2WFBA

High resolution structure of the apo form of the orange protein (orp) from desulfovibrio gigas
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
120
structure length
120
Chain Sequence
ASHMQRIAVTAEGPGLDGLVDPRFGRAAGFVVVDAATMAAEYVDNGASQTLSHGAGINAAQVLAKSGAGVLLTGYVGPKAFQALQAAGIKVGQDLEGLTVRQAVQRFLDGQVPMAAGPNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structure of the Apo Form of the Orange Protein (Apo-Orp) from Desulfovibrio Gigas
rcsb
source organism Desulfovibrio gigas
molecule tags Biosynthetic protein
molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN ORP
total genus 37
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2wfbA00
1T3VA 2RE2A 1P90A 2WFBA 2YX6A 2KLAA 1RDUA 1O13A 2QTDA 1EO1A
chains in the Genus database with same CATH superfamily
4G9ZA 4CZKA 4FPAA 4BREA 4Z4IA 3OYGA 2CH5A 3SJJA 1HKGA 2HVHA 3SAGA 4FJNA 3M8RA 1NK0A 1KVBA 1HLUA 4IOXA 2F8SA 4CZIA 3CJCA 4G1QA 4RW9A 4O5BA 3QERA 4CHPA 3VQ5A 3THWA 4JKGA 3O1BA 3PSIA 3SK3A 1N8RO 3EL2A 3U8XA 4CW7B 4I6MA 2KQ2A 3RR7A 3VEZA 1X9SA 1BQNA 1DGKN 3KLHA 4EHUA 1C1CA 3VEYA 1BCMA 1LAWA 3SBTA 1NGFA 3S9HA 4DV5K 4JI4K 1Q9XA 5MLCQ 2HMPA 3E01A 3HYFA 3TTFA 3H1QA 2P9SA 4IEIA 4DS4A 4RW8A 4B9LA 3ZX3A 4FJJA 5JVHL 4LH4A 4GV6A 4C8KA 2QXFA 2XHBA 2KW4A 4FZXC 4O5FA 3TAQA 3WQTA 2QWMA 1NK8A 2FLOA 2QEXN 3CHWA 3B8AX 1NKCA 4IZ9A 3KLGA 3TI0A 1A5VA 4BRHA 4FK4A 1YIJN 3D2EB 4BDYA 1U48A 3KKSA 4OPKA 1MWKA 2WBNA 3C6HA 3BDPA 4B3OA 3I8DA 3O3FA 1VQON 4BRQA 4O0JA 4JKFA 1VSDA 2A42A 2FSNA 4AH9A 1VSFA 1FXXA 1TL1A 2HHHK 3R1XA 5AQRA 4QS7A 2E6LA 3FFKB 4M41A 4FJ7A 1VSJA 5F2RA 4BRFA 4JKHA 3QNOA 1VAZA 2NRVA 3U6FA 3V9ZA 1Q82O 1XHXA 5CY4A 3AO3A 2CGJA 5BR8K 1BIUA 4DS5A 2O8BA 1MDUB 1FKPA 3CCQN 3KWGA 3OYHA 3PIPL 4NCAA 1RCHA 5AZIB 2HBMA 4IWVA 1U4BA 4KRFA 3T7ZA 4B9QA 4CJKA 3HK2A 3BEXA 1C0MA 4J2DA 1NGDA 1ZBUA 3OYIA 3PLAA 3VQ4A 3KZBA 3SUQA 4FVMA 4XEIA 2P51A 3PUFA 3MECA 4OPAA 1DEJA 1WSFA 4YY3K 4DR5K 4JAXA 1SZ2A 3AO2A 5FPNA 3KLEA 4DFJA 2P9LB 2W42A 3H45C 3TTCA 2HNDA 3MCAB 4KH5A 3VQ6A 3M8QA 4E19A 5J2MA 3VGKA 3P39A 5CYQA 4IJNA 1TKXA 1J5EK 1GLFO 2ZWHA 1VQ8N 2BDPA 2PAVA 1WB9A 4BG8A 4N41A 3MEEA 4E7KA 2Z1GA 5F1XA 3SUNA 3NMUA 2NRHA 3KK7A 4CZFA 1BI4A 3QEVA 3W0LA 1ESVA 3DYAA 3CCLN 2PZSA 3VPZA 5LL6Z 2UXBK 1ITGA 4DSEA 3LP1A 1HJRA 4GVEA 1C1AA 2P9LA 1D4XA 3GDQA 3TABA 1WSGA 2UUCK 3A5OC 4JK7A 1GLAG 1M90O 4NCGA 1T7PA 1XC9A 4DHYA 3AVMA 3CI5A 2RN2A 3EE8A 4JI3K 2HNYA 1BG3A 3RMDA 2XY8A 2P9SB 4CJRA 3LL3A 1IBLK 5AQQA 5EXWA 2A6AA 3A5MC 5H1SQ 4DLGA 2QKBA 4JV5K 3RMAA 2D4WA 3WXLA 1RT2A 1FKOA 4CJ3A 4IO9L 3SJHA 2ZJPL 3ATVA 3ENBA 1QSYA 4CECA 1VK0A 4OLBA 1NGJA 2DFHA 2RE2A 3OJUA 2WOMA 4GKKK 4QCLA 3AVCA 3BF3A 1VSIA 2DY4A 4KKOA 3ENHA 2HBKA 2F96A 5AQTA 2GEMA 4DSKA 3WNEA 4GKJK 2VGNA 2KZZA 3LDLA 1X3MA 2NRZA 1EWQA 1OH5A 1T3VA 2FBVA 2YNGA 1TUYA 1HNZK 2OPRA 1RDAA 2QTDA 4FW2A 3L2QA 3MK6A 1YHQN 5LJWA 5EX5A 4LFCK 1KLNA 3ZSVA 3WQUA 4YOYA 3QICA 4DTUA 2UU9K 4CEBA 3PIOL 1EKEA 3SQ0A 5AFUA 4KHYA 3M8SA 5TKYA 2UYTA 1C1BA 1IJJA 1TKTA 4IDHA 4IFEA 3QFUA 4KH4A 4OLAA 3OYCA 3CERA 2YKNA 4MDBA 3VQQA 4O4GA 1MA9B 3HM8A 1SS6A 3OYBA 4B3RK 5AJ3K 4HCCA 1P8ZA 2YKMA 4DFMA 3LP3A 2HBJA 4CZEA 4MLEA 1VRTA 4QAGA 3O9RA 3I8BA 3G0ZA 3PX6A 3RVCA 3S3NA 3DRRA 3ZETB 3VQAA 4CZLA 3UB5A 3QBXA 3VEXA 3A0IX 1XNQK 1EETA 2PBDA 4DTPA 2ZF5O 4CJEA 3E66A 1T05A 5EY4A 1JJ2M 3NH2A 4HCBA 1GLEG 3IAYA 4I9QA 4M3ZA 3VF6A 2GWJA 3GOIA 1TUUA 1VRUA 2G8FA 3OW2M 3K58A 4JS4A 1Q81O 2ZQBA 1W0HA 3WXIA 3OYJA 4JN4A 4C1NI 3M5RA 3MN7A 3V4IA 4PKIA 4CEQA 5BPNA 5E41A 1QQNA 4CEEA 4CZHA 2DFFA 3RMBA 3VF4A 1DTQA 4DU1A 2HW3A 1Z26A 4CJ7A 2W6KA 4KTWA 1HYZA 2WONA 5C15A 3AO4A 3VGMA 3O9UA 1RFQA 3DAWA 4OJRA 3L4QA 4CEZA 4GV9A 3AGKA 5BREA 2WC9A 1U45A 3FE1A 2ZJQL 5ADXH 2P9UA 4X65K 3V9UA 3OYFA 3KK3A 4YFUA 2A41A 3DLRA 2ITGA 3M3ZA 3E9OA 3VQ8A 3QNNA 5KQDA 3LDQA 3EZ5A 4FWPA 1Z6RA 2J4RA 3HPOA 2ZM6K 4DR1K 3CC2N 5AZJB 2O8BB 4MFBA 1LWCA 1W2BM 2D0BA 3QIPA 4OX9K 3O3HA 3TR8A 4DR2K 4F8RA 4AF1A 2KHOA 5AQIA 3TSQA 3LZIA 1YJNN 3H6EA 4DF8A 3CCRN 4H03B 3KD1E 3LZJA 4W5RA 4IKFA 3QIOA 3R6MA 3TARA 2O8FA 1QQCA 3NCIA 1XHZA 2W41A 4C8NA 4N5SA 4M7YA 1VQ6N 1NGIA 2IC3A 2HNZA 3VTHA 3K9KA 3ZT2A 1RT3A 2HHSA 1T6CA 3SV4A 4FXDA 1XMQK 4NCBA 3ZSOA 4JYAK 4PKGA 4IOAL 4GY2B 1NMDA 4DTNA 2NZTA 1XWLA 3C65A 3M8PA 3VQEA 2OPSA 5AQOA 3L3UA 4YDUA 3DLBA 1RT5A 4OGCA 3PX4A 4H0VB 1NGBA 4A57A 4H4OA 4FO0A 4FJHA 3ISNC 2RPIA 5GIPA 2BTFA 4IO8A 1ASWA 3CQXA 4DWIA 4FM0A 4I6MB 5LMUK 3MWTA 4FLUA 3QMLA 2KTQA 5AQMA 3C7NA 2OTLN 3OBYA 4H5WA 4CJFA 3V1OA 4CF1A 2YNFA 1VSKA 2OPPA 4BVPA 4BC4A 2W6LA 3O4WA 4CERA 4CF9A 3CCEN 2X6SA 1BWFO 4HWIA 4WQ4C 4B9VA 2NRWA 1SQKA 1BQMA 2FBXA 5AQGA 5I9EB 5C12A 4DR4K 2E2OA 1FJGK 1OVQA 4FL9A 5AFUH 4IXCA 3VETA 1IBMK 4DB3A 4CJSA 1JLAA 4CD1A 3B6OA 3J80O 3NF6A 5ELZA 5FLXO 4QS9A 3HJFA 1HR0K 4A62A 2GV9A 2P9KB 1RT6A 3SUOA 5J2PA 2Z1HA 5JICA 2HB5A 2VWKA 4FZYA 4CGFA 3JXUA 2I7NA 4XH4A 1IV0A 3MN9A 4FLTA 5HBMA 4JLHA 4J2AA 1A5WA 2D0AA 5HROA 3DOKA 4BRKA 1RTIA 2JWKA 1JXEA 3EE9A 3BZKA 4O8KA 3CCVN 1W9HA 4WF9L 5K14A 1HKBA 2P9NA 3ATUA 4DG1A 2QI2A 3DXKB 3LM9A 4IFVA 3NGIA 1TK8A 5AQFA 1GOCA 1RDWX 1DKGD 2AA4A 3NBPA 1KFSA 1RBRA 1UA0A 3SYZA 4U67L 3CC4N 1BO5O 4E7IA 5AQYA 4CEDA 3OYNA 2GX9A 4CZMA 1GOBA 4H4MA 4LF4K 4FWSA 2B5JA 4FWRA 4PL8A 3CFPA 1HMVA 1HQEA 1BISA 3AVHA 3NVKA 3MDQA 2F9TA 1RTJA 4J2BA 4ELTA 1XI1A 4DFPA 5HRPA 4DV2K 2FC0A 3CJ1A 3RMCA 4DMNA 5KTQA 4M63C 4DR6K 1S6QA 1IBKK 2HOEA 3EKSA 2ZJRL 3TU5A 5AQVA 5KPTA 4CD3A 4HUEA 3S3OA 4O55A 4YORA 1Z25A 4IJAA 3WXMB 2D1KA 4DLEA 1W97L 1N36K 2HF3A 3IS9A 5KRTA 1RGIA 3MAQA 4FWMA 2O8EA 1BL3A 4FLWA 4DV6K 3LM2A 1TV6A 4BRDA 2ZGZA 4HHTA 2P1JA 1C6VA 4CJQA 3PO5A 1KVCA 3VERA 3V6DA 5LJVA 1HYVA 1RTDA 4JI7K 2Q2RA 4FJXA 5HL7L 3KD5E 4CJ5A 4CHOA 1S1TA 4K42A 1RILA 4FWKA 3OHRA 4DU3A 1VQPN 4CBWA 5KI6A 3NGZA 4X66K 3BGRA 1S1VA 2JLEA 1RDCA 2YHAA 4ZHRA 4CJPA 4AM7A 1VQ9N 3KLIA 1U49A 4CIEA 1NKBA 4YOUA 3NE6A 2B4JA 4H5VA 4LFAK 3EZWA 1JL1A 1OVYA 2I7PA 2YNHA 5CHIA 4UY8O 5M1PA 3SAHA 5AZIA 3T69A 4Z4CA 4BDZA 2O8DB 1S1XA 1OH7A 2KLAA 1MU2A 4GNIA 3TAGA 2Q3SA 2QXLA 5AQUA 1REVA 3K5LA 4E1NA 3HO1A 4PL7A 1QS4A 3MN5A 3EN9A 3V1QA 1ASUA 3CM5A 4CF2A 4F3TA 4A5AA 2NNWA 4V19S 2H3GX 4WYBA 4DSFA 3SV3A 1RBTA 4CK3A 1HNWK 3ULEA 4M3YA 4Z4FA 3SQ4A 3F5TA 1YITN 1IH7A 2AJQA 2P5OA 1LWFA 1TAQA 4O44A 3OYAA 5AQXA 2Y1IA 3DLEA 4ISGA 3L4IA 3F9KA 4F2SA 3ITHA 2E2QA 2OA8A 5AQJA 2FSKA 3AO5A 4JI0K 4OKKA 3IMXA 1WSHA 1L3SA 4FSVA 3UKUB 3F2KA 5KPRA 3CG7A 4KV8A 1NJXA 3P1GA 3THWB 3LANA 1JCGA 3W3DA 4LY7A 1KFDA 3ZCMA 3SLCA 