2WFF2

Equine rhinitis a virus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
219
structure length
219
Chain Sequence
DRIETTVVGVTIINSQGSVGTTYCYSKPDGRPPSTVSDPVTRLGPTLSRHYTFKVGEWPHSQSHGHAWICPLPSDKLKKMGSFHEVVKAHHLVKNGWDVVVQVNASFAHSGALCVAAVPEYEHTHEKALKWSELEEPAYTYQQLSVFPHQLLNLRTNSSVHLVMPYIGPGPTTNLTLHNPWTIVILILSELTGPGQTVPVTMSVAPIDAMVNGPLPNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1
publication title Equine Rhinitis a Virus and its Low Ph Empty Particle: Clues Towards an Aphthovirus Entry Mechanism?
pubmed doi rcsb
molecule tags Virus
total genus 25
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2009-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wff200
1FOD3 2HWB1 2HWD2 1VRH2 1AYN3 4PDWB 4CDQC 5A32A 4QPIC 1NA1B 4Q4V3 1AYM3 5K0UA 1RUJ3 5CFDB 1HXS3 4GB33 1SMVA 2HWB2 2QQPA 4JGYA 1RUD3 5ACA3 1RHI2 3DPRC 1B35C 1FOD1 1RUH2 1EV13 1MQTB 1AYN1 3VBSC 1CJDA 1OOPA 4NWWA 4CEWB 1F2NA 3NAPB 4Q4V1 1AYM1 1TMF2 1R1A2 3VBUB 1RUJ1 1E57A 2RS33 1HRI3 4IV1C 3M8LA 4GH4A 2TBVA 1HXS1 4RQPB 4GB31 1FOD2 1NY71 1RUD1 4N53B 5ACA1 1AYN2 4WM8B 1EV11 2R043 5K0UC 4Q4V2 1AYM2 3ZFGC 1RUJ2 4RR3B 1D4M3 3CJIB 3VBFA 1AL23 4JGYC 2FZ1A 4GB32 2MEV2 2RMU3 2RS31 1HRI1 5JZGB 1FMD3 1IHMA 1NY72 5ACA2 5D8AB 2X5IC 1OOPB 1EV12 4Q4W3 5FMOL 4CEYC 4SBVA 2R041 1RUG3 4FTSA 3JD73 5BNPA 1D4M1 4GH4C 1HRI2 1W39A 1AL21 2PLV3 2RMU1 1FMD1 4Q4W1 2R042 2RS53 3VBFB 4Q4Y2 2WWSA 2GH8A 1D4M2 1NCRA 1RUG1 1BMV2 3JD71 1AL22 1QQP3 4CDXA 1AR63 2PLV1 4YVSA 5C4WA 5CFCC 1NCQA 4Q4W2 4YVWB 2XBO3 1PIV3 1R093 5CFDA 4N43B 1RUG2 2RS51 1ND2A 5BNPC 4FTEA 2DF7A 4GMP3 1V9U3 3VBHC 3JD72 5C9AC 1QQP1 1AR61 2WFF2 1ZBE3 1AR82 4CDWA 1QJY3 4JGZA 1QJZA 4CEWA 1NCRB 2BFUS 2XBO1 1PIV1 3VBUA 1R091 2R072 2XPJA 1QJX3 1QJU3 4CDXC 4GMP1 1V9U1 1PGW1 4RQPA 1QQP2 4YVSB 1AR62 1RUC3 5C4WB 4PDWC 1NCQB 4N53A 4WM8A 3VBOB 2WS92 1NA1C 2VQ0A 1ZBE1 1C8NA 2HWE3 1ND2B 1QJY1 2XBO2 5CFDC 1R092 4RR3A 2GSYA 1AR92 2WZR3 3CJIA 1VAKA 1QJU1 1QJX1 5JZGA 5D8AA 1MQTC 4QPGB 1RUC1 4CDWB 4JGZB 4WM7A 1ZBE2 5DDJ3 5FMOS 5BNNB 4CEWC 3NAPC 1FPN3 1VBE3 3VBUC 2HWE1 3ZFEB 5ABJB 2WZR1 1QJX2 1QJU2 1ND3A 4RQPC 1RUE3 3HAGA 4N53C 1RUI3 4WM8C 4GMP0 4CDUB 1OPOA 2ZZQA 2HWF3 4BCUA 1VBC3 3VDDA 4RR3C 2HWE2 5DDJ1 5A33A 1FPN1 3CJIC 1HXS2 2WZR2 1VBE1 4Q4X3 5JZGC 1RUD2 5D8AC 1X33A 4WM7B 1OOPC 1RUE1 1R083 1RUI1 1K5MA 1NG0A 5DDJ2 4FTBA 4YVWA 2HWF1 1ASJ3 1COV3 1VBE2 1VBC1 2RS32 4N43A 1ND3B 4EJRA 2IZWA 3J8F3 4RS5A 1F8VA 4Q4X1 1BBT3 2FZ2A 5LK7B 3VBRB 1VB2A 1AUYA 1RUI2 1MEC3 1H8TB 4FSJA 3VDDB 1R081 1AR73 5A33B 1OHFA 4Y4YA 1NOVA 3VBFC 3ZXAC 1VBC2 5L7OB 3JB8A 1Z7S3 1ASJ1 1COV1 2RMU2 3ZFFA 1RMU3 1FMD2 3J8F1 3TN93 5C8CB 3IDEA 5GKAC 1BBT1 1K5MB 1R082 4AEDB 2RM23 1X36A 3VBOA 2ZTNA 1MEC1 4YVWC 1AR71 4N43C 1DDLA 1ASJ2 1COV2 4RS5B 2BPA2 2HWD3 1VRH3 1Z7S1 1VBA3 2PLV2 1AL0G 1RMU1 1POV3 1BBT2 4QPGA 3TN91 4QPIA 1MEC2 5J96B 1AR72 2RM21 2RS52 5BNNA 1NCRC 1ZBA3 4Y5Z0 2RS13 3ZFFB 3ZFEA 5ABJA 3JBG1 1Z7S2 1RHI3 1RUH3 2HWD1 1RMU2 4YVSC 5C4WC 3DPRA 1VRH1 1B35A 1VBA1 1NCQC 3TN92 1POV1 3VBOC 1EAH3 5BNOB 2RM22 4CDUA 1TMF3 1R1A3 1PIV2 1ND2C 3LOBA 2BBVA 4IV3B 1V9U2 1ZBA1 1PGW2 4LLFA 1BEV3 2RS11 4CDQB 2ZAHA 1RHI1 1VBA2 5AC93 2BUKA 1RUH1 1VB4A 4QPIB 4QPGC 4CDWC 1CD3G 4JGZC 1QJY2 1PVC3 1TME3 5BNNC 1EAH1 3ZFGA 1PO13 4RHV3 1TMF1 1R1A1 1ZBA2 4RFT0 2MEV3 2RS12 3ZFEC 5ABJC 3DPRB 1B35B 1BEV1 1RUC2 1C8M3 1A6CA 3VBSB 2X5IA 5AC91 3VBRA 4CDUC 4CEYA 2BFUL 1H8TA 1EAH2 1HRV3 1PVC1 4IV1B 1TME1 2HWC3 5L7OA 1PO11 1RUF3 4RHV1 1HQNA 1POV0 2MEV1 1BEV2 5A32B 4WM7C 5AC92 5K0UB 5C8CA 1C8M1 3ZFGB 4AEDA 4Q4Y3 1FPN2 1PVC2 1TME2 1VBB3 1PO12 2R063 4RHV2 1HRV1 4JGYB 1RB8G 1ND3C 2HWC1 5FOJB 1RUF1 3JB4C 1GFF2 2X5IB 1RUE2 1M06G 4CEYB 1C8M2 3VBRC 5CFCA 1H8TC 3VDDC 2RR13 2HWF2 1PO23 1HRV2 4Q4Y1 5L7OC 4GH4B 2WLPA 1VBB1 2HWC2 1RUF2 3VBHA 2R061 4Q4X2 1RVF3 1BMV1 5C9AA 2WFF3 1VBD3 5C8CC 4NWVA 1AR83 1K5MC 4AEDC 5BNOA 3JBG3 2RR11 2R073 1VBB2 5J98B 1PO21 2R062 4IV3A 4RS5C 3J8F2 1RVF1 4CDQA 3S6PA 4PDWA 5CFCB 1WCDJ 2WS93 2WFF1 1VBD1 1AR81 1NA1A 2RR12 4Z92B 1AR93 5BNPB 1PGL1 1PO22 3VBHB 2HWB3 5C9AB 3ZFFC 2R071 1RVF2 2Y26A 1MQTA 1VBD2 3VBSA 5BNOC 2WS91 1PGL2 3NAPA 1HX6A 3JBG2 4IV3C 4IV1A 1AR91 4CDXB 3FBMA
chains in the Genus database with same CATH superfamily
