2WFF2

Equine rhinitis a virus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
219
structure length
219
Chain Sequence
DRIETTVVGVTIINSQGSVGTTYCYSKPDGRPPSTVSDPVTRLGPTLSRHYTFKVGEWPHSQSHGHAWICPLPSDKLKKMGSFHEVVKAHHLVKNGWDVVVQVNASFAHSGALCVAAVPEYEHTHEKALKWSELEEPAYTYQQLSVFPHQLLNLRTNSSVHLVMPYIGPGPTTNLTLHNPWTIVILILSELTGPGQTVPVTMSVAPIDAMVNGPLPNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1
publication title Equine Rhinitis a Virus and its Low Ph Empty Particle: Clues Towards an Aphthovirus Entry Mechanism?
pubmed doi rcsb
molecule tags Virus
total genus 25
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2009-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wff200
2WFF1 4YVSA 4CDWB 1COV2 1MQTA 1C8M3 2HWD2 5FMOL 4GH4A 5A32A 4N43C 1CD3G 1ZBE2 2R043 2ZZQA 1RUF2 1X33A 3JD72 1EAH2 1HXS1 2ZAHA 1HRV1 4CDUA 1ND2C 1NA1C 1RUI1 4WM8B 3ZFGC 1R083 5DDJ2 5K0UA 1QJU3 1AL21 1BBT2 1RVF3 3ZFEC 2PLV2 1AR81 1ND3A 5C4WC 2RS31 1PGL2 1NOVA 4CDWA 5BNNA 4Q4X1 2WZR1 1AR91 2Y26A 4QPIB 1RUC1 1WCDJ 1PO23 1PO13 1FMD1 1VRH1 1B35C 1H8TA 1PVC3 5FOJB 2RMU3 4Q4W3 5BNOB 2HWB3 1RUG3 1PGW2 5AC93 1ZBA1 3CJIB 2RS52 2XBO1 4Y5Z0 4CEWC 4N43B 2X5IC 4JGYC 1QJY3 1F8VA 1Z7S3 2WLPA 3VDDC 4QPIA 4RHV1 1ND2B 1NA1B 4PDWA 1TME3 1V9U3 1BMV1 4Q4Y1 1EV11 4YVWC 1RUJ1 2BFUS 2R061 1RUD2 4AEDC 5BNOA 5C4WB 1FOD2 1HRI3 1VBA1 2R072 2RM21 3CJIA 1OOPA 1TMF2 1BEV1 1RUI3 2R041 4N43A 1OPOA 1VBC2 1B35B 4IV3A 1AR83 2RR11 2RS33 3J8F2 1PIV1 1RUH1 1ND2A 1R081 1C8M2 1NA1A 5ACA1 2ZTNA 4Q4X3 5D8AB 2HWE3 2BPA2 1VAKA 4CEWB 5L7OC 1FMD3 4JGYB 5C4WA 1VBD2 1X36A 2VQ0A 3JB4C 4JGZB 1PO11 1ZBA3 1QJU2 1PVC1 1RVF2 2RMU1 4Q4W1 1VBB3 2RS12 1RUG1 4CEYB 4AEDB 5AC91 4QPGC 4RS5A 1RUE3 3VBFB 1VBE3 5D8AA 4RHV3 4FTEA 1QJY1 1Z7S1 4Q4Y3 4Q4V1 1RUJ3 2R063 3NAPB 2DF7A 2HWC3 4GB33 2WS91 1K5MC 4JGZA 1VBA3 1TME1 2RM23 4CDQB 1V9U1 5A33B 1QJX1 1AR62 1BEV3 1IHMA 5ABJA 5L7OB 1DDLA 3TN93 1NCRB 1A6CA 1HRI1 3VBSA 4CEYA 1RHI3 3VBUA 1RUF1 5FMOS 3VBFA 2RR13 4IV1C 1FPN2 4N53C 2WFF2 1PIV3 1RUH3 1AUYA 5ACA3 1AR73 5DDJ1 4NWVA 1AYN3 3NAPA 4GMP1 1AYM1 1PGL1 1HXS2 4CDQA 5JZGC 2HWE1 1POV0 1HRV2 5A33A 5C9AB 1RUI2 1AL22 1NCRA 2GH8A 4Z92B 5CFDC 1R1A1 2RS32 4WM8A 3ZXAC 1ASJ3 1VBB1 2WZR2 1AR92 1D4M1 1RUC2 3ZFFC 1FMD2 1VRH2 2MEV3 1RUE1 1VBE1 3DPRC 4Q4V3 4IV1B 5BNPC 2WS93 1MEC2 5C9AA 4N53B 3ZFGB 3ZFEB 2XBO2 5CFCC 4RQPC 1QJX3 2HWC1 3M8LA 1RMU1 4GB31 1QQP1 1SMVA 1RUF3 1OHFA 1NCQC 3VBHC 1EAH3 4RHV2 4YVSC 1TMF1 1MQTC 3TN91 1RHI1 4GH4C 5DDJ3 1BBT3 1VBC1 1BMV2 4Q4Y2 1EV12 1RUJ2 2R062 2PLV3 5CFDB 4GMP3 1AYM3 4N53A 1AR71 3J8F1 3ZFGA 2RM22 3ZFEA 4CDUC 1BEV2 2X5IB 2R042 1AYN1 5J96B 3ZFFB 1CJDA 5K0UC 1NG0A 5J98B 4FSJA 2GSYA 1GFF2 1RB8G 3VDDB 1ND3C 1VBD1 2RR12 4SBVA 1R1A3 5BNPB 3FBMA 5BNNC 4CDWC 1R082 5ACA2 1B35A 1R091 3JBG1 2RS53 4YVWB 1D4M3 4RQPB 3JB8A 1QJZA 2TBVA 5CFDA 1H8TC 2IZWA 4EJRA 1ASJ1 1NCQB 4RFT0 3VBHB 1PO22 1PO12 4CEWA 4YVSB 2X5IA 2MEV1 3ZFFA 4JGYA 4NWWA 1PVC2 2RMU2 4Q4W2 4RR3C 1NY71 5A32B 4CDXC 2HWB2 3VDDA 1RUG2 1RMU3 1RUD3 1QQP3 5AC92 2HWF1 5BNPA 1COV1 1FOD3 2HWD1 2R073 4QPIC 3IDEA 4YVWA 4RQPA 1TMF3 3VBRC 4PDWC 1QJY2 4AEDA 1ZBE1 1Z7S2 5K0UB 1VBC3 1E57A 4Q4V2 3JD71 1EAH1 1POV3 1NCQA 1HX6A 5BNOC 3VBHA 3LOBA 3S6PA 3J8F3 5BNNB 5C8CC 1TME2 3CJIC 2XPJA 1V9U2 1BBT1 4LLFA 1OOPC 1QJX2 2PLV1 2FZ2A 1HRI2 4QPGB 1H8TB 4IV3C 1W39A 1VBD3 3HAGA 5L7OA 1R093 3JBG3 1AR82 4RR3B 4CDXB 1F2NA 1AL0G 2RS13 1M06G 1K5MB 1PGW1 1AYM2 4Q4X2 2HWE2 2RS51 2WWSA 3VBRB 4PDWB 3VBOC 4QPGA 2BBVA 1R1A2 1ZBA2 2HWF3 4RS5C 1COV3 1MEC1 2HWD3 5C8CB 2BUKA 1VBB2 1C8NA 4WM7C 5D8AC 1D4M2 1OOPB 4RR3A 4CDXA 1AR63 1RUD1 1ZBE3 4FTSA 1RUE2 1FOD1 1K5MA 1VBE2 4BCUA 3JD73 5JZGB 4IV3B 2R071 1FPN3 2BFUL 4JGZC 2WFF3 2FZ1A 3VBRA 1VB2A 4FTBA 1POV1 4IV1A 2HWC2 5ABJC 1RMU2 4GB32 3VBSC 1QQP2 1VBA2 4CEYC 3VBUC 1C8M1 3VBFC 5C8CA 1HXS3 1HRV3 3TN92 5GKAC 1RHI2 3VBOB 1HQNA 1AL23 3DPRB 5JZGA 1PIV2 1RUH2 3NAPC 4RS5B 1AR72 4CDQC 1QJU1 5CFCB 1RVF1 4WM7B 2WZR3 1AR93 1AYN2 1RUC3 2RS11 1NCRC 1VRH3 4WM8C 1MQTB 1MEC3 1PO21 5LK7B 4GMP0 4GH4B 1R092 3JBG2 3VBOA 2XBO3 3DPRA 5ABJB 2HWB1 3VBSB 1ASJ2 3VBUB 4CDUB 5CFCA 1VB4A 2QQPA 5C9AC 1AR61 4WM7A 2MEV2 1NY72 1ND3B 1EV13 1FPN1 2WS92 4Y4YA 2HWF2
chains in the Genus database with same CATH superfamily
4HFSA 1SBFA 4IE4A 3T4VA 5F3EA 1XYOA 4QQ2A 2GH2A 5HPOA 1IG3A 3VDCA 1UIKA 1WA6X 2IXCA 4K40A 5FMOL 3USSA 4BA6A 1W9SA 1IS4A 2CTVA 3TEZA 4LK7A 2VQUA 3IWZA 1ZBE2 4P08A 2GC0A 3J7NA 2W39A 4INDA 1FAYA 2FDFA 2ZGSA 4BWOA 4LEJA 2ZACA 4KQ7A 3GHNA 3Q8AA 4D94A 1HRV1 1ZM1A 4CDUA 5TSWA 5IATA 1U5IA 4BXFA 1NA1C 1UW8A 3WDVA 3O7OA 3ZKYA 3E6CC 1AL21 1RVF3 2JD9A 4BQ5A 4P14A 4G9SB 2FMYA 1AR81 1HLCA 3GNEA 5C4WC 4K20A 5CAZA 4LBLA 1PGL2 4FPYA 1NOVA 2XUMA 3RZJA 2CSGA 1W9TA 3LEMA 1UU5A 4AI9A 5FK7A 5FZ7A 2WZR1 1AR91 2Y26A 4QPIB 3M3QA 4E9KA 3E6DA 1RUC1 1LOAA 1TQ5A 2VZUA 1PO13 3ASIA 2OS2A 5FYTA 4KL1A 3D5OA 1H8TA 1PVC3 5A7WA 1H1MA 3N35A 3AK0A 3WG3A 5B4XA 1J3PA 5FUPA 1I6XA 5BNOB 2QVSB 1EYBA 3B02A 2GNDA 4AE2A 3RWNA 5JMCA 3A23A 2A6ZA 3WQ0A 4OULA 3HN3A 4LE3A 1F8VA 1U5ZA 1Z7S3 5BNQA 3SC7X 1PVXA 3E1F1 5IAXA 1W28A 5HXVA 1F5FA 4YLZA 3ZMNA 2XHNA 