3MX5A 3VGLA 4J8FA 1KXPA 2NUBA 3EY1A 2XY5A 4FJIA 2HF4A 3RTVA 1CZ9A 4KI6A 4BRLA 2X6NA 4ILJA 3S3MA 4FJKA 5M1NA 3WNGA 1JCEA 5AQLA 3IRXA 3WXKA 3OTOK 3KTQA 1WUAA 5IWAK 3LDPA 4CHQA 1JLGA 3OYDA 1ATNA 5AR0A 4JEPA 4FWOA 4N56A 3ZSRA 1Q7YO 4FOEA 4H5NA 4CESA 1VHXA 3G71N 4WQ5A 3MEDA 3VQ9A 3SNNA 1J5OA 1T03A 1JLCA 3LDNA 1QVFM 4DQRA 1NJYA 1MWMA 3HBTA 4CGGA 1NNEA 2O4IA 5AQWA 5C25A 3JS6A 3BZCA 4H0PA 2KKZA 3P4IA 3WXJA 3KVGA 5SWMA 3O4QA 3O4NA 4DTJA 2B6AA 3V9WA 4DR7K 3ZT1A 3NVMA 2GWKA 3SPYA 3CJBA 4MQ3A 4JHDB 4NYFA 4LSNA 5T7BA 2BUPA 1IG9A 3AA5X 4IFYA 1XQSC 3UKRB 3VESA 1L3UA 3LPTA 4H8KA 1Q9YA 3ZSZA 1ZYQA 4PA1A 3M6GA 1HKCA 5JS2A 4B9NA 2FBTA 4YOVA 3ZLJA 4N76A 2G8VA 4JI5K 4W5TA 4BRGA 2VG5A 4FLVA 4WCEL 4CJ4A 3C95A 5AQPA 1NWKA 3WNHA 5D3GA 3T1HK 4BGBA 3M1FA 1DT9A 4CE9A 2G8UA 3O9QA 3U9ZA 1TK5A 1S9GA 3KJVA 1HPMA 3TAPA 1KRPA 2NLXA 1WSIA 5AQZA 3NF7A 4FLZA 4Z4HA 4DKWA 1QHAA 3NH1A 2D0OA 1NLVA 1SL1A 4RW7A 4IG3A 1U47A 2QKKA 1E3MA 4BDPA 3HI0A 1J6ZA 4BC5A 4CK2A 2E1ZA 4FWLA 3V9XA 3ZSWA 3AV9A 1RT1A 3B6PA 1WSEA 1VSMA 3G10A 1BDGA 4DV3K 3GG4A 2BH1A 1NKEA 4KTZA 2VG6A 1UA1A 4EAHD 3C7NB 1UOCA 4OKJA 1NMNA 4EP4A 2OCEA 4CBUA 4FK2A 3KK1A 4KHNA 3HPHA 4DSJA 4JKEA 5C10A 4DR3K 3VEOA 5C0YA 1EXQA 1N33K 1KCFA 2YJFA 1YT3A 1RTHA 1V4SA 4JI6K 4EZ6A 3VMFB 3L2VA 4E7HA 3RRHA 1J9AA 3HOTA 3L0QA 1CZBA 4LF9K 4FCYA 4BRIA 1GLDG 1RNHA 3OYMA 3LP0A 4NLCA 3C0BA 1ZC6A 5GAEP 1KAZA 4AHVA 3FLCO 4C23A 3MXJA 1O1WA 4IOCL 3VTIA 3OS0A 3QBWA 1VSEA 1HYSA 3D0PA 4K41A 3AARA 4DTSA 1HRHA 1HQUA 3CMEN 1HNVA 1TKZA 4BR7A 2O8FB 2YX6A 3ID6A 1S22A 2FBYA 3H08A 5M1KA 1T44A 3CFOA 4JI2K 5CR4A 1IKWA 5EVZA 1WBDA 3H3OB 3FZMA 2PYLA 1NK4A 3UKRA 4DQ8A 1GLJO 4FWQA 3FR0A 1IKVA 3E9PA 1KTQA 1SAZA 4NYNA 4BRCA 1NJWA 4B1ZA 3AVAA 1X3NA 1QE1A 1S9EA 4E89A 4CZJA 1BU6O 2FSJA 4CJWA 3DRSA 1ATRA 1C0GA 4ELUA 2QWOA 3VQBA 3QEWA 3O9SA 3OVNA 2YI1A 3J7AP 4DQSA 1VQNN 4WFBL 4Y1CA 4LFBK 3ULEB 3D2FB 1JLEA 3FZKA 1GOAA 4A2AA 2ETJA 4DQIA 4E7LA 4B9UA 2EWSA 4Y1DA 2D5RA 4CI6A 2IDOA 4C8MA 3VQDA 3CJAA 1X9JA 3ID8A 3RSEA 1S1UA 2HSTA 1RBUA 3DJCA 2I5JA 2P5GA 4JKDA 4CIGA 1VSLA 2E88A 4DV4K 3A5LC 5GINA 4YOWA 3CF5L 1Q86O 4LH5A 5I42A 4Z4EA 2A3ZA 3QEXA 2E5LK 2Q1NA 5DM6L 5HOOA 4M7XA 3LAMA 2HHWA 3JAMO 4ILHA 2P9KA 4A5BA 4CFCA 1HPZA 4CBXA 2ZE2A 2A5XA 3PY8A 3S41A 4DTOA 3BY5A 4BRAA 3V81A 4XH5A 4KBOA 3SAFA 1WOQA 5CE3A 4CGHA 3NFAA 3THYA 3H46O 3AVFA 4QS8A 4BC2A 3CCJN 4FJ5A 4OVLA 4B8AB 1BA1A 3C94A 4AHTA 4DUYK 5JS1A 1JL2A 4PHTX 1QSSA 3BF1A 4RCHA 2Q0RA 1YVUA 1I39A 3D45A 2NRRA 3SQ2A 3FZLA 3AVIA 3HTVA 1FK9A 4YNQA 1TKDA 4K8ZA 1HX1A 4BWMA 3SMSA 3LALA 3LP2A 3FFIA 4EHTA 1NGGA 3AA4A 4CJLA 3G25A 2YNIA 4CGIA 2W40A 4IBNA 2KZMA 2ASPA 2GBZA 1SKWA 1RDDA 1Y97A 1OH8A 4X62K 1K9MO 4HVJA 3VENA 1KLMA 2YHWA 1QSLA 5BN8A 3BP8A 3AA3A 4KHSA 1NU0A 2O8DA 2Q0UA 1UAXA 2JGUA 2G8IA 4O8UA 3WT0A 3OYKA 3AVGA 4ISEA 1BCOA 2BE2A 3K5OA 4B1YB 1K8AO 2QWQA 3GBTA 3N4QA 4A59A 5DM7L 2BGGA 1YVNA 2V52B 5AQKA 3TAFA 1EQYA 2E8AA 1LAVA 4AM6A 5C2FA 4W5OA 1CXQA 3PSFA 5KGWA 3IKMA 3J81O 4DTMA 4FJ8A 4M42A 4Z0UA 3H1VX 2Z1IA 1LW0A 2YV0X 4IDKA 1YTAA 4YOTA 1YI2N 4PWDA 2OANA 5I3UA 3HM9A 4B08A 1XUPO 2XY6A 2AP1A 3CIPA 3HVRA 2GUIA 3I33A 1YJ9N 3HSTB 4I7FA 1JCFA 4ILGB 1KSPA 2V7ZA 4DTRA 4PUOA 1SKSA 3QDKA 4KPYA 3HRGA 2O8EB 1U04A 2O4GA 1O13A 3CYMA 3Q7BA 4BACA 3LPUA 4HUGA 1OH6A 4KB1A 1SKRA 1J54A 3MWPA 4LD0A 3A2FA 3SMPA 3TANA 5KPZA 1ASVA 1GLLO 3ZYYX 3CQ8A 5AQNA 3LAKA 1QQMA 4JS5A 3AGRA 3HP6A 4M3RA 4L3QA 2IAJA 3VQCA 4DV7K 1NGHA 1JKHA 4FPBA 1YTUA 4NO7A 2F9WA 5ADXA 4BQLA 4BRMA 5BRFA 4K43A 1N6QA 4OGEA 4ISFA 1KAYA 2PFUA 4CIFA 1CZAN 3CFRA 4KREA 4RW6A 2GELA 2A40A 2QWPA 4CK1A 1TGOA 2OYQA 4LF7K 1BHLA 4WE1A 4U7BA 4BR0A 3L2WA 4EZ9A 5LMNK 3OY9A 4KHQA 2QA4N 4E0DA 4CFAA 5BN9A 3U4LA 2P9IB 3HVTA 1YUWA 4DV1K 4YOXA 4CEOA 3DRPA 4E1JA 3ENOA 4FJLA 4JHDA 2E1YA 5EU7A 4ELVA 4K25A 4C8LA 1NM1A 3NHGA 4BROA 2BANA 2A1SA 5JLFA 1HUXA 4HTUA 3ZETA 4FLXA 2IVPA 1J53A 2HHQA 4GVMA 4DQQA 1Z05A 4WFNL 2LSNA 4BC3A 1WAJA 2DFEA 4B3SK 4W5QA 3TAMA 5B8HA 1XNRK 2GTDA 1VQ5N 1N34K 3L8BA 4RW4A 5FRNA 1TL3A 1X9MA 2O8CA 3OA9A 4CHYA 1RT7A 5BRHA 4BWJA 3CETA 3V1RA 1D9FA 3EO3A 1K8KA 1KVAA 3D2FA 3THXA 3HSCA 2FXUA 5JMVA 3KWIA 4PQUA 3OBWA 3PV8A 2VCPA 2Y1JA 4YDUC 3PX0A 4FM2A 2IVOA 3D7EO 2VQEK 1L3VA 4K8XA 3QETA 2Q97A 3SI6A 3T3FA 4FM1A 3VF2A 1ZBFA 2EX3A 2KFNA 5HRRA 1DLOA 4PY5A 4BE1A 4JKGB 3U3YA 4OPHA 3AVKA 3QFPA 3ZX2A 4YHHK 2JWLA 4RG8A 1ZBIA 4A61A 1NGEA 2HHVA 3CC7N 1JXBA 1WNSA 2NRTA 3EKUA 4QOZB 1HJOA 4JK8A 3C6AA 4B1WB 1VQ7N 3BUZB 1P90A 2VG7A 2E20A 4KO0A 3K0SA 4Z4GA 3K2PA 4KH6A 1R59O 4GMJB 3HOSA 5F0XA 3NGYA 3O80A 3KK2A 3EYZA 4F4KA 3IFRA 2WUSA 4M3TA 2FF3B 1G15A 3R9PA 2WFBA 1D8YA 4Q5VA 3ZEUA 1BUPA 3J7YP 5BPMA 3SPZA 4KFBA 2CGLA 4ZTJA 3ZSYA 3O6WA 3L2UA 1NJIO 3A5NC 4KHUA 3HT3A 5GAGP 4JK9A 3OYLA 5JVGL 3OS2A 5HRSA 1T8EA 3QB0A 3WNFA 1KAXA 4ICLA 3WEEA 2CH6A 2E4LA 4F3OA 5KGXA 3GL1A 2HMIA 4CGDA 4B1UB 1C0TA 4AHCA 3E9LA 4CZGA 3UIQA 3FGUA 1LW2A 3HZ6A 4LF6K 5GIOA 3AY9A 1NGCA 5FRMA 1CLQA 5GADP 4CF0A 3KKRA 4TSXA 5AZJA 3HXMA 4KHPK 4DF4A 4DUZK 2ITMA 4RTFD 2RHKA 5M1QA 2VGMA 3C6TA 3UE5A 3L6QA 4NXMK 1QZ5A 1QHTA 3MN6A 1JLBA 5AQHA 5A2QO 5BRDA 4JI8K 4BRNA 4ZTFA 4J2EA 4B8CA 4R5PA 2QWRA 3ZT4A 1X9WA 3KLFA 1K6YA 1S5JA 3E1YA 3F73A 1S1WA 3VQ7A 3F9MA 4LC9B 1TK0A 5KRSA 4NXNK 3NH0A 2OTJN 1YAGA 2EHGA 2ZGYA 4MO4A 5CYMA 3K57A 3RWUA 1BIZA 3NF8A 3I0SA 4H0TB 1SL2A 1BI4B 3K5NA 4BY9C 3MX2A 4AILC 1NK9A 5JLHA 3QEIA 2RKIA 4CF8A 1GLCG 2G8WA 1K8KB 1RDUA 4B1XB 3P5JA 4H0OA 1XMOK 3DI6A 3Q7CA 5E26A 5EOYA 2WTUA 3J8AA 3LDOA 1L3TA 4L8RB 1U2VB 3RRGA 3EEQA 2R7YA 3KHYA 2PYJA 4FK0A 2E6MA 3QLHA 4CJVA 3ZX0A 3CPWM 3DXMA 1DTTA 5M1FA 2HBLA 2VQFK 3ASMA 2V7YA 3VA3A 2G8HA 3DLGA 2XY7A 4RWTA 2HVIA 1S72N 1WBBA 2NRXA 3L2RA 4Y0WA 1A5XA 5HRNA 2FF6A 3T19A 1QVGM 3AVBA 1OKJA 3H3NO 3VEVA 1TYQA 3CPEA 3TTDA 4B9MA 4CFDA 5CZ2A 3SZ2A 1SV5A 2F8TA 1KD1O 4FJMA 1TYQB 4R79A 1RT4A 2IOCA 2KFZA 3DWLA 1GLBG 4CJUA 3LWLA 2Z1JA 5M1OA 1QZ6A 4C1NK 4FYDA 3ZSXA 3U9DA 1B92A 3OJSA 4KI4A 1E4GT 5BPLA 1RDBA 1BGXT 4JRQA 4JKCA 4CVNE 4H5RA 3J7ZO 3ZEUB 2VWBA 4JD2A 3ALYA 3ZSQA 1XC3A 3O08A 1Y64A 1KC8O 4DU4A 5C42A 4WFAL 4CHNA 1HNXK 4JRPA 1L5UA 3AA2A 3WEEB 4IG0A 3AVNA 4BGAA 4KB0A 4FLYA 3HPGA 1M1KO 4BR5A 2VWJA 3K59A 4I9LA 3VQPA 2ZD1A 4DSIA 4DFKA 3MXMA 2D0PA 4MLHA 4FVUA 4EIAA 1K73O 1EO1A 3QEPA 3NAEA 1S6PA 4E7JA 1YF5L 3ZT0A 5FPEA 1ZXOA 1S3XA 4DTXA 1T6DA 1ATSA 3MXIA 5FPDA 2HHTA 3L3VA 5IT9O 3O3GA 3DMJA 1VQMN 2GUPA 2YCHA 3CCMN 3SCXA 4BQZA 1BOTO 4IEEA 4H0XB 3I55N 4CHZA 5HLFA 3I0RA 3VN5A 1H1VA 3DLHA 1FW6A 4M45A 