2VW2A 4M3CA 1HJGA 2HWB1 2C24A 3C8XA 1UNBA 3D8CA 1AYN3 4P9IA 4PDWB 4Y22A 1Q8QA 3U75A 3WG2A 4CDQC 1RINA 5JOXA 5T54A 4ZU4A 2ILMA 3DECA 4Q1RA 3BKZA 3HMYA 2YYOA 3ON7A 3FN9A 4JAAA 1NA1B 3E1F1 1YXWA 4IE5A 5LA0A 5K0UA 3DYOA 3P1IA 5FYMA 2PHLA 5FQ0B 3I2OA 2VY0A 5JXGA 1WMXA 4OULA 2XDVA 4YNIA 1SMVA 2UWBA 4OHWA 5H9PA 1GZ9A 1C1LA 5CVRA 3H7JA 3RI9A 4I01A 1XE7A 5A3LA 1EV13 1LHOA 2IWGB 1CIYA 2NMNA 4GWMA 1YJKA 2Q1FA 4INDA 3ZLIA 4ARYA 5FCCA 3VBSC 4D94A 1OOPA 2OA2A 4FPJA 4QGNA 2AUYA 2K46A 2KM2A 1YJLA 4NAMA 3WW1A 4ARXA 4CEWB 4E4ZA 1W9TA 4AGGA 5F5CA 1NXMA 1R1A2 1HKDA 3I97A 1UW8A 3CMGA 5LY1A 2DFBA 2JG9A 4IV1C 4RFRB 4Q5OA 3M8LA 2TBVA 2OKXA 4B4QA 4GB31 4MGQA 3PMSA 4XILA 3J7HA 4AFDA 2XJSA 1FOD2 4BA6A 5J09A 3EXUA 1F35A 1RUD1 4MHUA 1IS4A 4FOWA 2Q8EA 1URXA 1CAWB 1LGCA 1CAXA 2R043 4XURA 4GWIA 3BIWE 5HCHA 4Q4V2 1AYM2 2JDUA 4NJ4A 1VE0A 1MR5A 1RUJ2 1MVQA 4IGOA 1D4M3 4MGTA 2VZQA 2XONA 5C7GA 3I2HA 3OBRA 4HN1A 2I07B 4JGYC 1KEXA 4BXSV 3V0AB 2RDSA 1HRI1 5JZGB 2QQUA 3MZHA 1QDOA 5ACA2 4OHYA 2JE7A 1APNA 3OY8A 4LO6B 5I0RA 4DZGA 3KCYA 1U12A 1K12A 2J1RA 4QGMA 3VZMA 1WD4A 2A5ZA 4AVVA 4UW4A 5E8AA 4YW4A 1MZFA 4AI8A 2VCCA 3B5LB 4FPGA 3L9JT 3JD73 2PQSA 2Z79A 5CAZA 4LORA 3B3QE 4XVHA 4ZHNA 1X8MA 4H14A 1OXCA 4Y1VA 1LU1A 3D0SA 2VNRA 4LIUA 3ME2A 4FAHA 3KHBA 1FMD1 2VE1A 5FXVA 2VMIA 5HI0A 3H3UA 3PLQA 2D7FA 3RRDA 2FDIA 4K7JA 4FI9A 2XL7A 3I2KA 3KM5A 4MYEA 2RS53 3WUCA 3I59B 2XVKA 5T5JA 3WF1A 4A4AA 5F8PA 2B5HA 3TEXA 1UZZA 1ZZ6A 2XG3A 1RUG1 2G9GA 3T2QA 1REFA 1BMV2 1AR63 4CCKA 5CNAA 3BALA 3LEMA 1GR3A 2ZHMA 4CCLA 1DFQA 1NCQA 2Q1ZB 3RJ2X 2QQLA 1NQDA 2O14A 3AZVA 3WDYA 1WKYA 4CDQA 2C4XA 2WZPP 3ZXJA 1S0DA 2JIJA 3OJBA 3NV4A 1ND2A 1JI6A 4FTEA 1GOFA 5F2WA 1W6MB 2B7YA 4AEKA 1UZWA 3OD4A 2YMZA 4TLFA 4GJYA 5HCAA 4YG3A 5EHDA 1NLSA 5JI7A 1MS8A 1QQP1 3GZUC 5IVCA 4O9EA 3VKLA 3WR0A 2CHHA 3H8UA 4ZY9A 2LW8A 5LA9A 3RZJA 2JE8A 5FFOC 1IOAA 4XFHA 3K48A 5HXVA 2YPDA 1Y9GA 2VQUA 3VKOA 2XBO1 2XKPA 3CF6E 5IVFA 4FOVA 3VZLA 2R072 3ZM8A 1O59A 1SBFA 3K46A 5FV3A 5HCFA 3VKFC 2PXJA 1V9U1 2WA3A 4UF0A 3ZR6A 2WNOA 3BPSA 5K9YA 1YWKA 3WSOA 3D5OA 4BHPA 1PGSA 3GJAA 2UYBA 5FYHA 3MFAA 4WM8A 3MW4A 3OBAA 4XJWA 5IJRA 2OPWA 3CLPA 1XE8A 4E2SA 4CZSA 2GP5A 2ZHNA 4EWAA 2BOJA 4V2VA 1DLLA 2XQXA 5CFDC 5F3CA 4CXYA 3H8XA 3N7LA 2C1FA 2PHDA 5JSRA 2JENA 3BU0A 1OD3A 4CP9A 1JUHA 2ZZJA 4FXGB 3SC7X 3BVCA 2DUQA 4IERA 1ENRA 4FO9A 1RYYA 1MQTC 2VUJA 3WF3A 4CDWB 5J48A 2QQKA 1SPPB 2BNNA 3KCCA 3OYWA 5DN2A 5FZ7A 1G9BA 4Y26A 2HBTA 3VDCA 1W99A 3EJKA 2A6WA 2FBEA 2HKXA 4MGIE 1ZZBA 1H6YA 1S2BA 3NAPC 4YG0A 2XJRA 3VBUC 5LW9A 4Q26A 2MHFA 1NE4A 3MIDA 1O8PA 1D2QA 5FO8B 3FFZA 1QJX2 2Y38A 3U11A 3AL6A 3SQOA 1LOAA 3BPZA 2ARBA 5A6XA 4ZPIA 3W20A 3V56A 1RUI3 2ET7A 1O7FA 5EPAA 5EJZB 3WP3A 3E6CC 2WWUA 4GMP0 1IZ3A 1UYPA 2BP6A 4KG8A 5E16A 2ZZQA 2HWF3 5ANQA 1JZ8A 3LSDA 4R9CA 4RR3C 2HWE2 5DDJ1 4BK4A 5EJ1B 2IXKA 2OQ6A 2WZ8A 3JQXA 1W03A 3PHMA 1HXS2 1N1TA 2WZR2 2YB7A 1VBE1 2HJIA 3DKQA 4AFBA 3HOBA 1HW5A 4R9AA 4YRDA 2ET1A 5KR7A 4UW3A 4TZDA 5FYSA 1OVPA 2NP0A 5JSOA 2WKKA 3SKJE 2DCKA 2Z4FA 3NQHA 1SBEA 2DVBA 4WM7B 3AP9A 1OOPC 3N35A 5A1FA 5FBJA 3QD6A 4TXWA 1WCSA 3SH3A 4ZU7A 3LFIA 2QQJA 2XKOA 3I4IA 5JXHA 1NXD1 5KHGA 3AZWA 1K5MA 1NG0A 2Q5TA 4HN0A 2JG9C 3RPQA 2ORXA 2VOWA 1VBC1 1UZ0A 5FPXA 1YLLA 2RS32 4K8RB 2BDRA 3MLJA 5A7SA 1RJ8A 2W3JA 3HQUA 1F8VA 3WNLA 5LEKA 4Q4X1 5IVEA 2CWMA 3VHRA 2YXSA 4NR1A 3ZKUA 1JOPA 1UXZA 5LK7B 2IFWA 2Z69A 2ZX4A 4A3XA 1H8TB 3BYWA 5IHRA 1R081 5A33B 5C5UA 4ZS3A 1S2EA 4MVTA 2W5FA 2E33A 4PHZA 4AFAA 4XHXA 3PIGA 3SMHA 5L7OB 2K0GA 3JB8A 5KWRA 1H1MA 1GNZA 1V6OA 4UWDA 4BIOA 2ZGTA 1ASJ1 2RMU2 3M2MA 3ZFFA 4FPHA 5LWBA 2SLIA 1SLIA 3THPA 3ZKYA 5LZ6A 1IKPA 3J8F1 1KQRA 1OLRA 3AL5A 4DMIA 3EB7A 4IEPA 1Q8OA 5GKAC 5FUIA 4DO0A 1V70A 3NKGA 2EIDA 1X36A 4YVWC 2FCUA 4NRQA 3O1UA 3NRUA 3ACGA 3USUB 1UMIA 2ZX0A 4HFSA 1HDKA 1DDLA 4RS5B 1W9WA 2IC1A 4B8EA 3NJYA 3RMXA 3IN9A 1CZSA 2GNMA 2PLV2 2WDBA 1DQ0A 3AFGA 5LATA 2D97A 1JOJA 2PTMA 3I2JA 3PTYA 3OB8A 1JU4A 4QPGA 3TN91 4QPIA 1EPZA 1MEC2 4IXLA 3MHZA 1MZ5A 2BZDA 4JC1A 3P6BA 4IE0A 1AR72 2RM21 1GWLA 2W91A 5F39A 3UV9A 2H0VA 2VG9A 2VZRA 1HB3A 3OPZA 4LKFA 5F3GA 2P3IA 2VW0A 4AYUA 5ABJA 2QQMA 3VV1A 4M0HA 3AZZA 1WBFA 2ZACA 4KWUA 5LRSA 1W9FA 3V0BA 1UOBA 3DPRA 3OUHA 1B35A 3A21A 1TEIA 3B02A 1VBA1 1NCQC 4IEWA 5FZ8A 1QDCA 2J1TA 4M3CF 1S0IA 3VBOC 2JDMA 2A6XA 4JVAA 4LOSA 3WNMA 4CDUA 5FWJA 2Y0OA 1R1A3 1PIV2 5CEHA 1ND2C 1S1AA 2R6QA 3ACLA 3M3OA 5CZKA 2BBVA 3LOBA 1HIXA 3W5MA 2JDHA 5ERLA 1UY3A 1PGW2 1W2NA 4QX7A 1AF9A 1OKOA 4WVVA 3UK9A 3WDUA 3K51A 1DHKB 1O3SA 1W8FA 2ZAHA 1H4GA 1W6PA 1RHI1 3E5QA 3G6JB 4MLOA 1CPNA 1HB2A 4ES9A 5BUVA 4K20A 1CD3G 5HXMA 4ASLA 5FZOB 4F8AA 4BU2A 2XJTA 1WCUA 1J83A 2JICA 5BNNC 2CYFA 2IXIA 2RDQA 1BHGA 4LIVA 2CY6A 4IE6A 4LJHA 5FP4A 3IB3A 5FYIA 5FZ4A 4OI1A 4ATEA 1GKBA 3AJZA 3O14A 3MLKA 2Y33A 4AI9A 1IPKA 2QJVA 5FZEA 3J26N 3M3EA 2JJ6A 4W65A 4XCAA 3RZGA 1BEV1 4BLIA 4HSLA 4YZ1A 4CCMA 3D0JA 1C8M3 4QKFA 5A3MA 3EO6A 1W2UA 4Z07A 4HKLA 4LBQA 1W0PA 5AC91 1W04A 4QB1A 3VBRA 1ZZCA 2IFRA 1YCIA 4CEYA 1R64A 2BFUL 2YDEA 3AVRA 4NIGA 1H9PA 1SHWB 4XDQA 1HRV3 3NNJA 3PU3A 1D4VB 3PU8A 4XACA 3WQ0A 2VU9A 5IK5A 1X7NA 2HWC3 1PO11 1RUF3 4M3CB 1VAMA 