4PDWA 5HI0A 4U36A 2GNTA 1CGPA 2JDMA 4QX2A 5E89A 1ALYA 5IVFA 5FPVA 4JHTA 4D6SA 4ASKA 4YVWC 1N47A 1RUJ1 2BFUS 4CP0A 3R4UA 4UW6A 4GD4A 3BTYA 5GLZA 3VD3A 4TN7A 5F1RA 1RXFA 4NO4A 1CN1A 3UK9A 2WNVB 1V6IA 1RINA 1MS3A 1BEV1 1W05A 1RUI3 4N43A 3WLUA 2Y64A 5I8SA 1UYXA 2A3WA 3T2QA 4AVBA 2ZKLA 4AI8A 4ISRA 4B7KA 2VOKA 4LPLA 3I49A 3I59B 4IEOA 5JLVA 1X8MA 2PHRA 2PHDA 4QM9A 4JRAA 5FP7A 2JE9A 4B3NA 4ATFA 5JR2A 3I2FA 4IXLA 4DUXA 1BJQA 2VTFA 4OI1A 3NMBA 1FMD3 3VD7A 2D7FA 4AAPA 1W2UA 5FZAA 2GP5A 1W6OB 3DUIA 1A8DA 4XQDA 4UI9L 3INAA 3J7LA 4LMFA 4NMIA 2I2SA 4R9CA 2WQ8A 2VQ0A 3OUIA 1HN0A 4PLNA 5A1FA 1Y4WA 1PO11 2OX0A 2XJQA 4IGQA 4E2GA 4IW3A 1PVC1 1RVF2 5JOYA 4I0AA 1UKGA 4YW1A 1W8TA 2OPKA 3OBTA 1VBB3 1O8PA 2B4KA 1XYNA 2JDZA 3P5BA 1DU3D 5JXIA 5IW0A 4D6RA 2O14A 2E9QA 3FL7A 1IG0A 4KNCA 2ZHLA 4N9IA 1GZWB 2OQ7A 1RUE3 4MVTA 4P9IA 3VBFB 2YPJA 4UYBA 2WO1A 5IAVA 3RSJA 3MW3A 2VNRA 5D8AA 3HIFA 2VZ3A 4JQRA 5IVBA 4FTEA 1V00A 1YXWA 3PJYA 5EZWA 4ZU4A 1Z7S1 1GZCA 1W2AX 2W46A 4YG6A 3MIFA 2AENA 2ZGLA 4Q4V1 3AC0A 1KDMA 4IEXA 2R063 5FYBA 2C0ZA 3VB9A 1LOCA 1LOGA 3AKRA 3D4KA 4I3PA 4FAHA 3DYMA 4GB33 1VBA3 2C5DA 3AM2A 4DEQA 2RM23 4CUAA 2P5BA 1GQGA 1UO9A 4PI2A 3BCWA 1CJPA 4XFHA 3LPFA 1Y43B 2LW8A 2H0VA 2ZGMA 2PAKA 2ZX3A 2JECA 3O0VA 5FMOS 3WT3A 4A7KA 3RZKA 1FPN2 2UWAA 3H1MA 3M2MA 3LA3A 3MI8A 4R52A 3I8TA 2BVVA 3LSDA 5DZFA 2G4IA 2Q8DA 5F3CA 2ZEWA 2XKOA 2W87A 1AR73 1WBLA 4QQLA 3HBZA 1WLTA 4NR1A 2YB7A 3FFQA 2VG9A 1X50A 2DVFA 2FCUA 5KHJA 4BM8A 1POQA 4YGEA 3VD4A 1EPWA 1H2MA 1S0GA 5DMYA 1JZ2A 2WNUC 3U75A 2ZMKA 1HXS2 1ODMA 1RXGA 5F8PA 2G9FA 3C7FA 2Z79A 1QDCA 1LECA 3ZYFA 1RUI2 4Q1RA 3ZN5A 5A3WA 4NVPA 2WLQA 2Y6KA 3CJXA 2Y8KA 4HETA 3WHUA 3NNFA 1JH5A 2MNGA 2LROA 1K45A 4P9GA 3ZSKA 4CP9A 1JZ5A 4IGPA 3IDAA 4TXWA 1OT5A 4D3WA 1QGLA 5HCFA 5IK4A 1S55A 3AKSA 1I9RA 5JI7A 1F15A 2W2IA 1VBB1 3HVDA 4KBZA 1S0EA 4XILA 4TLGA 2WN2A 1FMD2 3KT4A 1ZZBA 2DBIA 1QJFA 2QQMA 4YW6A 3ZYRA 2XJTA 1RUE1 1ZZ7A 3DPRC 3FUOA 4IQPA 3KGZA 1W9FA 3L9JT 4AL9A 3DF0A 4OHVA 3IM0A 2JG8B 4NPRA 5C9AA 2EICA 1U0AA 5FP9A 3W21A 3ZFGB 1PK6B 1DZQA 4XE9A 3L2HA 4D7SA 3POSA 1F35A 4XXAA 4Y4RA 2Y60A 4GXLA 4LBQD 4RQPC 4E4HA 1QJX3 1ZZCA 1S0DA 4Q29A 4TWTA 1OPMA 4GB31 5C33A 1I5ZA 3AVSA 1XNCA 1OHFA 2D98A 2YFZA 3N9OA 1YJKA 3ZN6B 5J7MA 1VIWB 1DQ4A 3THPA 3AL6A 3CZUA 2UU8A 4YVSC 2YU1A 2ORXA 2VCBA 3N7MA 1MQTC 1MZEA 1RGSA 2DU0A 4YZ4A 3GCXA 4BU2A 3AKQA 3C3VA 4BPZA 4KWLA 1VBC1 4L8QA 5FZ3A 2R062 1VAVA 2WFPA 5A1LA 4L9BA 2JIGA 3VL8A 3MFAA 3LCPA 5FJKA 4N53A 2VQTA 1AR71 2OVUA 4P02B 5T5OA 2RM22 3IIAA 1E5IA 1OLME 2HBUA 3RI8A 3ZFEA 3HWJA 3H7JA 1Z0HA 3MICA 4BXSV 2C9KA 2Z5WA 3CKHA 4ZU5A 1D2SA 4XFIA 3GHMA 5J96B 1S0IA 5K0UC 3A22A 1NG0A 3O5SA 5IVCA 4X6QB 2VMIA 3P1IA 4LBQB 3C7GA 5FZIA 1H2LA 2GSYA 4FSJA 4CSWA 2WNVA 1ND3C 1W6PB 4QGNA 4XHXA 3VDDB 1Q8VA 4SBVA 3OPZA 4XCBA 1ULOA 2ZEZA 4N7UA 4XDOA 5FZKA 5BNPB 4L0PA 3NV2A 3ORJA 4BH9A 1R082 4Q8LA 4EE2A 1LULA 3AFKA 5L9RA 5IK8A 1YJLA 4NOTA 1D4M3 3NJZA 1O59A 5A3MA 2TBVA 2X29A 5CFDA 3WZ1A 1CONA 4CXYA 2HEWF 1MS8A 4AYUA 5HCBA 5A3OA 2W91A 4XF0A 5IFTA 1NCQB 1PZ9A 3HOBA 3HQXA 1CVNA 2C9AA 4K21A 1LHWA 4RFT0 3VBHB 2PHXA 3JU9A 4CEWA 4N9HA 3ITQA 3RS6A 1W6MA 2CDOA 4JTOA 4LKFA 2YV8A 3POYA 4NROA 4RR3C 5A32B 4CDXC 3H9AA 4YG3A 1VR3A 5FZDA 4DOUA 2FDHA 1AJOA 2ZA9A 3BPSA 5AC92 1JZ8A 1COV1 4J6GA 4EZHA 2XMLA 5LEKA 4BQYA 1BXHA 4LHSA 1ULPA 1KS4A 3I2DA 4QPIC 3PU3A 1N1VA 4PIYA 1MR5A 3VDBA 4M3CF 2PHLA 3LF7A 4AG4A 1GZWA 1QWRA 4LOTA 4CUGA 3JD71 3NV1A 4WZFA 4K3UA 4PLMA 5T5LA 2VMHA 3RPQA 5J3UA 4XBNA 3LOBA 3S6PA 2HJIA 1JXNA 1QHDA 3J8F3 4A3ZA 1QKQA 1Y3TA 5C8CC 4DXRA 5KC6A 1V9U2 4Y20B 4YGBA 4LLFA 4YZ5A 2WBKA 1U5YA 1OOPC 3AMMA 1QJX2 4MGSA 5FZHA 2W08A 2VECA 3MLLA 3ROUA 1OQEA 1Q5OA 3ZN4A 1AXYA 2E7QA 2ZXQA 1H0BA 1N3QA 4IV3C 4K8RB 3CU7A 2R16A 1KJRA 1SHWB 3HAGA 3NQHA 1H2KA 1YEWA 5JSPA 5KXEA 4HKWA 5KXCA 3LEIA 2OZ6A 3OSDA 1H30A 1H8VA 2RG4A 1R093 1SDDB 3JBG3 4I02A 5FYCA 3VGIA 2O8OA 3PVEA 1OA4A 3GM8A 1I3HA 1F2NA 5FMBA 2O0OA 5FZOB 2CDPA 2VUCA 2RS13 1LGNA 5E16A 1DGLA 2BGOA 2ET7A 4Q4X2 1YUDA 2GN7A 3ATGA 4LULA 2GZWA 2HWE2 4BLJA 1YQ5A 1WMXA 1YYNA 2WJSA 2KD7A 4H14A 2VCCA 1ZX5A 2SLIA 2BERA 4KG0A 4KWKA 3L2YA 3I2JA 4GAZA 4GWNA 3VBRB 4DPNA 1AHSA 3VBOC 4QX1A 4HK9A 4QPGA 4HONA 1W0NA 4CXXA 1PMHX 3DV8A 1JBCA 3MF6A 3SCFA 4ZZ5A 1N3OA 2JDHA 5EV7A 2EIBA 4C91A 1ZBA2 2HBTA 2YYOA 1AJKA 2HWD3 1YO8A 5LBFA 2VNVA 3KSCA 3QOPA 1SLLA 4A6SA 2C6SA 1URXA 1WMDA 3ACHA 1OLRA 1VMHA 2R32A 2PN5A 4I09A 3VD5A 1D4M2 2J1UA 1DQ6A 1LR5A 2DTWA 3GALA 4PBOA 4YM0A 4URAA 4NAOA 3WW4A 3T3YA 1XU2A 3I3EA 4XEZA 2P17A 1TNFA 5A6ZA 4BCUA 1UY2A 4R9BA 2GAUA 5JZGB 4TSVA 3PUSA 2JG9C 2LS6A 4L99A 4UOJA 4WZCA 1IPKA 3Q8FA 1GANA 1KJLA 4AVSA 3RI9A 4YGCA 2WFF3 4AHZA 1C4RA 1SLAA 1WGPA 4CVUA 4FTBA 4BQ4A 1RUNA 3HQRA 2HWC2 4IE5A 4EWAA 5ABJC 3VBSC 1G6NA 1O3QA 5LB6A 1WMEA 3UYJA 2VZOA 2D3RA 1PGSA 3VBFC 3FMGA 4HN1A 5DG1A 4CPBA 4X6RB 4E8DA 3OGSA 4AR2A 5KC5A 1ZREA 5GLTA 4GKXA 4D7TA 3OY8B 4N8MA 3WG4A 3FC0A 4MSVA 1R64A 5HCHA 4DRRA 2R6QA 2ZHNA 4E4SA 3TEYA 1HQNA 4HANA 1WLDA 4NIGA 3Q8BA 3R4DB 2CGOA 4P00B 2FQPA 4XUQA 1PIV2 2AH2A 4W6YA 4PCRA 5LA9A 2Y6HA 3I3MA 2V09A 3QH7A 1QDOA 2PHWA 1HDKA 