1U2VA 4B9TA 1WLJA 3C6UA 4Z94A 5HP1A 4EFHA 4XIUA 4UQGA 4W5NA 1W7AA 2F4VK 1NK5A 4BR9A 1B9FA 1F21A 3DOLA 2A1RA 3THYB 5BR9A 3HP9A 4GW6A 2X74A 3CM6A 2QWLA 4DV0K 4E3SA 3WUHA 3IUCA 4OO1J 3QESA 2YHXA 3DXMB 1VQKN 3T1AA 1ZBLA 1X1PA 4FW1A 3PO4A 3JSMA 1EP4A 4B3MK 1BA0A 4H5TA 2DPNA 2Q31A 3TAEA 4JKAA 4M3UA 4JI1K 4O0IA 1LOTB 5E84A 3RR8A 2ASOA 4B1VA 1IG8A 3O8MA 3CCSN 3NDKA 3GE1A 1IO2A 4BG9A 3D2EA 2IVNA 4A2BA 1D9DA 3U3GA 2YHYA 4F9OA 3OYEA 3AVLA 1Q8IA 4N47A 2UXDK 1ZBHA 1HNIA 1QQOA 2UUAK 3DXKA 3OS1A 3CQYA 1TAUA 3CCUN 3SBGA 2QWNA 4CGJA 4ID5A 5TKWA 1RBSA 4LF5K 3LWMA 1N32K 3K9JA 5FDLA 5FROA 3FZFA 3R3LA 4EP5A 1U6ZA 3I56N 4ID1A 3CJ9A 3THVA 4KTQA 2P9NB 3TPQA 3TSUA 4C8OA 2UUBK 1LV5A 1WAFA 3QINA 2IGIA 4CEAA 5DMRA 1TVRA 4HTLA 5SZTA 4KHWA 4CFBA 1N5YA 1VQ4N 3CXCM 4OKEA 2HHXA 5LY3A 2OZSA 1YJWN 1V4TA 4MDAA 4GV3A 3IDHA 3P38A 2OPQA 4LSLA 2D0CA 1NK6A 5CZ1A 3G6EN 4JNEA 4Q0BA 3MCPA 3O1WA 3P31A 3O5BA 5J2NA 3VOVA 1ILYA 1NJZA 1SUQA 4X64K 3V9SA 4MO5A 4WQ5C 3JYTA 4HUFA 4DSLA 3HL8A 2RF2A 1G99A 4FJ9A 3CD6N 4OPJA 5C2DA 4K0KK 4I2PA 5AQSA 3RSEB 4BR2A 2E2NA 2YJEA 5J2QA 3LDSA 5C24A 5GAHP 2V51B 3KIOA 1UWBA 1Q18A 2ASMA 2IIRA 4PKHA 1R0AA 1E4FT 4M3WA 5J1EA 4BRPA 3CMAN 3MEGA 4FOIA 3ZT3A 1D5AA 4DQPA 1NBWA 2Q36A 1VSHA 1B9DA 2YHBA 3UKUA 5FPMA 2P9PA 3IG1A 2G8KA 2QK9A 1EWRA 2F7TA 4WQ4A 4NB4A 3P83D 3DLLL 1ZBSA 1SL0A 3AO1A 1JLFA 3QO9A 3DM2A 4B3TK 3SUPA 3VEWA 2UXCK 3TWHA 1IKXA 1C0FA 1RBVA 4AQYK 2IS3A 3CJ7A 1WN7A 2P9UB 4BR4A 1WSJA 4FWNA 4CCHA 2QM1A 3NF9A 2HHUA 3TSPA 4CJTA 4FZZA 1VQLN 1I3AA 4M3XA 2P9PB 3FZHA 4FJGA 4NLBA 4F2RA 3AAPA 5DK5A 4KAZA 2VYPA 1EX4A 2CGKA 3R8EA 3SQ1A 2PY5A 1QTMA 4B9SA 3VA0A 3AAQA 2X78A 4JKBA 2DTUA 4H0YB 5KQ8A 1NOYA 1C0UA 1LWEA 4I2QA 1YXQA 3MMVA 1JLQA 2QW9A 3N4PA 1LCUA 4DCHA 2O8CB 4LF8K 3O9TA 4AHRA 1I94K 1IKYA 4AHSA 1KQSM 3G4SN 4JD2B 3K5MA 1NOZA 4CEFA 3THXB 1NK7A 2P9IA 2ATQA 3A8YA 4AHUA 4XH1A 1NGAA 4BVOA 3ULDA 4E1MA 1CXUA 3D6RA 3T1YK 3DLKA 1NG9A 3AVJA 4BE0A 2E2PA 2XO7A 2OZMA 2XRIA 4BE2A
chains in the Genus database with same CATH topology
5JVGL 2YJFA 4CZKA 4G9ZA 3MWTA 1V4SA 3QB0A 1KAXA 3QMLA 4FPAA 5AQMA 3WEEA 3C7NA 3VMFB 4BREA 2OTLN 2CH6A 3OBYA 4H5WA 2CH5A 4BVPA 1HKGA 3GL1A 4BC4A 3O4WA 3L0QA 3SAGA 3HOTA 4HWIA 1BWFO 3CCEN 4WQ4C 4B1UB 2NRWA 1SQKA 1HLUA 4BRIA 4IOXA 1GLDG 3E9LA 5AQGA 4CZGA 4CZIA 3CJCA 3FGUA 5C12A 5I9EB 4NLCA 2E2OA 3C0BA 1ZC6A 5GAEP 3HZ6A 1KAZA 3FLCO 4FL9A 5AFUH 4C23A 4JKGA 4IOCL 4IXCA 3O1BA 3VETA 3VTIA 3QBWA 5GIOA 3AY9A 1NGCA 3SK3A 1N8RO 3EL2A 4DB3A 3U8XA 5GADP 4K41A 3AARA 4CD1A 5AZJA 4I6MA 5ELZA 4QS9A 3VEZA 3CMEN 4BR7A 2ITMA 4A62A 2YX6A 3ID6A 4RTFD 1S22A 2P9KB 2RHKA 1DGKN 5M1QA 2VGMA 4EHUA 3UE5A 3VEYA 3L6QA 3SBTA 1QZ5A 3MN6A 1NGFA 5M1KA 5AQHA 1T44A 5JICA 5CR4A 5EVZA 5BRDA 2HMPA 3TTFA 3H3OB 5MLCQ 3H1QA 2P9SA 3FZMA 4IEIA 4BRNA 3UKRA 3ZX3A 4DQ8A 1GLJO 5JVHL 2QWRA 4FWQA 3FR0A 3JXUA 4GV6A 2I7NA 3E9PA 4XH4A 1SAZA 3E1YA 4BRCA 4B1ZA 3MN9A 1X3NA 3F9MA 4O5FA 4LC9B 3WQTA 2QWMA 2FLOA 2QEXN 4CZJA 3CHWA 1BU6O 3B8AX 4IZ9A 4BRKA 2OTJN 1YAGA 2JWKA 3EE9A 2FSJA 4BRHA 4O8KA 3CCVN 1ATRA 2ZGYA 1C0GA 4MO4A 3D2EB 2QWOA 1YIJN 4WF9L 3O9SA 1HKBA 2YI1A 3ATUA 2P9NA 4H0TB 1MWKA 2QI2A 2WBNA 3DXKB 1VQNN 3LM9A 4WFBL 3C6HA 4BY9C 3MX2A 5JLHA 3ULEB 1VQON 3D2FB 1GLCG 4BRQA 3FZKA 4A2AA 4JKFA 5AQFA 1K8KB 1RDUA 2A42A 2FSNA 4B1XB 2EWSA 1RDWX 1DKGD 4H0OA 2AA4A 3Q7CA 5EOYA 3R1XA 5E26A 4QS7A 5AQRA 4CI6A 3J8AA 3LDOA 1U2VB 3FFKB 3KHYA 4U67L 3CJAA 5F2RA 1X9JA 4BRFA 3ID8A 4JKHA 3RSEA 3ZX0A 3DXMA 3CPWM 3CC4N 5M1FA 2HSTA 1VAZA 2HBLA 1BO5O 3DJCA 2NRVA 5AQYA 1Q82O 4JKDA 2V7YA 2GX9A 2CGJA 4CZMA 1MDUB 4RWTA 2E88A 1S72N 3A5LC 4FWSA 2NRXA 5GINA 4YOWA 4Y0WA 4FWRA 3CCQN 3CF5L 4PL8A 3KWGA 1Q86O 2FF6A 3PIPL 1QVGM 5AZIB 2HBMA 4IWVA 1OKJA 3T7ZA 4B9QA 3H3NO 2A3ZA 3VEVA 3NVKA 1TYQA 3CPEA 3TTDA 3BEXA 3MDQA 2Q1NA 5DM6L 1NGDA 1KD1O 1TYQB 4R79A 5HOOA 3PLAA 2F9TA 3KZBA 3DWLA 4M7XA 1GLBG 4XEIA 4ILHA 5M1OA 2P9KA 4A5BA 1QZ6A 4C1NK 4OPAA 4CBXA 3CJ1A 1DEJA 2A5XA 3U9DA 1E4GT 3S41A 5BPLA 4JAXA 4M63C 4JKCA 1SZ2A 4BRAA 5FPNA 2P9LB 4H5RA 3ZEUB 4XH5A 3H45C 4KBOA 3TTCA 2HOEA 3J7ZO 2VWBA 4JD2A 3MCAB 3SAFA 3EKSA 1WOQA 1XC3A 4KH5A 3TU5A 5AQVA 5CE3A 2ZJRL 5KPTA 3O08A 1Y64A 3H46O 3VGKA 4CD3A 4QS8A 4BC2A 1KC8O 3P39A 3CCJN 1BA1A 4YORA 4IJNA 4WFAL 1GLFO 2ZWHA 4IJAA 1VQ8N 3WXMB 2D1KA 2PAVA 4BG8A 1W97L 4PHTX 2HF3A 5F1XA 3BF1A 4RCHA 2Q0RA 3NMUA 2NRHA 3KK7A 3WEEB 4CZFA 4BGAA 2NRRA 3W0LA 1ESVA 3FZLA 3HTVA 1RGIA 3VPZA 3CCLN 1M1KO 4FWMA 4GVEA 4BR5A 2P9LA 1D4XA 3GDQA 3LM2A 4BRDA 1HX1A 3SMSA 2ZGZA 3A5OC 4JK7A 1GLAG 4EHTA 1NGGA 1M90O 2D0PA 4MLHA 4FVUA 4EIAA 1K73O 3G25A 1EO1A 3VERA 4DHYA 2W40A 5LJVA 1YF5L 3CI5A 3EE8A 2ASPA 1BG3A 5FPEA 1ZXOA 2P9SB 1S3XA 2Q2RA 3LL3A 5HL7L 1K9MO 5AQQA 4K42A 5EXWA 1T6DA 2A6AA 2YHWA 3A5MC 1ATSA 3OHRA 4FWKA 3VENA 5H1SQ 1VQPN 5FPDA 2D4WA 3WXLA 4CBWA 3BP8A 5BN8A 4IO9L 3SJHA 2Q0UA 2ZJPL 1VQMN 3ATVA 2GUPA 3ENBA 4O8UA 2YCHA 3CCMN 3WT0A 4AM7A 1VQ9N 4BQZA 4ISEA 1BOTO 4YOUA 4IEEA 4B1YB 1K8AO 2QWQA 3GBTA 3N4QA 4H0XB 4A59A 1NGJA 5DM7L 1YVNA 2V52B 5AQKA 4H5VA 3I55N 1EQYA 2E8AA 5C2FA 4AM6A 1H1VA 2RE2A 1U2VA 3EZWA 3IKMA 1OVYA 4UY8O 2I7PA 5CHIA 3BF3A 5M1PA 3SAHA 5AZIA 3T69A 4Z94A 4EFHA 3ENHA 2HBKA 2KLAA 4GNIA 2GEMA 5AQTA 3H1VX 2QXLA 5AQUA 4BR9A 2VGNA 4YOTA 3LDLA 1YI2N 2OANA 5BR9A 1X3MA 2NRZA 4PL7A 2QWLA 3MN5A 3EN9A 3IUCA 1T3VA 3WUHA 4OO1J 1XUPO 1TUYA 2YHXA 3DXMB 1VQKN 2AP1A 3CIPA 4A5AA 3I33A 2QTDA 3MK6A 1YJ9N 1YHQN 2NNWA 5LJWA 5EX5A 1JCFA 1BA0A 4ILGB 2H3GX 4H5TA 4WYBA 3WQUA 2DPNA 2Q31A 2V7ZA 4YOYA 4JKAA 3QICA 3QDKA 1LOTB 3HRGA 3PIOL 5E84A 3ULEA 2ASOA 3F5TA 1O13A 1YITN 3Q7BA 4B1VA 1IG8A 3O8MA 3CCSN 5AFUA 3GE1A 4BG9A 5AQXA 5TKYA 2UYTA 4ISGA 1IJJA 3D2EA 4IDHA 3L4IA 4IFEA 3QFUA 2IVNA 4KH4A 4A2BA 2E2QA 5AQJA 2FSKA 2YHYA 4F9OA 3IMXA 3CERA 4MDBA 3MWPA 3SMPA 5KPZA 1MA9B 3HM8A 1GLLO 1SS6A 4FSVA 1QQOA 3UKUB 3ZYYX 3F2KA 5AQNA 3DXKA 1P8ZA 5KPRA 2HBJA 4CZEA 4MLEA 1QQMA 3CQYA 3AGRA 3O9RA 3I8BA 3SBGA 3CCUN 3RVCA 2QWNA 4L3QA 5TKWA 3ZETB 1NGHA 1JCGA 3W3DA 4FPBA 4CZLA 3UB5A 4NO7A 2F9WA 3QBXA 5ADXA 3VEXA 3A0IX 4BQLA 3K9JA 3SLCA 3MX5A 3FZFA 3R3LA 3VGLA 1U6ZA 4BRMA 4J8FA 1KXPA 3I56N 5BRFA 2PBDA 4K43A 2HF4A 2ZF5O 3E66A 4ISFA 1KAYA 2PFUA 5EY4A 3CJ9A 1CZAN 4BRLA 1JJ2M 2P9NB 2GELA 2A40A 1GLEG 2QWPA 4ILJA 3TPQA 3TSUA 5M1NA 1JCEA 5AQLA 3VF6A 2GWJA 3WXKA 4U7BA 4BR0A 1WUAA 3GOIA 3LDPA 4HTLA 2QA4N 1TUUA 1VQ4N 1ATNA 3OW2M 3CXCM 5BN9A 3U4LA 5AR0A 4JEPA 2P9IB 1Q81O 5LY3A 1YJWN 1V4TA 1YUWA 4FWOA 4MDAA 1Q7YO 4GV3A 4FOEA 4H5NA 3WXIA 3IDHA 4YOXA 3P38A 3G71N 