2WAAA 4UBHA 5ANNA 3RWKX 3MUZ1 1JXNA 1W2TA 1W0OA 5DG1A 4XUQA 2UURA 3SXWA 2MEV1 3U14A 1CR7A 3BOPA 1YI7A 4GZ9A 3VN4A 2QQIA 5BV6A 5EXOA 2HYKA 2I2SA 3HR9A 1PX3A 1EP0A 5FPZA 4BQ4A 1W8WA 5IK7A 5K0UB 4JHZA 4AEDA 1W90A 4FVVA 4O9GA 3LA3A 3THCA 2C9KA 1FPN2 1PVC2 1W3VA 2BGOA 4LBQD 2R063 2ZEYA 4L8QA 2ZHLA 2P3JA 1SDDB 3KLSA 2DWRA 3MF9A 4GAZA 1H2LA 3RQ0A 2CAUA 1C57A 2J22A 3DUIA 1OBNA 2AYHA 1RUE2 2V09A 1QJEA 2X5IB 1GZWA 5DUVA 3DL3A 3VHPA 1LOGA 3LPFA 1JHJA 5DUUA 5FO7B 4D8MA 5EP9A 4LA2A 1ZM1A 1PMJX 4COVA 3K75B 3OEAA 1WA4A 4IE4A 5CFCA 3O0WA 1F15A 5FPLA 3GM8A 2BQPA 1KD7A 1XPWA 5FZHA 5B4NA 4GULA 2CU5A 2CWSA 2WLPA 2DU1A 1VBB1 3C3VA 4KGGA 2WT0A 3CL1A 4PIXA 4CP1A 1WLCA 1O4TA 1VPHA 1RVF3 3MIHA 4I0AA 3KD4A 4Q27A 4XC9A 3JCIA 3EHKA 2ATFA 3LSEA 2VOVA 4B7EA 1CAXB 2BGCA 4CRQA 5C8CC 3LIGA 3MI8A 4QHBA 1DGWA 1K5MC 1PMHX 2JEMA 4DEVA 1W8HA 1E5SA 3ES1A 5BNOA 1GOGA 2A3XA 3OBTA 4HXCA 4Y1UA 3MGUA 2WNEA 2R073 5A7WA 3POWA 3X29B 3A23A 2R30A 5SV5A 1QF3A 2IXCA 4XQWA 3OY8B 1YQCA 2QE3A 5EQUA 4PQQA 5CG9A 1WUVA 2WNUC 1WZXA 4GJZA 4PCRA 5GLZA 3S6PA 4A42A 4BM8A 1WCDJ 4O7XA 5JOWA 5FZ1A 4BDVB 2XJQA 4HT1T 5G04L 1VBD1 4XE9A 1AX2A 1AR81 1GP6A 2BWCA 3J7LA 2JG8C 2B42B 3MICA 1GV9A 2RR12 3IIAA 1V6MA 4N8MA 5EJ3A 2W08A 1PO22 1WW7A 3VBHB 4CU9A 1CQ9A 4IGPA 3HJRA 3L2HA 4M3CE 1QOSA 1CAUA 3ABZA 2YUEA 5FZ9A 3ZFFC 4DXTA 1MZ6A 4IEOA 2DURA 1RL3A 2V73A 4NE9A 4FQZA 2ZGSA 3M3QA 1ENXA 2PHTA 1W6QA 1OLMA 1JUIA 4BISA 2R1DA 3J7NA 3VBSA 1WA6X 5GLWA 2BWAA 3WT3A 3ZXLA 2WS91 1OFSA 2GMMA 3POGA 4O65A 5JSPA 1V6KA 1CAVA 2JDZA 4JCKA 3WDVA 4IV1A 1W9SA 2GC0A 3OGRA 3FBMA 2OIIA 4C8DA 3QCWA 4IEZA 2HWD2 2ID4A 1U5YA 2Y6FA 1MS9A 1VRH2 1G6NA 4V1PA 4N9HA 5LA2A 4AZZA 4ISQA 2VR4A 3WINE 4CCJA 2VTXA 3LZZA 3OD0A 2QQVA 3H1YA 4K6BA 4QPIC 3FX3A 4A2UA 1ZYBA 4XMIA 4AI0A 4XBQA 3FC0A 1XE0A 2D43A 1S0GA 1IS3A 1Q56A 5FRAA 3RGBA 1H8VA 2VVDA 4XXAA 1HXS3 3TEWA 2HWB2 4JGYA 3HN1A 4Q0PA 4R4XA 4A41A 2I74A 4ZXKA 2PELA 4P14A 3CHXA 1U5XA 3DPRC 3E6DA 1B35C 1RUH2 2E51A 2BERA 1LENA 3UNPA 1XNBA 1AYN1 2VW1A 2WL1A 1CJDA 2UU8A 3WNKA 5I0UA 4NWWA 4E4SA 2KD7A 4ZXEA 3IMNA 4AWDA 3CEWA 3A4UA 4WVWA 4EYUA 3T3YA 4WVMA 5FZ0A 1T6BX 2RS33 3H1MA 4KWJA 4AFCA 3H8RA 3AZXA 3ITQA 4UF0B 4XQDA 1CVNA 4WVZA 4AHXA 1H2MA 4AVCA 1JYIA 5A3OA 4QT6A 1BJQA 4XFIA 4DOUA 2FCTA 4WM8B 1SLAA 3ENRA 2WJSA 1EV11 5F3IA 2ZMNA 3ACFA 2WZEA 2ZBJA 4OI4A 2G1MA 1LNSA 1W9YA 4J25A 5CB7A 3I2GA 3N7JA 3WHTA 1YRZA 1WD3A 4E8CA 3PURA 3LFMA 4KGQA 3SKVA 1G9DA 1AL23 3FWEA 2G9FA 4E27A 3G7DA 4GB32 3I49A 2RMU3 4XHBA 3U07A 5I93A 4P00B 5IK8A 4PF5A 3BU7A 3OPTA 1V6NA 4IE7A 3LF7A 5KXCA 4CCCA 3FLPA 4Q8LA 3OYWB 4Q4W3 4XYXA 4PLNA 1REEA 4CEYC 2C26A 4SBVA 5FBZA 4ITCA 3LKJA 1DG6A 2ZOEB 2R041 2CSGA 2E32A 4XFCA 5A3WA 5A1LA 3F95A 4I02A 4FTSA 1AZDA 2OS2A 2ZGKA 5H9RA 4MGYE 1D4M1 2X10A 3TNQA 3VD5A 1LRHA 1HRI2 3FHQA 5FDBA 1AVBA 4LULA 5JUVA 2PLV3 1D7PM 4Q1PA 4MGKE 1LHVA 2D98A 2B45X 3KWVA 5SV8A 2A6VA 3UGGA 4MGZE 5L73A 2OUJA 4LHKA 3VBFB 4Q4Y2 1S0FA 2GH8A 1LESA 4LE4A 4U36A 3FHAA 4P9GA 2BW8A 4OCTA 3BN6A 3VDAA 4XJ9A 1NAEA 2WINB 3AK0A 3JD71 4IUGA 3U0ZA 1HV1A 2W94A 3AYCA 3LQCA 1Y4WA 4R8HA 3ZDSA 2DCYA 1RJ7A 1A34A 1WW5A 4KNCA 5A1AA 4FOQA 5CIRA 4YVSA 3KV6A 4BQ5A 1T6GC 1S55A 5CFCC 3JUUA 3ZOIA 4Z2WA 1GQHA 4PIYA 2GMEA 1PIV3 1VRBA 1R093 3NNGA 4AVTA 4UFLA 2GAUA 2NYYA 3GDBA 5CFDA 1RUG2 1W6NA 1YFWA 2RS51 5BNPC 4P02B 2DF7A 4GMP3 1FV3A 2W9XA 5FLHA 5CADA 2ZGLA 2Q8CA 5CKMA 3N9QA 4LUMA 1OPMA 4FPCA 3I54A 1CN1A 3T4HB 1AR61 1JW6A 4EZ4A 4F7ZA 4MSVA 1K42A 1OQ1A 1Q8PA 1FI2A 5DAPA 4AFMA 1OUSA 1ZBE3 3K3OA 1IS6A 1W05A 5DAWA 2G9ZA 1EUUA 4JGZA 3I7DA 4NUBA 1NCRB 5FXZA 2CNAA 3O12A 5GJ6A 2W46A 5FZKA 3VBUA 1BVP1 2ZCWA 2ZKLA 1QJU3 3NJXA 3LIHA 1WGPA 4XBNA 4CDXC 3E5UA 1U0AA 2VMEA 1QQP2 2Y6HA 5C4WB 2YC2A 2JDNA 4RSUA 4JRLA 4X8PA 3WDXA 1ULOA 3UESA 5GM0A 2D44A 5F5AA 3Q8AA 1SFPA 1SCRA 5IW0A 2JWPA 1QU0A 2D3RA 2VQ0A 1O6UA 3ZYIB 2VXJA 4RA0A 2VO5A 2E63A 2XBO2 2XVLA 4RN5A 2VOTA 4RR3A 3JQWA 3MYXA 4AE2A 4XIOA 5FJHA 5BPXA 5JAXA 1XNAA 2VQTA 2XMLA 5F5QA 4PQ9A 3KT7A 1O91A 1VAKA 1IG0A 4B1MA 3ZSKA 4YZ4A 2C6SA 3A7QA 2ZEXA 4QPGB 3O1TA 4XUTA 1NQJA 3D4KA 5FYBA 4K1ZA 1AXYA 1FT9A 4IL7A 4LR4A 2WSUA 1FPN3 1LODA 5D2AA 4H2AA 2MPFA 2CGNA 3OUIA 5FUPA 2ERFA 4PLMA 4CU7A 4DUVA 3JZVA 5A3UA 5ABJB 4P5HA 5DAXA 2ZGMA 1OLQA 4XJ8A 4RQPC 2OX0A 2CAVA 4Y4RA 3V0BB 1AXZA 1RUE3 4L9BA 3O1VA 4N53C 1UYYA 2NZ9A 3D3AA 3U37A 1X9PA 1ZVFA 4Q2FA 5IVYA 3ZYBA 4BLJA 3WF0A 4CDUB 3W58A 1OA4A 2XH6A 4WZCA 1UY4A 3M4FA 5EFUA 4FAGA 2VECA 3VDDA 3K4AA 3LGRA 3CBNA 5LY2A 2QZ3A 2ZGRA 2EXHA 3CJIC 2DYCA 5DZEA 5JOZA 2J1EA 1XNCA 1W28A 2A70A 1W6PB 1W8UA 1RITA 2PAKA 4CE8A 5FPBA 5D8AC 4ATFA 4J6GA 3VHNA 3IM0A 1CPMA 4DUWA 1OH3A 5C3OA 2ZGNA 4K3UA 4L92A 1LAJA 1RUI1 3VZOA 3T0DA 1OI6A 5DDJ2 4QX0A 