2WFF2

Equine rhinitis a virus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
219
structure length
219
Chain Sequence
b'DRIETTVVGVTIINSQGSVGTTYCYSKPDGRPPSTVSDPVTRLGPTLSRHYTFKVGEWPHSQSHGHAWICPLPSDKLKKMGSFHEVVKAHHLVKNGWDVVVQVNASFAHSGALCVAAVPEYEHTHEKALKWSELEEPAYTYQQLSVFPHQLLNLRTNSSVHLVMPYIGPGPTTNLTLHNPWTIVILILSELTGPGQTVPVTMSVAPIDAMVNGPLPNPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1
publication title Equine Rhinitis a Virus and its Low Ph Empty Particle: Clues Towards an Aphthovirus Entry Mechanism?
pubmed doi rcsb
molecule tags Virus
total genus 25
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2009-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wff200
1RMU1 1NA1C 2PLV3 4CDWC 1OOPB 1RUG1 4BCUA 1B35A 4YVWB 1MQTB 4FTBA 4CDXC 1R1A2 1ZBE1 1EV13 1CJDA 1VAKA 4GH4C 3NAPB 1W39A 1NCRA 3DPRA 3VBRA 1MEC1 1IHMA 1VBB3 1AR72 1R1A3 1VBC1 1PGW2 1QJY3 1VBE1 2X5IC 1MQTC 1D4M1 5BNNA 2WFF1 5ACA2 1RUC2 5JZGA 1NOVA 4RFT0 2GH8A 4CDUA 2ZZQA 1HRV2 1PO23 1R093 2WZR2 5K0UC 1NY71 5FMOL 1OPOA 1QJU1 4YVWA 2R073 1NCQB 1RUC3 5ACA3 2RS12 4Q4W1 1QJX2 1R082 3J8F1 5C8CC 5D8AA 1HRV3 3VBSA 3NAPA 2WZR3 1RUJ1 1PO11 4IV3C 3IDEA 4GMP3 5CFDB 4PDWB 4CEYA 2RS13 1RMU2 3CJIA 1QJX3 5FOJB 1HXS2 5A33B 1C8M1 1ND3C 1V9U3 1RUH1 1FOD2 1ZBE2 5C9AC 1QJZA 4IV1A 1AL21 1TMF3 4YVSA 5LK7B 1VBA1 1EAH1 5L7OA 1RMU3 1ZBA1 4JGZC 1RUG3 5C4WB 1RUE2 1SMVA 1RHI2 1HXS3 4FTSA 5CFDC 1ASJ1 5CFCA 1VBC2 1ZBE3 1FOD3 1FMD1 1B35B 4Q4Y1 1QQP1 4N53A 1RHI3 1AR81 4PDWA 2BFUL 1NCRB 2ZTNA 3DPRB 1NY72 1VBC3 4QPIA 1QJU2 1D4M3 3VBHB 2WFF3 5FMOS 3JD71 1B35C 5BNOA 2HWD1 5BNNB 3ZFGB 5DDJ1 5JZGB 4RR3C 4CDUB 4LLFA 1VBD1 5C4WA 4QPGC 1QJU3 2FZ2A 3VDDA 1HX6A 1AYN1 5J98B 3VBRC 1RUD1 2XBO1 1PGL1 1VBB2 4Q4W3 3J8F3 1GFF2 1C8NA 1C8M2 5AC92 2ZAHA 1QJY2 5D8AB 1RUJ3 1PIV1 3VBSB 3ZFEA 1PO13 4Q4V1 3VBUC 1VB4A 1BBT1 2DF7A 2HWC1 1PO22 1R092 2HWE1 1WCDJ 4FSJA 1ZBA2 2MEV1 4Q4X1 3VBHA 1C8M3 4CEYB 3ZFFB 3VBFA 1ASJ2 5AC93 3CJIB 1OOPC 1FMD2 4YVWC 3ZFGA 2R072 1AYM1 4Q4Y2 1EAH3 4CDQB 4IV1B 1COV1 4YVSB 4GB31 1QQP2 4RS5A 3NAPC 1ZBA3 1ND2B 3TN91 1AR82 5L7OB 1ASJ3 4N43A 1AR91 4RQPB 4CDXA 1RB8G 2RM22 1FMD3 2HWB1 5BNPA 1K5MB 1POV1 5CFCB 4CEYC 4Q4Y3 1RVF1 2RR11 4GH4A 1AR61 3JD72 1QQP3 1V9U2 2HWD2 1M06G 2R041 5DDJ2 1TMF2 1AR83 2RM23 1H8TA 4N53B 2TBVA 4JGYA 3ZFFA 4QPIB 2XBO2 1RUG2 3JD73 1VRH1 1AL0G 2HWD3 1NCQC 1X33A 4CDQA 5DDJ3 5K0UA 5BNOB 3LOBA 1VBD3 1ND2A 4CEWB 1Z7S1 4RQPA 5J96B 1A6CA 1MEC2 1BBT2 1RUD3 2XBO3 4N53C 2HWE2 3VDDB 1K5MA 3VBOA 4Y4YA 4PDWC 2MEV2 1R1A1 4QPIC 1VBE2 1D4M2 2WFF2 4IV3A 4Q4V3 1POV0 1MEC3 1BBT3 1COV2 2GSYA 2HWC3 3ZFEB 4GB32 2HWE3 1AR71 2MEV3 4Q4X3 4WM8A 3TN92 1ND3A 5C4WC 5C9AA 1VBE3 2R061 2HWB2 2FZ1A 4AEDB 3VBFB 4Q4W2 1BEV1 3J8F2 2RR12 1COV3 1F2NA 4GB33 4CEWA 2WZR1 4JGZA 1PVC1 3TN93 1RUJ2 1PO12 4RS5B 3ZFEC 2HWB3 1NCRC 3DPRC 4N43B 4CDXB 2RR13 1R081 5BNPB 1AR63 3VBHC 3VBFC 1RUH2 4FTEA 4GH4B 1AL22 1FPN1 1TME1 5BNNC 3ZFGC 1BMV1 1VBA2 5JZGC 1EAH2 1Z7S2 4CDUC 1H8TB 4RS5C 5A32A 4JGYB 1VRH3 1HXS1 2X5IB 4AEDA 3FBMA 4N43C 1RUH3 1FOD1 5ABJA 1AL23 5BNPC 4RR3A 1VBA3 2WS91 4QPGA 4WM7A 1Z7S3 5K0UB 5D8AC 3VBSC 2HWF1 1NA1A 4CDWA 1HRI1 1RUE1 1RHI1 1X36A 2BBVA 2RMU1 4Y5Z0 2RS31 1H8TC 3VBOB 4JGYC 2R062 5C8CB 3ZFFC 2RS51 2BFUS 4RHV1 3CJIC 1RUF1 1BEV2 3JB8A 4GMP0 3VBUA 4CDQC 1AUYA 1AR73 4IV1C 4IV3B 4YVSC 1PVC2 1RUI1 3JBG1 1VBD2 1OOPA 1ND2C 2X5IA 2R063 1MQTA 5L7OC 1AYN2 4RQPC 4WM8B 1RUD2 2PLV1 1PGL2 2IZWA 1ND3B 5C9AB 1BEV3 1K5MC 3VBOC 5CFCC 1EV11 1PVC3 1FPN2 1PIV2 1TME2 4JGZB 1BMV2 4Q4V2 1AYN3 2HWC2 1HQNA 4NWWA 1VBB1 3M8LA 1R083 5C8CA 4Q4X2 4WM8C 5AC91 4NWVA 1QJY1 2XPJA 2WLPA 1FPN3 1PIV3 1TME3 2BPA2 1NG0A 1AYM2 2Y26A 2WS92 3HAGA 5BNOC 1PO21 1R091 2HWF2 4CEWC 1HRI2 2RMU2 1AR92 1PGW1 1NCQA 2RS32 3ZXAC 3VDDC 5A32B 2R071 4SBVA 1AYM3 1RUC1 4EJRA 5ACA1 2RS52 4RHV2 2WS93 1RVF2 1CD3G 1RUF2 5ABJB 1AR62 2QQPA 1E57A 4RR3B 1HRV1 2WWSA 2HWF3 3S6PA 1VB2A 4QPGB 4WM7B 2R042 1HRI3 1RUE3 4Z92B 1DDLA 5CFDA 2RMU3 1AR93 2RS33 1RUI2 3VBRB 1NA1B 3JBG2 2RM21 4CDWB 4GMP1 1POV3 5A33A 2BUKA 2RS11 2RS53 4RHV3 1QJX1 1RVF3 1RUF3 2PLV2 1VRH2 1F8VA 1OHFA 4AEDC 1V9U1 1EV12 2R043 3JB4C 5ABJC 1TMF1 2VQ0A 3VBUB 1RUI3 3JBG3 5GKAC 4WM7C
chains in the Genus database with same CATH superfamily
3EXUA 2YG0A 1W6PA 3PUAA 5FZ8A 4J6GA 2GNMA 4GALA 2C24A 4MGIE 1OH4A 1RUG1 4YVWB 1G6NA 1JZ3A 1FT9A 3I7DA 4L99A 3HVDA 1JZ5A 5T5JA 5C8WA 5A1FA 4UFIA 4LPLA 1Q56A 3RMXA 1ENQA 1QMJA 2YFUA 4LO5B 1QF3A 1VAKA 2VG9A 3TNQA 3DYPA 2J1SA 4YM3A 1W39A 3DXTA 1W8OA 5FYIA 3LGRA 4AAPA 3AMMA 1H9WA 1RIRA 2WT1A 1VBB3 4FFFA 3KGZA 4XW3A 1OUXA 2Y6FA 2ZEXA 3AZWA 3RFRA 1ULCA 3HOBA 2W46A 1PGW2 3ZN5A 3HNMA 5F5IA 1VBE1 1MQTC 1UU6A 4HN1A 1ENSA 4LLOA 5LBBA 5LA2A 4KL1A 3IMMA 4OZOA 2DU1A 5JZGA 1YJKA 4MXWA 2WAOA 4MGTA 5B4NA 1GQHA 3DF0A 1HRV2 2QQVA 3LSEA 2LS6A 5CZKA 4AZZA 5C3SA 4FI9A 4LKEA 3H1WA 4OHYA 1V6OA 1V70A 4HKOA 4ORFA 5FMOL 5FXZA 3VZMA 3PNAA 3OYWB 2WBKA 2OKXA 2ZMKA 1U5YA 4S2DA 2XR4A 4XFCA 5IVFA 1APNA 2AR6A 3TEZA 3KQRA 2QZ3A 2E9QA 3ACLA 5CKQA 1RTVA 1NCQB 5ACA3 3BTYA 3B01A 1QJX2 4Q4W1 4NIAA 3WQ0A 2A6WA 2JDUA 5D8AA 3OY8A 1SFPA 2DBIA 4MXVA 