1L7RA 2P34A 3CZJA 1I5PA 4Q0PA 4BLIA 4MHRA 1NXD1 5CFCB 5LASA 4JDOA 5JIUA 4W6XA 3GGLA 1PZ7A 1BVVA 1HKDA 1NLSA 5FZ8A 1AYN2 2RS11 4ES9A 3M3OA 1GICA 3WF0A 4YM3A 3ZSEA 2VBDA 4HMZA 3ZYPA 1YI9A 3H8UA 3UGHA 5LRSA 2Y34A 2ZGRA 1WW6A 1XNTA 4HSJA 5EYXA 3ZR6A 1MEC3 4GMP0 4YW4A 3WHTA 4LBQA 3T30A 1R092 3JBG2 1QF3A 2XBO3 4URTA 2R1BA 4JX0A 4WV8A 4XHBA 1F5JA 4YZ1A 1UXZA 3UKNA 4YG0A 3KMHA 2H0BA 3RZZA 1WMFA 4CDUB 4O7XA 1OUSA 3DXTA 3MPBA 3SEEA 2QQPA 4JCKA 2PQQA 1LJ7A 2VBBA 4S2FA 3IMNA 1PX3A 1JTZX 1W6QA 2WUHA 1ZNPA 3M4FA 1LU1A 3OG2A 1H1IA 2PQSA 1S2EA 3ILNA 3KF5A 1VAMA 1YFWA 4JC1A 4M0NA 2V73A 5FBJA 4UFKA 2QQUA 4JKMA 5SV8A 3T08A 1J84A 1ONAA 1ZA7A 2ZX2A 2WS92 3B00A 3OD0A 2YGLA 2TUNA 4OLLA 1CAWB 5T55A 4L11A 2WFF1 3UJOA 4CE8A 2RDRA 4ET7A 2HWD2 1C8M3 5EJ3A 3AP5A 2IC1A 5E88A 1XQNA 1REFA 5A32A 4Y22A 4XVHA 1W90A 4NUBA 1CR7A 2XJSA 4CCNA 4G3YC 4K6BA 2VUAA 2R043 1UOJA 1YIFA 1MS5A 1RUF2 2ILMA 3GZUC 3QD6A 3ZMOA 4A7ZA 1XB9A 3NV4A 1EAH2 3V0BA 2ZAHA 3AYEA 4TLFA 1LODA 4QQPA 4FPHA 3TAYA 3N7LA 2OT7A 1ND2C 2XONA 4ATEA 1V6NA 2DVAA 2UYAA 1W6NA 2DVGA 1AZDA 2I74A 4DY3A 2J1AA 3ZFGC 4FPFA 3FHIB 1LHUA 4EWDA 3OF1A 2JDKA 1IZ3A 5DDJ2 1BBT2 3DKQA 2WA3A 2A6VA 4KWJA 1V0AA 4LO5B 2F17A 4Q0SA 5F7UA 3W58A 1LKNA 2IXJA 3NNLA 4CDWA 1KDKA 2VY0A 1D2QA 2VZSA 5T54A 3ZXLA 2ENRA 1IS3A 2GMPA 2QFEA 2VJXA 3I54A 3HNMA 1PO23 1UU4A 5FLHA 4QHZA 3PNAA 3WF4A 1B35C 2VZQA 5A70A 3MGUA 2JEMA 4KG8A 4A44A 3NWKA 2RMU3 1W3XA 5LBCA 5DAQA 3RRDA 1DYOA 1LGCA 1Q8QA 2HWB3 1RUG3 3O14A 4OMDA 4KMQA 1PGW2 2W52A 4XMIA 3C7OA 1XXNA 2XBO1 1V6LA 4MV2A 4N43B 5FZOA 1JHJA 3LA2A 5H9PA 2J42A 2OXBA 5LA0A 4JGYC 1QJY3 4O61A 5IVYA 2XQRA 4BQ1A 1F9KA 5L9BA 1DQ2A 1TVGA 2OPWA 3VDDC 1G9AA 5FPUA 3N7JA 4IGOA 4MO3M 4DRVA 5FY1A 4RHV1 4K7JA 2V5YA 3AX4A 4LK6A 3SITA 3ZSLA 4GWJA 2GP3A 1Q56A 1TME3 3LA7A 5FPXA 1PX4A 1XPWA 5FIXA 2QQIA 2AEZA 4Q4Y1 2WO2A 2PMWB 5CKQA 1RUD2 4DMIA 4AEDC 3M1HA 3HEIA 4AW7A 2PYTA 5FRAA 3Q9OA 4XBQA 3CJIA 2FDIA 3BOWA 3ZXGA 1E5HA 1TMF2 1LHVA 2ZGQA 3R0RA 4XFGA 2R041 1UN1A 4YM1A 5LZ6A 1RJ7A 2ET1A 2VUDA 5FWJA 1H2NA 3WP3A 4QX8A 1AR83 3WCSA 1YCIA 1N1YA 1J3QA 2RR11 5DABA 4QWNA 3RMYA 1RUH1 3FN9A 1OQDA 3WD5A 4TTGA 1W8WA 1C8M2 1NA1A 3ECQA 5LY1A 4EQVA 4Q5OA 5JPNB 5D8AB 3A21A 1OLQA 2BPA2 2YMZA 4NIAA 2CGNA 2BNMA 1SLTA 3BIEA 2ZGKA 3H0OA 5JIAA 3IN9A 5C4WA 4DINB 1VBD2 5JUVA 3AKTA 3NJYA 2C26A 4J1WA 5DUVA 1DQ0A 3OJBA 1W99A 3JB4C 1O91A 4K1YA 3EO6A 5BUVA 3LSEA 2PA7A 3PUHA 2P6CA 4N7IA 1UD1A 3KWVA 3RZLA 3FLPA 1S1AA 2RMU1 4Y1YA 4MGTA 4YW7A 1APNA 3E97A 1RUG1 3I7DA 4AXOA 5KXDA 3WF1A 3H42B 2QKDA 4KI5M 1UZVA 5IHRA 4DUVA 3U0ZA 2EAKA 1H9WA 4UBGA 3U11A 4CEWB 2ADDA 3VN4A 1GQHA 2RJLA 4OZXA 3ALQA 3AVRA 3IKWA 1OFNA 1QJY1 2P3JA 1CZTA 3TNPB 4HZFA 4IE7A 2WABA 2E26A 1VRBA 1RUJ3 2A70A 3K3OA 2DF7A 4DQAA 1QOSA 1DZTA 1FT9A 1GNHA 2ADEA 3IIIA 4JGZA 1NZCA 3N4MA 3ZYJB 2XLGA 5C8WA 4BQ2A 3ZX7A 1TME1 4BHPA 1ACCA 4NHMA 4EYUA 4GA9A 4YZ2A 1C1FA 3VZLA 1OKQA 2D43A 1DHKB 1IS5A 5FY9A 1BEV3 1IHMA 2BP6A 4E2QA 1OXCA 3SH5A 5L7OB 3RQ0A 3TN93 1JYCA 4CEYA 3PIJA 1RHI3 2XB6C 2W92A 4LKSA 2EXKA 3OBRA 2A73B 4AOCA 4IV1C 1L7QA 4QXBA 3VKFC 4CP9B 2AZ5A 2XL7A 2XOMA 1SBDA 3W5MA 4ZZ8A 2VMDA 3PIGA 4M3CE 4YZ3A 2R30A 1ZA4A 2F4PA 4LNVA 2BWAA 1AX2A 2P6HA 5A1AA 4AWDA 4IERA 1YC61 4CCLA 3MIBA 1D7PM 1OA3A 4NWVA 4XFAA 1CAWA 3NAPA 4GMP1 1WKYA 4QGLA 4COZA 4CCCA 4S2HA 4OHZA 1PGL1 1UYPA 5JZGC 4CDQA 1POV0 1HRV2 3POJA 4ZS2A 4LIVA 5A33A 5C9AB 5BY5A 3NSTA 2ARBA 1Z78A 1CIWA 4LXLA 5LW9A 1AL22 4Z92B 3B5LB 5H9RA 5JDBA 2YROA 2Y6JA 2Q4SA 3WV6A 4AI3A 3RJRA 4O65A 2XWBB 5AVAA 5C6CA 1NE6A 2WZPP 3ZXDA 3JQWA 1ZZ8A 1FX5A 2X10A 2JWPA 3PLQA 2WZR2 1AR92 5A3UA 3PUQA 3WEZA 1RUC2 5F2WA 2R7EB 3T2OA 3ZFFC 3ZPOA 3GF6A 2Q1MA 4AHWA 1ZRDA 1D0HA 3K2OA 4AQTA 3I97A 3ZYBA 4Q4V3 4ZS3A 3I2HA 5BXXA 3MDPA 1HV0A 2A1XA 3SNMA 4AHYA 1HB1A 3P3NA 2W9XA 3UL2A 4N53B 2VOXA 1WA4A 3IBMA 3N9QA 3ZFEB 3EXUA 1ULCA 3OPTA 3PL0A 4V1PA 2VNOA 5CFCC 1OFSA 4LLOA 1GOGA 2JDAA 2OZJA 1R1ZA 1J58A 4JHZA 1OF4A 2HYKA 1VE0A 1RMU1 1QQP1 4K8FA 5B4NA 2JDPA 2YGMA 2JE8A 4HVOA 3ZM8A 4IEZA 4DZGA 5JCTA 3CHXA 2JX9A 1TZOA 3DL3A 4PQ9A 5GLUA 5I8TA 2GDFA 4AAXA 3TN91 2GALA 4RYDA 2D5HA 1RHI1 2W94A 1G8WA 1WW5A 2UWBA 4WVMA 1SZBA 4CU8A 5J48A 2K0GA 1RUJ2 4HL0A 2W47A 5CFDB 2PLV3 3POEA 5DN2A 5FP3A 2G19A 4N90A 5CG9A 3KT1A 3RG0A 4NHLA 5CB7A 4XC9A 3WNMA 3PUIA 4YNIA 4P9XA 4Y5TA 2D5FA 2MPFA 4FOYA 4BIFA 4CDUC 1V6MA 4AEKA 1DGWX 1CAUA 2OUHA 1BEV2 2CAUA 3CQOA 1QH7A 1W6MB 2D97A 2JDYA 3C8XA 2E53A 2GMEA 3RNSA 5IYYA 2DBNA 5A6YA 4BDVB 5J1XA 1GFF2 3QH6A 5JI9A 1W8OA 3FFZA 4L97A 4Y33A 2J1RA 4XACA 1XE0A 3AJYA 1U12A 2X53S 3ZLIA 1O4YA 4H55A 1SFNA 4LBOA 3VHOA 3ZYIB 2RS53 4MGZE 4CUBA 4U2AA 3JB8A 3SH4A 4AFCA 2HKXA 5AFBA 2WDBA 4LORA 5FFOC 3S5QA 4IE0A 4LJHA 1H8TC 2IZWA 2YHJA 2L9LA 1C28A 1A8MA 1T6BX 3VKNA 3JQXA 3AP9A 1GUIA 1PO12 3FBYA 5FYYA 2X5IA 1PM7A 2PHTA 2A71A 4P5HA 5HV0A 4NWWA 1PVC2 3VHPA 2VOVA 1Q8PA 3LPGA 2QQWA 3T1LA 2EF6A 5FZ9A 4A3XA 4MOAA 3I3BA 4M01A 2QZ3A 4LQRA 4COWA 1WLWA 1FOD3 1NT0A 5A7QA 1DQ1A 2R073 4LKDA 4C0BA 4AK3A 1DBNA 3DYOA 4S2DA 2ARCA 4RQPA 3LQCA 2QDNA 1O5UA 1OH4A 4PDWC 1JOBA 1Z7S2 3BTXA 2LRPA 2WZ8A 3E5UA 2QUOA 1VBC3 4PQQA 3POIA 3LEKA 3LFMA 