4JN4A 4WQ5A 4E1JA 3ENOA 4C1NI 4JHDA 3M5RA 2E1YA 3MN7A 4PKIA 3LDNA 1QVFM 3G6EN 4K25A 5BPNA 4JNEA 1NM1A 1MWMA 3HBTA 3MCPA 3O1WA 4BROA 3P31A 1QQNA 3O5BA 5JLFA 1HUXA 3VOVA 3ZETA 4CZHA 1ILYA 5AQWA 2IVPA 3VF4A 3JS6A 4H0PA 1Z05A 2KKZA 4WFNL 4CJ7A 4BC3A 3P4IA 4MO5A 4WQ5C 3KVGA 3WXJA 5C15A 3CD6N 1G99A 5B8HA 5C2DA 3VGMA 2GTDA 5AQSA 3RSEB 4BR2A 3O9UA 1VQ5N 2E2NA 2YJEA 1RFQA 3DAWA 3L4QA 3OA9A 5BRHA 5GAHP 3AGKA 4GV9A 3CETA 2GWKA 3NVMA 2V51B 2WC9A 5BREA 3CJBA 1Q18A 2ASMA 3FE1A 2ZJQL 3EO3A 1K8KA 2IIRA 2P9UA 4JHDB 1E4FT 4PKHA 5ADXH 3D2FA 3HSCA 4BRPA 3CMAN 2BUPA 2FXUA 1XQSC 4FOIA 3UKRB 3VESA 2A41A 5JMVA 3KWIA 1NBWA 2Q36A 3M6GA 1HKCA 3OBWA 3M3ZA 2VCPA 3UKUA 3E9OA 5FPMA 5KQDA 3LDQA 4YOVA 2P9PA 4YDUC 4FWPA 1Z6RA 2F7TA 2J4RA 2IVOA 3D7EO 4WQ4A 3CC2N 4NB4A 3DLLL 1ZBSA 2Q97A 5AZJB 4BRGA 3VF2A 1W2BM 3VEWA 4WCEL 5AQPA 1C0FA 4AF1A 4JKGB 2KHOA 1NWKA 5AQIA 4OPHA 3TSQA 1YJNN 3H6EA 3QFPA 3CJ7A 3ZX2A 2P9UB 4BR4A 3CCRN 4H03B 2JWLA 4FWNA 4BGBA 3M1FA 1DT9A 1NGEA 2QM1A 4A61A 3O9QA 3TSPA 3U9ZA 3CC7N 2NRTA 3EKUA 3R6MA 1HJOA 1HPMA 3C6AA 4JK8A 4B1WB 1VQ7N 3BUZB 1P90A 1VQLN 2NLXA 2P9PB 5AQZA 2E20A 3FZHA 4NLBA 4DKWA 1QHAA 3AAPA 2W41A 2VYPA 2D0OA 1NLVA 2CGKA 4M7YA 1VQ6N 1NGIA 3R8EA 3VTHA 4KH6A 3K9KA 1T6CA 3HI0A 1J6ZA 1R59O 4BC5A 3AAQA 2E1ZA 4JKBA 4FWLA 3HOSA 4H0YB 5F0XA 5KQ8A 4PKGA 1YXQA 4IOAL 4GY2B 3MMVA 3O80A 1NMDA 2QW9A 3N4PA 1LCUA 2NZTA 4DCHA 3IFRA 3C65A 3O9TA 2WUSA 1BDGA 2FF3B 3GG4A 5AQOA 4YDUA 2BH1A 1KQSM 3R9PA 3G4SN 2WFBA 4JD2B 4EAHD 3C7NB 3ZEUA 2P9IA 3A8YA 1BUPA 4H0VB 4XH1A 1NGAA 1NGBA 4BVOA 4A57A 5BPMA 4CBUA 4FO0A 2CGLA 3D6RA 5GIPA 2BTFA 3O6WA 4JKEA 5C10A 1NJIO 3VEOA 3A5NC 4IO8A 2E2PA 3CQXA 5C0YA 5GAGP 4JK9A 4I6MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3V A;  2RE2 A;  1P90 A;  2WFB A;  2YX6 A;  2KLA A;  1RDU A;  1O13 A;  2QTD A;  1EO1 A; 
#chains in the Genus database with same CATH topology
 4G9Z A;  4CZK A;  4FPA A;  4BRE A;  4Z4I A;  3OYG A;  2CH5 A;  3SJJ A;  1HKG A;  2HVH A;  3SAG A;  4FJN A;  3M8R A;  1NK0 A;  1KVB A;  1HLU A;  4IOX A;  2F8S A;  4CZI A;  3CJC A;  4G1Q A;  4RW9 A;  4O5B A;  3QER A;  4CHP A;  3VQ5 A;  3THW A;  4JKG A;  3O1B A;  3PSI A;  3SK3 A;  1N8R O;  3EL2 A;  3U8X A;  4CW7 B;  4I6M A;  2KQ2 A;  3RR7 A;  3VEZ A;  1X9S A;  1BQN A;  1DGK N;  3KLH A;  4EHU A;  1C1C A;  3VEY A;  1BCM A;  1LAW A;  3SBT A;  1NGF A;  3S9H A;  4DV5 K;  4JI4 K;  1Q9X A;  5MLC Q;  2HMP A;  3E01 A;  3HYF A;  3TTF A;  3H1Q A;  2P9S A;  4IEI A;  4DS4 A;  4RW8 A;  4B9L A;  3ZX3 A;  4FJJ A;  5JVH L;  4LH4 A;  4GV6 A;  4C8K A;  2QXF A;  2XHB A;  2KW4 A;  4FZX C;  4O5F A;  3TAQ A;  3WQT A;  2QWM A;  1NK8 A;  2FLO A;  2QEX N;  3CHW A;  3B8A X;  1NKC A;  4IZ9 A;  3KLG A;  3TI0 A;  1A5V A;  4BRH A;  4FK4 A;  1YIJ N;  3D2E B;  4BDY A;  1U48 A;  3KKS A;  4OPK A;  1MWK A;  2WBN A;  3C6H A;  3BDP A;  4B3O A;  3I8D A;  3O3F A;  1VQO N;  4BRQ A;  4O0J A;  4JKF A;  1VSD A;  2A42 A;  2FSN A;  4AH9 A;  1VSF A;  1FXX A;  1TL1 A;  2HHH K;  3R1X A;  5AQR A;  4QS7 A;  2E6L A;  3FFK B;  4M41 A;  4FJ7 A;  1VSJ A;  5F2R A;  4BRF A;  4JKH A;  3QNO A;  1VAZ A;  2NRV A;  3U6F A;  3V9Z A;  1Q82 O;  1XHX A;  5CY4 A;  3AO3 A;  2CGJ A;  5BR8 K;  1BIU A;  4DS5 A;  2O8B A;  1MDU B;  1FKP A;  3CCQ N;  3KWG A;  3OYH A;  3PIP L;  4NCA A;  1RCH A;  5AZI B;  2HBM A;  4IWV A;  1U4B A;  4KRF A;  3T7Z A;  4B9Q A;  4CJK A;  3HK2 A;  3BEX A;  1C0M A;  4J2D A;  1NGD A;  1ZBU A;  3OYI A;  3PLA A;  3VQ4 A;  3KZB A;  3SUQ A;  4FVM A;  4XEI A;  2P51 A;  3PUF A;  3MEC A;  4OPA A;  1DEJ A;  1WSF A;  4YY3 K;  4DR5 K;  4JAX A;  1SZ2 A;  3AO2 A;  5FPN A;  3KLE A;  4DFJ A;  2P9L B;  2W42 A;  3H45 C;  3TTC A;  2HND A;  3MCA B;  4KH5 A;  3VQ6 A;  3M8Q A;  4E19 A;  5J2M A;  3VGK A;  3P39 A;  5CYQ A;  4IJN A;  1TKX A;  1J5E K;  1GLF O;  2ZWH A;  1VQ8 N;  2BDP A;  2PAV A;  1WB9 A;  4BG8 A;  4N41 A;  3MEE A;  4E7K A;  2Z1G A;  5F1X A;  3SUN A;  3NMU A;  2NRH A;  3KK7 A;  4CZF A;  1BI4 A;  3QEV A;  3W0L A;  1ESV A;  3DYA A;  3CCL N;  2PZS A;  3VPZ A;  5LL6 Z;  2UXB K;  1ITG A;  4DSE A;  3LP1 A;  1HJR A;  4GVE A;  1C1A A;  2P9L A;  1D4X A;  3GDQ A;  3TAB A;  1WSG A;  2UUC K;  3A5O C;  4JK7 A;  1GLA G;  1M90 O;  4NCG A;  1T7P A;  1XC9 A;  4DHY A;  3AVM A;  3CI5 A;  2RN2 A;  3EE8 A;  4JI3 K;  2HNY A;  1BG3 A;  3RMD A;  2XY8 A;  2P9S B;  4CJR A;  3LL3 A;  1IBL K;  5AQQ A;  5EXW A;  2A6A A;  3A5M C;  5H1S Q;  4DLG A;  2QKB A;  4JV5 K;  3RMA A;  2D4W A;  3WXL A;  1RT2 A;  1FKO A;  4CJ3 A;  4IO9 L;  3SJH A;  2ZJP L;  3ATV A;  3ENB A;  1QSY A;  4CEC A;  1VK0 A;  4OLB A;  1NGJ A;  2DFH A;  2RE2 A;  3OJU A;  2WOM A;  4GKK K;  4QCL A;  3AVC A;  3BF3 A;  1VSI A;  2DY4 A;  4KKO A;  3ENH A;  2HBK A;  2F96 A;  5AQT A;  2GEM A;  4DSK A;  3WNE A;  4GKJ K;  2VGN A;  2KZZ A;  3LDL A;  1X3M A;  2NRZ A;  1EWQ A;  1OH5 A;  1T3V A;  2FBV A;  2YNG A;  1TUY A;  1HNZ K;  2OPR A;  1RDA A;  2QTD A;  4FW2 A;  3L2Q A;  3MK6 A;  1YHQ N;  5LJW A;  5EX5 A;  4LFC K;  1KLN A;  3ZSV A;  3WQU A;  4YOY A;  3QIC A;  4DTU A;  2UU9 K;  4CEB A;  3PIO L;  1EKE A;  3SQ0 A;  5AFU A;  4KHY A;  3M8S A;  5TKY A;  2UYT A;  1C1B A;  1IJJ A;  1TKT A;  4IDH A;  4IFE A;  3QFU A;  4KH4 A;  4OLA A;  3OYC A;  3CER A;  2YKN A;  4MDB A;  3VQQ A;  4O4G A;  1MA9 B;  3HM8 A;  1SS6 A;  3OYB A;  4B3R K;  5AJ3 K;  4HCC A;  1P8Z A;  2YKM A;  4DFM A;  3LP3 A;  2HBJ A;  4CZE A;  4MLE A;  1VRT A;  4QAG A;  3O9R A;  3I8B A;  3G0Z A;  3PX6 A;  3RVC A;  3S3N A;  3DRR A;  3ZET B;  3VQA A;  4CZL A;  3UB5 A;  3QBX A;  3VEX A;  3A0I X;  1XNQ K;  1EET A;  2PBD A;  4DTP A;  2ZF5 O;  4CJE A;  3E66 A;  1T05 A;  5EY4 A;  1JJ2 M;  3NH2 A;  4HCB A;  1GLE G;  3IAY A;  4I9Q A;  4M3Z A;  3VF6 A;  2GWJ A;  3GOI A;  1TUU A;  1VRU A;  2G8F A;  3OW2 M;  3K58 A;  4JS4 A;  1Q81 O;  2ZQB A;  1W0H A;  3WXI A;  3OYJ A;  4JN4 A;  4C1N I;  3M5R A;  3MN7 A;  3V4I A;  4PKI A;  4CEQ A;  5BPN A;  5E41 A;  1QQN A;  4CEE A;  4CZH A;  2DFF A;  3RMB A;  3VF4 A;  1DTQ A;  4DU1 A;  2HW3 A;  1Z26 A;  4CJ7 A;  2W6K A;  4KTW A;  1HYZ A;  2WON A;  5C15 A;  3AO4 A;  3VGM A;  3O9U A;  1RFQ A;  3DAW A;  4OJR A;  3L4Q A;  4CEZ A;  4GV9 A;  3AGK A;  5BRE A;  2WC9 A;  1U45 A;  3FE1 A;  2ZJQ L;  5ADX H;  2P9U A;  4X65 K;  3V9U A;  3OYF A;  3KK3 A;  4YFU A;  2A41 A;  3DLR A;  2ITG A;  3M3Z A;  3E9O A;  3VQ8 A;  3QNN A;  5KQD A;  3LDQ A;  3EZ5 A;  4FWP A;  1Z6R A;  2J4R A;  3HPO A;  2ZM6 K;  4DR1 K;  3CC2 N;  5AZJ B;  2O8B B;  4MFB A;  1LWC A;  1W2B M;  2D0B A;  3QIP A;  4OX9 K;  3O3H A;  3TR8 A;  4DR2 K;  4F8R A;  4AF1 A;  2KHO A;  5AQI A;  3TSQ A;  3LZI A;  1YJN N;  3H6E A;  4DF8 A;  3CCR N;  4H03 B;  3KD1 E;  3LZJ A;  4W5R A;  4IKF A;  3QIO A;  3R6M A;  3TAR A;  2O8F A;  1QQC A;  3NCI A;  1XHZ A;  2W41 A;  4C8N A;  4N5S A;  4M7Y A;  1VQ6 N;  1NGI A;  2IC3 A;  2HNZ A;  3VTH A;  3K9K A;  3ZT2 A;  1RT3 A;  2HHS A;  1T6C A;  3SV4 A;  4FXD A;  1XMQ K;  4NCB A;  3ZSO A;  4JYA K;  4PKG A;  4IOA L;  4GY2 B;  1NMD A;  4DTN A;  2NZT A;  1XWL A;  3C65 A;  3M8P A;  3VQE A;  2OPS A;  5AQO A;  3L3U A;  4YDU A;  3DLB A;  1RT5 A;  4OGC A;  3PX4 A;  4H0V B;  1NGB A;  4A57 A;  4H4O A;  4FO0 A;  4FJH A;  3ISN C;  2RPI A;  5GIP A;  2BTF A;  4IO8 A;  1ASW A;  3CQX A;  4DWI A;  4FM0 A;  4I6M B;  5LMU K;  3MWT A;  4FLU A;  3QML A;  2KTQ A;  5AQM A;  3C7N A;  2OTL N;  3OBY A;  4H5W A;  4CJF A;  3V1O A;  4CF1 A;  2YNF A;  1VSK A;  2OPP A;  4BVP A;  4BC4 A;  2W6L A;  3O4W A;  4CER A;  4CF9 A;  3CCE N;  2X6S A;  1BWF O;  4HWI A;  4WQ4 C;  4B9V A;  2NRW A;  1SQK A;  1BQM A;  2FBX A;  5AQG A;  5I9E B;  5C12 A;  4DR4 K;  2E2O A;  1FJG K;  1OVQ A;  4FL9 A;  5AFU H;  4IXC A;  3VET A;  1IBM K;  4DB3 A;  4CJS A;  1JLA A;  4CD1 A;  3B6O A;  3J80 O;  3NF6 A;  5ELZ A;  5FLX O;  4QS9 A;  3HJF A;  1HR0 K;  4A62 A;  2GV9 A;  2P9K B;  1RT6 A;  3SUO A;  5J2P A;  2Z1H A;  5JIC A;  2HB5 A;  2VWK A;  4FZY A;  4CGF A;  3JXU A;  2I7N A;  4XH4 A;  1IV0 A;  3MN9 A;  4FLT A;  5HBM A;  4JLH A;  4J2A A;  1A5W A;  2D0A A;  5HRO A;  3DOK A;  4BRK A;  1RTI A;  2JWK A;  1JXE A;  3EE9 A;  3BZK A;  4O8K A;  3CCV N;  1W9H A;  4WF9 L;  5K14 A;  1HKB A;  2P9N A;  3ATU A;  4DG1 A;  2QI2 A;  3DXK B;  3LM9 A;  4IFV A;  3NGI A;  1TK8 A;  5AQF A;  1GOC A;  1RDW X;  1DKG D;  2AA4 A;  3NBP A;  1KFS A;  1RBR A;  1UA0 A;  3SYZ A;  4U67 L;  3CC4 N;  1BO5 O;  4E7I A;  5AQY A;  4CED A;  3OYN A;  2GX9 A;  4CZM A;  1GOB A;  4H4M A;  4LF4 K;  4FWS A;  2B5J A;  4FWR A;  4PL8 A;  3CFP A;  1HMV A;  1HQE A;  1BIS A;  3AVH A;  3NVK A;  3MDQ A;  2F9T A;  1RTJ A;  4J2B A;  4ELT A;  1XI1 A;  4DFP A;  5HRP A;  4DV2 K;  2FC0 A;  3CJ1 A;  3RMC A;  4DMN A;  5KTQ A;  4M63 C;  4DR6 K;  1S6Q A;  1IBK K;  2HOE A;  3EKS A;  2ZJR L;  3TU5 A;  5AQV A;  5KPT A;  4CD3 A;  4HUE A;  3S3O A;  4O55 A;  4YOR A;  1Z25 A;  4IJA A;  3WXM B;  2D1K A;  4DLE A;  1W97 L;  1N36 K;  2HF3 A;  3IS9 A;  5KRT A;  1RGI A;  3MAQ A;  4FWM A;  2O8E A;  1BL3 A;  4FLW A;  4DV6 K;  3LM2 A;  1TV6 A;  4BRD A;  2ZGZ A;  4HHT A;  2P1J A;  1C6V A;  4CJQ A;  3PO5 A;  1KVC A;  3VER A;  3V6D A;  5LJV A;  1HYV A;  1RTD A;  4JI7 K;  2Q2R A;  4FJX A;  5HL7 L;  3KD5 E;  4CJ5 A;  4CHO A;  1S1T A;  4K42 A;  1RIL A;  4FWK A;  3OHR A;  4DU3 A;  1VQP N;  4CBW A;  5KI6 A;  3NGZ A;  4X66 K;  3BGR A;  1S1V A;  2JLE A;  1RDC A;  2YHA A;  4ZHR A;  4CJP A;  4AM7 A;  1VQ9 N;  3KLI A;  1U49 A;  4CIE A;  1NKB A;  4YOU A;  3NE6 A;  2B4J A;  4H5V A;  4LFA K;  3EZW A;  1JL1 A;  1OVY A;  2I7P A;  2YNH A;  5CHI A;  4UY8 O;  5M1P A;  3SAH A;  5AZI A;  3T69 A;  4Z4C A;  4BDZ A;  2O8D B;  1S1X A;  1OH7 A;  2KLA A;  1MU2 A;  4GNI A;  3TAG A;  2Q3S A;  2QXL A;  5AQU A;  1REV A;  3K5L A;  4E1N A;  3HO1 A;  4PL7 A;  1QS4 A;  3MN5 A;  3EN9 A;  3V1Q A;  1ASU A;  3CM5 A;  4CF2 A;  4F3T A;  4A5A A;  2NNW A;  4V19 S;  2H3G X;  4WYB A;  4DSF A;  3SV3 A;  1RBT A;  4CK3 A;  1HNW K;  3ULE A;  4M3Y A;  4Z4F A;  3SQ4 A;  3F5T A;  1YIT N;  1IH7 A;  2AJQ A;  2P5O A;  1LWF A;  1TAQ A;  4O44 A;  3OYA A;  5AQX A;  2Y1I A;  3DLE A;  4ISG A;  3L4I A;  3F9K A;  4F2S A;  3ITH A;  2E2Q A;  2OA8 A;  5AQJ A;  2FSK A;  3AO5 A;  4JI0 K;  4OKK A;  3IMX A;  1WSH A;  1L3S A;  4FSV A;  3UKU B;  3F2K A;  5KPR A;  3CG7 A;  4KV8 A;  1NJX A;  3P1G A;  3THW B;  3LAN A;  1JCG A;  3W3D A;  4LY7 A;  1KFD A;  3ZCM A;  3SLC A;  3MX5 A;  3VGL A;  4J8F A;  1KXP A;  2NUB A;  3EY1 A;  2XY5 A;  4FJI A;  2HF4 A;  3RTV A;  1CZ9 A;  4KI6 A;  4BRL A;  2X6N A;  4ILJ A;  3S3M A;  4FJK A;  5M1N A;  3WNG A;  1JCE A;  5AQL A;  3IRX A;  3WXK A;  3OTO K;  3KTQ A;  1WUA A;  5IWA K;  3LDP A;  4CHQ A;  1JLG A;  3OYD A;  1ATN A;  5AR0 A;  4JEP A;  4FWO A;  4N56 A;  3ZSR A;  1Q7Y O;  4FOE A;  4H5N A;  4CES A;  1VHX A;  3G71 N;  4WQ5 A;  3MED A;  3VQ9 A;  3SNN A;  1J5O A;  1T03 A;  1JLC A;  3LDN A;  1QVF M;  4DQR A;  1NJY A;  1MWM A;  3HBT A;  4CGG A;  1NNE A;  2O4I A;  5AQW A;  5C25 A;  3JS6 A;  3BZC A;  4H0P A;  2KKZ A;  3P4I A;  3WXJ A;  3KVG A;  5SWM A;  3O4Q A;  3O4N A;  4DTJ A;  2B6A A;  3V9W A;  4DR7 K;  3ZT1 A;  3NVM A;  2GWK A;  3SPY A;  3CJB A;  4MQ3 A;  4JHD B;  4NYF A;  4LSN A;  5T7B A;  2BUP A;  1IG9 A;  3AA5 X;  4IFY A;  1XQS C;  3UKR B;  3VES A;  1L3U A;  3LPT A;  4H8K A;  1Q9Y A;  3ZSZ A;  1ZYQ A;  4PA1 A;  3M6G A;  1HKC A;  5JS2 A;  4B9N A;  2FBT A;  4YOV A;  3ZLJ A;  4N76 A;  2G8V A;  4JI5 K;  4W5T A;  4BRG A;  2VG5 A;  4FLV A;  4WCE L;  4CJ4 A;  3C95 A;  5AQP A;  1NWK A;  3WNH A;  5D3G A;  3T1H K;  4BGB A;  3M1F A;  1DT9 A;  4CE9 A;  2G8U A;  3O9Q A;  3U9Z A;  1TK5 A;  1S9G A;  3KJV A;  1HPM A;  3TAP A;  1KRP A;  2NLX A;  1WSI A;  5AQZ A;  3NF7 A;  4FLZ A;  4Z4H A;  4DKW A;  1QHA A;  3NH1 A;  2D0O A;  1NLV A;  1SL1 A;  4RW7 A;  4IG3 A;  1U47 A;  2QKK A;  1E3M A;  4BDP A;  3HI0 A;  1J6Z A;  4BC5 A;  4CK2 A;  2E1Z A;  4FWL A;  3V9X A;  3ZSW A;  3AV9 A;  1RT1 A;  3B6P A;  1WSE A;  1VSM A;  3G10 A;  1BDG A;  4DV3 K;  3GG4 A;  2BH1 A;  1NKE A;  4KTZ A;  2VG6 A;  1UA1 A;  4EAH D;  3C7N B;  1UOC A;  4OKJ A;  1NMN A;  4EP4 A;  2OCE A;  4CBU A;  4FK2 A;  3KK1 A;  4KHN A;  3HPH A;  4DSJ A;  4JKE A;  5C10 A;  4DR3 K;  3VEO A;  5C0Y A;  1EXQ A;  1N33 K;  1KCF A;  2YJF A;  1YT3 A;  1RTH A;  1V4S A;  4JI6 K;  4EZ6 A;  3VMF B;  3L2V A;  4E7H A;  3RRH A;  1J9A A;  3HOT A;  3L0Q A;  1CZB A;  4LF9 K;  4FCY A;  4BRI A;  1GLD G;  1RNH A;  3OYM A;  3LP0 A;  4NLC A;  3C0B A;  1ZC6 A;  5GAE P;  1KAZ A;  4AHV A;  3FLC O;  4C23 A;  3MXJ A;  1O1W A;  4IOC L;  3VTI A;  3OS0 A;  3QBW A;  1VSE A;  1HYS A;  3D0P A;  4K41 A;  3AAR A;  4DTS A;  1HRH A;  1HQU A;  3CME N;  1HNV A;  1TKZ A;  4BR7 A;  2O8F B;  2YX6 A;  3ID6 A;  1S22 A;  2FBY A;  3H08 A;  5M1K A;  1T44 A;  3CFO A;  4JI2 K;  5CR4 A;  1IKW A;  5EVZ A;  1WBD A;  3H3O B;  3FZM A;  2PYL A;  1NK4 A;  3UKR A;  4DQ8 A;  1GLJ O;  4FWQ A;  3FR0 A;  1IKV A;  3E9P A;  1KTQ A;  1SAZ A;  4NYN A;  