3D3AA 5T5OA 2JDMA 1YC61 1RUJ1 5B4XA 3IM0A 2D3SA 1D2SA 1G9CA 5IK7A 1HJGA 5FQ0A 4IV3C 4GMP3 4DXRA 2WNOA 4CEYA 4L2NA 5FYCA 1TE1B 1W6OB 1WBFA 2FHRA 2RS13 5FZKA 1W8FA 1CAVB 4QGMA 3O1VA 4QGLA 3PUHA 3W9AA 3WDVA 3PVOA 2JE7A 1CAXB 5FMDA 2WT0A 4YVSA 4XUQA 1PMHX 2PN5A 2A3XA 1WZXA 3UT0A 2Y6KA 5LK7B 2DTYA 1UZ0A 1CQ9A 5I0UA 4K8RB 1O4TA 1PK6B 4D3WA 4BQXA 1Y9GA 1ZZ9A 3C7GA 1JYTA 1UZWA 1SBFA 1ZBA1 1RUG3 5C4WB 1UYPA 3LB9A 1RHI2 1HXS3 1H30A 2SBAA 1W6PB 5CFCA 1TG7A 4M01A 1VBC2 2VTXA 1FOD3 1SLIA 5FTTC 4BLJA 3S7IA 3HMYA 3WF1A 4ASMB 3O1UA 3BTZA 3NV2A 1OLQA 4L92A 5FZBA 3WQ1A 4Q4Y1 3KV4A 2VJXA 5J96B 5FO8B 2EIEA 4XUOA 1GYKA 1QQP1 2WQZC 4NIGA 2WO2A 1W03A 1H8VA 3GCXA 2JENA 2DCYA 4OI2A 1AR81 4PDWA 2BFUL 1LR5A 2ORXA 3P3PA 4MLOA 2PAEA 3LPFA 3U1XA 4LE4A 3H1MA 4PQQA 1QJU2 4C91A 1LOFA 1OSGA 1WMFA 2BGOA 4LIVA 3GZTB 4KWJA 1IOAA 1US2A 1S0DA 3AMQA 3LQCA 1UKRA 2PTMA 2P6CA 1DQ0A 1W0NA 5FMOS 5SV8A 4XYXA 5B2GB 3JD71 2YYOA 4YRDA 2W47A 3P5BA 4TZDA 1IS3A 3H8OA 4KU8A 1JUIA 5FPLA 1ST8A 4YZ1A 4FP3A 1GKBA 5IATA 2JDZA 4OZXA 5JZGB 1YFUA 1UY2A 4MXWB 2VMCA 1HIXA 3LA2A 2Y8KA 1EUTA 4YG6A 1W28A 1NXMA 2FZ2A 1MR5A 3GALA 3I2KA 3N9LA 3C8XA 1QIQA 4QX1A 4YM0A 3D8CA 1LGBA 2VQUA 3E5QA 4G9SB 4IEQA 2UY9A 3KGLA 2Z5WA 3AP5A 2FMYA 4Q4W3 1GWMA 3IN9A 3N7MA 2W52A 4FPFA 4LKFA 1KJLA 1VE0A 3N7JA 1GFF2 4L97A 2A7AA 2BYVE 4MGKE 5BNQA 3AFGA 2KXLA 2P6HA 1H2KA 1DGRA 3IAQA 3J7LA 2B45X 1XYOA 4QPWA 5D8AB 1RUJ3 1PIV1 1S2KA 3CQOA 3OY8B 3ZO0B 2XJUA 4IEZA 1W2UA 4NN0A 1DYPA 2IVJA 1ULDA 1VB4A 3A23A 2DF7A 4P9GA 4QT6A 1WW4A 5I8YA 1PO22 1R092 2WO7A 4HPKA 1WCDJ 2VOKA 4FSJA 5FQ0B 5EIYB 1HB4A 2BOJA 4LKSA 4Q4X1 4QKFA 1A3KA 3T3YA 2QBXA 3GBFA 4IQPA 3ZFFB 4CEYB 5AC93 1OT5A 1H0BA 3NV1A 3ZYBA 4G4FA 1W9FA 5ANNA 2W95A 4JQRA 1LGNA 2WQ8A 3ETQA 3GXUA 4A7YA 1JU3A 4Z8BA 2PAMA 2ZGOA 4YVSB 1F15A 3GNEA 2I07B 2DBNA 4GB31 1VLNA 1MVEA 4BQWA 1GQGA 3IDAA 3NAPC 1ZBA3 3LDKA 4P02B 3AYAA 4EN7B 1QGLA 1OFSA 1D7PM 4N43A 4PLOA 1AR91 1HN1A 2RM22 5GLWA 2CTVA 1NAEA 3F95A 4S2HA 4XDOA 1NE4A 3TNPB 3OG2A 3K77A 3RQ0A 5GM0A 4HT1T 5FJHA 1SQ4A 3ZMNA 2I2SA 2Y6LA 1X8MA 5CFCB 4META 2UWCA 4C1XA 4Q4Y3 2JG9C 4YGBA 3OUJA 2QQOA 3FUOA 4FPYA 4M3CF 2NLRA 4CPBA 1GZWA 1YIFA 4LO6B 1VMFA 3ATGA 3HBZA 1QQP3 3CEWA 3FLTA 3KV6A 1V9U2 2HWD2 4KG8A 5F5CA 5C3PA 3R05A 2WNUC 1LCLA 5DDJ2 1TMF2 5HXMA 1AR83 1CESA 1UMHA 2JJ6A 3KVAA 3PUQA 3WDWA 5JMOA 4CVUA 2FMDA 5FPAA 4BQYA 4CU9A 2GP5A 2BZDA 4XDPA 3RVHA 4D7SA 3RYRA 3ITQA 5A7OA 3T2QA 3JD73 4Q0UA 3SMHA 3UJQA 2IVIB 1XXNA 1REEA 2WDBA 1AL0G 1FAYA 3OD4A 2XHNA 4P9YA 3RI9A 4BXFA 3H1YA 4B29A 2W91A 1YRZA 3POEA 3VZOA 1YQCA 1SLCA 2VZVA 4JV4A 3PHMA 4P9JA 1ND2A 5KR7A 1Q8PA 1XPWA 4JRLA 1SBDA 1ZRIA 3WHTA 1QDCA 2BNMA 2WWJA 2NQYA 5IVBA 4WBBA 2QTWB 5KC6A 3USSA 4AWDA 4LK6A 2MEV2 5JOXA 5APAA 3WEZA 5FP3A 3K4ZA 2A3WA 3I3EA 3KF3A 4AL9A 3O14A 4K1ZA 1VAVA 3JQWA 4BIFA 2D6NA 2WQ4A 1D4M2 4LQRA 1QJEA 2B4KA 5FK7A 5IFTA 2YPDA 2XQXA 2ZABA 1N3PA 3D0SA 5T55A 2VZ1A 2WWUA 4HK9A 4IV3A 4ZY9A 1POV0 5GZFA 3WZ1A 4YW5A 4M00A 1QHDA 4JCKA 2O1QA 2VNRA 2GALA 1ZZBA 4KG0A 4Q4X3 1LHOA 1SLAA 4K3UA 3RZHA 3VD3A 1XC6A 4HPKB 4CP9A 5LRSA 4A42A 4QDRA 1UL9A 3NJVA 1W8ZA 1QOOA 4G3YC 4AEDB 2G1MA 4GQ7A 4LHLA 4GD4A 4UAPA 4XXAA 2Y60A 4Y26A 3Q9OA 4M4RA 5C9AC 1F2NA 4GB33 1SDDB 3L2YA 4XCBA 3D6EA 1JHJA 3ILFA 4RL7A 3W59A 4K21A 1RJ7A 4JDOA 3POWA 4XUTA 3THTA 4R4ZA 5HPOA 1U5ZA 1PO12 3H8XA 4IEWA 4Y1VA 3ETPA 3OBZA 4IUGA 4OI1A 5A7NA 4DXZA 3AJYA 4N43B 4MADA 2VVEA 4QQOA 5HCBA 3O1TA 3KT4A 1VRBA 2GN7A 2ZHNA 4RGAA 1G86A 4EN8B 3KD4A 3B5LB 5CKNA 1XRUA 3ZIWA 1GV9A 1X9TA 4I09A 3P1IA 1GZWB 3U78A 4NO4A 1AL22 4E8DA 3NJZA 3NJYA 5CU1A 3ZFGC 1A34A 4P9LA 2WNVC 4X6QB 1MACA 1W06A 1EAH2 1XE0A 4YW4A 1PHMA 1Z7S2 4Y4RA 3GZEA 4QDSA 2E6VA 4NPLA 3D0JA 4B7EA 1DFQA 3NNJA 4RS5C 3U0ZA 5FY1A 1HQLA 2VBPA 5A7SA 2B46X 2W1SA 2J7MA 3LEMA 2ZEWA 2J1EA 1JOJA 2F4PA 3HEIA 3OBTA 2Y6GA 4QKNA 2WLQA 3VL8A 3VZNA 1UYYA 3E97A 1JS9A 2OVUA 3JUUA 2RE9A 5BNPC 3WP3A 3RJRA 4EWDA 3TWIA 1VBA3 4CXYA 4AHWA 4XETA 2XJRA 3DL3A 4FBFA 3ME2A 4YW6A 4IEUA 3WP4A 3PIJA 1NA1A 4CDWA 4QX3A 5JI9A 1HRI1 1RHI1 4IDZA 1X36A 2W1UA 3U4XA 5A6YA 3V65A 3K3NA 3ABZA 1A78A 3PLQA 4XUPA 2D6MA 4OQ8A 1L7LA 3POJA 4JGYC 4LA3A 4DMIA 2RS51 2YGLA 3KV5A 1RUF1 2P17A 5FYUA 3ZR5A 3ZSLA 2JXAA 4GA9A 4XJAA 5K4LA 1LU1A 3MW2A 4GMP0 2ZOEB 2IXJA 4HVOA 5LWBA 2E7TA 3I4IA 4NVPA 5SV5A 4PLNA 3RJ2X 4QXHA 4CDQC 1AUYA 4IV3B 1PVC2 3IMNA 4XAAA 3UV9A 5LA9A 1WA6X 2GMMA 1C1FA 5JXGA 2FCVA 2X5IA 5LA0A 1WUVA 3CMGA 1X7NA 4ZKTB 4RQPC 3SH4A 2HEYF 4CCOA 2PLV1 2YU2A 1PGL2 2IZWA 5AFBA 1DLLA 4DY5A 2VGDA 5KHIA 5C5TA 1K5MC 4P9IA 3VBOC 1O4YA 5LEKA 1RXFA 4XABA 4E2QA 1EV11 3PUSA 4BQ1A 4XDQA 5FUPA 3MV11 2HYXA 5FZ3A 3H50A 1DQ1A 3THCA 1H6XA 4LBNA 2H0BA 3M2MA 1U0AA 3FC0A 2CV6A 3UKVA 2P5BA 3CU7A 4AFMA 2XH6A 2FDJA 4Q27A 1AYN3 1OLMA 3B93A 2YB7A 4NHLA 1V6JA 3WW1A 3AL6A 1BKZA 4NRPA 4UOJA 3WG3A 3O1RA 2B42B 4M0NA 5C5UA 2R7EB 1N1SA 2O8OA 3AFKA 1KFUL 1MVQA 1KD7A 3OTFA 1J1TA 2X29A 4NWVA 1CPNA 1I5ZA 1OA3A 3MIBA 3WNNA 1S2BA 2WLPA 1H9PA 5EZWA 1ACCA 3I54A 4D6RA 1QJFA 1LRHA 1N1VA 3R0RA 2Y26A 3LEKA 3SXWA 4FPCA 3HN1A 3J7HA 3DXUA 2XJVA 5FP7A 2ADEA 1PO21 1BQPA 1R091 2HWF2 2XJSA 3BPZA 4XILA 5CA6A 