3F95A 1FYUA 1UU6A 3LZZA 4Q4V2 4QQOA 3TYJA 1POV3 3ZOIA 5GZCA 2ORZA 5F32A 4IETA 4EN7B 2RV9A 5I93A 1OMIA 2J1EA 4GJYA 2B42B 4MXWA 5BNNB 2IXKA 2AYHA 2XPJA 1YI7A 3GZEA 1JOPA 2NMOA 4D7YA 2XJUA 2XUEA 2PLV1 2IUWA 1GP6A 3A0NA 3VZOA 1LB2A 3UGFA 1JZ7A 4QPGB 3KGLA 2FCTA 2JDNA 2K9ZA 4D0QA 5SV5A 3BU0A 5FZ6A 2YZ4A 3SQOA 3I4IA 3SKJE 1AXZA 1TE1B 3BGAA 5F5IA 4CPBD 4ZONA 3F2ZA 2W95A 5B2GB 4HT1T 4NE9A 3A4UA 5L7OA 1OLMA 2JKXA 1CZVA 1L7LA 3B01A 5FKCA 2EXJA 1SPPB 4RD7A 2WO3A 5T5PA 4ARYA 3D3AA 4FPCA 1KEXA 2IVIB 4AFMA 3AKPA 5HCAA 3KHBA 1O6UA 4UFHA 1NX9A 1H4GA 2DCJA 2A6YA 2KM2A 4B29A 4XF1A 2ID4A 1OD3A 5LK5A 3X29B 5F2SA 2ZZJA 2CHHA 2RS51 2WWSA 1Q8OA 3CDZB 4LR4A 4R4XA 3AZWA 4WVVA 4IE6A 2OW4A 4HOOA 4MYEA 4UT5A 4QM8A 2JD4A 2UY8A 3DN7A 4LUKA 2G1MA 4GIQA 5HV4A 5K8SA 3U37A 3NRUA 4LO7A 2BBVA 1X9PA 3SKVA 1W2OA 1KFUL 2XJVA 4PF1A 2E7AA 2QQLA 5LCWL 2A3YA 1VALA 5FP8A 4I0WB 2YU2A 4QDQA 3VZKA 1VLNA 1COV3 5JMOA 4TZDA 3GZAA 2XLFA 3H50A 2BUKA 4QGMA 4Q27A 4QB1A 5ANNA 3RGBA 3SXWA 4S2GA 3THCA 1VBB2 3WG1A 5FWEA 1C8NA 1ULGA 4WM7C 5D8AC 3SISA 1MS4A 1QU0A 2A6XA 4RR3A 4CDXA 1AR63 4YARA 3T0BA 2VBPA 3AYAA 4NAMA 4FTSA 1RUE2 1FOD1 2FHRA 1K5MA 1RITA 3B3QE 5FCCA 5FV3A 3JD73 1JUIA 1QOOA 3VV1A 4B1MA 2R071 2VZTA 1YFUA 5C7GA 4YM2A 1XYPA 3WDYA 1YQ6A 3D6EA 3LFIA 1HN1A 4CU7A 1YQ2A 5F39A 4Y1UA 3PURA 4OHWA 2Y38A 1ZZ6A 5ISLA 2WA4A 1RL3A 3W5NA 4NRQA 4XJUA 1VB2A 1F31A 1POV1 3VLBB 3GXUA 1H4HA 4XJ9A 4Q8KA 3WW1A 4FP2A 3N9LA 4GB32 1NLQA 2IWGB 3PDQA 1VBA2 4OYUA 1UIJA 1LOFC 5C8CA 2B45X 5A3LA 2Z4FA 1AXKA 4XTMA 3RZHA 2Y6GA 1SBEA 4QDSA 1GR3A 1UY1A 3B69A 4BB3A 5EJZB 5FXXA 1CAXA 1GYKA 3OGGA 3AMQA 3LIGA 2DFBA 3K4ZA 3O0WA 2OUJA 3J9SA 4MGQA 4HPKB 4AGGA 2WNOA 2XQXA 2G9GA 1QNYA 1A3KA 1W04A 1ZVFA 5D2AA 3ETPA 4RS5B 1AR72 5FLJA 4XJAA 4XZUG 2XL9A 2YBSA 1QJU1 3SLIA 4EN6B 3NW4A 3SEPA 2WL1A 2VMGA 5GZGA 1FXZA 2A75A 4CTEA 1S0JA 1W6QB 1J59A 3POGA 3FLRA 1VRH3 1RJ8A 1OKOA 4I01A 2YBPA 1OBNA 2YY1A 2VH9A 1IQAA 1UMZA 4HLTA 1BKZA 5EFUA 2A3XA 2DUPA 1FATA 2AACA 2YXSA 4JVAA 3OEBA 4Y22B 5T3NA 3UJQA 3GYDA 3VBOA 4E2SA 5FTTC 3TB0A 1N1TA 2VM9A 2VW1A 2FBEA 3B9CA 3FJSA 3I2IA 1OURA 1T2XA 1RYYA 3VZMA 2XWJB 3PTYA 3VBUB 3V0BB 1O3RA 1OSGA 5JOXA 3CL1A 1W6NB 1XBFA 1AR61 1XNAA 2CU5A 2DCTA 2Q30A 5C9AC 1REDA 1SLCA 5EIYB 3MPPG 4CYDA 2ATFA 3OEAA 1KQRA 4JDNA 4R8HA 4HG6B 1EV13 2JG9A 5CG8A 2HLEA 2ZX0A 4CDWB 1COV2 5K9YA 4PIXA 1YNAA 4XTPA 1NE4A 3OGVA 3NNGA 4GH4A 1RTVA 5FREA 4B4PA 5A7PA 2NPIA 5F5QA 3RZGA 1KFXL 5FYMA 4H7MA 1AX0A 4FXGB 3V0AA 3JZVA 4JAAA 3THDA 4MLOA 2Y0OA 4Y3OA 1WCSA 3JD72 5FPAA 5FQ0B 4OVEA 2OIIA 1KITA 3POBA 2ES3A 4XETA 4XDQA 1YFXA 4YW3A 4ZXEA 2YC2A 4WM8B 2OQ6A 3D82A 3MYXA 3ES1A 3V65A 3ZYGA 1GP4A 3ZFEC 3WF3A 2LUWA 1W8FA 2B9VA 2RS31 1V70A 1CZSA 1J83A 5BNNA 4Y1ZA 5BPXA 4EN8B 2WNVC 4Q4X1 5KHGA 4GKYA 5DUXA 1OVPA 3VZNA 5HXMA 2A6WA 3S0MA 1WCDJ 4FO9A 4NHXA 1VRH1 3EMRA 3KVBA 1AVBA 3KV9A 4Q4W3 1K5JA 2XH6A 4LOSA 4LA3A 5FYIA 4XOGA 4W65A 2BTVC 1ZBA1 3H1YA 3CJIB 4F83A 3BUCA 2NM1A 1J3RA 3GJAA 5JXGA 1SPPA 3T1MA 2RDNA 3ZIXA 3WUDA 3OCPA 4PLOA 4CEWC 2VQAA 2QBXA 4MX3A 5D21A 3WNXA 1XE7A 1Y9QA 5F6LB 4YRDA 4FPKA 2WLPA 4M0HA 4QX0A 4UFIA 4QKDA 4Q0VA 3H8OA 1NYWA 2D3SA 4PF5A 2D44A 1S2BA 3UKTA 3NNJA 3MUY1 2VTXJ 3DGTA 4BQWA 4LHKA 1NA1B 4HKOA 2WO7A 4A42A 1CAVB 2Z2SB 3UT0A 5C5UA 5FYVA 3VHRA 4CCEA 4YFWA 4L2NA 4BMBA 1EV11 1BMV1 4HXCA 4YW5A 4MHUA 5BNOA 1DYPA 5C4WB 3PUAA 4CZSA 2QJVA 1HRI3 4FXKB 2B46X 1N3PA 3RMXA 4AVCA 1DG6A 4LBKA 1G86A 1UZ0A 3BYWA 4A41A 1JS9A 1B09A 1W9WA 1UF2C 4XFFA 2W3JA 3HNYM 3NVCA 3KCCA 1XNDA 3MIDA 1OUXA 5F3IA 2K46A 5FYSA 3Q8EA 1Y9MA 4GWIA 4DUWA 1K42A 3P3PA 1GMMA 4IESA 3WNPA 3J8F2 5C71A 1PIV1 3LD8A 4FT8A 4OZOA 1ND2A 4AGRA 1ZRFA 2K2SA 4FFHA 4ORFA 2ZTNA 5GJ6A 2R0FA 4AVAA 4B8EA 5ACA1 1KS5A 3H3LA 4LIUA 5G05L 3TOJA 3BN6A 1C5IA 1VAKA 1CX4A 3ELNA 2D40A 3CBNA 4R4ZA 4XUNA 5E6HA 2VXJA 5CKMA 2AEYA 1H1AA 1U5XA 5EJ1B 2WT1A 2GNMA 1GOHA 1ENQA 3B7MA 2HEYF 4I0BA 4JGZB 4HBNA 3WW3A 1JODA 3JXSA 2E6VA 2B39A 1ST8A 1NQDA 3ILFA 4Q4W1 5I0SA 1DLLA 3AJZA 3KT7A 4XZPA 2E51A 2RS12 1Y7BA 1NZIA 4HPKA 4QX5A 4XUTA 4CEYB 3BIWE 4PJYA 4XDPA 3WP6A 4QPGC 1X8EA 3OUHA 4RS5A 3VKLA 2Q5TA 1VBE3 2C1FA 2VXRA 2W68A 2ZGNA 3A0KA 3WY6A 2F4LA 4RHV3 4Z1VA 4FVVA 2PAEA 5CBLA 2D6PA 3U1XA 1OI6A 5FY5A 5GM0A 3DKWA 3C7HA 3U4SA 1G9CA 3O12A 2ZCWA 5A6QA 4Q4Y3 4FPEA 2EA7A 3OYWA 3IB3A 2Q1ZB 3NAPB 5GZDA 4DXTA 2WS91 2F6BA 1W8NA 3R4SA 4CDQB 4DS0A 4A4AA 3I2OA 3EBRA 4XXPA 5A33B 3BU7A 1LCLA 4BYYA 3GZTB 4IEVA 1DDLA 2MHFA 1PZ8A 1A6CA 1HRI1 3MEPA 5JXHA 1DGWA 1SEFA 3VBUA 1RUF1 3HMYA 2RR13 1X82A 2JG8C 4V2VA 4EV0A 3O1UA 2UYBA 2WFF2 1RUH3 4BMEA 1PK6C 1AUYA 2IVJA 2ARXA 3V64A 2ZGUA 4MGKE 4P9LA 1SDWA 3BI3A 3TBDA 1V6OA 2QNKA 2B7YA 2CNAA 2V5DA 2ZGPA 5DDJ1 5FZEA 3AP7A 4FAGA 2GC3A 4WVWA 2QQKA 4Y26A 1HJFA 1W8HA 1LNSA 5H9SA 1AYM1 3WR0A 4JZRA 1SLIA 1QOTA 2PHFA 5FXZA 3K4AA 4AEJA 5J37A 5KWRA 5LBBA 3WOGA 1A78A 5F5CA 1NCRA 2H6BA 2GH8A 4V2WA 3FHAA 5FQ0A 3C2UA 1NKGA 2AUYA 3IDBB 3ZR5A 3KV6A 3KM5A 2ZS6B 1R1A1 2BU9A 3N9NA 3AZZA 2A5ZA 3EQEA 5IUQA 4META 4WM8A 5F6KA 5C3QA 4RA0A 1GQPA 2XXZA 3ZXAC 1ASJ3 4C1WA 3AMNA 2XG3A 2B8MA 4Q26A 2SBAA 4X8NA 5FY0A 3AB0A 3MV01 4WVMB 2MEV3 4NPLA 