4YWAA 1QNWA 3AMHA 4YVWA 3AP5A 4ZZ5A 2J1UA 2HWF1 1COV3 1VBE2 3IDBB 5CYYA 1OURA 4LHLA 1ND3B 3W21A 4EJRA 5C71A 3ZYGA 2W1QA 3F2ZA 1QH7A 2J1SA 4KMQA 1ST8A 2ZXQA 1KDKA 1BBT3 1IKQA 4LBQB 2FZ2A 3ELNA 1DGRA 5FZGA 5LBEA 3VBRB 2FDFA 2JIGA 4FSJA 1UX6A 2D6LX 1YQ6A 3CZJA 3QH6A 1JH5A 1CZTA 3GF6A 1ZZ9A 3MO4A 5LCWL 4UW5A 1K5JA 3ZN6A 1NOVA 5H9SA 1O3RA 3ZXAC 1VBC2 1XQNA 3N7MA 3AX4A 1Z7S3 4XTPA 3TOJA 2L9LA 4CCNA 4F83A 2CGPA 4O61A 1RMU3 1CWPA 4EN9B 4W50A 1HN1A 2CDOA 2V4VA 5FYTA 5A7QA 4OZXA 1DGWX 4YG6A 2IVIB 4NPLA 3GNEA 4TLGA 4YW6A 1R082 4AEDB 5T55A 3AP7A 3VBOA 2DVFA 1DBNA 5F6KA 2VZVA 3Q9OA 3PVOA 4KWKA 3S7IA 3S0MA 1N1SA 1TZOA 4HK9A 4N43C 2XUEA 2BVVA 4BMBA 3T09A 3NWKA 2EIBA 1ASJ2 1GP5A 1STMA 2A73B 4UFMA 2BPA2 2HWD3 4FPFA 2EAAA 4YW1A 2VMCA 1VRH3 2ZPXA 2VC9A 1GZWB 3NNLA 4XBLA 1VR3A 3POYA 5DZGA 4YYOA 1AL0G 4EN7B 1ZNPA 2VZ1A 1J3PA 3KT1A 2VUDA 2DCZA 1UOGA 1GSLA 1NKGA 2Y34A 2B4KA 4F3JA 1TG7A 2YZ4A 5FY1A 2NQYA 1PZ7A 5DG2A 3IDAA 2ZGOA 3U10A 5BNNA 1ZBA3 4Y5Z0 1FNYA 4EV0A 2RS13 4C0BA 3ZIWA 3ZSMA 1J3QA 3GZAA 3JBG1 4MUVA 1HB1A 2WNVB 3ATGA 3N3HA 1RUH3 1OA2A 4NHXA 4YVSC 4AEMA 4LKSA 2PHXA 3EBRA 2XOMA 3T2OA 4GKXA 4XFFA 3TN92 4LXLA 3OBZA 5FY0A 1EAH3 1OVSA 2ADEA 2PQQA 2WYFA 5BNOB 5J1XA 2RM22 4BQXA 2BU9A 1N3QA 2VCAA 2VZ3A 2XJPA 3WP4A 2A6ZA 4Z2AA 1RUOA 1F5JA 3E5XA 2JD9A 3KZ4C 4Y1XA 1A8MA 1HQLA 1NLQA 4LLFA 3RWNA 1YC61 4XTMA 5KC6A 4AQTA 3EMRA 5JPMB 4CDQB 2A1XA 4DEQA 2IXLA 3T1MA 5FY9A 3UKVA 1VBA2 2RV9A 3WF2A 3H42B 2BUKA 2ENRA 3TWIA 2GU9A 3NV2A 4JGZC 1G9CA 5IAXA 3E6BA 1Q8VA 1QJY2 5EYXA 3AMNA 4DFSA 1PHMA 5FYZA 3KHCA 1TME3 3TEZA 1YQ2A 3BCWA 5FREA 3ZFGA 4NIHA 3Q8EA 4RHV3 3CNAA 1L3JA 1R1A1 5F2SA 1CAUB 1ALYA 1GQGA 1UMZA 3ZFEC 1G7YA 3DXTA 5K4LA 4LBKA 4URTA 4D69A 5IT6A 1W6QB 1RUC2 4KH9A 1EPWA 2PYTA 5A3NA 1A6CA 3VBSB 1GUIA 3GCXA 3GHMA 3IMMA 1C1FA 3RS6A 4LEJA 4E9KA 1CJPA 3Q8BA 4JKLA 5FZLA 4YFWA 3RYKA 1LHUA 1HB4A 1C28A 3VKNA 1CAVB 1W6OB 3VKMA 2VGDA 1KS5A 4IV1B 2P2KA 1VLNA 1HQNA 2Q4SA 1POV0 3HBKA 1DZRA 4BWOA 1XNDA 2CGOA 1BEV2 4L11A 1XSRA 4OUSA 3O1OA 4K40A 2W2IA 1UY0A 5AC92 2VMDA 3NKTA 5C8CA 1C8M1 5JDBA 4YZ5A 1GNYA 4SLIA 1JZ4A 2G4IA 1WMEA 4CCOA 4XUOA 2P34A 4Q4Y3 1WMDA 4HKOA 3W9AA 2ZAAA 3VZKA 1LCLA 1PO12 1HRV1 1PNFA 4NHYA 4JGYB 1KDMA 3HNMA 1RB8G 2QQOA 2GMPA 3AXDA 3KGLA 3ZXDA 3L2YA 1S0CA 2HWC1 1RUF1 3POSA 5FOJB 3JB4C 2JX9A 1GFF2 1I5PA 1QOOA 4R52A 4FFHA 2GNTA 2YGLA 1PVXA 2UY9A 2WNUA 4UYBA 2Q8OA 3SH5A 2WIIB 2X05A 3ZX7A 3AYDA 1VMHA 1J58A 1U5IA 3VDDC 5FWEA 1YNAA 2JG8A 4NIAA 3TBDA 1XBFA 2FDHA 5L9VA 2W92A 2EIGA 4KBZA 4A45A 4ZKTB 3KS7A 5HV4A 2ZABA 2R061 4LT5A 5GZGA 4HETA 3ORJA 3B9CA 1BMV1 2ZGQA 5C9AA 5AVAA 3CZUA 1E5HA 2AEYA 2VZSA 2X29A 4XAEA 4LPLA 5FY7A 2ZEZA 1H1AA 4LO8A 3E97A 4I09A 3WVJA 2JDKA 1KFUL 1GMMA 1YUDA 4NWVA 1AX0A 4KU8A 4QQLA 1S2KA 2GC2A 2VM9A 1R1ZA 1SDWA 4BJ0A 2P37A 4PI2A 1Y9MA 4UT5A 3JBG3 1S4CA 3ZVXA 1VBB2 2EXJA 4XIKA 2OT7A 5APAA 3AKPA 5IVJA 1O8SA 2QZ2A 4C1XA 1CESA 3DYPA 1RVF1 4CU6A 4PDWA 1H4HA 3GHNA 3OTFA 3AKTA 3AVSA 2Y6GA 1ODMA 1NA1A 1L7RA 2UWCA 3MLLA 4GWNA 2IVJA 3D6EA 1XB9A 1H9WA 5LB6A 5FP3A 1PGL1 5FQ0A 1PK6C 3J4UH 3S30A 3IBMA 3KVAA 4AHWA 2R071 4HBNA 1TNRA 2EXIA 4LK7A 2NMOA 1DGRN 3HVDA 3WNXA 4CP0A 4XETA 4NMIA 2QTWB 1VBD2 3P3PA 5ISLA 1BK1A 1XYNA 4OZOA 3ZSEA 3O1MA 4QQHA 4QQPA 3C7EA 4KWLA 3U1XA 3ACHA 4I30A 4IV3C 3LEIA 1ZRFA 5LK5A 4HONA 3A0KA 1FOD3 5EWSA 4QM8A 2YFUA 2X8KA 3ACIA 4K1YA 3WHUA 1OMIA 1X82A 4OYUA 3T1LA 2EVXA 2FMDA 3K4ZA 3PNAA 4GKYA 1QXRA 1UAIA 2AH2A 2QDRA 3POJA 5GZCA 5J36A 1F4AA 4Q4V3 1AYM3 4MZUA 2BNOA 1RUJ3 2LRPA 3KF3A 2CV6A 5CFDB 1VALA 5AFEA 3AC0A 3UJOA 4B4RA 4EN0A 4EZHA 2WT2A 2D93A 2IXJA 4TYSA 3PUQA 3S57A 2QQPA 4FFGA 2YC4A 4PIZA 5ACA3 3RZMA 1VIWB 2XJUA 3NW4A 3VGIA 4NOTA 4XEZA 1MQTB 2VNVA 2YHJA 5GALA 5I0TA 4B3NA 5BYNA 1H1IA 4DNYA 1O4YA 4LK6A 3GBGA 3SCGA 3NAPB 4QX3A 1TMF2 4CCDA 3DKWA 5CG8A 3VBUB 3PIJA 2Y64A 1LHWA 2PMWB 4DIQA 1GZTA 2QFEA 1OSGA 2VULA 4CU8A 4YM3A 1WW6A 1JZ3A 4QU1A 1HXS1 4Y22B 5FO9B 1UN1A 1MVEA 1QKQA 1SBDA 2B9VA 1MS4A 3GZTB 1NY71 1KGYA 1QXPA 1AYN2 1RXGA 2DU0A 1I9RA 2JE9A 4QKNA 5A7PA 3CO2A 2VBPA 3H0OA 4YGCA 4JKMA 4XW3A 3ZYHA 3ZFGC 1OF4A 2QBXA 1JMUB 2YFZA 4RR3B 4DXRA 5I91A 3BI3A 3I59A 3OF1A 1ZZ7A 3DYMA 3WQ1A 2WRAA 3WP6A 2WSVA 2FZ1A 3MUY1 5FJKA 5FXXA 3ZO0B 2H0BA 2RS31 5FKCA 5J7MA 4YZ2A 1FXZA 1IHMA 4OQ9A 1UO9A 3WW4A 1J1TA 3RZLA 1OOPB 5A7NA 3WNPA 5C8WA 1EV12 1RC6A 2DVGA 2C0ZA 4YGDA 3DCQA 4QGLA 5FMOL 2ADDA 4GXLA 3QLQA 3RI8A 1GYKA 1H2NA 4QB6A 3MIGA 2JG9B 3WZ1A 4AHYA 1YYNA 2AREA 2BEOA 3HD8B 3M1HA 5BNPA 1TQ5A 2E9QA 4GH4C 2P6CA 2F4LA 3WXPA 1AL21 5IWFA 4G9SB 2RMU1 1QEXA 2WBKA 4RD7A 3K4DA 5KXBA 3IPVA 4QKBA 3V65A 3WEZA 2GN3A 1ZRCA 4Y1YA 1MS1A 2IUWA 3PVNA 4Q4W1 1ULEA 2R042 3DGTA 5BXXA 3B94A 5GLTA 1BYHA 1WWYA 3LPGA 1LEDA 