4CEWC 2WYFA 3M1HA 5DAWA 4A3XA 2VE1A 3QCWA 1Q8OA 1UYXA 3N35A 3N3HA 4Z2WA 3N9OA 1W05A 1RUC1 4EJRA 5KBFA 2DWRA 1SG3A 4JRAA 3NNFA 1RVF2 3CNAA 4I30A 5BXXA 3FL7A 5A6QA 3HT2A 4XACA 5LZ6A 1E57A 4JC1A 1AR62 2WWSA 4IGPA 3AX4A 3S6PA 4D8MA 1GOHA 1VB2A 5GZEA 2R042 1HRI3 3P6BA 4BHPA 3POSA 4Z92B 2YC2A 5CFDA 1DDLA 4DUWA 4DFSA 1NA1B 1N1TA 1XOYA 2RM21 3OGVA 2JG8A 4CDWB 2QDNA 4QQHA 4XF9A 5IVJA 2XB6C 4XIKA 3AC0A 1UPIA 4Y5SA 4RGGA 3AZYA 2ZS6B 2RS53 1RUF3 2CWSA 5JPMB 1VRH2 3WQBA 2D6OX 2D43A 3T2PA 3LPGA 2ZGSA 4ZU7A 2XLGA 3E6DA 2VCCA 3FN9A 5FYZA 1V9U1 1W9SA 4UF0A 5FXWA 3WXPA 2B9UA 4QWNA 3QLQA 2TEPA 1JYVA 2NZ9A 1TMF1 4JQTA 2V09A 5ABJC 4XFFA 4MZUA 4WVWA 1W2AX 2NMOA 4B4RA 3H8RA 3K4AA 5L36A 2Q5TA 4FFHA 1G9DA 4UT5A 2G9ZA 5J7MA 3VKLA 1YQ5A 2PLV3 3PU3A 1AF9A 1D2QA 4YG3A 4AVVA 2GN3A 5JWPA 1ZA4A 4XUNA 1UX6A 3MUY1 2D6LX 4FTBA 1WW6A 1H4HA 2CGOA 4ZONA 1ZBE1 1EV13 4ZXEA 4BXSV 4K7JA 2DUPA 1LOAA 1CJDA 5EYXA 4RN5A 1VPHA 3WG1A 2HBTA 1TNRA 3AMPA 3H3LA 4GWJA 5FY5A 4EROA 5GZGA 3T1LA 3VKNA 4DUVA 1ODNA 3NAPB 2GNTA 1SFYA 2QQIA 4M4PA 3PTRB 5JR2A 3VBRA 1PGSA 5AVPA 2X53S 3WNXA 2R0FA 5CVRA 1YQ6A 4YSFA 4LXLA 3WSOA 1AR72 4DOUA 3ACHA 1O5LA 3H9AA 1CZTA 1R1A3 1ZREA 5BY5A 5J37A 3WNKA 3EO6A 1D4M1 5GLZA 2EVXA 5IAVA 4UFJA 3ZXGA 1UOFA 2XVKA 1VR3A 2WNVA 4K1YA 4AI9A 1KS5A 1NOVA 2FDKA 1S0GA 1HLCA 2GH8A 2Y6JA 4X6RB 4PIYA 1FATA 1S55A 3WW3A 4O9GA 3IPVA 1PO23 1R093 4S2GA 3ZYFA 2ZX4A 3WV6A 2WZR2 3OBRA 4FQZA 5FPUA 2KD7A 1OPOA 1W3XA 1XNDA 4YVWA 2WL1A 5L19A 4D6QA 3MF9A 4UXAA 4FP2A 5A3TA 1RUC3 2PYTA 4E8CA 4FPGA 1UAIA 1E5RA 4CYDA 5A3MA 1AX0A 1K5JA 3R4SA 1T6GC 3ZR6A 2OXBA 4B8EA 1E5IA 2YBSA 2C9KA 5F8PA 2VOWA 1IKPA 3WLUA 1PO11 1JU4A 1OLME 3AKPA 4GXLA 5LBCA 1GP4A 2ZJCA 2PHXA 3IDEA 5CFDB 4DUXA 4HANA 1W3VA 3C7EA 1J3QA 3O1MA 2KA3A 4A45A 3N9NA 1G9AA 1RMU2 2GC3A 2JG8B 4CP2A 3B3QE 5FOJB 3NSTA 4NAMA 5KHJA 4IEXA 4UFMA 5FZ6A 3ZXFA 2VMIA 1V9U3 4LR4A 3S30A 2JECA 3OGJA 4UFLA 4UW4A 1STMA 1YWKA 1AL21 1CIYA 1TMF3 1LGCA 4HK8A 2A73B 3S5QA 1O3RA 5LASA 4UF0B 4QPYA 5JDBA 1EAH1 5FZ1A 3WG2A 1IS4A 4AEKA 5FFOC 2CGPA 4LA2A 4RGKA 2CAVA 1RUE2 2W68A 1SCRA 1AJKA 1SMVA 4AGVA 4XPVA 5L9VA 4NROA 5A3OA 2C1FA 3NNGA 1ASJ1 2ET7A 2TUNA 4FCAA 4PCRA 3U14A 4I2OA 1ZBE3 1FMD1 1U5XA 1YQ8A 4R9DA 5FZLA 2VUDA 2JE8A 5A6XA 3T0BA 2PQSA 4DXTA 2VZRA 1H2NA 1V0AA 1GZTA 2P37A 2ORZA 1QH7A 4UI9L 3HBKA 4K9SA 1WD4A 4S2FA 5FYBA 3QH7A 1YFXA 1ZZ8A 2D98A 4XQDA 4AAXA 1NY72 1W6OA 4IEOA 4IE5A 4QPIA 5FMBA 3RDIA 5IFPA 2C6SA 5JSPA 2VTFA 3CF6E 4LKDA 1PMJX 3B02A 4Y24A 1GANA 4EZHA 2D97A 1BLZA 1D4M3 3RPQA 1QXRA 1G9FA 3ENRA 1MS1A 2E31A 4HLTA 2W2IA 4NE9A 1B35C 5H9RA 4DINB 4MGQA 3ZFGB 4Z1VA 4DS0A 4YFZA 2WNVB 3V0AA 3KV9A 5EQUA 3SHRA 3LIHA 1W6NA 3IPVB 3POYA 4LLFA 5C4WA 4XMAA 3IKWA 3MIGA 2ZACA 4Y20A 4GKXA 4D69A 1GQPA 2VW2A 3HNBM 5I8SA 1PGL1 1LENA 2VAUA 5A80A 2VU9A 4YZ2A 1O59A 1N3QA 3CO2A 4RA0A 4RFRB 2BBAA 2VOTA 1WW5A 3NNMA 1C8M2 1O8PA 2UYBA 4JZRA 3A0NA 5FYTA 5LBFA 4XC9A 3AKRA 1LAJA 5T5LA 3ZFEA 1PO13 2XDVA 3Q8CA 4A7ZA 2OPKA 1W9YA 2PHUA 1FXZA 1C57A 1F9KA 3LAGA 3NQHA 3ZN4A 3ZSKA 4OI0A 1BBT1 1O5UA 2YROA 4GULA 3RSJA 4XF3A 2ZGNA 3K51A 2HWE1 3MBWA 1YJLA 1PX3A 5T52A 4LE3A 1JYCA 1BK0A 1WA4A 4CCNA 1OURA 5EYYA 3ZSEA 1F5FA 4NOTA 4YG0A 3VBFA 3IIAA 4AF9A 4F83A 4CPBD 2W5FA 2UU8A 1GOGA 4PT6A 5T50A 4QM8A 3O0XA 2Y0IA 4P5YA 4QDQA 1XNTA 3KMHA 3ROUA 1EAH3 3AZXA 4QU2A 1UY3A 3SLIA 4CDQB 1COV1 3Q8FA 3UETA 2MHFA 4CU8A 1JZ8A 2BNOA 4DY3A 1AZDA 2WC2A 1NQDA 3B69A 2IFWA 2G9FA 1X9PA 2VO5A 3MW3A 1ASJ3 1S0EA 2O14A 4RQPB 3POIA 1FMD3 1RYYA 2PHLA 2VOXA 3K48A 2Z2SB 2HWB1 3RG0A 3B9IA 1K5MB 2AREA 5DG2A 1LHNA 2V5DA 4LORA 3MLLA 1RVF1 1AR61 1NLRA 3KCXA 5FZDA 3S7EA 2VULA 1C28A 1C3HA 1CGPA 1LULA 2DCKA 2IUWA 2LW8A 3EQEA 1UOBA 2D5HA 3KCCA 4I02A 1M06G 1K12A 2R041 5FLHA 1MS0A 4MGSA 3RWKX 3MIDA 2VZOA 1H8TA 3HIFA 1IPSA 4CSWA 2XLFA 4P9WA 2XG3A 2VXRA 3LZZA 3BU0A 1G7YA 3ZFFA 3NV4A 2ATFA 5DG1A 4QPIB 2C0ZA 2A6XA 2XBO2 2R1DA 4LK7A 3ZYRA 1VRH1 4LBQD 2WABA 1ZZ6A 5HXVA 3HPNA 2I74A 5HV0A 3AP6A 2ZA9A 1AHSA 3MO4A 2IWGB 2OZ6A 2VR4A 5J48A 4WVVA 3HQRA 4YM2A 3VV1A 4XMIA 2XVLA 3D82A 4XFBA 2FDFA 4MVTA 4ISRA 5K9YA 2BVVA 4LMFA 3KM5A 2QKDA 3QBQA 4OVEA 4XURA 1OD3A 4CEWB 3V0AB 1GNHA 4XQWA 4CA9A 3C2UA 1W6NB 4C0HA 1MEC2 1QXJA 4N53C 3UNPA 4KGGA 4PBOA 1W0OA 2KM2A 4Y4YA 4Y20B 1YI9A 1L7RA 2ES3A 4ZPIA 2NM1A 3SCGA 1BVVA 5K7PA 5JIAA 3V64A 3GGLA 5DAXA 2AEZA 1QNWA 3I3QA 4YM1A 1RXGA 2ID4A 5HV4A 2NP0A 3VD5A 3GHMA 1C4RA 4CUCA 3VDBA 1JYWA 1ULGA 2WFF2 2QQMA 2Y0OA 2OQ6A 5JOZA 1TZOA 1LODA 1ENRA 4U36A 3WF4A 4NPRA 2UYAA 4YGDA 2RDRA 4LEJA 3JU9A 3UYJA 3OUHA 5KXBA 1EPWA 1BBT3 1REFA 4QX8A 3OGGA 3ZFEB 2HWE3 4BOWA 4O65A 5JCTA 4QXBA 1AR71 5A7QA 3MZHA 1FNZA 4H2AA 4WM8A 3TN92 3UGFA 4RYDA 1FNYA 3LA7A 1JTZX 3VL9A 1VBE3 2R061 4QB2A 4DXSA 3GM8A 2Q8OA 1PX4A 4GWMA 2ZGUA 4Y1YA 3BTXA 2DCTA 3VBFB 2YDEA 5ISLA 3CJXA 4M3CA 4FVVA 2EXHA 5FZAA 4C1WA 2RR12 5CYYA 4IW3A 1COV3 4JKKA 2H6CA 3C7FA 3AKTA 1XB9A 2WZR1 4P00B 1W99A 4OMDA 4QGNA 4ONUA 4TTGA 2K46A 4IE4A 1GZ9A 3PIGA 3FJSA 4XJ8A 2HWB3 4V2WA 4IL7A 1QWRA 4FPOB 4XTPA 4BB3A 2A70A 5M0TA 1LOBA 3Q8EA 4R4XA 1AR63 3EMRA 2DURA 4GZ9A 1O4ZA 3EYPA 4JKLA 3VBHC 3M3OA 4FPEA 1RUH2 5DPNA 