHW A;  3KLE A;  1SS6 A;  2O8F B;  4WYB A;  4HCC A;  4C1N I;  3SAG A;  4DR2 K;  1BIS A;  2P9U A;  1NK4 A;  1Y97 A;  2O4I A;  3ENO A;  1NK9 A;  1V4T A;  3LWM A;  1YTA A;  1K73 O;  1WBD A;  5SZT A;  2XY7 A;  2Y1J A;  3LM2 A;  2DFE A;  1EET A;  4RG8 A;  3E66 A;  1LCU A;  2Q0U A;  3LL3 A;  3CCE N;  5DMR A;  3OYE A;  5CR4 A;  4BRA A;  1L3V A;  1MU2 A;  3B8A X;  5CYM A;  5C24 A;  4H5R A;  4CIE A;  4B9M A;  4G1Q A;  4BQZ A;  3CG7 A;  4ILJ A;  3O9S A;  2VWJ A;  2YNI A;  3ASM A;  3QIC A;  3T7Z A;  3D7E O;  3TPQ A;  1NG9 A;  2P5G A;  4NLC A;  3LAN A;  5AQP A;  3T69 A;  4I9Q A;  5K14 A;  3ZT1 A;  4WFB L;  1O1W A;  4DV4 K;  2HBL A;  1G15 A;  4DV3 K;  4JS5 A;  1C0G A;  3ULE A;  4DTN A;  3S3M A;  2Q3S A;  4B9L A;  2O8E B;  1IKX A;  1C0F A;  2KKZ A;  5AQG A;  1Z05 A;  1S72 N;  5AQM A;  3MDQ A;  4YOW A;  1K8K B;  5LL6 Z;  4LF9 K;  3BUZ B;  3G25 A;  4BRF A;  1YI2 N;  1RBS A;  1RT6 A;  2EX3 A;  2CH5 A;  4JKA A;  1BGX T;  1KTQ A;  3AVA A;  1TKX A;  5FPM A;  3THY A;  4DTO A;  2JWL A;  1SKR A;  3M5R A;  2G8V A;  2YHA A;  2HVI A;  4E1J A;  3ISN C;  4BWM A;  4JYA K;  2HF3 A;  1UA0 A;  4BGB A;  3CCM N;  2ITG A;  2P9L B;  2KQ2 A;  3V4I A;  1QHT A;  3LP1 A;  2HHU A;  5AZJ B;  1BQN A;  2DFH A;  4GV6 A;  2XY5 A;  1RT7 A;  2YHW A;  4CI6 A;  3F5T A;  3KZB A;  1DEJ A;  2NRV A;  4IG0 A;  1Y64 A;  4QS7 A;  2VWB A;  3KLF A;  1VQK N;  1OKJ A;  3DXK B;  3PSI A;  1RTI A;  2PFU A;  2AJQ A;  2P9K A;  5AQN A;  3ZSV A;  4J2B A;  3GE1 A;  1QVG M;  4H0V B;  3CM5 A;  1RDA A;  1BCO A;  2G8I A;  3O9T A;  4WFA L;  2X6S A;  4ZHR A;  1WB9 A;  3L4I A;  3VGK A;  3OYL A;  3AVB A;  2YNH A;  3VQA A;  3HYF A;  4DTP A;  4CJF A;  1S1U A;  4AH9 A;  3ZT0 A;  5EXW A;  1FKP A;  3WXL A;  4FW1 A;  4J2D A;  1T7P A;  1VK0 A;  1NGG A;  4CF1 A;  2KHO A;  3BF3 A;  1VSK A;  4BE2 A;  4PY5 A;  3LDL A;  1WSF A;  3SUQ A;  4CHP A;  4B9V A;  3HOS A;  4FWS A;  5D3G A;  4F2S A;  3VQE A;  4BRL A;  1MDU B;  4BR7 A;  3OW2 M;  4LF5 K;  3V81 A;  3OTO K;  3AGR A;  1YIT N;  3ZYY X;  2XHB A;  3VEZ A;  1NU0 A;  4A5B A;  3M8R A;  4RW4 A;  4IJN A;  4H0X B;  4CJQ A;  2F9T A;  4FPA A;  1EO1 A;  2Q2R A;  3CI5 A;  4IOC L;  3G71 N;  1CZB A;  4L8R B;  4JI8 K;  2O8F A;  2OZM A;  4ICL A;  4W5R A;  4JK9 A;  3P38 A;  4NB4 A;  3OYK A;  4M45 A;  4E3S A;  5IWA K;  3LZJ A;  2CH6 A;  3A5N C;  3O4N A;  2YHX A;  4EZ6 A;  3PIP L;  5AQY A;  2ZGY A;  3AVL A;  4HTL A;  3DI6 A;  2Z1J A;  4XEI A;  4MFB A;  3RR8 A;  2UXD K;  1WN7 A;  1S1T A;  3MEC A;  4BR0 A;  4CER A;  1XWL A;  4C8K