1F9KA 5G05L 4AAXA 1LOCA 2WWSA 1LEMA 4H3WA 5IK4A 1D4M2 1GU3A 4BQYA 4CTEA 5FR3A 2YBPA 1LB2A 3JU9A 2E7QA 3HPNA 2GN7A 1ULCA 5A6QA 4HK8A 4CDXA 1BCXA 4LOTA 5C3SA 5B2GB 1DQ4A 5J3UA 1MPXA 3GCWA 2PLV1 4Y20A 1UU5A 3WD5A 4LKEA 1PZ9A 1Q3EA 2RVAA 4Q0VA 5KXEA 4CP2A 4YVWB 5L9RA 4NIIA 2J7MA 4AF9A 2VOKA 1UKGA 4K8FA 3LAGA 4UI9L 2XVGA 3OEBA 3JD72 2W87A 4CSWA 5IAVA 1OUXA 2QUOA 5FZDA 5C9AC 3GXUA 4CA9A 5FOBB 1US2A 3POEA 3ILNA 4TWTA 4FXKB 3RG0A 1W8TA 1AXKA 5FUNA 5A3PA 1ULGA 4NRPA 4AQ6A 2WFF2 1H30A 4AQ2A 1J3RA 1AJKA 3KB5A 4RGAA 1QJY3 4CDWA 1SPPA 1SACA 3ZXEA 1W06A 3ZN6B 4COWA 3IAPA 1G8WA 1QJZA 3AYEA 3PTRB 2BFUS 5FK7A 2DBNA 4BQ1A 1PIV1 5CU1A 1DIWA 1R091 3PVEA 2XPJA 3HNBM 1QJX3 3HQRA 5EV7A 1OD5A 3WY6A 4GMP1 1OQDA 2E6VA 2VMFA 1PGW1 2GNBA 5JMCA 4RQPA 3GYDA 1HV0A 1RUC3 1TVGA 1X8EA 2Z5WA 1UY1A 1AR62 4DB5A 2W1WA 4PDWC 1NCQB 4W6YA 4MXVA 4N53A 3ZYFA 5A6ZA 1V00A 1WCQA 2RDNA 3OGGA 4IESA 3VBOB 1I5ZA 1NA1C 3K3NA 5A80A 1ZBE1 1C8NA 4YZ3A 3WF4A 5C3PA 4MG2A 2HWE3 1BXHA 1ND2B 1N1YA 4IEVA 4ISRA 1KITA 2AR6A 2CDPA 3BGAA 4M0NA 1AR92 2WZR3 3FLTA 1UU4A 3CJIA 1V6IA 3P3NA 3ZYJB 2VCMA 5FMCA 3UGFA 4D7SA 5JWPA 1QJU1 4NN0A 2FDGA 4BOWA 4AVSA 3QOPA 5JIUA 5D8AA 5E88A 2FMYA 4I3GA 5T50A 2VPVA 4LBNA 1ZA7A 4WM7A 1LGBA 1YI9A 4UFHA 3WUDA 5FMOS 4YSFA 5BNNB 4CEWC 5DQ0A 4PT6A 5F6LB 1O3QA 1LOBA 2JDPA 5FZAA 4B7KA 3FE5A 1B09A 1BZWA 3GALA 3UKNA 4H7MA 2WUHA 3LOIA 1X50A 1ACCA 3SNMA 1RXFA 3TB0A 3HAGA 3I3BA 1VP6A 1YIPA 4AHZA 2GP3A 3BTYA 2ZKNA 4YPJA 1GLHA 1JU3A 4XCBA 1LOEA 2O8OA 2XL9A 4NO4A 5J37A 2B9UA 2VBBA 2WN3A 3DEMA 1QIQA 1O5LA 5A33A 2O1QA 3C7OA 3LA2A 5FY5A 2WO1A 1FPN1 4QPWA 3N7KA 4CP9B 2V5DA 3RFRA 4AEJA 4DRVA 2PHRA 4X6QB 4EWEA 1J59A 2W0XA 4FBFA 5JZGC 2WYSA 1RUD2 4PLOA 2BGPA 3M3IA 3UGHA 1J84A 1UYXA 3IWZA 1X33A 3SCFA 5HPOA 4FQ4A 1XOYA 1RUE1 3AMPA 4OUEA 2DUPA 2VMHA 1PNGA 2VCBA 1QHDA 2D5HA 1DF0A 1VAVA 4X6RB 3ETQA 3PDQA 2OXBA 3MV01 3N9LA 4ZS2A 4MXWA 4N43A 2EIEA 3FFQA 4LBOA 4AVAA 2IZWA 1NE6A 3ZN5A 4RS5A 3KV9A 4COUA 1JOBA 1XC6A 1F31A 2D3SA 3OCPA 2J1VA 5GLUA 3KVBA 5CBLA 1AUYA 1RUI2 1MEC3 2DCTA 3AB0A 4AL9A 4DPNA 3TAYA 5IFPA 2EAKA 1AR73 1Y3TA 4OHVA 3LWCA 2E7AA 5JIAA 4LO4B 4OHXA 3WG3A 2JB4A 4E4DX 2W95A 4BB3A 1BKZA 2PAMA 4BYYA 1QMJA 4YM2A 4Y33A 1COV1 3WCRA 3N9PA 3AKRA 1FMD2 1GWKA 2ZS6B 5JVVA 4CUGA 4C91A 1XU1A 5E1RA 4QQOA 2VUAA 3INAA 4LQRA 3CQOA 4URAA 4A3ZA 1P8JA 5C8CB 3IDEA 4QDRA 4OHZA 5JCTA 1BBT1 1K5MB 2B8MA 2ARCA 2RG4A 2BJSA 5FZ3A 2ZTNA 4L97A 3RNSA 5K8SA 5F37A 3WG4A 2ZX2A 3AP4A 4MH0E 3HBZA 1A78A 2MNGA 1E5RA 1YFXA 2OQ7A 4FPEA 3FHIB 4J1WA 3H50A 2AZ5A 3HNYM 3I2FA 1QGLA 2FQPA 4P9YA 4S2HA 1US3A 4LHNA 4DINB 1Z7S1 1JZ2A 4ASMB 4BK5A 1EUTA 2R49A 4CXXA 3LA7A 2WNUB 3DV8A 1OA3A 3POIA 1QJFA 1RMU1 2PHFA 1UZYA 1POV3 3B01A 2WFPA 4Q0QA 3PUAA 2F6BA 4BMEA 5FYCA 4WZFA 3R0RA 4IW3A 1IPJA 1QOTA 2AEZA 2JG8B 5J96B 4HSJA 1LOFA 3K77A 5FYYA 3H9AA 5C3QA 1FYUA 1DCSA 2JXAA 3ZFFB 3VB9A 3ZFEA 2H6BA 2WO3A 4JQRA 1X9TA 1UQXA 2VZPA 2PFWA 3K2OA 3MIEA 5A6YA 3W59A 2HWD1 2W47A 4PJYA 1VRH1 1LECA 2DVDA 1CZVA 2KR2A 4TTGA 4XF1A 3TYJA 2XWBB 1JYNA 2CL2A 5HCBA 2KXLA 3RZKA 4HMZA 1TMF3 3ZN4A 3FZ3A 1W8OA 5F9TA 1SEFA 3SISA 3PUHA 4LHSA 5F1RA 3PUIA 4YW3A 1V9U2 1ZBA1 5GZEA 2YBKA 2X09A 4MHRA 5F5IA 2RS11 3ES4A 3LE0A 3WNOA 3OUJA 4XUNA 3I3DA 2R16A 1TE1B 1W8NA 2QKDA 2RDRA 5GLVA 1RUH1 1VB4A 2D6KA 3JXSA 3C7HA 3MEPA 4QPIB 4CDWC 1VMJA 4YFZA 3VHOA 4RGGA 3EQEA 3WLUA 5FY8A 4AGVA 4XF3A 1SCSA 1JYWA 3BUCA 4JDMA 1PVC3 1Q43A 1SG3A 1EAH1 1JHNA 2SBAA 1G9AA 3AMMA 1C3HA 2VL4A 4OQ8A 3WW3A 1SFYA 3WDTA 1Y9QA 2BYVE 4LLOA 2ORZA 3AJYA 4RFT0 3R6SA 1WBLA 2DTYA 3I2DA 5FKBA 2N7GA 3LDKA 3DPRB 4P9JA 5KHKA 1B35B 1ULDA 4HZFA 5FLJA 2WQ4A 2J1AA 5FP8A 3QBQA 2X5IA 3RYRA 2BRTA 5EYYA 1ONAA 1HN0A 2LM3A 4HANA 1DQ5A 3QH7A 4QB2A 5T5LA 3V64A 4HLTA 5E89A 3ECQA 1TME1 5CA6A 3BTZA 1HLCA 4RHV1 4K9SA 5T52A 2OW4A 1XYPA 4XDOA 3OG2A 4S2FA 3KT4A 2NLRA 4Y5TA 2YC0A 4Y5SA 4HL0A 3AKQA 3MPBA 3U4SA 3VZJA 2W1UA 5KHIA 2VD7A 3SCHA 1LHNA 2YG0A 3USSA 4P9LA 1NT0A 1M4WA 4WM7C 4Z82A 2GNDA 2YPJA 3MIFA 3MV11 3C7GA 1GOHA 4HG6B 4UBGA 3C7FA 1N47A 5AFBA 2RHPA 4OVEA 4D0QA 3R4SA 5LRRA 3SHRA 3RVHA 2R32A 4LA3A 2QVSB 1EY2A 4QXKA 1YQ8A 1DYPA 2ES3A 3B7MA 3THTA 1UYZA 3M7AA 1YHFA 4X8NA 4XFBA 1C8M2 3AP6A 1BK0A 4CEYB 4CXWA 5HBAA 1H8TC 2RR13 5A7OA 5JI9A 1PO23 4B4PA 3EYPA 1HRV2 2VZUA 4Q4Y1 1IQAA 1I6XA 3DXUA 5KHHA 1OKQA 1PK6A 2PA7A 5TSWA 5DMYA 3RZHA 1NX9A 2HWC2 1UX7A 1RUF2 4R9BA 4UFJA 3VBHA 4L2NA 4HOOA 2NPIA 4Q4X2 1DYOA 5LBCA 4L99A 5DPNA 4QPYA 5FAXA 3T0AA 3ZMNA 1LR5A 4LNVA 1U5ZA 2ARAA 2WFF3 1D0HA 2XGXA 4N9IA 4Y3OA 4E2GA 1G9FA 2A7AA 1S0JA 3ZPOA 2D5FA 1S0EA 2D6NA 3I8TA 5C3RA 3POFA 3WOGA 4QXHA 2VZTA 3CKHA 1JZ5A 3Q8CA 3N9OA 4D6QA 3WW2A 4R9DA 5C70A 4IDZA 2R062 4IV3A 2XQRA 3NVCA 4RS5C 4AOCA 3J8F2 