3GZAA 3OGSA 1FPN1 2EALA 1NXD1 2DVFA 2QQKA 5E16A 2VZUA 1I9RA 1BMV1 3TYJA 4I3PA 1HW5A 4AFCA 2QE3A 1QKQA 3FMGA 5JSRA 1O7FA 1OH3A 4CDUC 2XXZA 3I3BA 1H8TB 2RVAA 3POBA 5DZEA 3AXEA 5DN2A 1VRH3 5A32A 4MX3A 4PQ9A 4AEDA 1OQDA 2F6BA 3K4DA 3VHRA 4W65A 5EFUA 3SQOA 1EP0A 1FX5A 2XLAA 2BRTA 3AVRA 5F5AA 1NT0A 3ASIA 5KC5A 4O9EA 4FQ4A 4H55A 1W8NA 2WS91 5A3NA 2OT7A 2QQNA 2RDNA 4FFGA 1UX7A 1JZ7A 4BIOA 1LKNA 2NN8A 3VBSC 2EAKA 4TSVA 5JPNB 3BGAA 1KDKA 1RUE1 2VNVA 4W6XA 2RMU1 2RS31 4QKBA 1DGWX 2RDSA 3I2DA 2VMDA 5GLTA 4AK3A 4EE2A 1L7QA 2EICA 2SLIA 4FAGA 5FOBB 3UL2A 2BFUS 5F2WA 5T5PA 2XUMA 3FX3A 1BEV2 3JB8A 2LRPA 3PL0A 4ZZ8A 5BV6A 4XJUA 4JDNA 5E89A 5GZDA 3WVJA 1AR73 2BV4A 1WLWA 2CNAA 2AC1A 1UMZA 4QD2A 1JZ6A 1LHWA 3JBG1 4TN7A 4DEQA 3I3MA 3T2TA 1MZEA 3ST7A 3BCWA 2R063 4BYYA 1MQTA 4D7YA 5FWJA 2W39A 2YZ4A 4WM8B 4XHXA 1RUD2 2ZKNA 4OHZA 2CWMA 3VHOA 2J1AA 1GBGA 2IXHA 1O6UA 3WNLA 1BCXA 4M3CB 2IXLA 4XF0A 2VL4A 1W9TA 3SCHA 3BVCA 2WT2A 4YFWA 1TME2 4UWDA 1UKGA 2OW4A 3N36A 1CIWA 4J1XA 4Q4V2 1GR3A 2QQJA 1O8SA 1SFNA 1W6MA 4LOSA 1UYZA 2Z69A 2HWC2 3U4SA 1HQNA 2FDIA 4QM9A 1Q5OA 4UBHA 1S1AA 5DUUA 5LW9A 2VPVA 5I8TA 1UZVA 3KHBA 4LUKA 3M4FA 1UMIA 1AX2A 4A44A 3W5MA 1H1IA 1VALA 3FFZA 3VDAA 2D44A 3D4KA 2DFBA 1FPN3 1PIV3 2BOIA 2VUAA 2WRAA 1AYM2 1GSLA 2YMZA 4AQ2A 5FYVA 1TVGA 3HNYM 5BNOC 4WV8A 5FJKA 1CVNA 2ZEYA 3NMBA 4BK4A 3TRSB 3NRUA 4K8FA 4FOYA 1ZVFA 3I3DA 3O5SA 5FKBA 4OQ9A 3ZXEA 2PAKA 5HCHA 4XJZA 2MPFA 2CDPA 2ZCWA 4AFBA 3ZDVA 1UY4A 1PGW1 3WF2A 2WAAA 3PVEA 5E1RA 5A32B 4LHNA 5FLIA 3N9MA 4M3CE 4SBVA 1JOPA 2PFWA 3GCWA 2I45A 2WS93 4HONA 4RHV2 1Y3TA 4Y3OA 4AVBA 5FREA 2DDUA 4DZGA 1HRV1 3ZXLA 2DCZA 1YIPA 2FDGA 4COYA 5IAXA 2AYHA 2VD7A 4AHZA 1RUE3 2VW0A 5DAQA 5J09A 3HJRA 4GKYA 2RMU3 4KBZA 1AR93 3W58A 2RS33 1RUI2 2J1TA 4IESA 4IERA 2ZZJA 2D40A 4AHYA 2ZX1A 1OPMA 4OHWA 1HDKA 3OEAA 5A33A 3LFMA 5J36A 4I0BA 4D0QA 1QJX1 4YW7A 3WNOA 5CADA 3EJKA 2DUOA 4GWNA 2A71A 1F8VA 5C6CA 2W1QA 3I97A 2W92A 1OF3A 2VQTA 2ARXA 3MICA 3JB4C 5L73A 2H0VA 4OYUA 4KNCA 3U11A 1Y4WA 5AVAA 1F5JA 3DYOA 3JBG3 2Y6HA 3NKGA 1XNBA 4BPZA 2VZPA 5GKAC 4ZXKA 4WM7C 4LHKA 4OUSA 2VC9A 4KQ7A 3WOGA 4XE9A 3KVBA 4Q5OA 3I59A 1J84A 1B09A 1GLHA 1MQTB 4UW5A 4QX0A 1GP6A 3AXDA 3OJBA 3VGIA 3AJZA 3I2JA 2VW1A 2EXKA 5E8AA 5CB7A 1S0BA 1UU4A 5A7PA 4Z2AA 1J59A 2X05A 5FZ0A 5FPZA 3W5NA 4XFGA 1ODMA 1UNBA 1DGWA 1MEC1 2VH9A 1JH5A 5FYYA 4J1WA 5EHDA 4CTEA 4RD7A 2W08A 3M3IA 4INDA 1W6MB 4XIOA 1VBC1 3UGGA 2WFPA 5FY8A 2A6VA 3KS7A 4IETA 2BGPA 2A75A 2EXJA 2WFF1 4CP1A 5ACA2 4A6SA 1RGSA 3ILNA 4FPHA 4MG2A 1K45A 1VJ2A 1O3QA 4CCEA 3PVNA 4CDUA 1RUNA 5TSWA 4XOGA 3FHAA 4KWKA 1UIKA 5F32A 3ES1A 1HN0A 5FY9A 3WR0A 3R6SA 4AVAA 3DCQA 1H4GA 1KDMA 3OB8A 1AXKA 1LJ7A 1QJU1 2GC2A 2NPIA 2ZHLA 2R6QA 4PJYA 4R9AA 3MIFA 3ZSJA 3WCSA 3MYXA 2WJSA 2YU1A 5FWEA 3OPWA 1JN2P 5DZFA 3WX5A 2QQLA 2ZGTA 5JXJA 2RS12 1WLDA 2QFEA 2LUWA 1S0FA 3RZGA 3AKSA 5C8CC 4ZU4A 1HRV3 3LA3A 1VP6A 3VBSA 2VOVA 5FP8A 3NAPA 2QJVA 1VIWB 3JXSA 2Q8CA 4QU1A 4XQ4A 2P3JA 5AFEA 1DZQA 1WCKA 2HH9A 4YW3A 3VD9A 2JICA 2V72A 3LCPA 4YLZA 2DVAA 2Z4FA 2XKPA 2J22A 3BODA 4OUMA 3FLPA 4BJ0A 2WIIB 1IG0A 1UOJA 2JG9A 1QJX3 2Y33A 2EIDA 1CJPA 4JTOA 1OA4A 2Y38A 2Q8EA 1LEMA 3ZPYA 5A3PA 4DPNA 1HXS2 3UGHA 5A33B 2BQPA 4H3WA 2OZJA 1ND3C 1HKDA 1IQDC 1RUH1 1FOD2 2UWAA 3HT1A 1JI6A 3BIWE 2WNUA 3PUIA 4GJYA 4CU7A 1QJZA 5GZCA 2AEYA 4HMZA 5IHRA 5JSOA 5JMCA 4B1LA 3H3ZA 2BERA 3WP5A 1G9BA 1I1EA 3V0BA 4CRQA 2E53A 2XL7A 3H8UA 2GAUA 3O12A 2IXIA 2JEMA 5FZMA 4AXOA 1SHWB 3RZMA 4XF1A 4JGZC 2QQUA 3VLBB 5CG9A 1W8WA 3DYMA 2GH2A 2JDKA 3GDBA 4N7UA 5F39A 4CP0A 3U75A 4DRVA 1N3OA 4C0BA 2A1XA 1W04A 4QXCA 2BU9A 3FUQA 2WZ8A 1GMMA 3I59B 3SISA 2X10A 2ILMA 1OFNA 1YCIA 2P3YA 3AM2A 2J1UA 2KR2A 4I0WB 2RV9A 1JMUB 1WW7A 2D7FA 1AXZA 1H1AA 4PHZA 1RHI3 4ZU5A 3PDQA 4LT5A 3H7JA 2ZTNA 5JIUA 1VBC3 4FPKA 4XJWA 2ARAA 2HYKA 1PVXA 1XQNA 3AP9A 3BYWA 5FUIA 3ELNA 5C3QA 4PLMA 4NIIA 3APBA 5A6ZA 3VBHB 3SC7X 2WFF3 4P9XA 4RSUA 3FZ3A 2DCJA 5D2AA 4BZ4A 3UKNA 3ZM8A 5BNOA 3DECA 5IUQA 3ORJA 2HWD1 3LEGA 3M3EA 4BE3A 5DDJ1 1DQ4A 2Z79A 3A0KA 3T08A 3IZOA 4RR3C 1JODA 1UCXA 3CLPA 3PJYA 2J1VA 4AI1A 2R16A 3RMYA 4R8HA 4CDUB 4E27A 3ACIA 4HVQA 1QJU3 2H6BA 5H9PA 3I2GA 5EJ3A 1HX6A 4CCCA 5J98B 2B9VA 2WSUA 3I2FA 1RUD1 4KU7A 4MHRA 2WKKA 3AMNA 1QY4A 4HETA 2VUCA 5FK8A 4UYBA 1SLBA 4MOAA 3SITA 5FZ9A 1C8NA 4YGCA 5AC92 2PHDA 1LESA 2ZAHA 1QJY2 4NHYA 4XZUG 4HZFA 1ZRDA 3BOWA 2YXSA 5ERLA 2C26A 3J26N 1RL3A 5IJRA 3VBSB 2N7GA 4SLIA 3T1MA 5KWRA 3VKMA 3ZLIA 4DIQA 4Q4V1 3USUB 4NPMA 1UU5A 2HWC1 5D21A 5KXCA 3QOPA 3SH5A 2WR9A 1ZBA2 1A8MA 1R1ZA 2MEV1 1WWYA 2IC1A 1PZ7A 4MYEA 5FZOA 2JG9B 1MS8A 1OOPC 2FCTA 4Q2FA 3VKFC 3AKQA 4Q8KA 4MH0E 1Z0HA 2AGSA 3BB6A 5T3NA 3VHNA 1XYPA 3H42B 5A3UA 1OBNA 2QUOA 3ZFGA 2R072 3AZVA 4XVHA 1AYM1 1URXA 1SPPA 2JWPA 4KWLA 4Q4Y2 4W8JA 3URFA 2WNUB 3Q8BA 4J25A 2JD9A 3MW4A 1D0HA 4L0PA 2A6ZA 4QMAA 5I0TA 1IPJA 1QQP2 4RS5A 3SEEA 3ZPOA 3RZLA 3V0BB 2WA3A 1UY0A 2WYSA 1KGYA 2F17A 3DN7A 3VD4A 2OUJA 1AR82 1RB8G 3BALA 4AQ6A 5BNPA 3I2IA 4A3ZA 1POV1 3ACGA 4XZPA 5FY0A 2OYZA 4ZHNA 3I2OA 1UY1A 2Q8DA 3NNLA 4AE2A 4CEYC 1W6QA 5FP4A 3LF7A 3JD72 4W6WA 3GJBA 4XBNA 2Q0AA 2IFRA 4XAEA 