A;  1YUW A;  1UA1 A;  2ITM A;  2OPS A;  2Z1H A;  4H5V A;  1X9S A;  5AQI A;  4BVO A;  4CE9 A;  4W5Q A;  1N36 K;  3TAM A;  4JV5 K;  3ZT4 A;  4KI4 A;  4B1V A;  3J80 O;  3S9H A;  4CEF A;  4Q5V A;  3WT0 A;  2F7T A;  3ENB A;  1VQ4 N;  3HVT A;  3J8A A;  1J5O A;  3TAF A;  3DMJ A;  4N5S A;  3NGY A;  2FXU A;  2NRT A;  4E7K A;  3SUO A;  1IBL K;  1J54 A;  5GAE P;  1KAZ A;  4HUG A;  1I39 A;  3KWG A;  3LAL A;  2RN2 A;  4BR2 A;  5JS1 A;  2PYJ A;  3OYF A;  3NFA A;  4CEQ A;  1JXB A;  4ID5 A;  1K8K A;  4N56 A;  3ZEU B;  3U3G A;  2HVH A;  4OPK A;  1XMQ K;  4B9T A;  1B92 A;  3KKR A;  3KIO A;  4KTZ A;  4FWM A;  5BRF A;  4CJ4 A;  1YTU A;  3FZF A;  3THW B;  1LWE A;  4FJL A;  4FJN A;  4FWO A;  3VEX A;  3DYA A;  3C6U A;  3QIP A;  3O3F A;  2OCE A;  4F2R A;  4J8F A;  5AQS A;  3E9O A;  2ETJ A;  1WSE A;  3NAE A;  3AA5 X;  3J7Z O;  4CBW A;  4DMN A;  4LFA K;  1KVC A;  2P9L A;  4C8M A;  3CFP A;  2W41 A;  2A40 A;  1KD1 O;  3R6M A;  2BDP A;  2UUC K;  1U04 A;  5BRD A;  3A2F A;  1NK5 A;  5AZJ A;  2P1J A;  5FPN A;  3G10 A;  3ID6 A;  3SQ0 A;  4EHU A;  1VSJ A;  3IS9 A;  1ZXO A;  1LW0 A;  1OVY A;  4Z4G A;  4M3R A;  1RNH A;  3CYM A;  4JI4 K;  3DXK A;  4OKK A;  3RMD A;  1TYQ B;  3I33 A;  2YNF A;  1KXP A;  3MCA B;  4LH5 A;  3FZM A;  5TKY A;  3LAM A;  1BG3 A;  2ZGZ A;  4FO0 A;  4AHS A;  4DSK A;  2OPQ A;  1C1A A;  3DLR A;  2RHK A;  3HRG A;  4FJG A;  4BDZ A;  2KZM A;  3WEE A;  3PO5 A;  4O0J A;  4FJ9 A;  5LY3 A;  5GIN A;  3W0L A;  1U48 A;  3JXU A;  1A5X A;  5JS2 A;  5TKW A;  3L3V A;  1X9M A;  4DF4 A;  4QS9 A;  3PV8 A;  4DCH A;  1HPZ A;  1HNV A;  1Z6R A;  4L3Q A;  4DSE A;  5A2Q O;  4OLA A;  2FBX A;  2HHV A;  2WC9 A;  3ATV A;  5BR8 K;  2YI1 A;  1RDW X;  4DUY K;  1RDC A;  5DM6 L;  2RE2 A;  2HMP A;  3QBW A;  3TAP A;  2HBK A;  1VQ5 N;  5GAH P;  1NGB A;  4DLE A;  5KQ8 A;  3SAH A;  3U6F A;  2QA4 N;  1P90 A;  1ASV A;  1YJW N;  2ASO A;  3LAK A;  3MAQ A;  4PKH A;  2WUS A;  3VQD A;  4MO5 A;  2O8D B;  1VQO N;  1IV0 A;  2RF2 A;  5BPL A;  5KGX A;  5C12 A;  3HK2 A;  4B1Z A;  1ESV A;  3PX0 A;  2OYQ A;  5CHI A;  1XI1 A;  2HHQ A;  3GL1 A;  3ZT2 A;  3DLE A;  5AQV A;  3DXM B;  3L8B A;  4CHZ A;  3QNO A;  3Q7B A;  1LV5 A;  3VOV A;  5BPN A;  1WSH A;  2RPI A;  1C0T A;  1A5W A;  1YF5 L;  5CE3 A;  4DU3 A;  4NCA A;  4FJI A;  3WXI A;  2Q36 A;  3KK2 A;  4KH5 A;  3LPT A;  3E1Y A;  4E7H A;  1QZ5 A;  3U9Z A;  1GLJ O;  2A1S A;  3RTV A;  1BU6 O;  4F3T A;  3KLI A;  3AAP A;  1SQK A;  4R79 A;  1ASU A;  4F3O A;  3VGL A;  3OYA A;  3UIQ A;  2P9I B;  3NF9 A;  3O3G A;  4EP4 A;  4M63 C;  5EOY A;  1U6Z A;  3BEX A;  4W5O A;  3CC2 N;  4DSL A;  4KRF A;  4W5N A;  1L3U A;  1RT4 A;  4OO1 J;  2VWK A;  4EFH A;  1RFQ A;  2IGI A;  4JI3 K;  3ZEU A;  1Q86 O;  4IEI A;  4CD1 A;  1YJ9 N;  1UAX A;  1VSD A;  1W2B M;  3TSP A;  2A41 A;  2QTD A;  4H03 B;  4B8C A;  2FSJ A;  2G8K A;  3T1H K;  3THW A;  1VSL A;  2D0O A;  4YDU C;  3SUN A;  5B8H A;  2WFB A;  1IKY A;  4B3S K;  3A8Y A;  2IC3 A;  4FW2 A;  3AA2 A;  4YDU A;  1S1W A;  4CVN E;  3NE6 A;  1S9G A;  3R1X A;  2ZD1 A;  4FK2 A;  2A6A A;  2HHT A;  1ZBS A;  3HPO A;  4XIU A;  1TUU A;  4DR3 K;  3O08 A;  1N6Q A;  4BQL A;  1KAY A;  4DV5 K;  5BPM A;  1BIU A;  1DTT A;  4O55 A;  3ENH A;  1TUY A;  3GG4 A;  5C10 A;  3ULD A;  4ELV A;  4BC3 A;  3VTH A;  2VGN A;  2QWM A;  4ILH A;  1RT1 A;  3CFR A;  4KTQ A;  1EP4 A;  3O8M A;  2WBN A;  3OYI A;  3V9S A;  1ATS A;  1GLE G;  4H5W A;  3VA3 A;  4KHY A;  1TVR A;  4K41 A;  3CPW M;  4CGI A;  4DFJ A;  1C0U A;  5EVZ A;  4JI6 K;  1LAV A;  4I6M B;  4FLW A;  1FJG K;  3HPH A;  3EYZ A;  4CJ3 A;  2P5O A;  4E1M A;  4FWK A;  3LP0 A;  2BUP A;  1W97 L;  2HHW A;  3O1B A;  2QKB A;  5BRH A;  4LSN A;  1CXU A;  1UWB A;  3H45 C;  3S41 A;  1VSM A;  5I42 A;  1J5E K;  2QM1 A;  3DLK A;  5KQD A;  2P9P B;  3JAM O;  3O1W A;  2WTU A;  2Q0R A;  1EX4 A;  3CC7 N;  3WUH A;  5CYQ A;  2ZQB A;  4OKE A;  3FFI A;  4Z0U A;  4Y0W A;  4IFE A;  4DR4 K;  3THX B;  4NXN K;  1YVN A;  1JLB A;  3MCP A;  2BE2 A;  4I2P A;  4E19 A;  5AJ3 K;  5J2Q A;  1TK5 A;  1N8R O;  3H46 O;  3L2Q A;  5J2P A;  2Y1I A;  2IIR A;  1S1X A;  3KK3 A;  4EIA A;  1P8Z A;  3CJ1 A;  3U4L A;  4CZH A;  3HM9 A;  5HBM A;  4CGF A;  2W40 A;  3G4S N;  3UE5 A;  3CCS N;  3NGI A;  3C95 A;  3ZSY A;  1S6Q A;  3SCX A;  4F4K A;  2P51 A;  3VQ5 A;  2O8D A;  4GV9 A;  1GLB G;  4M41 A;  3L2R A;  4H0T B;  5JLF A;  1VSE A;  5M1K A;  4BWJ A;  4WF9 L;  2CGL A;  1YIJ N;  2B5J A;  4YHH K;  4CJS A;  4Y1C A;  4LD0 A;  4BDY A;  3VMF B;  1HYS A;  3DXM A;  1XHX A;  4GW6 A;  3WNH A;  3TSQ A;  3VN5 A;  3MN7 A;  4E7J A;  2GX9 A;  4Z4H A;  4RWT A;  4B8A B;  1MWK A;  4JI2 K;  4CJW A;  2PY5 A;  2NRZ A;  3RSE B;  1ASW A;  3HXM A;  4JKD A;  3OBY A;  3QEX A;  3MWT A;  2DTU A;  2QWP A;  1E4F T;  3VEO A;  3P1G A;  3K0S A;  2BAN A;  1IH7 A;  3LPU A;  1SUQ A;  4DQ8 A;  4CF0 A;  4A59 A;  5CZ1 A;  1BA0 A;  4AHV A;  2P9I A;  4JNE A;  3CM6 A;  2X6N A;  3AVF A;  1BIZ A;  3K9K A;  3SQ1 A;  1NLV A;  3M3Z A;  4K8X A;  3SYZ A;  4YOY A;  3JS6 A;  2B6A A;  1VRT A;  4NCG A;  4IOA L;  4CHY A;  4CIF