3THDA 2XLFA 5FP9A 1GP4A 2D6PA 3KV4A 3NNMA 2JDYA 4CUAA 3MW2A 3VD4A 4FP2A 1KFXL 5L19A 2VNGA 1QY4A 5CFCB 4Q0SA 2VNOA 1CGPA 4D7YA 5DXDA 2GC3A 3O0VA 5LEJA 2O8QA 4W6WA 1IQDC 4BQWA 5FMDA 5KXDA 1AR93 5BNPB 4Z92B 2XWJB 4BPZA 3WV6A 2A6YA 2HWB3 4MGSA 4JRAA 2E31A 5F32A 5FY4A 2AC1A 3IPVB 4LKDA 4S2DA 1RGSA 1FNZA 1RVF2 1UIKA 1W8ZA 4QDSA 1E5IA 2Y26A 4ET7A 4EWDA 5KHJA 2WQ8A 1DGLA 1QH6A 4YM1A 3U4XA 4NIDA 3NJVA 4IEQA 5BNQA 4H55A 3NO8A 4IQPA 3KMHA 1XJAA 5KC5A 3C2UA 5AVPA 5A7WB 2P3YA 3VL9A 1PGL2 4XJAA 4NROA 4OI0A 5L7OC 4DQAA 3WX5A 2ZMLA 4COYA 4Y24A 4CDXB 4HPKA 5FK8A 4KG0A 1NUKA 4A6OA 3OOXA 2OPKA 4AAPA 3AXEA 1KJLA 3J7MA 4Y20B 3NNFA 2P1BA 1O5UA 2YU2A 2R1BA 4J1XA 3MBWA 4JDOA 5A32A 1LOFC 1F4HA 1UL9A 3T30A 4NHKA 4YW2A 2FD8A 4M4PA 3BB6A 4GB33 3PUSA 3DF0A 3AM2A 4KI5M 4NPRA 3MW3A 2GC1A 4FCAA 5F3EA 1RUD3 4EN8B 3NMBA 1RHI2 1O3TA 3M70A 1Q8SA 4QX1A 3MDPA 4QX5A 1FOD1 2C5DA 4KQ7A 3HT1A 1WCKA 1OQEA 1UOFA 4HKWA 3J9SA 4ORFA 4XOGA 2Q8DA 2PAEA 3AZYA 3I2IA 1IG3A 2XR4A 2OZ6A 1F2NA 5C33A 4HVQA 5IYYA 1YQ5A 4RGKA 4Q4V1 1AYM1 1CONA 1RUJ1 2TUNA 1WLWA 1E57A 1YFUA 3POBA 4NHMA 1HRI3 2JB8A 2F17A 1LTEA 2EALA 1FAYA 4GH4A 2DFCA 2Q1MA 3KQRA 1DP0A 2CTVA 4KU7A 4RQPB 1K45A 4Y1ZA 2F4PA 5ACA1 4N53B 1GBGA 4TN7A 4GQ7A 4EROA 3IAQA 2PHWA 4MV2A 3OPWA 4LITA 4PF1A 2LTNA 3KF5A 3B00A 5LASA 3ZMOA 5FPAA 1SLCA 3AYAA 4JX0A 3KCXA 1SFNA 3T4VA 5K0UC 3UT0A 3AMQA 1JBCA 1ENQA 1OC1A 4IGQA 5D1IA 3CJIB 4A6SA 3VBFA 3HN3A 4AR2A 3IKWA 3B93A 4LTAA 4CPBA 2MEV2 5DABA 5KBFA 4YLZA 1V0AA 2A75A 1FMD3 1NY72 2A3YA 5GZFA 5D8AB 3ZDVA 2X5IC 4U2AA 1T2XA 3GGLA 2VQAA 4UW6A 5I0SA 2RE9A 2WLQA 1Y43B 2W1SA 3ZYPA 2DBIA 1QNYA 4WVMB 3KV5A 4NPMA 5IFTA 1RUG3 5JPNB 4EQVA 2HLEA 4DXSA 1AX1A 2X53S 4MOAA 1FV2A 2VH9A 3CIHA 3N36A 1MS5A 1W39A 4QM9A 3PMEA 3FL7A 4XZUG 3H1WA 2ZX3A 4META 3FUQA 4QMAA 1NZIA 1QWRA 2ZEWA 4L0PA 1KRIA 4CPBD 3O0XA 3ILRA 3N9NA 3FUOA 2K2SA 2V72A 3VL8A 1XNTA 2V4AA 2V5YA 3SEEA 5F7UA 4PBOA 2YGMA 1AHSA 4YW7A 2YROA 1JYVA 4DUXA 1KJRA 1YO8A 1NCRA 3MFCA 3OGVA 2OYZA 1KS4A 1JZ6A 4I3PA 3RSJA 1AL22 1XSQA 1QQP3 4LUKA 1OLME 1J1LA 2VUCA 2OUHA 5DUWA 2TNFA 1GZCA 1SZBA 1DU3D 3QACA 5C4WA 5M0TA 2W68A 4FOYA 4Q4W2 5FPUA 2DTWA 1LULA 3A22A 4KL1A 5I8SA 2Q30A 3GZEA 4P9XA 2QNKA 2XBO3 4FPOB 2WWJA 2VXRA 3BOWA 4BXFA 5DZFA 4JZRA 3LCPA 4MXWB 4N43B 4FT8A 1PM7A 1V9U3 3UKTA 3VBHC 2VBDA 2P5BA 1PMIA 1EYBA 3FLRA 1AJOA 3IZOA 4GIQA 4S2GA 3LB9A 1CIWA 4AVBA 5FZFA 2FCVA 4RL7A 1DLCA 2P3KA 5T5OA 5EZWA 3H8OA 1AR82 3MPPG 4CUCA 4ZU5A 3RZZA 1NZCA 2FDKA 3ETPA 5HV0A 5DAQA 1ZA4A 2ZGPA 1WW4A 3IIIA 2NN8A 5FYVA 4CEWA 4N90A 4YM0A 3ST7A 3T0BA 2YY1A 5JXJA 1DZQA 2W39A 3FMGA 4OFGA 4YGBA 4YARA 1I3HA 4QX8A 3T2TA 4EN6B 3LDBA 4UXAA 2RJLA 2ZA9A 4YVSB 3W5NA 1ULPA 4B29A 2DCJA 1I1EA 3S5QA 2HEWF 2JKBA 1JYCA 4QXCA 2WS92 1CX4A 1W3XA 1CAWA 2GZWA 2R0HA 3WCSA 4DXZA 1JS9A 1W6NB 4MADA 2YV8A 1QJY1 3NV3A 3ROUA 2Y6LA 3HEIA 1R092 2QCSB 3OGSA 2GSYA 5FLIA 3OSDA 3ZSLA 2QDNA 5FZIA 1OF3A 4JDNA 1UU6A 2DVAA 1XYOA 4XUPA 2Y0IA 3ZXFA 3V0AA 1QJX1 4AGRA 5JZGA 3HIFA 2TEPA 1C5IA 2GH2A 2VTXJ 2WABA 4JQTA 4NRMA 1ZRIA 2WC2A 1RUC1 4NVPA 4K21A 5GZDA 4JGZB 4ONUA 1ZBE2 2HEVF 5DDJ3 2KA3A 3O1RA 4EE2A 1SQ4A 2R7EB 2UYAA 4WBBA 1VBE3 3APBA 2HWE1 2E7TA 4Z1VA 4A7YA 3ZFEB 4IEUA 3H3ZA 3VDBA 4COZA 2WZR1 3D82A 1QJU2 1ND3A 5FP7A 4RYDA 4QHZA 4MX3A 2HBUA 5JMOA 4HVRA 1KXGA 1FATA 4WM8C 4AI3A 5FZBA 4DRRA 4LO7A 4A44A 1OPOA 3H3LA 4H7LA 2B46X 2HEYF 1JTZX 1GQPA 1VBC3 2QQNA 2XXZA 1LJ7A 4HVOA 4M01A 4BCUA 2ARXA 2G19A 2WQZC 3ZXGA 2XHNA 4I2OA 2ETEA 4FPLA 3PL0A 4Q4X3 1TNFA 1UY2A 4FFIA 1CX1A 3N9MA 4C90A 3AFKA 1GICA 1VMFA 1UF2C 1R083 1DYKA 3ZIXA 3ASIA 4FTBA 1WMFA 4D7TA 1OH4A 1O4ZA 2B39A 2NM1A 2EA7A 1XRUA 3ALQA 1ASJ3 5CKQA 3HT2A 3LDRA 4PI0A 1W6MA 4XF9A 3SEPA 3J8F3 2EXKA 2RJKA 3NL1A 2JDAA 3VZNA 4AG4A 4C0HA 2D40A 4P9WA 4XJZA 5E6HA 2WAOA 3MF6A 4B1LA 1VB2A 5JOYA 5L9BA 2BV4A 1ENSA 1ZX5A 1GANA 3N4MA 4PBPA 3VDDB 2DDUA 4GA9A 5FPVA 1OHFA 4JHTA 4OLLA 1N3OA 4Y4YA 1GWMA 3VBFC 3I3MA 1XU2A 5T3NA 3BTXA 2VTFA 2WT1A 4P08A 3NJZA 1IPSA 1RTVA 1XXNA 3PJQA 1W2AX 2HYXA 2Y60A 3LD8A 2WNVA 2O0OA 1UD1A 3TN93 4C1WA 3UETA 4OMCA 3RYPA 3AKSA 4LO5B 5FZMA 3GBFA 3IT8A 2AACA 2RM23 5FZCA 5IATA 3HQXA 4FP3A 4QDQA 1MEC1 1JYTA 3IDCB 2ZGUA 1MS0A 2J42A 1AR71 4XABA 5JR7B 4QHOA 1BQPA 2GDFA 2XUMA 3ZR5A 4DY3A 1COV2 5FIXA 1UXXX 3BTAA 4Q8KA 1VJ2A 4N7UA 5CISA 3LEKA 3UL2A 3B9IA 3GBWA 4V2WA 4UFKA 1ODNA 2LS6A 1VBA3 5JXIA 3TEYA 4XJUA 1A8DA 1ZZ8A 2BVBA 5C6CA 4BQ2A 1BBT2 2E26A 4OUMA 4Q29A 5LBFA 3R05A 1LU2A 1K3IA 3GJBA 3URFA 4XMAA 2ZX1A 5DUXA 4BZ4A 4E8DA 2RS52 4DY5A 1NYWA 4ASKA 1NCRC 4MO3M 4XF4A 1PK6B 2BNMA 1SLBA 5A70A 5IUQA 1RIRA 1Z7S2 3I3QA 2GALA 1RHI3 3TRSB 1JZ7A 1S0BA 4QD2A 2JKXA 1H2KA 2W52A 4A7KA 2PN5A 1UKRA 1RMU2 2Y6KA 2E53A 3BODA 4I0BA 5C4WC 1LGNA 