4BRC A;  1NJW A;  4B1Z A;  3AVA A;  1X3N A;  1QE1 A;  1S9E A;  4E89 A;  4CZJ A;  1BU6 O;  2FSJ A;  4CJW A;  3DRS A;  1ATR A;  1C0G A;  4ELU A;  2QWO A;  3VQB A;  3QEW A;  3O9S A;  3OVN A;  2YI1 A;  3J7A P;  4DQS A;  1VQN N;  4WFB L;  4Y1C A;  4LFB K;  3ULE B;  3D2F B;  1JLE A;  3FZK A;  1GOA A;  4A2A A;  2ETJ A;  4DQI A;  4E7L A;  4B9U A;  2EWS A;  4Y1D A;  2D5R A;  4CI6 A;  2IDO A;  4C8M A;  3VQD A;  3CJA A;  1X9J A;  3ID8 A;  3RSE A;  1S1U A;  2HST A;  1RBU A;  3DJC A;  2I5J A;  2P5G A;  4JKD A;  4CIG A;  1VSL A;  2E88 A;  4DV4 K;  3A5L C;  5GIN A;  4YOW A;  3CF5 L;  1Q86 O;  4LH5 A;  5I42 A;  4Z4E A;  2A3Z A;  3QEX A;  2E5L K;  2Q1N A;  5DM6 L;  5HOO A;  4M7X A;  3LAM A;  2HHW A;  3JAM O;  4ILH A;  2P9K A;  4A5B A;  4CFC A;  1HPZ A;  4CBX A;  2ZE2 A;  2A5X A;  3PY8 A;  3S41 A;  4DTO A;  3BY5 A;  4BRA A;  3V81 A;  4XH5 A;  4KBO A;  3SAF A;  1WOQ A;  5CE3 A;  4CGH A;  3NFA A;  3THY A;  3H46 O;  3AVF A;  4QS8 A;  4BC2 A;  3CCJ N;  4FJ5 A;  4OVL A;  4B8A B;  1BA1 A;  3C94 A;  4AHT A;  4DUY K;  5JS1 A;  1JL2 A;  4PHT X;  1QSS A;  3BF1 A;  4RCH A;  2Q0R A;  1YVU A;  1I39 A;  3D45 A;  2NRR A;  3SQ2 A;  3FZL A;  3AVI A;  3HTV A;  1FK9 A;  4YNQ A;  1TKD A;  4K8Z A;  1HX1 A;  4BWM A;  3SMS A;  3LAL A;  3LP2 A;  3FFI A;  4EHT A;  1NGG A;  3AA4 A;  4CJL A;  3G25 A;  2YNI A;  4CGI A;  2W40 A;  4IBN A;  2KZM A;  2ASP A;  2GBZ A;  1SKW A;  1RDD A;  1Y97 A;  1OH8 A;  4X62 K;  1K9M O;  4HVJ A;  3VEN A;  1KLM A;  2YHW A;  1QSL A;  5BN8 A;  3BP8 A;  3AA3 A;  4KHS A;  1NU0 A;  2O8D A;  2Q0U A;  1UAX A;  2JGU A;  2G8I A;  4O8U A;  3WT0 A;  3OYK A;  3AVG A;  4ISE A;  1BCO A;  2BE2 A;  3K5O A;  4B1Y B;  1K8A O;  2QWQ A;  3GBT A;  3N4Q A;  4A59 A;  5DM7 L;  2BGG A;  1YVN A;  2V52 B;  5AQK A;  3TAF A;  1EQY A;  2E8A A;  1LAV A;  4AM6 A;  5C2F A;  4W5O A;  1CXQ A;  3PSF A;  5KGW A;  3IKM A;  3J81 O;  4DTM A;  4FJ8 A;  4M42 A;  4Z0U A;  3H1V X;  2Z1I A;  1LW0 A;  2YV0 X;  4IDK A;  1YTA A;  4YOT A;  1YI2 N;  4PWD A;  2OAN A;  5I3U A;  3HM9 A;  4B08 A;  1XUP O;  2XY6 A;  2AP1 A;  3CIP A;  3HVR A;  2GUI A;  3I33 A;  1YJ9 N;  3HST B;  4I7F A;  1JCF A;  4ILG B;  1KSP A;  2V7Z A;  4DTR A;  4PUO A;  1SKS A;  3QDK A;  4KPY A;  3HRG A;  2O8E B;  1U04 A;  2O4G A;  1O13 A;  3CYM A;  3Q7B A;  4BAC A;  3LPU A;  4HUG A;  1OH6 A;  4KB1 A;  1SKR A;  1J54 A;  3MWP A;  4LD0 A;  3A2F A;  3SMP A;  3TAN A;  5KPZ A;  1ASV A;  1GLL O;  3ZYY X;  3CQ8 A;  5AQN A;  3LAK A;  1QQM A;  4JS5 A;  3AGR A;  3HP6 A;  4M3R A;  4L3Q A;  2IAJ A;  3VQC A;  4DV7 K;  1NGH A;  1JKH A;  4FPB A;  1YTU A;  4NO7 A;  2F9W A;  5ADX A;  4BQL A;  4BRM A;  5BRF A;  4K43 A;  1N6Q A;  4OGE A;  4ISF A;  1KAY A;  2PFU A;  4CIF A;  1CZA N;  3CFR A;  4KRE A;  4RW6 A;  2GEL A;  2A40 A;  2QWP A;  4CK1 A;  1TGO A;  2OYQ A;  4LF7 K;  1BHL A;  4WE1 A;  4U7B A;  4BR0 A;  3L2W A;  4EZ9 A;  5LMN K;  3OY9 A;  4KHQ A;  2QA4 N;  4E0D A;  4CFA A;  5BN9 A;  3U4L A;  2P9I B;  3HVT A;  1YUW A;  4DV1 K;  4YOX A;  4CEO A;  3DRP A;  4E1J A;  3ENO A;  4FJL A;  4JHD A;  2E1Y A;  5EU7 A;  4ELV A;  4K25 A;  4C8L A;  1NM1 A;  3NHG A;  4BRO A;  2BAN A;  2A1S A;  5JLF A;  1HUX A;  4HTU A;  3ZET A;  4FLX A;  2IVP A;  1J53 A;  2HHQ A;  4GVM A;  4DQQ A;  1Z05 A;  4WFN L;  2LSN A;  4BC3 A;  1WAJ A;  2DFE A;  4B3S K;  4W5Q A;  3TAM A;  5B8H A;  1XNR K;  2GTD A;  1VQ5 N;  1N34 K;  3L8B A;  4RW4 A;  5FRN A;  1TL3 A;  1X9M A;  2O8C A;  3OA9 A;  4CHY A;  1RT7 A;  5BRH A;  4BWJ A;  3CET A;  3V1R A;  1D9F A;  3EO3 A;  1K8K A;  1KVA A;  3D2F A;  3THX A;  3HSC A;  2FXU A;  5JMV A;  3KWI A;  4PQU A;  3OBW A;  3PV8 A;  2VCP A;  2Y1J A;  4YDU C;  3PX0 A;  4FM2 A;  2IVO A;  3D7E O;  2VQE K;  1L3V A;  4K8X A;  3QET A;  2Q97 A;  3SI6 A;  3T3F A;  4FM1 A;  3VF2 A;  1ZBF A;  2EX3 A;  2KFN A;  5HRR A;  1DLO A;  4PY5 A;  4BE1 A;  4JKG B;  3U3Y A;  4OPH A;  3AVK A;  3QFP A;  3ZX2 A;  4YHH K;  2JWL A;  4RG8 A;  1ZBI A;  4A61 A;  1NGE A;  2HHV A;  3CC7 N;  1JXB A;  1WNS A;  2NRT A;  3EKU A;  4QOZ B;  1HJO A;  4JK8 A;  3C6A A;  4B1W B;  1VQ7 N;  3BUZ B;  1P90 A;  2VG7 A;  2E20 A;  4KO0 A;  3K0S A;  4Z4G A;  3K2P A;  4KH6 A;  1R59 O;  4GMJ B;  3HOS A;  5F0X A;  3NGY A;  3O80 A;  3KK2 A;  3EYZ A;  4F4K A;  3IFR A;  2WUS A;  4M3T A;  2FF3 B;  1G15 A;  3R9P A;  2WFB A;  1D8Y A;  4Q5V A;  3ZEU A;  1BUP A;  3J7Y P;  5BPM A;  3SPZ A;  4KFB A;  2CGL A;  4ZTJ A;  3ZSY A;  3O6W A;  3L2U A;  1NJI O;  3A5N C;  4KHU A;  3HT3 A;  5GAG P;  4JK9 A;  3OYL A;  5JVG L;  3OS2 A;  5HRS A;  1T8E A;  3QB0 A;  3WNF A;  1KAX A;  4ICL A;  3WEE A;  2CH6 A;  2E4L A;  4F3O A;  5KGX A;  3GL1 A;  2HMI A;  4CGD A;  4B1U B;  1C0T A;  4AHC A;  3E9L A;  4CZG A;  3UIQ A;  3FGU A;  1LW2 A;  3HZ6 A;  4LF6 K;  5GIO A;  3AY9 A;  1NGC A;  5FRM A;  1CLQ A;  5GAD P;  4CF0 A;  3KKR A;  4TSX A;  5AZJ A;  3HXM A;  4KHP K;  4DF4 A;  4DUZ K;  2ITM A;  4RTF D;  2RHK A;  5M1Q A;  2VGM A;  3C6T A;  3UE5 A;  3L6Q A;  4NXM K;  1QZ5 A;  1QHT A;  3MN6 A;  1JLB A;  5AQH A;  5A2Q O;  5BRD A;  4JI8 K;  4BRN A;  4ZTF A;  4J2E A;  4B8C A;  4R5P A;  2QWR A;  3ZT4 A;  1X9W A;  3KLF A;  1K6Y A;  1S5J A;  3E1Y A;  3F73 A;  1S1W A;  3VQ7 A;  3F9M A;  4LC9 B;  1TK0 A;  5KRS A;  4NXN K;  3NH0 A;  2OTJ N;  1YAG A;  2EHG A;  2ZGY A;  4MO4 A;  5CYM A;  3K57 A;  3RWU A;  1BIZ A;  3NF8 A;  3I0S A;  4H0T B;  1SL2 A;  1BI4 B;  3K5N A;  4BY9 C;  3MX2 A;  4AIL C;  1NK9 A;  5JLH A;  3QEI A;  2RKI A;  4CF8 A;  1GLC G;  2G8W A;  1K8K B;  1RDU A;  4B1X B;  3P5J A;  4H0O A;  1XMO K;  3DI6 A;  3Q7C A;  5E26 A;  5EOY A;  2WTU A;  3J8A A;  3LDO A;  1L3T A;  4L8R B;  1U2V B;  3RRG A;  3EEQ A;  2R7Y A;  3KHY A;  2PYJ A;  4FK0 A;  2E6M A;  3QLH A;  4CJV A;  3ZX0 A;  3CPW M;  3DXM A;  1DTT A;  5M1F A;  2HBL A;  2VQF K;  3ASM A;  2V7Y A;  3VA3 A;  2G8H A;  3DLG A;  2XY7 A;  4RWT A;  2HVI A;  1S72 N;  1WBB A;  2NRX A;  3L2R A;  4Y0W A;  1A5X A;  5HRN A;  2FF6 A;  3T19 A;  1QVG M;  3AVB A;  1OKJ A;  3H3N O;  3VEV A;  1TYQ A;  3CPE A;  3TTD A;  4B9M A;  4CFD A;  5CZ2 A;  3SZ2 A;  1SV5 A;  2F8T A;  1KD1 O;  4FJM A;  1TYQ B;  4R79 A;  1RT4 A;  2IOC A;  2KFZ A;  3DWL A;  1GLB G;  4CJU A;  3LWL A;  2Z1J A;  5M1O A;  1QZ6 A;  4C1N K;  4FYD A;  3ZSX A;  3U9D A;  1B92 A;  3OJS A;  4KI4 A;  1E4G T;  5BPL A;  1RDB A;  1BGX T;  4JRQ A;  4JKC A;  4CVN E;  4H5R A;  3J7Z O;  3ZEU B;  2VWB A;  4JD2 A;  3ALY A;  3ZSQ A;  1XC3 A;  3O08 A;  1Y64 