A;  5HP1 A;  4AHT A;  3VQ6 A;  4FLZ A;  1S5J A;  4XH5 A;  1IBK K;  2UU9 K;  3KJV A;  1KCF A;  2E2P A;  4CK3 A;  1TKZ A;  4C1N K;  4YY3 K;  3C6T A;  4JN4 A;  4JKB A;  2HMI A;  3V1R A;  4KHP K;  2HW3 A;  3HP6 A;  4B3O A;  4WQ4 C;  3VEY A;  1NMD A;  3M8P A;  4Z94 A;  4HCB A;  4OX9 K;  3L2V A;  4FK4 A;  1Z26 A;  3M8Q A;  3MK6 A;  3C65 A;  4YOX A;  2G8H A;  1W7A A;  4WQ4 A;  3P31 A;  1L3S A;  3ITH A;  5AQQ A;  2YHY A;  3ID8 A;  3ZX0 A;  1T6C A;  3OBW A;  3WQU A;  1JL1 A;  3WNF A;  4CJP A;  3T1Y K;  3WQT A;  4FJ8 A;  4A57 A;  4DSJ A;  4NYN A;  2FSN A;  4Q0B A;  1ITG A;  2E8A A;  1GLC G;  1EWR A;  2EHG A;  1JCE A;  3HPG A;  5I9E B;  4ISF A;  1QSL A;  1VHX A;  4C23 A;  4MLH A;  4CHN A;  1JLA A;  2D1K A;  4KO0 A;  3I8D A;  1S1V A;  4B9S A;  3KWI A;  1TKT A;  4HUE A;  3E9P A;  4I6M A;  4J2A A;  3OYB A;  3QO9 A;  4I2Q A;  2HST A;  2QK9 A;  4JLH A;  5F1X A;  2GWK A;  5E84 A;  2IVN A;  3WEE B;  3AA4 A;  2I7P A;  5F0X A;  3MXJ A;  3U8X A;  1SL1 A;  2ZJR L;  3H1V X;  3NMU A;  4X65 K;  2VQF K;  4IJA A;  4FZX C;  3CET A;  2P9P A;  1XC9 A;  1HRH A;  2ZF5 O;  3V1O A;  4TSX A;  5AQH A;  1C6V A;  4CJ5 A;  4FXD A;  3A5O C;  5JIC A;  4FLV A;  3THX A;  1NGA A;  4E0D A;  2IOC A;  3KLG A;  1ZYQ A;  3TAQ A;  1RIL A;  4FWP A;  5GIP A;  2YCH A;  3ZX2 A;  2QWR A;  3CCR N;  3CPE A;  4OPH A;  1M90 O;  2CGK A;  4OVL A;  2QXL A;  3KKS A;  1NGD A;  4OPJ A;  1WLJ A;  4JI5 K;  1VSH A;  5AZI B;  4LF4 K;  5HRO A;  5KRT A;  4LF8 K;  3CER A;  4O44 A;  4BRH A;  3VQ9 A;  1C1C A;  1WAJ A;  3MN9 A;  1GLF O;  4NYF A;  3BZK A;  4E7I A;  3CFO A;  3AAQ A;  3O9R A;  4M3U A;  3MED A;  4BRQ A;  1IG9 A;  4IO9 L;  4M3X A;  3ZCM A;  3OJS A;  4GKJ K;  4LF7 K;  3OYC A;  2UUB K;  1F21 A;  1U4B A;  2Q1N A;  3EO3 A;  1ZBH A;  3K5L A;  3JYT A;  4DQS A;  4BRO A;  2E20 A;  1RDU A;  4DV0 K;  1H1V A;  4JI7 K;  3RSE A;  4IDH A;  1BDG A;  5JMV A;  3RVC A;  4BRI A;  1I94 K;  4DUZ K;  5HLF A;  4DS5 A;  3R8E A;  4CEA A;  3RWU A;  1ZBI A;  1QSY A;  3OS0 A;  3AVM A;  3EZ5 A;  5ELZ A;  4RW8 A;  4C8N A;  2KZZ A;  3DOK A;  3K2P A;  1K6Y A;  1VSF A;  4CEZ A;  3R9P A;  1U49 A;  1BOT O;  2FC0 A;  3ZSX A;  4A62 A;  3D2E B;  3VQC A;  4AF1 A;  3UKR A;  4KI6 A;  3EE8 A;  1D4X A;  3VER A;  3TU5 A;  3G6E N;  4LY7 A;  3K5O A;  1R59 O;  1WSJ A;  5MLC Q;  2OA8 A;  5ADX A;  3SUP A;  1X9W A;  1U2V B;  2RKI A;  1KLN A;  2HNZ A;  3DRR A;  4FCY A;  2R7Y A;  2O4G A;  3B6O A;  5BN8 A;  1ZBF A;  1QQM A;  4XH4 A;  1NK8 A;  4I7F A;  1MWM A;  4CW7 B;  3SNN A;  1RTJ A;  