3GF6A 2W9XA 1JYXA 2EIBA 2UY8A 1SACA 1US3A 3MGUA 1V6LA 4KBBA 4BMEA 1S0JA 1PNGA 5FYSA 1XE7A 1YUDA 3LEIA 1V00A 4R9BA 1NYWA 4AGGA 1PM4A 2RM23 3WDUA 1FV3A 2TBVA 3MEPA 4ISQA 5LY2A 3MI8A 4JGYA 4D94A 1EYBA 4Q1RA 3DKWA 3T09A 1NX9A 3BUCA 2WA4A 3RWNA 5CKMA 4WVMB 2VCAA 1WCSA 5F3GA 1W8HA 2DTWA 2HWD3 4QHOA 2LM3A 2HEVF 1PZ9A 4DB5A 4KI5M 4CDQA 5DDJ3 2ZGLA 1HB2A 1ZZCA 4Y1XA 4AOCA 5BNOB 5LA1A 1W0PA 1ZX5A 1ZM1A 1HJFA 5F5QA 2WN2A 1Z7S1 3PVBB 4YPJA 4BH9A 4AFAA 4RQPA 3MIEA 1EY2A 1WMEA 2JD4A 4HL0A 3WP6A 3UJOA 1RUD3 1X8EA 4Q29A 4CUBA 5DUVA 5FPBA 1RUOA 3K46A 1K5MA 3VBOA 3O7OA 4LITA 4PDWC 1DZTA 2W3JA 3CHXA 3IWZA 3E6BA 3PTYA 4OLLA 4A7KA 1CX4A 3VZLA 2EIGA 3OSDA 1OF4A 4ARYA 3BTAA 3LSDA 4XFIA 1YHFA 2DVBA 3FWEA 1NE6A 1WLTA 4D6SA 1Y43B 4Q4V3 5KHKA 1V6NA 5C3RA 3CKHA 3KT7A 4JTNA 2HWC3 1A8DA 4I01A 2HJIA 4GB32 1PM7A 2FBEA 4LOTA 4FOQA 5FMCA 2MEV3 2GDFA 4PI0A 4QX5A 2XJPA 2ERFA 2WO3A 1UZYA 1ND3A 1GNZA 5C7GA 5C9AA 1UOGA 1MZFA 1O3TA 4CUAA 1OD5A 1C5IA 2VQAA 2EA7A 2WO1A 3I2HA 4O7XA 5FZOB 5A7WA 3TBDA 2VY0A 5LCWL 4ATEA 2W87A 3RZKA 2BP6A 3E1F1 3HR9A 2VTXJ 3J8F2 1OI6A 2YHJA 5F3EA 3U37A 1UWWA 5IK4A 2OPWA 2ARCA 3M7AA 4E4DX 1SPPB 1X50A 3K3OA 4PF5A 4CEWA 1T6BX 4JGZA 4AQTA 1PVC1 2CDOA 3TEWA 3EBRA 3SKVA 1OUSA 2F4LA 4RS5B 3RGBA 4C90A 4JKMA 4EV0A 3L2HA 4YZ5A 1NCRC 2GC0A 3BN6A 3DPRC 4HKLA 4URTA 4LUMA 2DYCA 4EN9B 3MUZ1 2BNNA 5BNPB 2RJ2A 3NW4A 4OHXA 3FLRA 1W6QB 4FTEA 3J7MA 3N9PA 5ANQA 1KRIA 1LOGA 1QU0A 1LHVA 5BNNC 1CAWA 1DYKA 3VZKA 2QVSB 5JXHA 1VBA2 5E88A 2FD8A 4BU2A 1YEWA 3J4UH 5EV7A 3UKTA 4B4QA 2BEOA 2QQWA 1GNYA 1OKQA 4JGYB 5JOYA 2ZGMA 1OQ1A 3B94A 1HXS1 1ULOA 4AI2A 1F4HA 4N43C 1SEFA 1P8JA 1FOD1 1MZ6A 4OHVA 1MS4A 5ABJA 4TXWA 1AL23 4NRMA 2ZGRA 4RR3A 4UW3A 4NRQA 5JVVA 4AVCA 2X09A 3EHKA 2W1WA 4IXLA 4NR1A 1Z7S3 2OQ7A 3A7QA 1N47A 5EWSA 3KCYA 4MV2A 2HWF1 1DLCA 2OUHA 1LHUA 2XJTA 1CAUA 5L9RA 3O1PA 1Q8QA 2PA7A 4OI4A 3IT8A 4B3NA 4KGQA 4COWA 5KXEA 3N4MA 3QACA 2YC0A 3FBYA 3NVCA 1MS9A 1K42A 2A6YA 2UURA 4UFHA 3ZYJB 3VBOB 2BJSA 2CL2A 2XVGA 1Q43A 5C8CB 3X29B 4GWIA 3VUOA 3CJIC 5FO7B 2VNGA 3DEMA 1BXHA 5JXIA 5KHGA 3MFCA 2D5FA 5FZFA 2JB8A 5A3WA 3OF1A 2AUYA 4AW7A 3ZKYA 4YW2A 2L9LA 3IB3A 4ATFA 3NJXA 4IV1C 5F2SA 5A1LA 3LFIA 1W8UA 5FDBA 1VBD2 1UN1A 1OOPA 4Q26A 2ZXQA 1ND2C 1CZVA 5L7OC 1AYN2 4KH9A 4X8NA 1M4WA 2WZPP 1OMIA 1QEXA 1ND3B 2C5DA 5C9AB 1UW8A 2Q1FA 3UESA 4DEVA 2LROA 5A7WB 3BIEA 5LBEA 1ULEA 2LALA 5FBZA 5EXOA 3GYDA 1PVC3 3E5UA 2V73A 2JIGA 3NO8A 2J42A 3ON7A 2VBBA 5I0SA 2RJLA 1LOEA 2HBUA 2JE9A 2VZTA 4JGZB 1WBLA 4CCKA 5IVCA 1J3PA 4NHMA 5DUXA 4E2GA 3W20A 4WZCA 3INAA 3OCPA 3PJQA 3BPSA 3M8LA 4LJHA 1TNFA 5J3UA 4JAAA 1U12A 3ALQA 4TLGA 3RS6A 4FOVA 5DZGA 5AC91 2D3PA 3C7HA 4NHXA 1QJY1 2XPJA 2G4IA 4XXPA 1GU3A 4LBLA 5FZHA 3NWKA 4M0HA 2XJQA 2RJKA 5BPXA 4BQ2A 2ZGPA 3HAGA 1H2MA 2DVGA 4AVTA 4I3GA 5F9TA 5I0RA 1CAWB 2VZQA 4CE8A 3AK0A 4ARXA 3B7MA 2WINB 5FV3A 3J7NA 1HRI2 3IDBB 3EB7A 2VCMA 4UBGA 5DAPA 4E4ZA 3O1SA 3GZUC 4HSJA 1YXWA 3ILRA 2BWCA 3ZXAC 3VDDC 4CUGA 1JZ2A 3SH3A 4CZSA 2HEWF 5FUNA 1NZIA 2R071 4HOOA 5FY7A 3WD5A 4EN0A 4EWEA 2RS52 1XSQA 2ZX0A 2JIJA 1ZRCA 1DIWA 1RUF2 5ABJB 4PI2A 2QQPA 4E4HA 3MLKA 4RR3B 1ZNPA 1GICA 3S0MA 2HWF3 2VBDA 2WNEA 3MIHA 4Z07A 3LD8A 4FPJA 2XHKA 3VDCA 5HCFA 2OA2A 1ENXA 1IQAA 1QXPA 5FPVA 3T4HB 1CAUB 4Y5TA 3VZJA 2ZHMA 3ZSMA 3FE5A 1XNKA 4LO8A 4UW6A 2ZAAA 5FR3A 4F8AA 4UFKA 4LBOA 1RVF3 3T0DA 4PIXA 2PLV2 4W6YA 3TOJA 5CIRA 1U5IA 3H7YA 1OHFA 4XF4A 4XEZA 3UK9A 5F7UA 2QZ2A 1EV12 2CGNA 4AEJA 4Q1PA 4XJ9A 2R043 3WNPA 4A41A 2O8QA 1F4AA 2VQ0A 1G8WA 4CCDA 5H9QA 3HWJA 5K0UB 5DMYA 4ZS3A 3N9QA 2GZWA 4Y22A 1CZSA 2E33A 4BA6A 1RMU1 2PQQA 1NA1C 4CDWC 1OOPB 4BCUA 4P5HA 1B35A 4PBPA 4CCMA 1SZBA 4LTAA 2ZBJA 1CWPA 1RC6A 4OUEA 4TWTA 1R1A2 4IGOA 4OFGA 4CDXC 2ZMLA 2WSVA 1DP0A 4R9CA 3WDXA 1NKGA 1X82A 2PHRA 3DUIA 3POGA 4P08A 4NIDA 2A3YA 3R4UA 1W9WA 2AZ5A 5HBAA 4GH4C 2CU5A 4ZS2A 2BVBA 3CL1A 3LE0A 4EWAA 5LRRA 1IGOA 1OC1A 1NCRA 1OXCA 3DPRA 4Q0VA 3U07A 2V4VA 2YY1A 3O0VA 1IHMA 3NL1A 5HI0A 2QNKA 2ZGQA 1J3RA 1JW6A 2J1RA 2ZX3A 5J1XA 4IE7A 1ZRRA 5FXXA 3T2OA 1QJY3 2X5IC 3A22A 2C9AA 1N1YA 2YFZA 3AP7A 3M3CA 5BNNA 5CEHA 3VD7A 1RUC2 4JX0A 1O91A 4RFT0 2AENA 2ZZQA 4MHUA 1EPZA 4MO3M 2OIIA 4GIQA 1BZWA 1YO8A 5JR7B 5K0UC 3T0AA 1NY71 4E9KA 1CN1A 5IW0A 2YBKA 3D5OA 4XFAA 3MDPA 4YZ4A 2GNBA 2JDNA 4LBJA 5IK8A 5DQ0A 5CBLA 4LULA 2D3RA 1Y9MA 3PMSA 2RG4A 2ZEZA 2R073 4XTMA 1Y7BA 5HCAA 2DUQA 1LU2A 3QD6A 1R082 3J8F1 1KEXA 2NYYA 5D1IA 3TEXA 1E5HA 1I6XA 1QOTA 4MGZE 1XE8A 4P14A 3ZIXA 2WZR3 1IS6A 2R0HA 4Y33A 3VKOA 2K2SA 2DV9A 3OBAA 1DQ5A 2VCBA 4AYUA 3NV3A 3CIHA 4MSVA 1IS5A 1ULPA 2C4XA 5F37A 3I8TA 4QXKA 5IT6A 1V6MA 4PDWB 1RJ8A 3ZXKA 1D0GA 1KITA 2JX9A 1DHKB 1NLSA 1XBFA 1XU2A 3AYEA 3CJIA 4AFDA 5EJZB 5IVVA 1LEDA 2B39A 2VNOA 1BK1A 1H1MA 1C8M1 2OX0A 2GNDA 3M3QA 4N8MA 1SCSA 4OULA 1ZBE2 2IXCA 3KF5A 1PZ8A 4IE0A 5GALA 4IV1A 3G6JB 1XU1A 4TLFA 5FZIA 5JAXA 4F7ZA 1VBA1 4HN0A 4YYOA 1XSRA 1QDOA 4MUVA 2RHPA 1MPXA 5L7OA 1REDA 1RMU3 1H2LA 4XCAA 1D4VB 2ENRA 2B8MA 4Y22B 3WF3A 1AJOA 1DZRA 4XBQA 4FXKB 4QQLA 2VUJA 5CNAA 5CFDC 4DQAA 3GBGA 1UXZA 2JG8C 4Z82A 5JLVA 3WNMA 1B35B 1Z78A 2PHFA 4LBQA 3FHIB 1XJAA 4JHTA 5C70A 3S5AA 