A;  1KC8 O;  4DU4 A;  5C42 A;  4WFA L;  4CHN A;  1HNX K;  4JRP A;  1L5U A;  3AA2 A;  3WEE B;  4IG0 A;  3AVN A;  4BGA A;  4KB0 A;  4FLY A;  3HPG A;  1M1K O;  4BR5 A;  2VWJ A;  3K59 A;  4I9L A;  3VQP A;  2ZD1 A;  4DSI A;  4DFK A;  3MXM A;  2D0P A;  4MLH A;  4FVU A;  4EIA A;  1K73 O;  1EO1 A;  3QEP A;  3NAE A;  1S6P A;  4E7J A;  1YF5 L;  3ZT0 A;  5FPE A;  1ZXO A;  1S3X A;  4DTX A;  1T6D A;  1ATS A;  3MXI A;  5FPD A;  2HHT A;  3L3V A;  5IT9 O;  3O3G A;  3DMJ A;  1VQM N;  2GUP A;  2YCH A;  3CCM N;  3SCX A;  4BQZ A;  1BOT O;  4IEE A;  4H0X B;  3I55 N;  4CHZ A;  5HLF A;  3I0R A;  3VN5 A;  1H1V A;  3DLH A;  1FW6 A;  4M45 A;  1U2V A;  4B9T A;  1WLJ A;  3C6U A;  4Z94 A;  5HP1 A;  4EFH A;  4XIU A;  4UQG A;  4W5N A;  1W7A A;  2F4V K;  1NK5 A;  4BR9 A;  1B9F A;  1F21 A;  3DOL A;  2A1R A;  3THY B;  5BR9 A;  3HP9 A;  4GW6 A;  2X74 A;  3CM6 A;  2QWL A;  4DV0 K;  4E3S A;  3WUH A;  3IUC A;  4OO1 J;  3QES A;  2YHX A;  3DXM B;  1VQK N;  3T1A A;  1ZBL A;  1X1P A;  4FW1 A;  3PO4 A;  3JSM A;  1EP4 A;  4B3M K;  1BA0 A;  4H5T A;  2DPN A;  2Q31 A;  3TAE A;  4JKA A;  4M3U A;  4JI1 K;  4O0I A;  1LOT B;  5E84 A;  3RR8 A;  2ASO A;  4B1V A;  1IG8 A;  3O8M A;  3CCS N;  3NDK A;  3GE1 A;  1IO2 A;  4BG9 A;  3D2E A;  2IVN A;  4A2B A;  1D9D A;  3U3G A;  2YHY A;  4F9O A;  3OYE A;  3AVL A;  1Q8I A;  4N47 A;  2UXD K;  1ZBH A;  1HNI A;  1QQO A;  2UUA K;  3DXK A;  3OS1 A;  3CQY A;  1TAU A;  3CCU N;  3SBG A;  2QWN A;  4CGJ A;  4ID5 A;  5TKW A;  1RBS A;  4LF5 K;  3LWM A;  1N32 K;  3K9J A;  5FDL A;  5FRO A;  3FZF A;  3R3L A;  4EP5 A;  1U6Z A;  3I56 N;  4ID1 A;  3CJ9 A;  3THV A;  4KTQ A;  2P9N B;  3TPQ A;  3TSU A;  4C8O A;  2UUB K;  1LV5 A;  1WAF A;  3QIN A;  2IGI A;  4CEA A;  5DMR A;  1TVR A;  4HTL A;  5SZT A;  4KHW A;  4CFB A;  1N5Y A;  1VQ4 N;  3CXC M;  4OKE A;  2HHX A;  5LY3 A;  2OZS A;  1YJW N;  1V4T A;  4MDA A;  4GV3 A;  3IDH A;  3P38 A;  2OPQ A;  4LSL A;  2D0C A;  1NK6 A;  5CZ1 A;  3G6E N;  4JNE A;  4Q0B A;  3MCP A;  3O1W A;  3P31 A;  3O5B A;  5J2N A;  3VOV A;  1ILY A;  1NJZ A;  1SUQ A;  4X64 K;  3V9S A;  4MO5 A;  4WQ5 C;  3JYT A;  4HUF A;  4DSL A;  3HL8 A;  2RF2 A;  1G99 A;  4FJ9 A;  3CD6 N;  4OPJ A;  5C2D A;  4K0K K;  4I2P A;  5AQS A;  3RSE B;  4BR2 A;  2E2N A;  2YJE A;  5J2Q A;  3LDS A;  5C24 A;  5GAH P;  2V51 B;  3KIO A;  1UWB A;  1Q18 A;  2ASM A;  2IIR A;  4PKH A;  1R0A A;  1E4F T;  4M3W A;  5J1E A;  4BRP A;  3CMA N;  3MEG A;  4FOI A;  3ZT3 A;  1D5A A;  4DQP A;  1NBW A;  2Q36 A;  1VSH A;  1B9D A;  2YHB A;  3UKU A;  5FPM A;  2P9P A;  3IG1 A;  2G8K A;  2QK9 A;  1EWR A;  2F7T A;  4WQ4 A;  4NB4 A;  3P83 D;  3DLL L;  1ZBS A;  1SL0 A;  3AO1 A;  1JLF A;  3QO9 A;  3DM2 A;  4B3T K;  3SUP A;  3VEW A;  2UXC K;  3TWH A;  1IKX A;  1C0F A;  1RBV A;  4AQY K;  2IS3 A;  3CJ7 A;  1WN7 A;  2P9U B;  4BR4 A;  1WSJ A;  4FWN A;  4CCH A;  2QM1 A;  3NF9 A;  2HHU A;  3TSP A;  4CJT A;  4FZZ A;  1VQL N;  1I3A A;  4M3X A;  2P9P B;  3FZH A;  4FJG A;  4NLB A;  4F2R A;  3AAP A;  5DK5 A;  4KAZ A;  2VYP A;  1EX4 A;  2CGK A;  3R8E A;  3SQ1 A;  2PY5 A;  1QTM A;  4B9S A;  3VA0 A;  3AAQ A;  2X78 A;  4JKB A;  2DTU A;  4H0Y B;  5KQ8 A;  1NOY A;  1C0U A;  1LWE A;  4I2Q A;  1YXQ A;  3MMV A;  1JLQ A;  2QW9 A;  3N4P A;  1LCU A;  4DCH A;  2O8C B;  4LF8 K;  3O9T A;  4AHR A;  1I94 K;  1IKY A;  4AHS A;  1KQS M;  3G4S N;  4JD2 B;  3K5M A;  1NOZ A;  4CEF A;  3THX B;  1NK7 A;  2P9I A;  2ATQ A;  3A8Y A;  4AHU A;  4XH1 A;  1NGA A;  4BVO A;  3ULD A;  4E1M A;  1CXU A;  3D6R A;  3T1Y K;  3DLK A;  1NG9 A;  3AVJ A;  4BE0 A;  2E2P A;  2XO7 A;  2OZM A;  2XRI A;  4BE2 A; 
#chains in the Genus database with same CATH homology
 5JVG L;  2YJF A;  4CZK A;  4G9Z A;  3MWT A;  1V4S A;  3QB0 A;  1KAX A;  3QML A;  4FPA A;  5AQM A;  3WEE A;  3C7N A;  3VMF B;  4BRE A;  2OTL N;  2CH6 A;  3OBY A;  4H5W A;  2CH5 A;  4BVP A;  1HKG A;  3GL1 A;  4BC4 A;  3O4W A;  3L0Q A;  3SAG A;  3HOT A;  4HWI A;  1BWF O;  3CCE N;  4WQ4 C;  4B1U B;  2NRW A;  1SQK A;  1HLU A;  4BRI A;  4IOX A;  1GLD G;  3E9L A;  5AQG A;  4CZG A;  4CZI A;  3CJC A;  3FGU A;  5C12 A;  5I9E B;  4NLC A;  2E2O A;  3C0B A;  1ZC6 A;  5GAE P;  3HZ6 A;  1KAZ A;  3FLC O;  4FL9 A;  5AFU H;  4C23 A;  4JKG A;  4IOC L;  4IXC A;  3O1B A;  3VET A;  3VTI A;  3QBW A;  5GIO A;  3AY9 A;  1NGC A;  3SK3 A;  1N8R O;  3EL2 A;  4DB3 A;  3U8X A;  5GAD P;  4K41 A;  3AAR A;  4CD1 A;  5AZJ A;  4I6M A;  5ELZ A;  4QS9 A;  3VEZ A;  3CME N;  4BR7 A;  2ITM A;  4A62 A;  2YX6 A;  3ID6 A;  4RTF D;  1S22 A;  2P9K B;  2RHK A;  1DGK N;  5M1Q A;  2VGM A;  4EHU A;  3UE5 A;  3VEY A;  3L6Q A;  3SBT A;  1QZ5 A;  3MN6 A;  1NGF A;  5M1K A;  5AQH A;  1T44 A;  5JIC A;  5CR4 A;  5EVZ A;  5BRD A;  2HMP A;  3TTF A;  3H3O B;  5MLC Q;  3H1Q A;  2P9S A;  3FZM A;  4IEI A;  4BRN A;  3UKR A;  3ZX3 A;  4DQ8 A;  1GLJ O;  5JVH L;  2QWR A;  4FWQ A;  3FR0 A;  3JXU A;  4GV6 A;  2I7N A;  3E9P A;  4XH4 A;  1SAZ A;  3E1Y A;  4BRC A;  4B1Z A;  3MN9 A;  1X3N A;  3F9M A;  4O5F A;  4LC9 B;  3WQT A;  2QWM A;  2FLO A;  2QEX N;  4CZJ A;  3CHW A;  1BU6 O;  3B8A X;  4IZ9 A;  4BRK A;  2OTJ N;  1YAG A;  2JWK A;  3EE9 A;  2FSJ A;  4BRH A;  4O8K A;  3CCV N;  1ATR A;  2ZGY A;  1C0G A;  4MO4 A;  3D2E B;  2QWO A;  1YIJ N;  4WF9 L;  3O9S A;  1HKB A;  2YI1 A;  3ATU A;  2P9N A;  4H0T B;  1MWK A;  2QI2 A;  2WBN A;  3DXK B;  1VQN N;  3LM9 A;  4WFB L;  3C6H A;  4BY9 C;  3MX2 A;  5JLH A;  3ULE B;  1VQO N;  3D2F B;  1GLC G;  4BRQ A;  3FZK A;  4A2A A;  4JKF A;  5AQF A;  1K8K B;  1RDU A;  2A42 A;  2FSN A;  4B1X B;  2EWS A;  1RDW X;  1DKG D;  4H0O A;  2AA4 A;  3Q7C A;  5EOY A;  3R1X A;  5E26 A;  4QS7 A;  5AQR A;  4CI6 A;  3J8A A;  3LDO A;  1U2V B;  3FFK B;  3KHY A;  4U67 L;  3CJA A;  5F2R A;  1X9J A;  4BRF A;  3ID8 A;  4JKH A;  3RSE A;  3ZX0 A;  3DXM A;  3CPW M;  3CC4 N;  5M1F A;  2HST A;  1VAZ A;  2HBL A;  1BO5 O;  3DJC A;  2NRV A;  5AQY A;  1Q82 O;  4JKD A;  2V7Y A;  2GX9 A;  2CGJ A;  4CZM A;  1MDU B;  4RWT A;  2E88 A;  1S72 N;  3A5L C;  4FWS A;  2NRX A;  5GIN A;  4YOW A;  4Y0W A;  4FWR A;  3CCQ N;  3CF5 L;  4PL8 A;  3KWG A;  1Q86 O;  2FF6 A;  3PIP L;  1QVG M;  5AZI B;  2HBM A;  4IWV A;  1OKJ A;  3T7Z A;  4B9Q A;  3H3N O;  2A3Z A;  3VEV A;  3NVK A;  1TYQ A;  3CPE A;  3TTD A;  3BEX A;  3MDQ A;  2Q1N A;  5DM6 L;  1NGD A;  1KD1 O;  1TYQ B;  4R79 A;  5HOO A;  3PLA A;  2F9T A;  3KZB A;  3DWL A;  4M7X A;  1GLB G;  4XEI A;  4ILH A;  5M1O A;  2P9K A;  