4KH4 A;  5I3U A;  3SPZ A;  3NHG A;  1A5V A;  3A0I X;  1RDB A;  3AO5 A;  3O3H A;  5LJW A;  2A5X A;  3BY5 A;  1ATR A;  4K43 A;  4CZF A;  1Q81 O;  3P5J A;  3CD6 N;  4PKG A;  2FSK A;  3SQ2 A;  3D2F B;  3VA0 A;  3ALY A;  3I0S A;  3Q7C A;  2AA4 A;  4O0I A;  1LOT B;  3PY8 A;  1KVA A;  3SJJ A;  3EKS A;  3M1F A;  4CJR A;  1DTQ A;  1JXE A;  4DTS A;  3FR0 A;  1RBT A;  3HZ6 A;  3LP2 A;  3K59 A;  3VEN A;  1NKE A;  4CFC A;  4CD3 A;  3FE1 A;  3E01 A;  2YNG A;  2DY4 A;  2E1Z A;  3K5M A;  4BRN A;  5DM7 L;  2E5L K;  1IBM K;  4EAH D;  3LZI A;  3M6G A;  2NRX A;  5JVG L;  3CJ7 A;  5AR0 A;  3CQ8 A;  1TL3 A;  1QSS A;  3CCV N;  3OA9 A;  2X74 A;  4EP5 A;  4FVM A;  3VF4 A;  4F9O A;  3ZET B;  1K9M O;  2V51 B;  4CBX A;  1TK8 A;  4B9U A;  3MN6 A;  1HPM A;  2PBD A;  4CJ7 A;  3PX4 A;  4KHN A;  4CGD A;  2QW9 A;  3CF5 L;  5FRM A;  5CZ2 A;  3EKU A;  4H0P A;  4PA1 A; 
#chains in the Genus database with same CATH homology
 1HKG A;  3VTH A;  2HBL A;  2QWM A;  2VGN A;  1C0G A;  3ULE A;  5C15 A;  2BTF A;  1VQ6 N;  1C0F A;  4BG8 A;  2GEL A;  1BUP A;  4ILH A;  2KKZ A;  5AQG A;  1Z05 A;  3O8M A;  1S72 N;  2WBN A;  5GAD P;  5AQM A;  3MDQ A;  4YOW A;  3O9Q A;  1IJJ A;  1ATS A;  1K8K B;  4BG9 A;  1GLE G;  1NBW A;  2Q97 A;  3A5L C;  4WCE L;  3GDQ A;  4H5W A;  4OPA A;  1DKG D;  3BUZ B;  4BRP A;  3G25 A;  2I7N A;  4IZ9 A;  2GUP A;  4K41 A;  4BRF A;  1GLA G;  4AM7 A;  1YI2 N;  4O5F A;  2NRR A;  5C2F A;  3DAW A;  5ADX H;  3CPW M;  2CH5 A;  1MA9 B;  5EVZ A;  1T6D A;  3CHW A;  4JKA A;  4I6M B;  4LC9 B;  2AP1 A;  3WXJ A;  3ZX3 A;  2UYT A;  5AZI A;  2E2N A;  4MO4 A;  5FPM A;  4FWK A;  4FWQ A;  2JWL A;  2BUP A;  3M5R A;  1VQN N;  1NGC A;  1W97 L;  4MDA A;  3O1B A;  5BRH A;  3H6E A;  4CBU A;  4FOI A;  4FL9 A;  5AQK A;  4E1J A;  4FOE A;  3H45 C;  3S41 A;  5AQU A;  2HF3 A;  4BGA A;  4BGB A;  4BVP A;  2QM1 A;  4IXC A;  4JD2 A;  4CZG A;  2NRH A;  3CCM N;  2P9L B;  2HOE A;  4PL8 A;  3C6A A;  1X3N A;  5EY4 A;  5KQD A;  2P9P B;  1NWK A;  3O1W A;  5AZJ B;  3EE9 A;  2DPN A;  2Q0R A;  4QS8 A;  3I56 N;  2QEX N;  4A61 A;  4GV6 A;  5C0Y A;  3VPZ A;  3CC7 N;  3WUH A;  2YHW A;  4CI6 A;  5M1F A;  3VET A;  3F5T A;  3KZB A;  1V4S A;  1DEJ A;  2NRV A;  4Y0W A;  4GV3 A;  4IFE A;  1YVN A;  3O9U A;  5HL7 L;  1Y64 A;  3KHY A;  4QS7 A;  2VWB A;  5F2R A;  3SAF A;  3MCP A;  1GLL O;  3P4I A;  2VGM A;  4JKF A;  3AAR A;  3H46 O;  1N8R O;  2IIR A;  4JHD B;  1VQK N;  1OKJ A;  3DXK B;  3VF6 A;  2PFU A;  4EIA A;  2P9K A;  1P8Z A;  3CJ1 A;  5AQN A;  3U4L A;  