1VBE1 3O1MA 5DAPA 2WSUA 4M4RA 3WNNA 1W06A 4RL7A 2GU9A 2J7MA 2QE3A 2D3PA 4XYXA 5GALA 5BNPC 1MEC2 1US2A 3B9IA 1DFQA 3LKJA 1CX1A 4K9SA 3WDWA 3TEXA 2XBO2 3LIHA 3E6BA 1CAUB 1LENA 4FCAA 5LY2A 3E5XA 3K75B 2B9UA 4B4RA 4E4ZA 3M3CA 1LHNA 2RDQA 1SMVA 4OUEA 3N9MA 2WNUB 3QACA 3WNKA 4LBNA 1NCQC 4EN9B 3VBHC 4RHV2 1G9FA 3DECA 2BOJA 1WCQA 1TMF1 1EUUA 3WQ1A 2NYYA 4KGQA 4NIHA 1PMJX 1RC6A 5EP9A 3ZSMA 4XMAA 2AGSA 1JOJA 1MVQA 4Q4Y2 2Z69A 3USUA 3CMGA 3UGGA 1N1SA 3J7MA 3GBGA 4GMP3 1OQ1A 1ULDA 1OC1A 3G6JB 4HSLA 5L73A 3WXPA 2WC2A 1CAVA 1GBGA 2VMCA 3MIHA 4I3GA 5IK7A 1BVP1 2YFUA 3U14A 4MGYE 1CPNA 4AI0A 4CRQA 2X5IB 4M3CA 2R042 4IEPA 4UF0B 3O1RA 3N9PA 3PVBB 3CIHA 2W1WA 1UOGA 2XVGA 3EHKA 1PM4A 1IS6A 3NJXA 1VBD1 2RR12 1DLCA 5GZEA 1BZWA 5CYYA 2JICA 4L92A 1HW5A 5CA6A 2RJ2A 4CDWC 3KS7A 2IFRA 4MZUA 4YPJA 2WAOA 4DXZA 2UWCA 2XR4A 3AZXA 3H3UA 2RHPA 4RQPB 2YUEA 3WG2A 1QJZA 1L3JA 1DGRN 1SCSA 1YRZA 4CCJA 5KHKA 4Z2WA 3N7KA 5CIRA 4X8PA 2VW0A 4ARXA 3LWCA 1ASJ1 4M4PA 4A6OA 4EJRA 2WRAA 4UFLA 1TG7A 1O5LA 2IFWA 1XJAA 2OA2A 2YPDA 1PO22 4NIDA 4MXWB 1W2TA 1WZXA 4YVSB 1SQ4A 4AF9A 1ENSA 2MEV1 1W3VA 3ZFFA 5JSOA 3VDAA 4BISA 4DY5A 2RMU2 4JTNA 2VUJA 3AZVA 1NY71 3H1WA 4XF9A 2HWB2 1RUG2 2J1TA 1RMU3 4FPGA 1BYHA 4Z07A 1QQP3 5I91A 4LBMA 2HWF1 3NV3A 5LWBA 1LHOA 4XAAA 1G7YA 1DGRA 2DWRA 2WWJA 5KBFA 4UXAA 3ZVXA 3OGJA 4IL7A 3IDEA 4YVWA 4LA2A 3TNQA 1O3TA 4CCMA 3VZJA 4UBHA 3VBRC 1QJY2 4NN0A 4LUMA 1ZBE1 2XDVA 2DTYA 4JKLA 4EWEA 4YSFA 1YQ8A 5K0UB 3KLSA 1BCXA 2HEVF 1E57A 1FNZA 3IAQA 1HX6A 1C3HA 1SFYA 4PIZA 3WP5A 1TME2 3ZXKA 3CJIC 4QXHA 4IEQA 4FPJA 4FOQA 3TWIA 1LEMA 4RFRB 1YHFA 2FZ2A 5FZGA 2FMDA 1JHNA 3OPWA 5J36A 4IEYA 4LBJA 3OOXA 2JJ6A 2DVBA 3DYPA 2C24A 5EPAA 1M4WA 1OH3A 3M3EA 3IPVB 5F9TA 3GCWA 4AQ6A 4H7LA 4LHNA 1UCXA 1WUVA 2EAAA 3NKTA 5CNAA 4COYA 4PBPA 4QU2A 3TEWA 1MS1A 3KQRA 1W0PA 1AR82 1CIYA 1GWLA 4XABA 1Y9GA 4RR3B 3J4UH 1QXRA 3WCRA 4CDXB 4QKNA 1AL0G 2FCVA 2KA3A 3RJ2X 1K5MB 4AHXA 3H7YA 5FUNA 2ZPXA 1H9PA 2DCKA 3WDTA 3WW2A 5GLVA 3AYDA 3LDKA 5T50A 2ZX4A 4HKLA 3KQ4B 4QX7A 3ST7A 4HN0A 4JRLA 2BNNA 1GWMA 3FHQA 2XLAA 5C70A 4HK8A 2G9ZA 1C5HA 3IMMA 1WBFA 4XW3A 4ZY9A 3ZSJA 3IDCB 4XQ4A 4EROA 5I0DA 1GSLA 1S2KA 2P3KA 1H6XA 2WZEA 3MLJA 2WR9A 5C8CB 2ZGTA 5ANQA 3S30A 3K77A 3LGRA 1I1EA 1STMA 4O9EA 2VZ1A 4XIOA 1OOPB 2D93A 5A7OA 4WBBA 4QMAA 1VMJA 2ZABA 4BQ3A 4QXKA 5K7PA 2BEOA 1JI6A 2LM3A 1IKPA 1CAXB 2HH9A 3CF6E 5IWFA 4IV3B 3O1PA 4CUCA 1FPN3 5A6XA 3ABZA 4JGZC 1UZYA 3MIGA 1ZZ9A 3SH3A 1OVSA 1PNGA 3CEWA 3AFGA 3LB9A 2Y0IA 4XF4A 2EXIA 1HB2A 4UWDA 1QEXA 1IGOA 1RMU2 2GN3A 3U4XA 1QQP2 2RE9A 2VCMA 2IXLA 3AP6A 1GZTA 5FKBA 2PAMA 1JUHA 4CEYC 4TYSA 3TRSB 4J25A 4ISQA 4UAPA 5KHIA 3PU8A 1KD7A 3GJBA 1HXS3 4QPYA 4Y24A 5FYUA 1HV1A 3T0AA 5DAWA 3UV9A 3TN92 4AI1A 2P37A 1RHI2 3RYPA 4BQXA 1UZWA 3VBOB 2WNUA 5JWPA 1DCSA 4YFZA 3ZPYA 1OD5A 3NAPC 4ASMB 1FNYA 4BK5A 2FDKA 1NAEA 3MW2A 2XVKA 2GMMA 3BB6A 4RSUA 2VAUA 3ZKUA 4CDQC 1LAJA 3GDBA 1UY3A 1RVF1 2PXJA 1QMJA 4JKKA 5T52A 4Q0UA 3AL5A 2DVDA 2YC4A 3ZDVA 2XHKA 3KV4A 1A34A 1P8JA 1XC6A 5C3SA 5FMDA 2D6KA 4XBLA 3URFA 5JOZA 2E32A 3LOIA 3ZXJA 4QX3A 4XPVA 1ZRCA 2JG9B 5DZEA 5CKNA 4YWAA 3C7EA 2QQVA 1C1LA 4MH0E 3RDIA 5C3OA 4UF0A 1JYTA 1YFYA 2CL2A 4CP2A 3O1VA 4GH4B 4ZHNA 1YLLA 2NQYA 5FY4A 3DPRA 1EPZA 2EALA 1XU1A 4DEVA 2GC1A 1D0GA 2VVFA 4LKEA 5KHHA 5ABJB 3V0AB 1O3SA 3VBSB 1WLCA 2ZKNA 4ZU7A 3NNMA 1DF0A 4PHZA 4Y1VA 1S0FA 3POFA 5DAXA 4A45A 1VB4A 4RGKA 1FV3A 2J1SA 3MO4A 4ASLA 4EZ4A 4WM7A 1O8SA 5G04L 1WD4A 4W50A 3OUJA 2VO5A 3AXEA 2VVEA 2VZPA 2ZBJA 5FPLA 1O4TA 1FPN1 2BJSA 3J7HA 3LDRA 4H3WA 4NHKA 4Y4YA 4YVSA 3FLTA 3PVNA 1EY2A 4FQ4A 1GWKA 1MQTA 4XIKA 5F37A 4Q2FA 1HQLA 2FD8A 3I3DA 1F4HA 3ETQA 1GOFA 2Q8EA 3KVAA 2XJRA 4N43C 2XJPA 4DB5A 1CD3G 1VJ2A 1DQ5A 3AMPA 4G4FA 3RVHA 4GJZA 1MPXA 3WVJA 2BBAA 2KXLA 2FDGA 2ZZQA 1BLZA 3BVCA 1X33A 2P2KA 3CO2A 1LOFA 1SLBA 2BDRA 1HXS1 2WT0A 3OD4A 4E27A 3M70A 2W0XA 4AQSA 2I07B 3OB8A 1YWKA 2P3IA 1RUI1 1R083 5K0UA 1QJU3 3FX3A 1QNWA 3M3IA 3AXDA 2PLV2 1QJEA 3HN1A 1ND3A 1E5SA 3D0SA 3KV5A 3PMEA 4FI9A 5FUIA 4YYOA 3WINE 5H9QA 3U07A 4Z8BA 4OHYA 3HNBM 3KCXA 2FDJA 1ULFA 2VE1A 2X8KA 5FLIA 2VD7A 4C90A 4XFBA 3MLKA 1UX7A 1YQCA 1JYWA 2VZVA 5FK8A 2Q8CA 1DIWA 1FMD1 2AC1A 4DFSA 4J1XA 2VR4A 4OCTA 2ZEYA 1HIXA 5FZLA 5FOJB 1ZRRA 3J26N 2B5HA 3IPVA 3ON7A 4E4DX 1O4ZA 1GNZA 1UZZA 2GC2A 2UURA 3LE0A 3ACIA 5ERLA 1HB4A 4NPMA 3T2PA 5DQ0A 5AC93 4QPWA 3ZXFA 1UAIA 2RS52 1KXGA 1JU4A 5FOBB 4Y5Z0 1BHGA 5JAXA 4LITA 1QXJA 1V6KA 2X5IC 1UY4A 3DCQA 4CU9A 1BQPA 5DPNA 4OI0A 2O1QA 1GV9A 2TEPA 4XJWA 2KR2A 4QPIA 4FQZA 1ND2B 3I3QA 1HJGA 5KXBA 3Q8CA 3AYCA 1SG3A 2ZX1A 4MUVA 1V9U3 2ZMLA 4O9GA 2NN8A 2WYFA 2R49A 2R061 1BK0A 3H3ZA 3GBFA 2D6NA 1FOD2 5A7SA 1VBA1 1UMHA 1IPSA 2R072 2RM21 2CYFA 5F5AA 4F7ZA 3KF3A 2V72A 1OOPA 4W4ZA 1ZRIA 4QQHA 5A7NA 3HD8B 3RWKX 3PVOA 1W03A 1OPOA 3R05A 1VBC2 4FPOB 2ZHKA 4LO4B 5E1RA 1B35B 1GU3A 1O7FA 1JU3A 4NIIA 5FO8B 2QTWB 2JXAA 2WAAA 2EVXA 4H2AA 4IV3A 5EQUA 1XE8A 4XCAA 2VPVA 5LRRA 3UETA 2RS33 2ZOEB 1R081 4BZ4A 4Q4X3 2CAVA 2DFCA 2HWE3 2DCYA 3I2KA 1D4VB 1K3IA 3ACLA 4JDMA 3VD9A 1JMUB 1LU2A 1ULEA 5IVEA 4QD2A 5L7OC 4KGGA 4BE3A 4NRPA 4ES8A 1T6GC 1UXXX 2LTNA 