4KBBA 1UCXA 3WQ7A 5T5PA 2D6MA 2YBSA 1POV1 4E2QA 2HH9A 2JECA 1C4RA 4XZPA 1UPSA 3WDWA 5LA1A 3WP5A 4JTOA 1JODA 4IEXA 1W2OA 1POQA 3KGZA 1UMHA 4IV3B 2LUWA 5DAVA 2VVFA 4BQ3A 4E4HA 1W6OA 5B4XA 2PHUA 1BEV3 2FDJA 5BY5A 2C9AA 3KQ4B 1W0NA 5AC93 4XPVA 2EICA 2R0FA 2IXHA 4QPGC 1A3KA 4XFAA 2OZJA 1SLTA 3RMYA 1DZTA 2BOIA 2EF6A 1HJFA 4GWJA 3PVBB 1PX4A 1MACA 4QKDA 3I3EA 5L36A 3B69A 1PO13 3OGJA 1TMF1 1ZRDA 1ZBA2 2Y6JA 1V6JA 1N1VA 2VJXA 3PJYA 1F5FA 2MEV3 2RS12 1YEWA 3R4UA 4AQSA 1UZVA 4QWNA 5ABJC 4LBMA 1DQ2A 1MS3A 4AW7A 1UIJA 3FJSA 2DUOA 4D6SA 2AGSA 2ZHKA 3H7YA 4TSVA 1N3PA 1SLLA 5IVVA 4OMDA 2ZJCA 1D0GA 3R4DB 4XDPA 1FX5A 5FTTC 4CDUC 1G86A 1H8TA 1EAH2 4QAWA 4G3YC 4P5YA 2P6HA 1WLTA 5IVBA 2I45A 1PVC1 2RJ2A 4W4ZA 3WNNA 4HPKB 4JV4A 5L7OA 2K9ZA 5C5TA 2XHKA 5JLVA 3ZSJA 3SLIA 5K7PA 3FBYA 4D6RA 4R4ZA 3SITA 4BH9A 4ZZ8A 2XB6C 4N7IA 3T08A 1UOJA 2P17A 4IETA 1C5HA 5A32B 1LKNA 4M00A 3CU7A 3CJXA 4FFFA 4W6XA 2WN2A 5I8TA 4ES8A 3HWJA 3NV1A 1DQ1A 3ZFGB 2QQWA 3BIEA 5CKNA 1DQ6A 2WO2A 1YFYA 1TME2 1VBB3 2Q0AA 4G4FA 5FYUA 2XJVA 1QXJA 4RHV2 1HQWA 2VAUA 4XAAA 1PZ8A 3USUA 1Q5OA 1L7LA 3NSTA 4UOJA 1ZREA 1ND3C 1Z0HA 2LROA 4AXOA 5LBBA 1YIFA 1L7QA 3S5AA 1Z78A 1IS5A 4UAPA 4JTNA 3VLBB 1M06G 3ZPYA 1H0BA 3UYJA 3VBRC 2XLAA 4XQ4A 2BTVC 2P4EA 2D6OX 4WV8A 5FXWA 3VD9A 1PM4A 4JKKA 4AK3A 1ZRRA 3O1SA 4M4RA 4LE3A 2HWF2 4QX2A 4LMFA 2VZOA 3A0NA 5FMBA 4NAOA 4GH4B 4QQ2A 5I0DA 5JR2A 2VOXA 5I8YA 1OFNA 1JN2P 5A3TA 5FZ6A 1Y7BA 1JYXA 1NLRA 4CYDA 4A7ZA 2XLGA 3CDZB 2Y8KA 3WQBA 4FPYA 4YGEA 4QXBA 2VMGA 1VBD3 2AENA 2ZMKA 4Q0UA 2UY8A 1AR83 4FPKA 3Q8FA 4AEDC 1D2SA 2A3WA 3DN7A 2WA4A 1BLZA 2LALA 3VD7A 2RR11 4XXPA 3VUOA 3ILFA 2FHRA 5J98B 4D3WA 1PO21 3ZYRA 3UJQA 3MIBA 1V6LA 1WLDA 4OI2A 2A71A 2OVUA 3P5BA 5D21A 1IGOA 2WR9A 4UFIA 4YW5A 2DV9A 3WG1A 4CVUA 2WS93 3ZXKA 2WFF1 4IEYA 3TNPB 4NHLA 5FZOA 4QU2A 3SH4A 2Z42A 4GD4A 1REDA 2VVEA 3M3CA 3LEGA 4XFGA 4DS0A 1RUNA 5C9AB 5EIYB 2WO7A 1BVVA 1XNKA 4W8JA 3RDIA 2BBAA 4I0WB 4XF0A 4AI2A 2WNVC 4BE3A 3O1PA 1ULFA 4LBJA 3RJRA 3KSCA 5H9QA 1H6XA 3U78A 1MZEA 2UWAA 1MQTA 1OT5A 2D3PA 4ZONA 2YU1A 1UPIA 4AI1A 4LBLA 5BNOC 3T2PA 2Z2SB 2JD4A 1GNHA 3S7EA 4BIFA 3NAPA 4Z8BA 4GALA 1HX6A 3O5SA 3O7OA 3JBG2 4CCEA 1AR91 1UWWA 3VD3A 4CUBA 2H6CA
chains in the Genus database with same CATH topology
2VW2A 4M3CA 2HWB1 3D8CA 1AYN3 4P9IA 4PDWB 4Y22A 1Q8QA 3WG2A 4CDQC 5JOXA 1RINA 5T54A 4ZU4A 2ILMA 4Q1RA 3HMYA 2YYOA 4JAAA 1NA1B 1YXWA 5K0UA 2PHLA 5FQ0B 2VY0A 4OULA 4YNIA 1SMVA 2UWBA 4OHWA 5H9PA 1GZ9A 1C1LA 5CVRA 3H7JA 3RI9A 4I01A 1XE7A 5A3LA 1EV13 1LHOA 2IWGB 4INDA 2NMNA 4GWMA 1YJKA 5FCCA 3VBSC 4D94A 1OOPA 2OA2A 4FPJA 4QGNA 2AUYA 2KM2A 1YJLA 3WW1A 4E4ZA 4CEWB 4AGGA 1NXMA 1R1A2 1HKDA 1UW8A 2DFBA 2JG9A 4IV1C 3M8LA 2TBVA 4B4QA 4GB31 3PMSA 4XILA 5J09A 4AFDA 2XJSA 1FOD2 4BA6A 3EXUA 1RUD1 1IS4A 4FOWA 1URXA 1CAWB 1LGCA 1CAXA 2R043 3BIWE 4Q4V2 1AYM2 1MR5A 1RUJ2 1MVQA 1D4M3 3OBRA 4HN1A 2I07B 4JGYC 3V0AB 5JZGB 1HRI1 3MZHA 1QDOA 5ACA2 4OHYA 2JE7A 1APNA 3OY8A 4LO6B 5I0RA 4DZGA 3KCYA 1U12A 4QGMA 3VZMA 1WD4A 2A5ZA 4AVVA 4UW4A 5E8AA 4YW4A 1MZFA 4AI8A 3B5LB 4FPGA 3L9JT 3JD73 2Z79A 5CAZA 3B3QE 1X8MA 4H14A 4Y1VA 1LU1A 3D0SA 2VNRA 3ME2A 4FAHA 1FMD1 2VMIA 5HI0A 3H3UA 3PLQA 2D7FA 3RRDA 4K7JA 2XL7A 4MYEA 3KM5A 2RS53 3WUCA 3I59B 2XVKA 5T5JA 2B5HA 1UZZA 1ZZ6A 2XG3A 1RUG1 2G9GA 1REFA 1BMV2 1AR63 5CNAA 3BALA 1GR3A 2ZHMA 1DFQA 1NCQA 2Q1ZB 3RJ2X 1NQDA 3AZVA 3WDYA 2WZPP 3ZXJA 1S0DA 3OJBA 3NV4A 1ND2A 4FTEA 1W6MB 2B7YA 4AEKA 3OD4A 2YMZA 4TLFA 5HCAA 4YG3A 1NLSA 5JI7A 1MS8A 1QQP1 3GZUC 4O9EA 3VKLA 3WR0A 3H8UA 5FFOC 1IOAA 4XFHA 3K48A 5HXVA 3VKOA 2XBO1 2XKPA 3CF6E 4FOVA 3VZLA 2R072 1SBFA 5HCFA 3VKFC 1V9U1 2WA3A 5K9YA 1YWKA 3D5OA 4BHPA 1PGSA 2UYBA 3MFAA 4WM8A 3MW4A 4XJWA 3CLPA 1XE8A 4E2SA 2ZHNA 4EWAA 5CFDC 1DLLA 3N7LA 2C1FA 2PHDA 5JSRA 2JENA 1JUHA 2ZZJA 4FXGB 2DUQA 4IERA 1ENRA 4FO9A 2VUJA 1MQTC 4CDWB 5J48A 2BNNA 3KCCA 3OYWA 1G9BA 4Y26A 4DRVA 3EJKA 2A6WA 2FBEA 2HKXA 4MGIE 1ZZBA 1S2BA 4YG0A 3NAPC 2XJRA 3VBUC 4Q26A 2MHFA 1NE4A 3MIDA 1D2QA 5FO8B 3FFZA 1QJX2 2Y38A 3U11A 1LOAA 3BPZA 2ARBA 3V56A 1RUI3 2ET7A 1O7FA 3WP3A 3E6CC 4GMP0 1IZ3A 4KG8A 5E16A 2ZZQA 2HWF3 3LSDA 4R9CA 4RR3C 2HWE2 5DDJ1 2IXKA 3JQXA 3PHMA 1HXS2 1N1TA 2WZR2 1VBE1 2HJIA 4AFBA 1HW5A 4R9AA 4YRDA 2ET1A 4TZDA 4UW3A 2NP0A 5JSOA 2WKKA 2DCKA 1SBEA 2DVBA 4WM7B 3AP9A 1OOPC 3N35A 3SH3A 3QD6A 4ZU7A 1WCSA 2XKOA 3I4IA 1NXD1 5KHGA 3AZWA 1K5MA 1NG0A 2Q5TA 4HN0A 2JG9C 3RPQA 2VOWA 1VBC1 5FPXA 1YLLA 2RS32 3MLJA 1RJ8A 1F8VA 5LEKA 4Q4X1 2CWMA 3VHRA 2YXSA 4NR1A 5LK7B 2IFWA 2Z69A 2ZX4A 4A3XA 1H8TB 1R081 5A33B 4MVTA 4AFAA 4XHXA 5L7OB 3SMHA 2K0GA 3JB8A 5KWRA 1H1MA 1GNZA 1V6OA 4BIOA 2ZGTA 1ASJ1 2RMU2 3M2MA 3ZFFA 4FPHA 2SLIA 1SLIA 3THPA 1IKPA 3J8F1 1KQRA 