1G99 A;  3GE1 A;  3H3N O;  1QVG M;  4H0V B;  4CZH A;  1KC8 O;  4YOT A;  1QZ6 A;  2GTD A;  3O9T A;  4FVU A;  2W40 A;  3G4S N;  5FPD A;  3UE5 A;  4WFA L;  3CCS N;  3N4Q A;  2YJF A;  2E2O A;  3L4I A;  4BRK A;  3VGK A;  4CZK A;  4GNI A;  3DLL L;  3D2E A;  2V7Z A;  3VES A;  3TTC A;  4GV9 A;  3SMS A;  3C7N A;  1GLB G;  2HBJ A;  3CXC M;  3PLA A;  4H0T B;  4NLB A;  5JLF A;  4WQ5 C;  5M1K A;  4WF9 L;  2CGL A;  1YIJ N;  2BH1 A;  3MX5 A;  4MLE A;  3AGK A;  5EXW A;  2VCP A;  1XQS C;  3VMF B;  3WXL A;  3DXM A;  3TSQ A;  1U2V A;  3KVG A;  4WQ5 A;  1NGG A;  4YOV A;  2KHO A;  2QWL A;  1T44 A;  3BF3 A;  2H3G X;  1Q82 O;  2EWS A;  4B9Q A;  3MN7 A;  4JEP A;  1ILY A;  2FLO A;  3PIO L;  3LDL A;  3C0B A;  3U9D A;  2GX9 A;  2V52 B;  5FPE A;  3F2K A;  4RWT A;  4B1W B;  1MWK A;  3ATU A;  3HOS A;  3LDO A;  4FWS A;  4JHD A;  2NRZ A;  4NO7 A;  3RSE B;  4B1U B;  2P9N A;  4JKD A;  4BRL A;  1MDU B;  3OBY A;  4BR7 A;  4BR5 A;  3MWT A;  3OW2 M;  2QWP A;  3UB5 A;  4BY9 C;  1T3V A;  1E4F T;  4PHT X;  4GY2 B;  3AGR A;  3VEO A;  1YIT N;  3ZYY X;  3CQY A;  1QQN A;  1JCF A;  3VEZ A;  3LM9 A;  1IG8 A;  1QQO A;  3HM8 A;  2J4R A;  4A5B A;  4DQ8 A;  4BRM A;  3D2F A;  4IJN A;  2P9S B;  4H0X B;  4JKG B;  4A59 A;  2F9T A;  1BA0 A;  3I55 N;  2YJE A;  2NNW A;  4FSV A;  4FPA A;  2P9I A;  4JNE A;  1EO1 A;  4YOU A;  3OHR A;  2Q2R A;  3CI5 A;  4IOC L;  3G71 N;  3K9K A;  3CMA N;  3O5B A;  1NLV A;  3M3Z A;  4KH6 A;  5BR9 A;  4YOY A;  4CZJ A;  3VF2 A;  1X9J A;  4JK9 A;  3JS6 A;  3P38 A;  4NB4 A;  1S3X A;  4PL7 A;  4IOA L;  3MWP A;  3QFP A;  3E9L A;  2ZJP L;  1HUX A;  2E1Y A;  1E4G T;  4XH5 A;  5AQZ A;  4B1X B;  2CH6 A;  3A5N C;  3HI0 A;  2OTJ N;  4RCH A;  2E2P A;  2YHX A;  4BRC A;  4JK7 A;  4C1N K;  4JN4 A;  3L4Q A;  4MDB A;  4JKB A;  3PIP L;  5AQY A;  5LJV A;  2ZGY A;  4ILG B;  4HTL A;  2QWO A;  4U67 L;  3TTD A;  3HTV A;  4XEI A;  3FLC O;  4H5N A;  3VEV A;  4BR0 A;  4FPB A;  1VAZ A;  1YUW A;  4WQ4 C;  4U7B A;  1WOQ A;  2ITM A;  3VEY A;  1NMD A;  5AQL A;  4H5V A;  4Z94 A;  1NGF A;  5AQI A;  5AQW A;  2V7Y A;  4BVO A;  5JVH L;  3MK6 A;  5EX5 A;  1M1K O;  1HLU A;  3C65 A;  3ZET A;  4YOX A;  3KK7 A;  4B1V A;  4WQ4 A;  1J6Z A;  3P31 A;  5AQQ A;  2YHY A;  3ID8 A;  3ZX0 A;  1T6C A;  3OBW A;  3WQU A;  4IOX A;  4A5A A;  3WQT A;  2HBM A;  4G9Z A;  3WT0 A;  2F7T A;  3ENB A;  4A57 A;  1VQ4 N;  1QVF M;  2FSN A;  1QHA A;  3IDH A;  3J8A A;  3P39 A;  2FXU A;  2E8A A;  1GLC G;  2NRT A;  4BRD A;  5GAE P;  1KAZ A;  2KLA A;  3KWG A;  1JCE A;  