4JGYB 4P9YA 2TNFA 2JB8A 3BTZA 3OYWB 1X36A 5I0TA 1UNBA 2D6MA 1XNBA 2XVLA 2CWSA 3A7QA 4AFBA 4CA9A 3D8CA 1IKQA 1WWYA 1ZBA3 3KD4A 2JIJA 2R0HA 4ONUA 4Q0QA 3MBWA 1QJU2 4GZ9A 4AEMA 1W2NA 4ZKTB 4Q1PA 3M7AA 1X9TA 5GZFA 4COUA 2ARAA 5IT6A 3G7DA 4AEDB 5JR7B 5AC91 1K12A 4FFGA 3I59A 4YGDA 3SMHA 1CQ9A 4YW2A 1JZ4A 5DUWA 1W9YA 1GZ9A 2QZ2A 4HVQA 2IXHA 1UYZA 3B94A 5E8AA 5C5TA 3AZYA 3ENRA 1UL9A 1W6OA 1JN2P 3WP4A 3FZ3A 2W1QA 3HBKA 2D6LX 1JZ6A 2Q1FA 1UYYA 2YDEA 3ACGA 1WCKA 4D8MA 3OBAA 2HWC3 3CLPA 1K5MC 1JYXA 1V9U1 2ZMNA 2ETEA 5FMCA 3SCHA 1W8UA 1QJX1 2Q0AA 5FXVA 3RYRA 1AR62 5CZKA 3PJQA 5ABJA 5FDBA 2DUQA 3RZMA 1REEA 1NCRB 2P4EA 3VBSA 3ME2A 5FZMA 1JYVA 1UQXA 3P6BA 4CP1A 3VBFA 4CXWA 3WNLA 2DURA 3APBA 4AVTA 4EN0A 2RVAA 2JB4A 4W8JA 4N53C 1PIV3 4OI4A 5IFPA 1G9DA 1UY0A 2VOWA 1V6JA 1X7NA 4QT6A 2E31A 5ACA3 2DV9A 4Y1XA 1XSQA 1W0OA 5FO7B 2WQZC 4XAEA 5FZ0A 2J22A 3R6SA 1AYN3 1SFPA 3FE5A 2WWUA 4QKFA 3DXUA 4F3JA 3K51A 3IAPA 1ZYBA 2HWE1 3OTFA 4XFCA 1C57A 2QCSB 2R1DA 5FZCA 3W9AA 5IVVA 2ZAAA 1MZ6A 1MACA 4XF3A 1SCRA 4RGAA 1CESA 3T4HB 2D6OX 5D1IA 5FXWA 5C3PA 2DU1A 5DZGA 4OHXA 5FYZA 5CISA 3WF2A 5CFDC 5JSRA 1JZ3A 2AR6A 5C3RA 1VP6A 2RS32 2Y6LA 2WN3A 2PFWA 3K46A 3RFRA 3KCYA 4HVRA 3T0DA 4NHYA 3SHRA 4ZPIA 1JYNA 1CPMA 1LOEA 1UX6A 2PELA 2Z42A 3NO8A 1G9BA 2W5FA 3S7EA 1D4M1 2JE7A 3LAGA 1XSRA 1FI2A 1VRH2 4KH9A 2EIGA 2VZRA 1ENRA 5CVRA 4E8CA 1WW7A 3USUB 3GBWA 3KZ4C 3VHNA 4IEWA 5EYYA 4IV1B 5I8YA 5L9VA 1VPHA 2CWMA 2WS93 1QIQA 5A3NA 3ES4A 4OUMA 4ZXKA 1ODNA 3V56A 4PT6A 1XOYA 4A7YA 2VC9A 3NJVA 5JOWA 4OUSA 3O1TA 4M00A 4Z82A 4OQ8A 4M3CB 5L19A 1IPJA 2HWC1 3M8LA 1IQDC 2W1UA 5LA2A 3UESA 1MVEA 2IXIA 2JENA 2A7AA 4QHBA 2PHUA 4OQ9A 5BYNA 1RUF3 4AGVA 5FR3A 5JPMB 2WNEA 5AFEA 3E5QA 4QAWA 4D69A 1EAH3 1JW6A 4LO6B 5K4LA 3WNOA 5FZBA 2DYCA 4XUPA 5A80A 3AP4A 1MZFA 3EYPA 5I0UA 4K1ZA 1UPSA 1SACA 2ZGOA 4GH4C 1TNRA 5DDJ3 1BBT3 5FP4A 2BV4A 1BMV2 1S0BA 1EV12 4OFGA 3ILRA 1US3A 4KU7A 3THTA 1EUTA 3ZO0B 4R9DA 2Q8OA 4B1LA 1NLRA 2JG8A 1AYM3 4XJ8A 3J8F1 3ZFGA 1PK6A 2WSVA 1HB3A 2QQJA 3PHMA 4UW3A 4XUOA 3MIEA 4DO0A 1WW4A 1AYN1 5CU1A 3ZFFB 1CJDA 1WCUA 5EXOA 1LGBA 4OMCA 2CV6A 5J98B 1MS9A 2VVDA 2W1SA 3BOPA 3UKVA 4MXVA 3ZN6A 1RB8G 4BIOA 4CCKA 4CCDA 3BKZA 1GNYA 1R1A3 2VTXA 4JQTA 5JXJA 3UNPA 2BW8A 3IZOA 3FBMA 5BNNC 3ACFA 4COVA 1AX1A 1NUKA 1UOFA 2V4AA 5ACA2 1B35A 4UFJA 1OF3A 4KU8A 1R091 3JBG1 3OGRA 4SLIA 4YVWB 1ENXA 5KR7A 3VL9A 2Y33A 5IJRA 4I2OA 2P1BA 1OA2A 1LOBA 1KGYA 1GKBA 1DZRA 1S0CA 1EP0A 2EXHA 4LTAA 5A3PA 3MUZ1 2ZJCA 5EWSA 5DG2A 2WYSA 4B4QA 4DNYA 4FPLA 3B93A 3ZYHA 4XJZA 4AQ2A 4JGYA 5A3TA 1XNKA 3WUCA 3VUOA 4Q4W2 4UFMA 5JVVA 1PNFA 1IOAA 3HJRA 3VDDA 3WQBA 1W6PA 5LEJA 4RGGA 4Z2AA 1RUD3 5FZFA 2WQ4A 5BNPA 2HWD1 2PTMA 4D6QA 1LEDA 5FBZA 5I0RA 2BVBA 4ITCA 1TMF3 1WD3A 3KHCA 3MF9A 4AEDA 2BGPA 2DUOA 1VMFA 4QDRA 2VMFA 4UW5A 1E5RA 4AVVA 2YG0A 1EAH1 2EIEA 3BODA 3LDBA 1NCQA 4DIQA 4C8DA 5BNOC 3VBHA 3H8RA 1Q43A 5IK5A 4BOWA 3QLQA 2JKBA 1DYKA 4UW4A 3WDXA 1BBT1 4QXCA 2E63A 4OI2A 2OYZA 4GALA 3K3NA 3HT2A 1HRI2 4AI2A 1JYIA 2VL4A 2CY6A 5T5JA 1H8TB 2VNGA 3KB5A 3T09A 1XRUA 5A7WB 1W39A 1VBD3 2VMEA 1H6YA 5M0TA 2O8QA 2VCAA 2C4XA 3PMSA 3NL1A 5AVPA 2UY9A 3MW4A 5DXDA 2AREA 2ZEXA 4BJ0A 2JDUA 3HR9A 1GLHA 3BTAA 4LO8A 2BZDA 2BGCA 4MADA 4P9JA 3SCGA 4I30A 2NMNA 1M06G 2WINB 4FOWA 1PGW1 1AYM2 4CCOA 3HPNA 2NZ9A 1F4AA 3N36A 4Y20A 2ERFA 3PTRB 4XQWA 1HQWA 4AZZA 1KRIA 4XURA 2H6CA 3HQUA 4PDWB 1BK1A 4A2UA 3K48A 3QBQA 2P3YA 2E7TA 3ZXEA 3HT1A 3VKMA 2XGXA 1R1A2 5DAVA 2HWF3 1PHMA 3O0XA 4RS5C 1MS0A 2V4VA 4FP3A 1LESA 1MEC1 3JUUA 3BALA 3JCIA 1J1TA 2I45A 4LT5A 3U78A 5FY7A 4RN5A 4Y5SA 2QQNA 3MV11 1RUD1 2HYXA 4GULA 1ZBE3 5LA1A 4QB2A 1UOBA 1UKRA 2NLRA 2BRTA 1NQJA 1VBE2 2J1VA 2Y6FA 3K4DA 5LATA 3RYKA 4C0HA 3W20A 1FV2A 5FY8A 2BFUL 3WX5A 1Q3EA 3OBZA 3POWA 4QU1A 2FZ1A 2QDRA 1LTEA 3VBRA 2EIDA 4P5YA 2XKPA 3QCWA 2DDUA 2WKKA 3DEMA 4GQ7A 2N7GA 4F8AA 4QKBA 4IV1A 4C1XA 3D0JA 2E33A 5EHDA 3U10A 4LHLA 1AF9A 1RUOA 2YC0A 2WT2A 1CWPA 3WQ7A 3VBUC 2X09A 1C8M1 1GP5A 1W8ZA 2VGDA 5F3GA 3IT8A 2OKXA 3O1OA 5J09A 1J1LA 4MGIE 1HRV3 4NRMA 5FJHA 5GLWA 2BNOA 5GKAC 1UPIA 1AL23 3DPRB 1NXMA 4R9AA 5BV6A 5JZGA 4DXSA 3CNAA 4KBBA 1RUH2 3FUQA 5L36A 3S5AA 4IDZA 2BWCA 2BOIA 3EJKA 4P9WA 5CADA 5FZ4A 1DP0A 3BPZA 3I2GA 2WZR3 1AR93 4IEUA 4NJ4A 1RIRA 4WM7B 5IVJA 1RUC3 4B7EA 4AFDA 2DCZA 1NCRC 3AMHA 2QQOA 1MZ5A 1QY4A 3T2TA 3O1SA 5FYHA 1LRHA 3ZDSA 4QB6A 4BK4A 5FPBA 5APAA 4FFFA 1UMIA 4FBFA 1YIPA 3NKGA 3MZHA 4WM8C 1MQTB 3LEGA 1PO21 1S4CA 3OY8A 3VKOA 3WSOA 5LK7B 3WDUA 2NP0A 4MG2A 4FOVA 5FAXA 4CU6A 4GWMA 5CEHA 4LE4A 4IUGA 4PI0A 2X05A 5LBEA 2VOTA 3EB7A 3MFCA 4W6WA 4KWUA 4QHOA 2VW2A 3S57A 2HWB1 4AFAA 2WIIB 4FFIA 4WVZA 2RDSA 1ASJ2 3W59A 2LALA 1PMIA 5CFCA 2RJKA 1Q8SA 1QH6A 5FZ1A 2MEV2 2VU9A 3ZIWA 2BQPA 2ZHMA 3N3HA 1NY72 1QXPA 2BYVE 1UWWA 1TEIA 2GNBA 1ND3B 2YBKA 4JV4A 5FPZA 5FO9B 2CGPA 2VULA 5DUUA 3H8XA 5HBAA 3MHZA 3FWEA 3S7IA 2HWF2
chains in the Genus database with same CATH topology