4JHZA 3T4VA 2O0OA 3RZZA 3LWCA 3WHUA 4Y1UA 1AVBA 4FO9A 5G04L 4A6OA 2VVFA 4N53A 4QAWA 2G19A 3ZYIB 4URAA 2CYFA 1HB1A 1NCRB 3DPRB 3BI3A 2TNFA 3FFQA 3IBMA 1W2TA 1YNAA 2HKXA 1KFXL 2VMHA 1MS3A 3HQUA 1GWKA 1VMHA 4HVRA 3AB0A 1UQXA 1ZYBA 1S0CA 5CAZA 2EAAA 1YFWA 2D93A 3AL5A 3E5XA 5BNNB 4N7IA 4FT8A 1JZ4A 4L11A 4YZ3A 4ES9A 3BOPA 4D7TA 3GJAA 3OUIA 4EN6B 1VBD1 4QPGC 5L9BA 4EQVA 3ZMOA 4AG4A 3WCRA 3VDDA 4FFIA 1IPKA 5FAXA 3S57A 1AYN1 3VBRC 2XBO1 2YGMA 4H14A 4BQ3A 1VBB2 2XONA 3R4DB 3J8F3 1GP5A 2XUEA 1KQRA 2Z42A 1W8TA 1DBNA 1DGRN 3A21A 2ADDA 4NJ4A 5FIXA 4BQ4A 1MS5A 2XMLA 3GHNA 1Q8VA 5BUVA 2ETEA 1ZA7A 4K20A 1DYOA 2Q30A 1WGPA 3CBNA 3AYCA 1BJQA 1GZCA 2B7YA 3ZYPA 4MGYE 3N7LA 1E5SA 1CX1A 1YQ2A 3VBUC 1UIJA 4AEMA 1BYHA 1S4CA 1QH6A 4H7MA 1KJRA 1SLTA 2CHHA 4IEYA 3RNSA 2OS2A 2V4AA 4Q8LA 3VBHA 3KSCA 1C8M3 1HQWA 1ASJ2 2BDRA 2XWJB 3CJIB 4K6BA 5LK5A 2P1BA 4QQPA 2WZEA 1FMD2 2VZSA 3OOXA 4YVWC 5FZ7A 5FZGA 5JI7A 4CCLA 1LB2A 2WUHA 1I5PA 4XBLA 3HN3A 5IWFA 4EYUA 3ACFA 1C1LA 1YYNA 2YC4A 1KXGA 1NQJA 3NKTA 1W2OA 2ZMNA 4IV1B 4COUA 1PMIA 1JBCA 1HB3A 1I3HA 1VMJA 1Y9QA 2PMWB 1F31A 3O0WA 4YWAA 5FZ4A 4C8DA 1ND2B 2VZ3A 3TN91 4LBMA 5L7OB 4CDXA 3IAPA 3RYKA 5GLVA 3WW4A 5FPXA 2PHWA 3K2OA 1XNAA 1DF0A 2XQRA 4I0AA 4B7KA 2RR11 3CZJA 1LNSA 4GH4A 4W4ZA 3VN4A 4COZA 4V1PA 1UF2C 5FLJA 1AX1A 2Q4SA 3WINE 1WCUA 4LBQB 3MFAA 3LOIA 3ZDSA 4AI8A 1WLCA 5FRAA 3USUA 3KWVA 3N7KA 5FZEA 4QHBA 4COVA 2DFCA 2VM9A 3KHCA 2E63A 2K0GA 4N53B 2E7AA 4PF1A 2R32A 2R30A 1O3SA 5A1AA 4E2SA 2DU0A 4OCTA 3A4UA 4DRRA 1RUG2 2P3KA 2VMFA 3B9CA 5KHHA 1DCSA 1J1LA 1OVSA 1KS4A 4HKWA 4CP9B 4ZZ5A 1DU3D 1BHGA 1AXYA 4E4SA 1NCQC 1ZRFA 1UXXX 2CSGA 1X33A 1H6YA 3LDBA 5FBJA 5K0UA 1OLRA 1SDWA 4CXWA 1IKQA 3KZ4C 5F3CA 1TQ5A 1F35A 3ES4A 1VBD3 2BWAA 3LOBA 3SNMA 1EUUA 4FXGB 2XGXA 4BISA 4LO7A 1OQEA 3GBWA 1DG6A 3ZOIA 1UPSA 1A6CA 2WN3A 3OEBA 1BBT2 2Y34A 2XBO3 4K40A 4QB1A 4X8PA 5BYNA 2PHTA 5E6HA 2HWE2 3VDDB 3MPBA 3OPTA 3THDA 2VVDA 1R1A1 4WZFA 4KMQA 3B00A 4QPIC 3VHPA 4HG6B 2ARBA 2QCSB 1OA2A 1VBE2 3AYDA 1YLLA 2JKBA 3OPZA 3TAYA 5JUVA 3WW2A 4XHBA 4BK5A 4LHSA 1MEC3 1COV2 1QOSA 2GSYA 2JDAA 4IE6A 1JUHA 4QKDA 3SKJE 2Q1ZB 3C7OA 4HBNA 3ZXJA 1PK6C 3J9SA 3PMEA 3H0OA 2JDYA 1JYIA 2AH2A 5C4WC 3ZN6A 4WVMA 1W2NA 2B5HA 2HWB2 2E7QA 4A4AA 4AQSA 2FZ1A 5FP9A 2Y64A 5LY1A 5EP9A 1ULFA 2NMNA 3DKQA 4Q4W2 1BEV1 1L3JA 1JOBA 3THPA 3KB5A 2GU9A 4HXCA 3H3UA 4Q0QA 4AVSA 4FOWA 2W94A 2YBPA 3E6CC 4YGEA 3TN93 2CAUA 1RUJ2 3HD8B 2UWBA 1GOFA 3ZFEC 4JDMA 1WKYA 5FO9B 1FI2A 4IEPA 5F3IA 2QDRA 3K75B 4CDXB 5IVEA 3F2ZA 3RI8A 5DXDA 5FYHA 2CY6A 1HV1A 5H9SA 2RR13 1R081 1NLQA 1WCQA 1JHNA 3MLJA 2FQPA 1S0IA 4ASLA 2LTNA 1TEIA 2JKXA 3VBFC 4A2UA 4FAHA 2GC1A 4GH4B 5FZCA 4DNYA 4FTSA 2EXIA 3C3VA 4Y1ZA 1TME1 3WDTA 4AHXA 5A3LA 3MV01 3RZJA 2FCUA 4O61A 3MPPG 5JZGC 5DUWA 3ZXDA 1POQA 2ZGKA 3ZYGA 2VMEA 2E51A 2P2KA 3AZZA 2DVDA 1WD3A 3PURA 3WY6A 3PU8A 1UD1A 1J58A 5C71A 2X5IB 1Q3EA 4CCJA 4H7LA 3POFA 3FBMA 1BVP1 1RUH3 1YFYA 3KLSA 1ALYA 4LNVA 3VB9A 3L9JT 4L8QA 2Q1MA 5CISA 2ZX2A 5A70A 4QPGA 1XYNA 4WM7A 4GAZA 5IK5A 1DQ2A 2XOMA 3Q8AA 1RINA 1LOCA 5EJ1B 5D8AC 4BM8A 5I93A 4LIUA 4CU6A 2PELA 5F6LB 1NUKA 4YW1A 5F6KA 2ZPXA 3AP4A 4GJZA 5FKCA 4QQ2A 3ZKUA 2BBVA 4Y5Z0 4DO0A 1J83A 1H8TC 4YNIA 5I91A 2X8KA 2VMGA 2R062 2BTVC 1OKOA 3ZFFC 4RHV1 3WDYA 4LO4B 5FY4A 2BW8A 1WMDA 2JB4A 4W50A 4V2VA 1QNYA 1DQ6A 1GUIA 1XNCA 1V6KA 4NMIA 3V56A 1ZZ7A 5EPAA 5DABA 3VBUA 4U2AA 3DV8A 2HLEA 5K8SA 3LIGA 1GWLA 1DGLA 2AACA 3AMHA 4IEVA 4QX7A 4YVSC 3TB0A 1RUI1 4QHZA 3ZVXA 5JOWA 2YV8A 3T30A 5GLUA 5C3OA 1HV0A 3M70A 4WVZA 1UO9A 2E32A 2IXKA 3CZUA 5FCCA 4BWOA 2ZHKA 4PIZA 5IYYA 1WMXA 2GMPA 5GJ6A 3ZN6B 4FPLA 1BEV3 4R52A 1UZZA 2P4EA 5CFCC 4NHKA 1S2EA 3JZVA 4AGRA 4HSLA 2YUEA 4BLIA 5F1RA 5G05L 3MHZA 4OMCA 1YI7A 1FPN2 1PIV2 4N9HA 3TEYA 3AVSA 3MF6A 1IZ3A 3W21A 2EF6A 2JDHA 1VAMA 3G7DA 3ZX7A 4CXXA 3IIIA 1BMV2 3OGRA 2VECA 3BKZA 2G9GA 3U10A 1JYNA 4NWWA 5FYMA 1VBB1 2D6KA 2K9ZA 1R083 3KQ4B 5C8CA 4Q4X2 4ASKA 2A5ZA 4WM8C 1W90A 2W0XA 1C5HA 3WUDA 4AI3A 1LOFC 1MZ5A 4BDVB 5LEJA 2R49A 3SCFA 1TME3 2BPA2 3LDRA 1T2XA 1NG0A 1LECA 3JCIA 4BQ5A 5KXDA 1FYUA 2WS92 4Q0PA 1CPMA 2BGCA 1RITA 3CDZB 1CR7A 3OYWA 5FXVA 3RYPA 4AR2A 5I0DA 3HQXA 4ES8A 1FV2A 4B4PA 4Q0SA 1JXNA 2RMU2 3ECQA 3DGTA 1AR92 3O1OA 1NCQA 2RS32 3JQXA 4IGQA 5IVYA 4LBKA 2JDPA 4KWUA 4EZ4A 3LKJA 4YARA 4F3JA 4ITCA 1OVPA 2D6PA 5ACA1 1AYM3 2V5YA 4JVAA 3I49A 1CD3G 5C33A 1NZCA 2ZKLA 4XFHA 2FDHA 2YPJA 3WUCA 4NAOA 1CONA 4QPGB 2P3IA 4QX2A 4WM7B 3IDCB 3SEPA 2RDQA 4ET7A 5CG8A 2XKOA 1ONAA 3WG4A 3VBRB 2ET1A 1K3IA 2E26A 3JBG2 3OD0A 5DAVA 5T54A 4BMBA 3WQ7A 1IG3A 5LB6A 2GP3A 1CAVA 4GMP1 1POV3 2GMEA 2BUKA 4B1MA 3QH6A 2RS11 4RHV3 4AI0A 3FHQA 4L9BA 2XL9A 1LTEA 3P3NA 3RRDA 4NUBA 1CAXA 3ZYHA 2R1BA 3BU7A 4NIHA 2PXJA 2XWBB 3WF0A 4AEDC 2P34A 1PNFA 1V6IA 1SBEA 3WT3A 1SLLA 4N9IA 4QB6A 4HFSA 2MNGA 1Q8SA 4N90A 1PK6A 3VBUB 1RUI3 4TYSA 5LATA 2VXJA 3KT1A 1R64A
chains in the Genus database with same CATH topology
3EXUA 1W6PA 4J6GA 2GNMA 4GALA 4MGIE 1RUG1 4YVWB 1G6NA 1FT9A 3I7DA 4L99A 5T5JA 5C8WA 1Q56A 3RMXA 1ENQA 1QMJA 4LO5B 1QF3A 1VAKA 2VG9A 3TNQA 4YM3A 1W39A 3LGRA 3AMMA 1H9WA 1RIRA 2WT1A 1VBB3 3KGZA 4XW3A 3AZWA 1ULCA 1PGW2 3ZN5A 1VBE1 1MQTC 1UU6A 4HN1A 1ENSA 4LLOA 4KL1A 2DU1A 5JZGA 1YJKA 4MXWA 1GQHA 3DF0A 1HRV2 3LSEA 4OHYA 3H1WA 1V6OA 1V70A 4HKOA 4ORFA 5FMOL 3VZMA 3PNAA 3OYWB 2ZMKA 1U5YA 4S2DA 4XFCA 1APNA 2AR6A 3KQRA 2QZ3A 2E9QA 3ACLA 1RTVA 1NCQB 5ACA3 3B01A 1QJX2 4Q4W1 3WQ0A 2A6WA 5D8AA 3OY8A 4MXVA 5T5OA 1RUJ1 3IM0A 2D3SA 1D2SA 1G9CA 5IK7A 5FQ0A 4IV3C 4GMP3 4CEYA 4L2NA 1TE1B 1W6OB 2FHRA 2RS13 1WBFA 1CAVB 4QGMA 4QGLA 3W9AA 3WDVA 3PVOA 2JE7A 1CAXB 2WT0A 4YVSA 2PN5A 2A3XA 5LK7B 2DTYA 1CQ9A 5I0UA 1O4TA 1PK6B 4D3WA 1ZZ9A 1SBFA 1ZBA1 1RUG3 5C4WB 3LB9A 1RHI2 1HXS3 1H30A 2SBAA 1W6PB 5CFCA 4M01A 1VBC2 1FOD3 1SLIA 5FTTC 4BLJA 3S7IA 3HMYA 4ASMB 3NV2A 1OLQA 4L92A 3WQ1A 4Q4Y1 5FO8B 1GYKA 1QQP1 2WQZC 1H8VA 2JENA 2DCYA 4OI2A 1AR81 4PDWA 2BFUL 1LR5A 3P3PA 4MLOA 2PAEA 4LE4A 3H1MA 4C91A 1QJU2 1LOFA 1OSGA 1WMFA 3GZTB 4KWJA 1IOAA 1S0DA 3AMQA 1UKRA 2PTMA 1DQ0A 5FMOS 5B2GB 5SV8A 4XYXA 3JD71 2YYOA 4YRDA 4TZDA 1IS3A 4KU8A 1JUIA 4YZ1A 4FP3A 1GKBA 2JDZA 4OZXA 5JZGB 1YFUA 4MXWB 1HIXA 3LA2A 4YG6A 2FZ2A 1NXMA 1MR5A 3GALA 4YM0A 3D8CA 1LGBA 3E5QA 4G9SB 4IEQA 2UY9A 3KGLA 2Z5WA 3AP5A 2FMYA 4Q4W3 3IN9A 3N7MA 2W52A 4FPFA 1KJLA 3N7JA 1GFF2 4L97A 2A7AA 2BYVE 4MGKE 5BNQA 3AFGA 2KXLA 1H2KA 1DGRA 2B45X 1XYOA 5D8AB 1RUJ3 1PIV1 1S2KA 3OY8B 3ZO0B 2XJUA 4IEZA 1W2UA 4NN0A 1DYPA 1ULDA 1VB4A 4P9GA 2DF7A 4QT6A 5I8YA 1WW4A 1PO22 1R092 4HPKA 1WCDJ 2VOKA 4FSJA 5FQ0B 4Q4X1 1A3KA 3GBFA 4IQPA 3ZFFB 4CEYB 5AC93 1H0BA 3NV1A 4G4FA 4JQRA 1LGNA 3ETQA 4A7YA 4Z8BA 2PAMA 2ZGOA 4YVSB 3GNEA 2I07B 4GB31 1VLNA 1MVEA 1GQGA 3NAPC 1ZBA3 3AYAA 4EN7B 1QGLA 1OFSA 4PLOA 4N43A 1AR91 2RM22 5GLWA 2CTVA 3TNPB 3UKNA 4S2HA 1NE4A 3RQ0A 5GM0A 4HT1T 3ZMNA 1SQ4A 5CFCB 2I2SA 1X8MA 4META 2UWCA 4C1XA 4Q4Y3 2JG9C 4YGBA 3FUOA 4FPYA 4M3CF 2NLRA 1GZWA 1YIFA 4LO6B 3ATGA 3HBZA 1QQP3 3CEWA 3FLTA 4KG8A 1V9U2 2HWD2 3R05A 2WNUC 1LCLA 5DDJ2 1TMF2 1AR83 1CESA 2JJ6A 3WDWA 2FMDA 4D7SA 3RYRA 3JD73 4Q0UA 3SMHA 3UJQA 1XXNA 1REEA 1AL0G 1FAYA 3OD4A 4P9YA 3RI9A 3H1YA 4B29A 1YRZA 3VZOA 1SLCA 4JV4A 3PHMA 4P9JA 1ND2A 1Q8PA 4JRLA 1SBDA 3WHTA 1QDCA 2BNMA 2NQYA 4WBBA 5KC6A 3USSA 4AWDA 2MEV2 5JOXA 2A3WA 3O14A 4K1ZA 1VAVA 3JQWA 4BIFA 2D6NA 2WQ4A 1D4M2 2ZABA 1N3PA 3D0SA 5T55A 4HK9A 4IV3A 1POV0 5GZFA 3WZ1A 4YW5A 4M00A 1QHDA 4JCKA 2O1QA 2VNRA 2GALA 1ZZBA 4KG0A 4Q4X3 1LHOA 1SLAA 4K3UA 4HPKB 5LRSA 1UL9A 1QOOA 4G3YC 4AEDB 4GQ7A 4LHLA 4XXAA 4Y26A 3Q9OA 1F2NA 4GB33 3L2YA 3D6EA 3ILFA 4RL7A 3W59A 4K21A 1RJ7A 4JDOA 3POWA 3THTA 4R4ZA 1U5ZA 1PO12 4IEWA 4Y1VA 4OI1A 4DXZA 3AJYA 4N43B 2VVEA 4QQOA 5HCBA 3KT4A 2GN7A 2ZHNA 4RGAA 1G86A 4EN8B 3KD4A 3B5LB 1XRUA 3ZIWA 1GV9A 4I09A 1GZWB 4NO4A 1AL22 3NJZA 5CU1A 3ZFGC 4P9LA 2WNVC 4X6QB 1MACA 1EAH2 4YW4A 1PHMA 1Z7S2 2E6VA 3D0JA 4B7EA 1DFQA 4RS5C 3U0ZA 1HQLA 2B46X 3VZNA 1JOJA 2F4PA 3VL8A 3OBTA 3WLUA 2WLQA 3E97A 2OVUA 3JUUA 2RE9A 5BNPC 3WP3A 3RJRA 4EWDA 3TWIA 1VBA3 4AHWA 4XETA 2XJRA 3DL3A 4FBFA 3ME2A 4IEUA 3WP4A 1NA1A 4CDWA 5JI9A 1HRI1 1RHI1 3U4XA 1X36A 3V65A 1A78A 3PLQA 2D6MA 4DMIA 4JGYC 4LA3A 2RS51 2YGLA 1RUF1 2P17A 3ZSLA 2JXAA 4GA9A 4XJAA 1LU1A 3MW2A 4GMP0 2ZOEB 2IXJA 4HVOA 2E7TA 3I4IA 4NVPA 5SV5A 4PLNA 3RJ2X 4CDQC 1AUYA 4IV3B 1PVC2 3IMNA 3UV9A 2GMMA 1C1FA 2X5IA 1WUVA 1X7NA 4ZKTB 4RQPC 3SH4A 2HEYF 2PLV1 1PGL2 2IZWA 5AFBA 1DLLA 4DY5A 2VGDA 5KHIA 1K5MC 4P9IA 3VBOC 1O4YA 5LEKA 4E2QA 1EV11 4BQ1A 4XDQA 3H50A 1DQ1A 4LBNA 2H0BA 3M2MA 1U0AA 3FC0A 2CV6A 3UKVA 3CU7A 4AFMA 2XH6A 4Q27A 1AYN3 3B93A 4NHLA 1V6JA 3WW1A 1BKZA 3WG3A 2B42B 4M0NA 3AFKA 1N1SA 2O8OA 1KFUL 1MVQA 1KD7A 3OTFA 1J1TA 2X29A 4NWVA 1CPNA 1I5ZA 1OA3A 3MIBA 1S2BA 2WLPA 1H9PA 5EZWA 3I54A 1LRHA 1N1VA 3R0RA 2Y26A 3SXWA 4FPCA 3HN1A 2XJVA 1PO21 1BQPA 1R091 2HWF2 2XJSA 3BPZA 4XILA 5CA6A 4CEWC 3M1HA 4A3XA 3QCWA 1Q8OA 3N35A 3N3HA 4Z2WA 1RUC1 4EJRA 5KBFA 2DWRA 4JRAA 1RVF2 3CNAA 4I30A 5BXXA 3HT2A 1AR62 1E57A 4JC1A 2WWSA 3AX4A 3S6PA 1VB2A 5GZEA 2R042 1HRI3 4Z92B 4BHPA 3POSA 1DDLA 5CFDA 4DFSA 1NA1B 1N1TA 4CDWB 2RM21 2JG8A 2QDNA 4QQHA 4XF9A 2XB6C 4XIKA 1UPIA 4RGGA 3AZYA 2ZS6B 2RS53 1RUF3 2CWSA 5JPMB 1VRH2 2D6OX 2D43A 2ZGSA 4ZU7A 2XLGA 3E6DA 1V9U1 3WXPA 2B9UA 3QLQA 2TEPA 2NZ9A 1TMF1 5ABJC 2V09A 4XFFA 4MZUA 4WVWA 2NMOA 4B4RA 5L36A 2Q5TA 1G9DA 5J7MA 3VKLA 2PLV3 1AF9A 1D2QA 4YG3A 4AVVA 2GN3A 5JWPA 1ZA4A 1UX6A 2D6LX 4FTBA 1WW6A 1H4HA 2CGOA 1ZBE1 1EV13 4K7JA 2DUPA 1LOAA 1CJDA 5EYXA 3WG1A 1TNRA 3AMPA 4EROA 5GZGA 3T1LA 3VKNA 3NAPB 2GNTA 1SFYA 3VBRA 1PGSA 5AVPA 2X53S 3WNXA 2R0FA 5CVRA 4YSFA 1AR72 4DOUA 1O5LA 3H9AA 1R1A3 1ZREA 5BY5A 5J37A 3EO6A 1D4M1 5GLZA 2EVXA 3ZXGA 2XVKA 1VR3A 2WNVA 4K1YA 1KS5A 1NOVA 1S0GA 1HLCA 2GH8A 4X6RB 4PIYA 1FATA 1S55A 3WW3A 4O9GA 3IPVA 1PO23 1R093 4S2GA 2ZX4A 3WV6A 2WZR2 3OBRA 4FQZA 1OPOA 1XNDA 4YVWA 2WL1A 5L19A 3MF9A 4UXAA 4FP2A 1RUC3 2PYTA 4FPGA 1UAIA 4CYDA 5A3MA 1AX0A 3R4SA 1T6GC 4B8EA 2VOWA 1IKPA 1PO11 3AKPA 4GXLA 2ZJCA 2PHXA 3IDEA 5CFDB 4HANA 1J3QA 2KA3A 1G9AA 1RMU2 2GC3A 2JG8B 4CP2A 3B3QE 5FOJB 3NSTA 5KHJA 4IEXA 3ZXFA 2VMIA 1V9U3 4LR4A 3S30A 2JECA 3OGJA 4UW4A 1YWKA 4HK8A 1AL21 1TMF3 1O3RA 1LGCA 2A73B 4QPYA 5JDBA 1EAH1 3WG2A 1IS4A 4AEKA 5FFOC 2CGPA 4LA2A 2CAVA 1RUE2 