2CGJ A;  4BR2 A;  1VQM N;  4M7X A;  1KAX A;  4IO8 A;  2P9U B;  5I9E B;  4UY8 O;  4ISF A;  1VQP N;  1DT9 A;  4C23 A;  5H1S Q;  3MMV A;  1K8K A;  4MLH A;  3ZEU B;  3TTF A;  3NVK A;  1X3M A;  1XUP O;  2YX6 A;  2ZWH A;  4BR9 A;  2D1K A;  2NZT A;  3CCJ N;  3HOT A;  4FWM A;  5BRF A;  3UKU B;  3R3L A;  4DB3 A;  3FZF A;  3KWI A;  2GEM A;  4FWO A;  3VEX A;  1VQ9 N;  3E9P A;  4I6M A;  3VTI A;  3WXK A;  3CJA A;  5AQR A;  2HST A;  2QI2 A;  4O8K A;  3SLC A;  4M7Y A;  4J8F A;  5AQS A;  3L0Q A;  3E9O A;  5F1X A;  1BO5 O;  2GWK A;  5E84 A;  2IVN A;  3WEE B;  5KPZ A;  1NJI O;  1GLD G;  4A2A A;  2I7P A;  3J7Z O;  1DGK N;  3SMP A;  4CBW A;  5F0X A;  3O6W A;  3U8X A;  3AY9 A;  3IKM A;  2ZJR L;  3H1V X;  3CQX A;  2P9L A;  2D4W A;  1KQS M;  3W3D A;  3LDN A;  2W41 A;  3NMU A;  2A40 A;  1KD1 O;  3R6M A;  4IJA A;  4CZI A;  3CET A;  2P9P A;  5BRD A;  2D0P A;  5AZJ A;  5FPN A;  4A2B A;  3L6Q A;  2ZF5 O;  3ID6 A;  5BN9 A;  4EHU A;  4IWV A;  4H5T A;  5AQH A;  3A5O C;  1ZXO A;  3WXM B;  5JIC A;  1OVY A;  1NGA A;  3SBT A;  3ULE B;  1ZC6 A;  3CCU N;  1JCG A;  5GIP A;  4FWP A;  5GIO A;  2YCH A;  3DXK A;  4RTF D;  3CJB A;  3A5M C;  3C6H A;  3ZX2 A;  3LDQ A;  4JKC A;  2QWR A;  1TYQ B;  1VQL N;  3H1Q A;  3I33 A;  3CCR N;  1KXP A;  3CPE A;  3QML A;  4OPH A;  1M90 O;  3MCA B;  2CGK A;  3FZM A;  5TKY A;  1K8A O;  4BR4 A;  2QXL A;  1NGD A;  1BG3 A;  2ZGZ A;  2JWK A;  4PKI A;  3N4P A;  3QFU A;  5M1N A;  5AZI B;  1S22 A;  4GVE A;  4FO0 A;  3LDP A;  2QWQ A;  4KBO A;  2RHK A;  3HRG A;  2F9W A;  3CER A;  4FWR A;  1EQY A;  4BRH A;  3CJC A;  3WEE A;  3D6R A;  3EN9 A;  1XC3 A;  2VYP A;  3UKR B;  2A3Z A;  5KPR A;  3MN9 A;  3FFK B;  5JLH A;  1GLF O;  5LY3 A;  4IEE A;  3W0L A;  5GIN A;  1NM1 A;  3JXU A;  4JD2 B;  5AQX A;  5TKW A;  3AAQ A;  3DWL A;  3O9R A;  2ZJQ L;  4QS9 A;  4XH1 A;  4K42 A;  4BRQ A;  3HSC A;  4DCH A;  4IO9 L;  1VQ7 N;  3CME N;  2FF3 B;  2IVO A;  5M1P A;  5KPT A;  3IMX A;  3QB0 A;  4L3Q A;  1Z6R A;  2IVP A;  4K25 A;  2Q1N A;  3EO3 A;  2NRW A;  2WC9 A;  3ATV A;  2YI1 A;  4BRO A;  1RDW X;  2E20 A;  1RDU A;  3BF1 A;  3GBT A;  5DM6 L;  2RE2 A;  1H1V A;  2ASP A;  2HMP A;  3QBW A;  2GWJ A;  1HJO A;  2HBK A;  1VQ5 N;  3O80 A;  4IDH A;  3RSE A;  5AQF A;  5GAH P;  3FGU A;  1BDG A;  1NGB A;  3CIP A;  3RVC A;  5JMV A;  4BRI A;  2P9K B;  3DJC A;  5AQT A;  1TYQ A;  3IFR A;  4YOR A;  3R8E A;  3FZL A;  1HX1 A;  5KQ8 A;  1RGI A;  4FWN A;  3SAH A;  4ISG A;  3FZK A;  3SK3 A;  1SZ2 A;  4BRE A;  1P90 A;  2QA4 N;  1BA1 A;  5ELZ A;  1YHQ N;  3H3O B;  2P9S A;  4JKG A;  1YJW N;  2ASO A;  3BP8 A;  4JKE A;  1VQ8 N;  1O13 A;  1ATN A;  1HKB A;  4DKW A;  4PKH A;  1NGI A;  3R9P A;  2WUS A;  1BOT O;  5BRE A;  4MO5 A;  4A62 A;  3D2E B;  4BC2 A;  1VQO N;  5GAG P;  4FWL A;  5BPL A;  4AF1 A;  3C7N B;  2QWN A;  1CZA N;  3UKR A;  5C12 A;  1NGJ A;  1ESV A;  2HF4 A;  3EE8 A;  4B1Z A;  4H0Y B;  5HOO A;  2OAN A;  3CCQ N;  1D4X A;  3VER A;  3TU5 A;  4WFN L;  3G6E N;  3TSU A;  5CHI A;  1SAZ A;  3GL1 A;  2E88 A;  4DHY A;  1R59 O;  5MLC Q;  1WUA A;  5AQV A;  3DXM B;  5ADX A;  4BRG A;  1NGE A;  1U2V B;  5AFU H;  2ASM A;  3Q7B A;  3VOV A;  5BPN A;  4AM6 A;  3CJ9 A;  1YAG A;  4BC5 A;  1YF5 L;  5CE3 A;  3O4W A;  3K9J A;  1QQM A;  5BN8 A;  4XH4 A;  3WXI A;  1MWM A;  1NGH A;  4KH4 A;  2Q36 A;  3A0I X;  3SJH A;  5E26 A;  2P9N B;  4KH5 A;  3E1Y A;  3I8B A;  3FZH A;  1QZ5 A;  5LJW A;  3U9Z A;  2OTL N;  2A5X A;  1GLJ O;  1ATR A;  3MN5 A;  4K43 A;  4CZF A;  1Q81 O;  3GOI A;  1BU6 O;  2A42 A;  3IUC A;  1Q18 A;  3CD6 N;  3AAP A;  1SQK A;  5AFU A;  4R79 A;  4PKG A;  2FSK A;  5AQJ A;  2FF6 A;  1HKC A;  3D2F B;  3VEW A;  3VGL A;  1YXQ A;  3HBT A;  1YJN N;  2P9I B;  4ISE A;  2AA4 A;  4H0O A;  3CC4 N;  1LOT B;  3F9M A;  3NVM A;  1JJ2 M;  5M1Q A;  3EKS A;  1SS6 A;  3M1F A;  4WYB A;  5C2D A;  4M63 C;  5EOY A;  1U6Z A;  2E2Q A;  4C1N I;  3BEX A;  3SAG A;  3CC2 N;  2P9U A;  3FR0 A;  3HZ6 A;  3VEN A;  3ENO A;  3QDK A;  1V4T A;  4CD3 A;  3FE1 A;  4OO1 J;  4EFH A;  4BC4 A;  1K73 O;  1RFQ A;  4HWI A;  3ZEU A;  1Q86 O;  4IEI A;  3EZW A;  4CD1 A;  2E1Z A;  1YJ9 N;  1W2B M;  3LM2 A;  2A41 A;  2QTD A;  4JAX A;  3TSP A;  4BRN A;  4H03 B;  3UKU A;  5DM7 L;  2FSJ A;  3E66 A;  4CZM A;  2Q31 A;  4JK8 A;  1LCU A;  2D0O A;  2Q0U A;  3LL3 A;  4YDU C;  4EAH D;  5B8H A;  2WFB A;  3M6G A;  2NRX A;  3CCE N;  5JVG L;  3CJ7 A;  5AR0 A;  1BWF O;  4CZE A;  3A8Y A;  2PAV A;  3CCV N;  5CR4 A;  3OA9 A;  3QBX A;  2NLX A;  5M1O A;  4CZL A;  4YDU A;  4BRA A;  4JKH A;  5C10 A;  3B8A X;  4H5R A;  3R1X A;  2A6A A;  3VF4 A;  4B1Y B;  4F9O A;  1ZBS A;  3ZET B;  1K9M O;  4BC3 A;  4BQZ A;  2V51 B;  4ILJ A;  1TUU A;  3EL2 A;  3O08 A;  4CBX A;  4O8U A;  4BQL A;  3O9S A;  4EHT A;  1KAY A;  3MN6 A;  5BPM A;  3MX2 A;  3QIC A;  3SBG A;  3T7Z A;  1Q7Y O;  3D7E O;  3TPQ A;  1HPM A;  2PBD A;  4CJ7 A;  5AQO A;  4NLC A;  3ENH A;  2QW9 A;  3CF5 L;  5AQP A;  1TUY A;  3GG4 A;  3T69 A;  3CCL N;  3EKU A;  4H0P A;  4WFB L;  3Q7C A;  3VGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...