4HFSA 1SBFA 1XYOA 4QQ2A 2GH2A 1UIKA 2IXCA 5FMOL 4K40A 3USSA 4BA6A 1IS4A 2CTVA 3IWZA 1ZBE2 2GC0A 2W39A 4INDA 1FAYA 2ZGSA 4BWOA 4LEJA 2ZACA 4KQ7A 3GHNA 4D94A 1HRV1 1ZM1A 4CDUA 5TSWA 1U5IA 1NA1C 1UW8A 3WDVA 3O7OA 1AL21 1RVF3 4P14A 4G9SB 2FMYA 1AR81 1HLCA 3GNEA 5C4WC 4K20A 5CAZA 4LBLA 1PGL2 4FPYA 1NOVA 2XUMA 1UU5A 2WZR1 1AR91 2Y26A 4QPIB 3M3QA 3E6DA 1RUC1 1LOAA 1TQ5A 3ASIA 1PO13 4KL1A 3D5OA 1H8TA 1PVC3 1H1MA 3N35A 3AK0A 3WG3A 1J3PA 1I6XA 2QVSB 1EYBA 3B02A 2GNDA 4AE2A 3RWNA 5JMCA 2A6ZA 3WQ0A 4OULA 4LE3A 1F8VA 1U5ZA 1Z7S3 5BNQA 1PVXA 5HXVA 1F5FA 4YLZA 3ZMNA 5HI0A 4PDWA 4U36A 2GNTA 1CGPA 5E89A 1ALYA 4YVWC 1N47A 1RUJ1 2BFUS 4CP0A 3R4UA 4UW6A 5GLZA 5F1RA 4NO4A 1CN1A 3UK9A 2WNVB 1V6IA 1RINA 1MS3A 1BEV1 1RUI3 4N43A 3WLUA 5I8SA 2A3WA 4AVBA 2ZKLA 4AI8A 4ISRA 4B7KA 2VOKA 3I59B 4IEOA 5JLVA 1X8MA 2PHRA 2PHDA 4QM9A 4JRAA 2JE9A 4B3NA 4ATFA 4IXLA 1BJQA 4OI1A 4CEWB 1FMD3 2D7FA 1W2UA 1W6OB 3DUIA 1A8DA 4XQDA 3INAA 2I2SA 4R9CA 2VQ0A 4PLNA 1PO11 2XJQA 1PVC1 1RVF2 5JOYA 4I0AA 1UKGA 4YW1A 2OPKA 3OBTA 1VBB3 1XYNA 2JDZA 1DU3D 2E9QA 4KNCA 2ZHLA 4N9IA 1GZWB 4P9IA 1RUE3 4MVTA 3VBFB 2YPJA 3RSJA 3MW3A 2VNRA 5D8AA 3HIFA 4JQRA 4FTEA 1V00A 1YXWA 3PJYA 5EZWA 4ZU4A 1Z7S1 1GZCA 4YG6A 3MIFA 2AENA 2ZGLA 4Q4V1 1KDMA 4IEXA 2R063 2C0ZA 1LOCA 1LOGA 3AKRA 3D4KA 4I3PA 4GB33 1VBA3 2C5DA 3AM2A 2RM23 1GQGA 3BCWA 1CJPA 4XFHA 1Y43B 2H0VA 2ZGMA 2PAKA 2ZX3A 2JECA 3O0VA 5FMOS 3WT3A 4A7KA 1FPN2 2UWAA 3H1MA 3M2MA 3LA3A 3MI8A 4R52A 3I8TA 2BVVA 3LSDA 5DZFA 2G4IA 2XKOA 1AR73 1WBLA 4QQLA 3HBZA 1WLTA 4NR1A 3FFQA 2VG9A 1X50A 2DVFA 5KHJA 4BM8A 4YGEA 1EPWA 1H2MA 1S0GA 2WNUC 2ZMKA 1HXS2 2G9FA 2Z79A 1QDCA 1LECA 1RUI2 4Q1RA 3ZN5A 4NVPA 2WLQA 3CJXA 4HETA 3WHUA 1JH5A 2MNGA 4P9GA 3ZSKA 4D3WA 1QGLA 5HCFA 5IK4A 1S55A 3AKSA 1I9RA 5JI7A 1VBB1 1S0EA 4XILA 1FMD2 3KT4A 1ZZBA 3ZYRA 2XJTA 1RUE1 1ZZ7A 3DPRC 3FUOA 4IQPA 3KGZA 3L9JT 3DF0A 4OHVA 3IM0A 2JG8B 4NPRA 5C9AA 1U0AA 3ZFGB 1PK6B 1DZQA 4XE9A 3L2HA 4D7SA 3POSA 4XXAA 4GXLA 4LBQD 4RQPC 1QJX3 1ZZCA 1S0DA 4Q29A 4TWTA 1OPMA 4GB31 5C33A 1I5ZA 1XNCA 1OHFA 2D98A 3ZN6B 5J7MA 1YJKA 1VIWB 1DQ4A 3THPA 2UU8A 4YVSC 3N7MA 1MQTC 1MZEA 1RGSA 2DU0A 4YZ4A 3AKQA 3C3VA 4BPZA 4KWLA 1VBC1 4L8QA 2R062 1VAVA 2WFPA 4L9BA 3VL8A 3MFAA 3LCPA 4N53A 5T5OA 1AR71 2OVUA 2RM22 3IIAA 3RI8A 3ZFEA 3HWJA 3H7JA 1Z0HA 3MICA 2Z5WA 4ZU5A 1D2SA 4XFIA 3GHMA 5J96B 1S0IA 5K0UC 1NG0A 3O5SA 4X6QB 2VMIA 4LBQB 4FSJA 1H2LA 2GSYA 2WNVA 1ND3C 1W6PB 4QGNA 4XHXA 3VDDB 1Q8VA 4SBVA 3OPZA 4N7UA 5BNPB 3NV2A 4BH9A 1R082 4Q8LA 1LULA 3AFKA 5IK8A 1YJLA 4NOTA 1D4M3 3NJZA 5A3MA 2TBVA 2X29A 5CFDA 3WZ1A 1CONA 2HEWF 1MS8A 4AYUA 5HCBA 4XF0A 1NCQB 1PZ9A 3HQXA 1CVNA 2C9AA 4K21A 1LHWA 4RFT0 3VBHB 2PHXA 3JU9A 4CEWA 4N9HA 3RS6A 1W6MA 4JTOA 2YV8A 3POYA 4RR3C 5A32B 4CDXC 3H9AA 4YG3A 1VR3A 4DOUA 1AJOA 2ZA9A 5AC92 1COV1 4J6GA 5LEKA 1BXHA 1KS4A 3I2DA 4QPIC 4PIYA 1N1VA 1MR5A 4M3CF 2PHLA 4AG4A 1GZWA 1QWRA 3JD71 3NV1A 4WZFA 4K3UA 4PLMA 5T5LA 2VMHA 3RPQA 5J3UA 4XBNA 3LOBA 3S6PA 2HJIA 1JXNA 1QHDA 3J8F3 5C8CC 1QKQA 1Y3TA 5KC6A 1V9U2 4Y20B 4YGBA 4LLFA 4YZ5A 1U5YA 1OOPC 3AMMA 1QJX2 2W08A 2VECA 3MLLA 3ROUA 1OQEA 1Q5OA 3ZN4A 1AXYA 2E7QA 1H0BA 1N3QA 4IV3C 3CU7A 2R16A 1KJRA 3HAGA 1H2KA 5JSPA 5KXEA 4HKWA 5KXCA 2OZ6A 1H30A 1H8VA 1R093 3JBG3 4I02A 3VGIA 2O8OA 3PVEA 1OA4A 1I3HA 1F2NA 2O0OA 2RS13 1LGNA 5E16A 1DGLA 2ET7A 4Q4X2 1YUDA 2GN7A 3ATGA 4LULA 2GZWA 2HWE2 4BLJA 1YYNA 2WJSA 4H14A 1ZX5A 2SLIA 4KG0A 4KWKA 3L2YA 4GWNA 4DPNA 3VBRB 1AHSA 3VBOC 4HK9A 4QPGA 3DV8A 1JBCA 3MF6A 3SCFA 1N3OA 5EV7A 4C91A 1ZBA2 2YYOA 1AJKA 2HWD3 1YO8A 3KSCA 3QOPA 1SLLA 1URXA 1WMDA 1OLRA 2R32A 2PN5A 4I09A 5KXDA 1D4M2 1DQ6A 1LR5A 2DTWA 3GALA 4PBOA 4YM0A 3WW4A 1XU2A 4XEZA 2P17A 1TNFA 4BCUA 4R9BA 2GAUA 5JZGB 4TSVA 4L99A 2JG9C 4WZCA 1IPKA 1GANA 1KJLA 4AVSA 3RI9A 4YGCA 2WFF3 4AHZA 1C4RA 1SLAA 1WGPA 4FTBA 1RUNA 2HWC2 4EWAA 5ABJC 3VBSC 1G6NA 1O3QA 1WMEA 2D3RA 1PGSA 3VBFC 3FMGA 4HN1A 5DG1A 1ZREA 4X6RB 5KC5A 5GLTA 4GKXA 4D7TA 3OY8B 3WG4A 3FC0A 4MSVA 4DRRA 2R6QA 2ZHNA 4E4SA 1HQNA 4HANA 1WLDA 3R4DB 2CGOA 2FQPA 1PIV2 2AH2A 4W6YA 4PCRA 2V09A 3QH7A 1QDOA 2PHWA 1HDKA 4Q0PA 2P34A 4BLIA 5CFCB 1NXD1 5JIUA 4JDOA 4W6XA 1PZ7A 1BVVA 1HKDA 1NLSA 1AYN2 2RS11 4ES9A 3M3OA 1GICA 4YM3A 3ZSEA 4HMZA 3ZYPA 1YI9A 3H8UA 5LRSA 2ZGRA 1WW6A 4HSJA 5EYXA 1MEC3 4GMP0 4YW4A 4LBQA 1R092 3JBG2 1QF3A 2XBO3 4URTA 2R1BA 4WV8A 4XHBA 1F5JA 4YZ1A 3UKNA 4YG0A 3KMHA 2H0BA 3RZZA 1WMFA 4CDUB 3MPBA 2QQPA 4JCKA 2PQQA 1LJ7A 4S2FA 3IMNA 1JTZX 1W6QA 3M4FA 1ZNPA 3TWIA 1LU1A 3WHTA 1H1IA 4M0NA 3ILNA 4JC1A 1VAMA 1YFWA 2V73A 5SV8A 1ONAA 2ZX2A 4OLLA 2WS92 3B00A 3OD0A 2YGLA 2TUNA 5T55A 1CAWB 3UJOA 4L11A 2WFF1 2HWD2 1C8M3 5EJ3A 3AP5A 2IC1A 5E88A 1XQNA 1REFA 5A32A 4Y22A 1CR7A 2XJSA 4G3YC 4K6BA 2VUAA 2R043 1YIFA 1MS5A 1RUF2 2ILMA 3GZUC 3QD6A 3ZMOA 4A7ZA 3NV4A 1EAH2 3V0BA 2ZAHA 3AYEA 4TLFA 1LODA 4QQPA 4FPHA 3TAYA 3N7LA 4ATEA 1ND2C 5F9TA 1V6NA 2DVAA 2UYAA 1W6NA 2DVGA 1AZDA 2I74A 4DY3A 5A3LA 3ZFGC 4FPFA 3FHIB 1LHUA 4EWDA 3OF1A 5DDJ2 1IZ3A 1BBT2 2WA3A 2A6VA 4KWJA 4LO5B 4Q0SA 3W58A 1LKNA 2IXJA 4CDWA 1KDKA 2VY0A 1D2QA 5T54A 3ZXLA 2ENRA 1IS3A 2GMPA 2QFEA 3I54A 1PO23 1UU4A 5FLHA 3PNAA 1B35C 3MGUA 2JEMA 4KG8A 3NWKA 2RMU3 3RRDA 1LGCA 1Q8QA 2HWB3 1RUG3 3O14A 1PGW2 2W52A 4XMIA 1XXNA 2XBO1 1V6LA 4MV2A 4N43B 3LA2A 5H9PA 4JGYC 1QJY3 4BQ1A 1F9KA 1DQ2A 3VDDC 1G9AA 