4A5B A;  1QZ6 A;  4C1N K;  4OPA A;  4CBX A;  3CJ1 A;  1DEJ A;  2A5X A;  3U9D A;  1E4G T;  3S41 A;  5BPL A;  4JAX A;  4M63 C;  4JKC A;  1SZ2 A;  4BRA A;  5FPN A;  2P9L B;  4H5R A;  3ZEU B;  4XH5 A;  3H45 C;  4KBO A;  3TTC A;  2HOE A;  3J7Z O;  2VWB A;  4JD2 A;  3MCA B;  3SAF A;  3EKS A;  1WOQ A;  1XC3 A;  4KH5 A;  3TU5 A;  5AQV A;  5CE3 A;  2ZJR L;  5KPT A;  3O08 A;  1Y64 A;  3H46 O;  3VGK A;  4CD3 A;  4QS8 A;  4BC2 A;  1KC8 O;  3P39 A;  3CCJ N;  1BA1 A;  4YOR A;  4IJN A;  4WFA L;  1GLF O;  2ZWH A;  4IJA A;  1VQ8 N;  3WXM B;  2D1K A;  2PAV A;  4BG8 A;  1W97 L;  4PHT X;  2HF3 A;  5F1X A;  3BF1 A;  4RCH A;  2Q0R A;  3NMU A;  2NRH A;  3KK7 A;  3WEE B;  4CZF A;  4BGA A;  2NRR A;  3W0L A;  1ESV A;  3FZL A;  3HTV A;  1RGI A;  3VPZ A;  3CCL N;  1M1K O;  4FWM A;  4GVE A;  4BR5 A;  2P9L A;  1D4X A;  3GDQ A;  3LM2 A;  4BRD A;  1HX1 A;  3SMS A;  2ZGZ A;  3A5O C;  4JK7 A;  1GLA G;  4EHT A;  1NGG A;  1M90 O;  2D0P A;  4MLH A;  4FVU A;  4EIA A;  1K73 O;  3G25 A;  1EO1 A;  3VER A;  4DHY A;  2W40 A;  5LJV A;  1YF5 L;  3CI5 A;  3EE8 A;  2ASP A;  1BG3 A;  5FPE A;  1ZXO A;  2P9S B;  1S3X A;  2Q2R A;  3LL3 A;  5HL7 L;  1K9M O;  5AQQ A;  4K42 A;  5EXW A;  1T6D A;  2A6A A;  2YHW A;  3A5M C;  1ATS A;  3OHR A;  4FWK A;  3VEN A;  5H1S Q;  1VQP N;  5FPD A;  2D4W A;  3WXL A;  4CBW A;  3BP8 A;  5BN8 A;  4IO9 L;  3SJH A;  2Q0U A;  2ZJP L;  1VQM N;  3ATV A;  2GUP A;  3ENB A;  4O8U A;  2YCH A;  3CCM N;  3WT0 A;  4AM7 A;  1VQ9 N;  4BQZ A;  4ISE A;  1BOT O;  4YOU A;  4IEE A;  4B1Y B;  1K8A O;  2QWQ A;  3GBT A;  3N4Q A;  4H0X B;  4A59 A;  1NGJ A;  5DM7 L;  1YVN A;  2V52 B;  5AQK A;  4H5V A;  3I55 N;  1EQY A;  2E8A A;  5C2F A;  4AM6 A;  1H1V A;  2RE2 A;  1U2V A;  3EZW A;  3IKM A;  1OVY A;  4UY8 O;  2I7P A;  5CHI A;  3BF3 A;  5M1P A;  3SAH A;  5AZI A;  3T69 A;  4Z94 A;  4EFH A;  3ENH A;  2HBK A;  2KLA A;  4GNI A;  2GEM A;  5AQT A;  3H1V X;  2QXL A;  5AQU A;  4BR9 A;  2VGN A;  4YOT A;  3LDL A;  1YI2 N;  2OAN A;  5BR9 A;  1X3M A;  2NRZ A;  4PL7 A;  2QWL A;  3MN5 A;  3EN9 A;  3IUC A;  1T3V A;  3WUH A;  4OO1 J;  1XUP O;  1TUY A;  2YHX A;  3DXM B;  1VQK N;  2AP1 A;  3CIP A;  4A5A A;  3I33 A;  2QTD A;  3MK6 A;  1YJ9 N;  1YHQ N;  2NNW A;  5LJW A;  5EX5 A;  1JCF A;  1BA0 A;  4ILG B;  2H3G X;  4H5T A;  4WYB A;  3WQU A;  2DPN A;  2Q31 A;  2V7Z A;  4YOY A;  4JKA A;  3QIC A;  3QDK A;  1LOT B;  3HRG A;  3PIO L;  5E84 A;  3ULE A;  2ASO A;  3F5T A;  1O13 A;  1YIT N;  3Q7B A;  4B1V A;  1IG8 A;  3O8M A;  3CCS N;  5AFU A;  3GE1 A;  4BG9 A;  5AQX A;  5TKY A;  2UYT A;  4ISG A;  1IJJ A;  3D2E A;  4IDH A;  3L4I A;  4IFE A;  3QFU A;  2IVN A;  4KH4 A;  4A2B A;  2E2Q A;  5AQJ A;  2FSK A;  2YHY A;  4F9O A;  3IMX A;  3CER A;  4MDB A;  3MWP A;  3SMP A;  5KPZ A;  1MA9 B;  3HM8 A;  1GLL O;  1SS6 A;  4FSV A;  1QQO A;  3UKU B;  3ZYY X;  3F2K A;  5AQN A;  3DXK A;  1P8Z A;  5KPR A;  2HBJ A;  4CZE A;  4MLE A;  1QQM A;  3CQY A;  3AGR A;  3O9R A;  3I8B A;  3SBG A;  3CCU N;  3RVC A;  2QWN A;  4L3Q A;  5TKW A;  3ZET B;  1NGH A;  1JCG A;  3W3D A;  4FPB A;  4CZL A;  3UB5 A;  4NO7 A;  2F9W A;  3QBX A;  5ADX A;  3VEX A;  3A0I X;  4BQL A;  3K9J A;  3SLC A;  3MX5 A;  3FZF A;  3R3L A;  3VGL A;  1U6Z A;  4BRM A;  4J8F A;  1KXP A;  3I56 N;  5BRF A;  2PBD A;  4K43 A;  2HF4 A;  2ZF5 O;  3E66 A;  4ISF A;  1KAY A;  2PFU A;  5EY4 A;  3CJ9 A;  1CZA N;  4BRL A;  1JJ2 M;  2P9N B;  2GEL A;  2A40 A;  1GLE G;  2QWP A;  4ILJ A;  3TPQ A;  3TSU A;  5M1N A;  1JCE A;  5AQL A;  3VF6 A;  2GWJ A;  3WXK A;  4U7B A;  4BR0 A;  1WUA A;  3GOI A;  3LDP A;  4HTL A;  2QA4 N;  1TUU A;  1VQ4 N;  1ATN A;  3OW2 M;  3CXC M;  5BN9 A;  3U4L A;  5AR0 A;  4JEP A;  2P9I B;  1Q81 O;  5LY3 A;  1YJW N;  1V4T A;  1YUW A;  4FWO A;  4MDA A;  1Q7Y O;  4GV3 A;  4FOE A;  4H5N A;  3WXI A;  3IDH A;  4YOX A;  3P38 A;  3G71 N;  4JN4 A;  4WQ5 A;  4E1J A;  3ENO A;  4C1N I;  4JHD A;  3M5R A;  2E1Y A;  3MN7 A;  4PKI A;  3LDN A;  1QVF M;  3G6E N;  4K25 A;  5BPN A;  4JNE A;  1NM1 A;  1MWM A;  3HBT A;  3MCP A;  3O1W A;  4BRO A;  3P31 A;  1QQN A;  3O5B A;  5JLF A;  1HUX A;  3VOV A;  3ZET A;  4CZH A;  1ILY A;  5AQW A;  2IVP A;  3VF4 A;  3JS6 A;  4H0P A;  1Z05 A;  2KKZ A;  4WFN L;  4CJ7 A;  4BC3 A;  3P4I A;  4MO5 A;  4WQ5 C;  3KVG A;  3WXJ A;  5C15 A;  3CD6 N;  1G99 A;  5B8H A;  5C2D A;  3VGM A;  2GTD A;  5AQS A;  3RSE B;  4BR2 A;  3O9U A;  1VQ5 N;  2E2N A;  2YJE A;  1RFQ A;  3DAW A;  3L4Q A;  3OA9 A;  5BRH A;  5GAH P;  3AGK A;  4GV9 A;  3CET A;  2GWK A;  3NVM A;  2V51 B;  2WC9 A;  5BRE A;  3CJB A;  1Q18 A;  2ASM A;  3FE1 A;  2ZJQ L;  3EO3 A;  1K8K A;  2IIR A;  2P9U A;  4JHD B;  1E4F T;  4PKH A;  5ADX H;  3D2F A;  3HSC A;  4BRP A;  3CMA N;  2BUP A;  2FXU A;  1XQS C;  4FOI A;  3UKR B;  3VES A;  2A41 A;  5JMV A;  3KWI A;  1NBW A;  2Q36 A;  3M6G A;  1HKC A;  3OBW A;  3M3Z A;  2VCP A;  3UKU A;  3E9O A;  5FPM A;  5KQD A;  3LDQ A;  4YOV A;  2P9P A;  4YDU C;  4FWP A;  1Z6R A;  2F7T A;  2J4R A;  2IVO A;  3D7E O;  4WQ4 A;  3CC2 N;  4NB4 A;  3DLL L;  1ZBS A;  2Q97 A;  5AZJ B;  4BRG A;  3VF2 A;  1W2B M;  3VEW A;  4WCE L;  5AQP A;  1C0F A;  4AF1 A;  4JKG B;  2KHO A;  1NWK A;  5AQI A;  4OPH A;  3TSQ A;  1YJN N;  3H6E A;  3QFP A;  3CJ7 A;  3ZX2 A;  2P9U B;  4BR4 A;  3CCR N;  4H03 B;  2JWL A;  4FWN A;  4BGB A;  3M1F A;  1DT9 A;  1NGE A;  2QM1 A;  4A61 A;  3O9Q A;  3TSP A;  3U9Z A;  3CC7 N;  2NRT A;  3EKU A;  3R6M A;  1HJO A;  1HPM A;  3C6A A;  4JK8 A;  4B1W B;  1VQ7 N;  3BUZ B;  1P90 A;  1VQL N;  2NLX A;  2P9P B;  5AQZ A;  2E20 A;  3FZH A;  4NLB A;  4DKW A;  1QHA A;  3AAP A;  2W41 A;  2VYP A;  2D0O A;  1NLV A;  2CGK A;  4M7Y A;  1VQ6 N;  1NGI A;  3R8E A;  3VTH A;  4KH6 A;  3K9K A;  1T6C A;  3HI0 A;  1J6Z A;  1R59 O;  4BC5 A;  3AAQ A;  2E1Z A;  4JKB A;  4FWL A;  3HOS A;  4H0Y B;  5F0X A;  5KQ8 A;  4PKG A;  1YXQ A;  4IOA L;  4GY2 B;  3MMV A;  3O80 A;  1NMD A;  2QW9 A;  3N4P A;  1LCU A;  2NZT A;  4DCH A;  3IFR A;  3C65 A;  3O9T A;  2WUS A;  1BDG A;  2FF3 B;  3GG4 A;  5AQO A;  4YDU A;  2BH1 A;  1KQS M;  3R9P A;  3G4S N;  2WFB A;  4JD2 B;  4EAH D;  3C7N B;  3ZEU A;  2P9I A;  3A8Y A;  1BUP A;  4H0V B;  4XH1 A;  1NGA A;  1NGB A;  4BVO A;  4A57 A;  5BPM A;  4CBU A;  4FO0 A;  2CGL A;  3D6R A;  5GIP A;  2BTF A;  3O6W A;  4JKE A;  5C10 A;  1NJI O;  3VEO A;  3A5N C;  4IO8 A;  2E2P A;  3CQX A;  5C0Y A;  5GAG P;  4JK9 A;  4I6M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...