2W68A 1SCRA 1AJKA 1SMVA 4AGVA 4XPVA 2C1FA 1ASJ1 2ET7A 2TUNA 4FCAA 4PCRA 4I2OA 1ZBE3 1FMD1 1U5XA 4R9DA 1H2NA 2P37A 1QH7A 4K9SA 1WD4A 4S2FA 3QH7A 1YFXA 1ZZ8A 2D98A 4XQDA 1NY72 1W6OA 4IEOA 4QPIA 3RDIA 5JSPA 3CF6E 3B02A 4Y24A 1GANA 2D97A 1D4M3 3RPQA 1QXRA 1G9FA 3ENRA 1MS1A 4HLTA 1B35C 5H9RA 4DINB 3ZFGB 4Z1VA 4DS0A 4YFZA 2WNVB 3V0AA 3SHRA 1W6NA 3IPVB 3POYA 4LLFA 5C4WA 4XMAA 3IKWA 3MIGA 2ZACA 4Y20A 4GKXA 4D69A 2VW2A 5I8SA 1PGL1 1LENA 2VU9A 4YZ2A 1N3QA 3CO2A 4RA0A 1WW5A 1C8M2 2UYBA 3A0NA 3AKRA 5T5LA 3ZFEA 1PO13 4A7ZA 2OPKA 3ZN4A 2PHUA 1FXZA 1C57A 1F9KA 3LAGA 3ZSKA 4OI0A 1BBT1 1O5UA 2YROA 4GULA 3RSJA 4XF3A 2ZGNA 3K51A 2HWE1 1YJLA 5T52A 4LE3A 1JYCA 1WA4A 5EYYA 3ZSEA 1F5FA 4NOTA 4YG0A 3VBFA 3IIAA 4AF9A 4F83A 2UU8A 5T50A 4QM8A 3O0XA 2Y0IA 3SLIA 3KMHA 3ROUA 1EAH3 3AZXA 4QU2A 4CDQB 1COV1 2MHFA 2BNOA 4DY3A 1AZDA 2WC2A 1NQDA 3B69A 2IFWA 2G9FA 3MW3A 1ASJ3 1S0EA 4RQPB 1FMD3 2PHLA 2VOXA 3K48A 2Z2SB 2HWB1 3RG0A 3B9IA 1K5MB 2AREA 5DG2A 1LHNA 3MLLA 1RVF1 1AR61 1NLRA 3KCXA 3S7EA 2VULA 1C28A 1C3HA 1CGPA 1LULA 2DCKA 3EQEA 2D5HA 3KCCA 4I02A 1M06G 2R041 5FLHA 1MS0A 3MIDA 1H8TA 3HIFA 2XLFA 4P9WA 2XG3A 2VXRA 3LZZA 1G7YA 3ZFFA 3NV4A 2ATFA 5DG1A 4QPIB 2C0ZA 2A6XA 2XBO2 2R1DA 3ZYRA 1VRH1 4LBQD 1ZZ6A 5HXVA 2I74A 3AP6A 2ZA9A 1AHSA 2IWGB 2OZ6A 5J48A 4WVVA 4YM2A 3VV1A 4XMIA 2XVLA 3D82A 4XFBA 4MVTA 4ISRA 5K9YA 2BVVA 3KM5A 2QKDA 3QBQA 4OVEA 3V0AB 4CEWB 1GNHA 4XQWA 3C2UA 1W6NB 4C0HA 1MEC2 1QXJA 4N53C 4KGGA 4PBOA 1W0OA 2KM2A 4Y4YA 4Y20B 1YI9A 2ES3A 3SCGA 2NM1A 5K7PA 1BVVA 5JIAA 3V64A 1QNWA 4YM1A 2NP0A 3GHMA 1C4RA 1ULGA 2WFF2 2Y0OA 5JOZA 4U36A 1LODA 1ENRA 4NPRA 2UYAA 4YGDA 4LEJA 3JU9A 5KXBA 1EPWA 1BBT3 1REFA 3OGGA 3ZFEB 2HWE3 4BOWA 5JCTA 3MZHA 1AR71 1FNZA 4WM8A 3TN92 1FNYA 3LA7A 1JTZX 3VL9A 1VBE3 2R061 2Q8OA 4GWMA 2ZGUA 4Y1YA 2DCTA 3VBFB 2YDEA 3CJXA 4M3CA 4FVVA 2EXHA 4C1WA 2RR12 1COV3 2H6CA 3AKTA 2WZR1 4QGNA 4ONUA 1GZ9A 3FJSA 4XJ8A 2HWB3 4IL7A 1QWRA 4FPOB 4XTPA 2A70A 1LOBA 4R4XA 1AR63 2DURA 1O4ZA 3VBHC 3M3OA 4FPEA 1RUH2 3GZAA 1FPN1 2EALA 1NXD1 2DVFA 5E16A 1I9RA 1BMV1 3TYJA 4I3PA 1HW5A 4AFCA 2QE3A 1QKQA 3FMGA 5JSRA 1O7FA 4CDUC 1H8TB 5DZEA 3AXEA 5A32A 1VRH3 4MX3A 4PQ9A 4AEDA 1OQDA 2F6BA 3VHRA 4W65A 5EFUA 1EP0A 1FX5A 2XLAA 3ASIA 5KC5A 4O9EA 4FQ4A 4H55A 2WS91 4BIOA 1LKNA 2NN8A 3VBSC 2EAKA 4TSVA 5JPNB 1KDKA 1RUE1 4W6XA 2RMU1 2RS31 1DGWX 3I2DA 5GLTA 4AK3A 2SLIA 4FAGA 5FOBB 3UL2A 2BFUS 5T5PA 2XUMA 3FX3A 1BEV2 3JB8A 5BV6A 4XJUA 4JDNA 5E89A 5GZDA 3WVJA 1AR73 1WLWA 2CNAA 4QD2A 1UMZA 1LHWA 3JBG1 3T2TA 1MZEA 3ST7A 3BCWA 2R063 4BYYA 1MQTA 4D7YA 2W39A 2YZ4A 4WM8B 4XHXA 1RUD2 2ZKNA 4OHZA 2CWMA 3VHOA 1GBGA 2IXHA 1BCXA 4M3CB 2IXLA 4XF0A 3SCHA 2WT2A 4YFWA 1TME2 1UKGA 2OW4A 3N36A 1CIWA 4J1XA 4Q4V2 1GR3A 1W6MA 1SFNA 2Z69A 2HWC2 1HQNA 4QM9A 1Q5OA 4UBHA 1S1AA 5DUUA 2VPVA 5I8TA 4LUKA 3M4FA 1AX2A 1H1IA 1VALA 3FFZA 2D44A 3D4KA 2DFBA 1FPN3 1PIV3 2VUAA 1AYM2 1GSLA 2YMZA 4AQ2A 5BNOC 4WV8A 1CVNA 3TRSB 4K8FA 4FOYA 1ZVFA 3O5SA 3ZXEA 2PAKA 4XJZA 2MPFA 2ZCWA 4AFBA 1PGW1 5E1RA 3PVEA 5A32B 4LHNA 5FLIA 4M3CE 4SBVA 2PFWA 4RHV2 2I45A 2WS93 1Y3TA 4AVBA 5FREA 4DZGA 1HRV1 3ZXLA 2DCZA 1YIPA 4COYA 2AYHA 4AHZA 1RUE3 2VW0A 5J09A 4GKYA 2RMU3 1AR93 3W58A 2RS33 1RUI2 4IESA 4IERA 2ZZJA 2D40A 4AHYA 2ZX1A 1OPMA 4OHWA 1HDKA 5A33A 5J36A 4I0BA 1QJX1 5CADA 3EJKA 2DUOA 4GWNA 2A71A 1F8VA 5C6CA 2ARXA 3MICA 3JB4C 5L73A 2H0VA 3U11A 4KNCA 5AVAA 1F5JA 3JBG3 3NKGA 1XNBA 4BPZA 5GKAC 4ZXKA 4WM7C 4LHKA 4OUSA 4KQ7A 3WOGA 4XE9A 3I59A 1B09A 1GLHA 1MQTB 4UW5A 3AXDA 3OJBA 3VGIA 3AJZA 2VW1A 2EXKA 5E8AA 5CB7A 1S0BA 1UU4A 1J59A 5FPZA 4XFGA 1DGWA 1MEC1 2VH9A 1JH5A 4J1WA 4CTEA 4RD7A 2W08A 3M3IA 4INDA 1W6MB 4XIOA 1VBC1 2WFPA 2A6VA 3KS7A 4IETA 2A75A 2EXJA 2WFF1 4CP1A 5ACA2 1RGSA 3ILNA 4FPHA 1VJ2A 1O3QA 3PVNA 4CDUA 1RUNA 5TSWA 4XOGA 4KWKA 1UIKA 3ES1A 3WR0A 3R6SA 4AVAA 1H4GA 1KDMA 1AXKA 1LJ7A 1QJU1 2GC2A 2NPIA 2ZHLA 2R6QA 4PJYA 4R9AA 3MIFA 3ZSJA 3WCSA 3MYXA 2WJSA 1JN2P 5DZFA 3WX5A 2ZGTA 2RS12 1WLDA 2QFEA 2LUWA 1S0FA 3AKSA 5C8CC 4ZU4A 1HRV3 3LA3A 1VP6A 3VBSA 2VOVA 3NAPA 2QJVA 1VIWB 4XQ4A 2P3JA 5AFEA 1DZQA 1WCKA 4YW3A 2JICA 3LCPA 4YLZA 2DVAA 3BODA 2XKPA 4OUMA 3FLPA 2WIIB 2JG9A 1QJX3 4JTOA 1CJPA 3ZPYA 1OA4A 2Y38A 1LEMA 4DPNA 1HXS2 5A33B 2BQPA 4H3WA 2OZJA 1ND3C 1HKDA 2UWAA 1RUH1 1FOD2 3HT1A 5C9AC 3BIWE 5GZCA 2WNUA 1QJZA 4HMZA 5JSOA 5JMCA 3H3ZA 3WP5A 1I1EA 1G9BA 3V0BA 4CRQA 2E53A 2XL7A 3H8UA 2GAUA 3O12A 2IXIA 2JEMA 4AXOA 4XF1A 4JGZC 3VLBB 5CG9A 4FTSA 4N7UA 2GH2A 4CP0A 4DRVA 1N3OA 4C0BA 3FUQA 3I59B 3SISA 2ILMA 1OFNA 1YCIA 3AM2A 4I0WB 1WW7A 2D7FA 1AXZA 1H1AA 1RHI3 4ZU5A 4LT5A 3H7JA 2ZTNA 5JIUA 1VBC3 4FPKA 4XJWA 2HYKA 1PVXA 1XQNA 3AP9A 3ELNA 4PLMA 3APBA 3VBHB 2WFF3 4P9XA 4RSUA 3FZ3A 2DCJA 4BZ4A 5BNOA 5IUQA 2HWD1 3M3EA 4BE3A 5DDJ1 1DQ4A 2Z79A 3A0KA 4RR3C 3PJYA 1UCXA 3CLPA 4AI1A 4E27A 4CDUB 2R16A 3RMYA 4R8HA 4HVQA 1QJU3 2H6BA 5H9PA 5EJ3A 1HX6A 5J98B 2WSUA 1RUD1 4KU7A 2WKKA 3AMNA 1QY4A 4HETA 1SLBA 3SITA 1C8NA 4YGCA 5AC92 2PHDA 1LESA 2ZAHA 1QJY2 1ZRDA 4HZFA 3BOWA 2YXSA 3J26N 1RL3A 3VBSB 2N7GA 4SLIA 3T1MA 5KWRA 3VKMA 4Q4V1 3USUB 1UU5A 2HWC1 5KXCA 3QOPA 3SH5A 1ZBA2 1A8MA 1R1ZA 2MEV1 2IC1A