3N7JA 4DRVA 4RHV1 4K7JA 2V5YA 3AX4A 3SITA 3ZSLA 1Q56A 1TME3 3LA7A 5FPXA 4Q4Y1 1RUD2 4DMIA 4AEDC 3M1HA 4AW7A 2PYTA 5FRAA 3Q9OA 4XBQA 3CJIA 3BOWA 3ZXGA 1TMF2 1LHVA 2ZGQA 3R0RA 4XFGA 2R041 1UN1A 4YM1A 1RJ7A 2ET1A 1H2NA 3WP3A 1AR83 3WCSA 1YCIA 1N1YA 1J3QA 2RR11 3RMYA 1RUH1 3WD5A 1OQDA 1C8M2 1NA1A 3ECQA 5JPNB 5D8AB 1OLQA 2BPA2 2YMZA 2CGNA 2BNMA 1SLTA 2ZGKA 3H0OA 5JIAA 3IN9A 5C4WA 4DINB 1VBD2 3AKTA 4J1WA 5DUVA 1DQ0A 3OJBA 3JB4C 1O91A 4K1YA 3EO6A 5BUVA 3LSEA 2PA7A 4N7IA 1UD1A 3FLPA 1S1AA 2RMU1 4Y1YA 1APNA 3E97A 1RUG1 3I7DA 4AXOA 2QKDA 3U0ZA 2EAKA 1H9WA 4UBGA 3U11A 3VN4A 1GQHA 2RJLA 4OZXA 3ALQA 3IKWA 1OFNA 1QJY1 2P3JA 3TNPB 4HZFA 1RUJ3 2A70A 2DF7A 4DQAA 1QOSA 1DZTA 1FT9A 1GNHA 4JGZA 1NZCA 3N4MA 3ZYJB 2XLGA 5C8WA 3ZX7A 1TME1 4BHPA 4NHMA 4GA9A 4YZ2A 1C1FA 3VZLA 1OKQA 2D43A 1DHKB 1IS5A 1BEV3 1IHMA 4E2QA 3SH5A 5L7OB 3RQ0A 3TN93 1JYCA 4CEYA 1RHI3 2XB6C 2EXKA 3OBRA 2A73B 4IV1C 3VKFC 2AZ5A 2XL7A 1SBDA 4M3CE 4YZ3A 2R30A 1ZA4A 2F4PA 4LNVA 2BWAA 1AX2A 4AWDA 4IERA 3MIBA 1OA3A 4NWVA 4XFAA 1CAWA 3NAPA 4GMP1 4QGLA 4COZA 1PGL1 4S2HA 4OHZA 5JZGC 4CDQA 1POV0 1HRV2 5A33A 5C9AB 5BY5A 3NSTA 2ARBA 1Z78A 1CIWA 1AL22 4Z92B 3B5LB 5H9RA 5JDBA 2YROA 2Q4SA 3WV6A 4AI3A 3RJRA 2XWBB 5AVAA 5C6CA 1NE6A 2WZPP 3ZXDA 3JQWA 1ZZ8A 1FX5A 3PLQA 2WZR2 1AR92 1RUC2 3ZFFC 3GF6A 2Q1MA 4AHWA 1ZRDA 1D0HA 4AQTA 4Q4V3 5BXXA 3MDPA 1HV0A 3SNMA 4AHYA 3P3NA 3UL2A 4N53B 2VOXA 1WA4A 3IBMA 3ZFEB 3EXUA 1ULCA 5CFCC 4V1PA 2VNOA 1OFSA 4LLOA 2OZJA 1R1ZA 1J58A 2HYKA 1RMU1 1QQP1 4K8FA 2YGMA 4HVOA 4IEZA 4DZGA 5JCTA 2JX9A 3DL3A 4PQ9A 5GLUA 5I8TA 2GDFA 3TN91 2GALA 2D5HA 1RHI1 1G8WA 2UWBA 1WW5A 4WVMA 5J48A 2K0GA 1RUJ2 4HL0A 5CFDB 2PLV3 4N90A 5CG9A 3KT1A 3RG0A 4NHLA 5CB7A 4YNIA 4P9XA 2D5FA 2MPFA 4FOYA 4BIFA 4CDUC 1V6MA 4AEKA 1DGWX 1CAUA 2OUHA 1BEV2 2CAUA 1QH7A 1W6MB 2D97A 2E53A 2GMEA 3RNSA 1GFF2 3QH6A 5JI9A 3FFZA 4L97A 3AJYA 1U12A 2X53S 1O4YA 4H55A 1SFNA 4LBOA 3VHOA 3ZYIB 2RS53 4MGZE 4U2AA 3JB8A 3SH4A 4AFCA 2HKXA 5AFBA 5FFOC 1H8TC 2IZWA 2YHJA 1C28A 1A8MA 3VKNA 3JQXA 3AP9A 1PO12 3FBYA 2X5IA 1PM7A 2PHTA 2A71A 4P5HA 4NWWA 1PVC2 3VHPA 2VOVA 1Q8PA 3T1LA 2EF6A 4A3XA 4M01A 2QZ3A 4COWA 1WLWA 1FOD3 1DQ1A 2R073 4C0BA 4AK3A 1DBNA 4S2DA 4RQPA 2QDNA 1O5UA 4PDWC 1Z7S2 3E5UA 2QUOA 1VBC3 4QQOA 3TYJA 4Q4V2 1FYUA 1UU6A 3LZZA 1POV3 5GZCA 4IETA 4EN7B 5I93A 1OMIA 2B42B 4MXWA 5BNNB 2IXKA 2AYHA 2XPJA 1YI7A 2NMOA 4D7YA 2XJUA 2PLV1 3A0NA 3VZOA 1LB2A 4QPGB 3KGLA 2K9ZA 5SV5A 2YZ4A 3I4IA 1AXZA 1TE1B 5B2GB 4HT1T 3A4UA 5L7OA 3B01A 5T5PA 2EXJA 4RD7A 4FPCA 4AFMA 3AKPA 5HCAA 1H4GA 2DCJA 2A6YA 2KM2A 4B29A 4XF1A 3X29B 5LK5A 2ZZJA 2RS51 2WWSA 1Q8OA 4R4XA 4LR4A 3AZWA 4WVVA 2OW4A 4MYEA 4QM8A 2JD4A 2UY8A 3DN7A 4LUKA 5K8SA 4GIQA 4LO7A 2BBVA 1KFUL 2XJVA 2E7AA 2A3YA 1VALA 4I0WB 3VZKA 1VLNA 1COV3 4TZDA 3GZAA 2XLFA 3H50A 2BUKA 4QGMA 4Q27A 3WG1A 3SXWA 4S2GA 1VBB2 1C8NA 1ULGA 4WM7C 5D8AC 3SISA 1MS4A 1QU0A 2A6XA 4RR3A 4CDXA 1AR63 4YARA 3AYAA 4FTSA 1RUE2 1FOD1 1K5MA 2FHRA 1RITA 3B3QE 5FCCA 3JD73 1JUIA 1QOOA 3VV1A 2R071 1YFUA 4YM2A 1XYPA 3WDYA 3D6EA 4Y1UA 4OHWA 2Y38A 1ZZ6A 2WA4A 1RL3A 4XJUA 1VB2A 1F31A 1POV1 3VLBB 1H4HA 4XJ9A 4Q8KA 3WW1A 4FP2A 4GB32 2IWGB 1VBA2 1UIJA 1LOFC 5C8CA 2B45X 1AXKA 4XTMA 1SBEA 1GR3A 3B69A 1CAXA 1GYKA 3OGGA 3AMQA 3O0WA 2DFBA 4AGGA 4EV0A 2OUJA 3J9SA 4HPKB 2G9GA 1QNYA 1A3KA 1ZVFA 4RS5B 1AR72 5FLJA 4XJAA 2XL9A 3SLIA 1QJU1 4EN6B 3NW4A 2WL1A 2VMGA 5GZGA 1FXZA 2A75A 4CTEA 1S0JA 1W6QB 1J59A 3FLRA 1VRH3 1RJ8A 4I01A 2YY1A 2VH9A 1IQAA 1UMZA 4HLTA 1BKZA 5EFUA 2A3XA 2DUPA 1FATA 2YXSA 4JVAA 4Y22B 5T3NA 3UJQA 3GYDA 3VBOA 4E2SA 5FTTC 3TB0A 1N1TA 2VW1A 2FBEA 3B9CA 3FJSA 3VZMA 2XWJB 3PTYA 3VBUB 3V0BB 1O3RA 1OSGA 5JOXA 3CL1A 1W6NB 5C9AC 1AR61 2DCTA 2Q30A 1REDA 1SLCA 3MPPG 4CYDA 2ATFA 1KQRA 4JDNA 4R8HA 1EV13 2JG9A 5CG8A 2ZX0A 4CDWB 5K9YA 1COV2 4PIXA 1YNAA 4XTPA 1NE4A 4GH4A 1RTVA 5FREA 4B4PA 2NPIA 5F5QA 1KFXL 4H7MA 1AX0A 4FXGB 3V0AA 3JZVA 4JAAA 4MLOA 2Y0OA 1WCSA 3JD72 5FQ0B 4OVEA 2OIIA 1KITA 4YW3A 2ES3A 4XETA 4XDQA 1YFXA 4WM8B 3MYXA 3D82A 3V65A 3ES1A 3ZYGA 3ZFEC 2LUWA 2RS31 1V70A 5BNNA 4Y1ZA 5BPXA 4EN8B 2WNVC 4Q4X1 5KHGA 4GKYA 5DUXA 3VZNA 2A6WA 3S0MA 1WCDJ 4FO9A 1VRH1 1AVBA 4Q4W3 2XH6A 4LA3A 4XOGA 4W65A 2BTVC 1ZBA1 3H1YA 3CJIB 4F83A 2NM1A 1J3RA 3T1MA 3ZIXA 3WUDA 3OCPA 4PLOA 4CEWC 2VQAA 4MX3A 3WNXA 1XE7A 1Y9QA 5F6LB 4YRDA 4FPKA 2WLPA 4M0HA 4Q0VA 1NYWA 2D3SA 4PF5A 2D44A 1S2BA 3UKTA 3DGTA 4LHKA 1NA1B 4HKOA 1CAVB 2Z2SB 3VHRA 4YFWA 4L2NA 4BMBA 1EV11 1BMV1 4YW5A 5BNOA 1DYPA 5C4WB 4CZSA 2QJVA 1HRI3 4FXKB 2B46X 1N3PA 3RMXA 4AVCA 1DG6A 4LBKA 1G86A 1B09A 1UF2C 4XFFA 3NVCA 3KCCA 1XNDA 3MIDA 3P3PA 4IESA 3J8F2 1PIV1 4FT8A 4AGRA 1ZRFA 1ND2A 2K2SA 4B8EA 4ORFA 2ZTNA 5GJ6A 2R0FA 4AVAA 5ACA1 1KS5A 3TOJA 1C5IA 1VAKA 1CX4A 3ELNA 2D40A 4R4ZA 1H1AA 1U5XA 2WT1A 2GNMA 1ENQA 3B7MA 2HEYF 4I0BA 4JGZB 4HBNA 3WW3A 2E6VA 2B39A 1NQDA 3ILFA 4Q4W1 5I0SA 1DLLA 3AJZA 3KT7A 4XZPA 2E51A 2RS12 1Y7BA 4HPKA 4QX5A 4CEYB 3BIWE 4PJYA 3WP6A 4QPGC 1X8EA 4RS5A 3VKLA 2Q5TA 1VBE3 2C1FA 2VXRA 2W68A 2ZGNA 3A0KA 3WY6A 4RHV3 4Z1VA 4FVVA 2PAEA 5CBLA 2D6PA 1OI6A 5GM0A 3DKWA 1G9CA 3O12A 2ZCWA 4Q4Y3 4FPEA 2EA7A 3OYWA 2Q1ZB 3NAPB