1OLRA 4DMIA 4IEPA 1Q8OA 5GKAC 1V70A 3NKGA 1X36A 4YVWC 3USUB 2ZX0A 4HFSA 1HDKA 1DDLA 4RS5B 2IC1A 4B8EA 3RMXA 3IN9A 2GNMA 2PLV2 1DQ0A 3AFGA 2D97A 1JOJA 2PTMA 3PTYA 4QPGA 3TN91 4QPIA 1EPZA 1MEC2 4IXLA 1MZ5A 4JC1A 1AR72 2RM21 3UV9A 2H0VA 2VG9A 3OPZA 2P3IA 2VW0A 4AYUA 5ABJA 3VV1A 4M0HA 3AZZA 1WBFA 2ZACA 5LRSA 3V0BA 3DPRA 1B35A 1TEIA 3B02A 1VBA1 1NCQC 4IEWA 1QDCA 4M3CF 1S0IA 3VBOC 2A6XA 4JVAA 4CDUA 2Y0OA 1R1A3 1PIV2 1ND2C 1S1AA 2R6QA 3ACLA 3M3OA 2BBVA 3LOBA 1HIXA 1PGW2 1AF9A 4WVVA 3UK9A 3WDUA 3K51A 1DHKB 1O3SA 2ZAHA 1H4GA 1W6PA 1RHI1 3E5QA 3G6JB 4MLOA 1CPNA 4ES9A 5BUVA 4K20A 1CD3G 4ASLA 4F8AA 2XJTA 2JICA 5BNNC 2CYFA 2IXIA 2CY6A 4OI1A 4ATEA 1GKBA 3AJZA 3O14A 3MLKA 1IPKA 2QJVA 3J26N 3M3EA 2JJ6A 4W65A 1BEV1 4BLIA 4HSLA 4YZ1A 3D0JA 1C8M3 5A3MA 3EO6A 1W2UA 4Z07A 4HKLA 4LBQA 1W0PA 5AC91 3VBRA 1ZZCA 2IFRA 1YCIA 4CEYA 2BFUL 2YDEA 1H9PA 4XDQA 1HRV3 1D4VB 3WQ0A 2VU9A 5IK5A 1X7NA 2HWC3 1PO11 1RUF3 4M3CB 1VAMA 4UBHA 1JXNA 5DG1A 1W0OA 3SXWA 2UURA 2MEV1 1CR7A 3BOPA 1YI7A 3VN4A 5BV6A 5EXOA 2HYKA 2I2SA 3HR9A 5FPZA 1EP0A 5IK7A 5K0UB 4AEDA 4FVVA 4O9GA 3LA3A 1FPN2 1PVC2 4LBQD 2R063 4L8QA 2ZHLA 2P3JA 3KLSA 2DWRA 3MF9A 1H2LA 3RQ0A 2CAUA 1C57A 3DUIA 2AYHA 1RUE2 2V09A 2X5IB 5DUVA 1GZWA 3VHPA 3DL3A 1LOGA 5DUUA 5FO7B 4LA2A 1ZM1A 5CFCA 4COVA 1WA4A 3O0WA 2BQPA 1KD7A 4GULA 2CWSA 2WLPA 2DU1A 1VBB1 3C3VA 4KGGA 2WT0A 3CL1A 4PIXA 4CP1A 1WLCA 1O4TA 1RVF3 3MIHA 4I0AA 3KD4A 4Q27A 3JCIA 3EHKA 2ATFA 3LSEA 2VOVA 4B7EA 1CAXB 2BGCA 4CRQA 5C8CC 3MI8A 4QHBA 1DGWA 1K5MC 2JEMA 3ES1A 5BNOA 3OBTA 2A3XA 4Y1UA 3MGUA 2WNEA 2R073 3POWA 3X29B 2R30A 5SV5A 1QF3A 2IXCA 4XQWA 3OY8B 2QE3A 5CG9A 1WUVA 2WNUC 4PCRA 5GLZA 3S6PA 4CDQA 4BM8A 5JOWA 1WCDJ 2XJQA 4HT1T 1VBD1 4XE9A 1AX2A 1AR81 2BWCA 2JG8C 2B42B 3MICA 1GV9A 2RR12 3IIAA 1V6MA 5EJ3A 2W08A 1PO22 1WW7A 3VBHB 1CQ9A 4M3CE 3L2HA 1QOSA 1CAUA 3ZFFC 2YUEA 1MZ6A 4IEOA 2DURA 1RL3A 2V73A 4FQZA 2ZGSA 3M3QA 1ENXA 2PHTA 1W6QA 1JUIA 2R1DA 3VBSA 5GLWA 2BWAA 3WT3A 3ZXLA 2WS91 1OFSA 2GMMA 5JSPA 1V6KA 1CAVA 2JDZA 4JCKA 3WDVA 4IV1A 2GC0A 3FBMA 2OIIA 3QCWA 4IEZA 2HWD2 1U5YA 1MS9A 1VRH2 1G6NA 4V1PA 4N9HA 4ISQA 3WINE 3LZZA 3OD0A 3H1YA 4K6BA 4QPIC 3FX3A 4A2UA 1ZYBA 4XMIA 4AI0A 4XBQA 3FC0A 2D43A 1S0GA 1IS3A 1Q56A 5FRAA 1H8VA 2VVDA 4XXAA 1HXS3 2HWB2 4JGYA 3HN1A 4Q0PA 4R4XA 2I74A 4ZXKA 2PELA 4P14A 1U5XA 3DPRC 3E6DA 1B35C 1RUH2 2E51A 1LENA 1XNBA 1AYN1 2VW1A 2WL1A 1CJDA 2UU8A 4E4SA 5I0UA 4NWWA 3IMNA 4AWDA 3CEWA 3A4UA 4WVWA 4WVMA 2RS33 3H1MA 4KWJA 4AFCA 3AZXA 4XQDA 1CVNA 4WVZA 4AHXA 1H2MA 4AVCA 4QT6A 1BJQA 4XFIA 4DOUA 4WM8B 1SLAA 3ENRA 2WJSA 1EV11 2ZMNA 2ZBJA 4OI4A 5CB7A 3N7JA 3WHTA 1YRZA 1WD3A 4KGQA 1G9DA 1AL23 3FWEA 2G9FA 4E27A 3G7DA 4GB32 2RMU3 4XHBA 3U07A 5I93A 5IK8A 4PF5A 3BU7A 5KXCA 1V6NA 3FLPA 4Q8LA 3OYWB 4Q4W3 4XYXA 4PLNA 1REEA 4CEYC 4SBVA 5FBZA 4ITCA 3LKJA 1DG6A 2ZOEB 2R041 4XFCA 4I02A 4FTSA 1AZDA 2ZGKA 5H9RA 4MGYE 1D4M1 3TNQA 1LRHA 1HRI2 5FDBA 1AVBA 4LULA 2PLV3 4Q1PA 4MGKE 1LHVA 2D98A 2B45X 5SV8A 2A6VA 4MGZE 5L73A 2OUJA 4LHKA 3VBFB 4Q4Y2 1S0FA 2GH8A 1LESA 4LE4A 4U36A 4P9GA 2BW8A 4XJ9A 2WINB 3AK0A 3JD71 3U0ZA 1HV1A 3AYCA 4R8HA 3ZDSA 2DCYA 1RJ7A 1WW5A 4KNCA 4FOQA 5CIRA 4YVSA 1T6GC 1S55A 5CFCC 3JUUA 4Z2WA 1GQHA 4PIYA 2GMEA 1PIV3 4AVTA 1R093 2GAUA 2NYYA 5CFDA 1RUG2 1W6NA 1YFWA 2RS51 5BNPC 2DF7A 4GMP3 1FV3A 5FLHA 5CADA 2ZGLA 4LUMA 1OPMA 4FPCA 3I54A 1CN1A 4F7ZA 1AR61 1JW6A 4MSVA 1OQ1A 1Q8PA 1FI2A 4AFMA 1ZBE3 1IS6A 4JGZA 3I7DA 1NCRB 2CNAA 3O12A 5GJ6A 3VBUA 1BVP1 2ZCWA 2ZKLA 1QJU3 1WGPA 4XBNA 4CDXC 3E5UA 1U0AA 1QQP2 5C4WB 4RSUA 4JRLA 4X8PA 3WDXA 5GM0A 2D44A 1SCRA 1QU0A 2D3RA 2VQ0A 3ZYIB 4RA0A 2E63A 2XBO2 2XVLA 4RR3A 3JQWA 3MYXA 4AE2A 4XIOA 5BPXA 5JAXA 5F5QA 4PQ9A 3KT7A 1O91A 1VAKA 3ZSKA 4YZ4A 4QPGB 1NQJA 3D4KA 4K1ZA 1AXYA 1FT9A 4IL7A 4LR4A 2WSUA 1FPN3 1LODA 2MPFA 2CGNA 2ERFA 4PLMA 5ABJB 3JZVA 4P5HA 2ZGMA 1OLQA 4XJ8A 4RQPC 2CAVA 3V0BB 1AXZA 1RUE3 4L9BA 4N53C 2NZ9A 4Q2FA 1ZVFA 4BLJA 4CDUB 3W58A 1OA4A 2XH6A 4WZCA 3M4FA 5EFUA 4FAGA 2VECA 3VDDA 3LGRA 2QZ3A 2ZGRA 2EXHA 3CJIC 2DYCA 5DZEA 5JOZA 1XNCA 2A70A 1W6PB 1RITA 2PAKA 5D8AC 4ATFA 4J6GA 3VHNA 3IM0A 1CPMA 2ZGNA 4K3UA 4L92A 1RUI1 3VZOA 1OI6A 5DDJ2 1QNWA 3AMHA 4YVWA 3AP5A 2HWF1 1COV3 1VBE2 3IDBB 4LHLA 1ND3B 4EJRA 3ZYGA 1QH7A 1KDKA 1BBT3 1IKQA 4LBQB 2FZ2A 3ELNA 1DGRA 3VBRB 4FSJA 1UX6A 2D6LX 3QH6A 1JH5A 3GF6A 1ZZ9A 4UW5A 3ZN6A 1NOVA 5H9SA 1O3RA 3ZXAC 1VBC2 1XQNA 3N7MA 3AX4A 1Z7S3 4XTPA 3TOJA 4F83A 2CGPA 1RMU3 4EN9B 4OZXA 1DGWX 4YG6A 3GNEA 1R082 4AEDB 5T55A 3AP7A 3VBOA 2DVFA 1DBNA 5F6KA 3Q9OA 4KWKA 3PVOA 3S0MA 3S7IA 1N1SA 4HK9A 4N43C 4BMBA 2BVVA 3NWKA 1ASJ2 2A73B 2BPA2 2HWD3 4FPFA 2EAAA 4YW1A 1VRH3 2ZPXA 1GZWB 4XBLA 1VR3A 3POYA 5DZGA 4YYOA 1AL0G 4EN7B 1ZNPA 1J3PA 3KT1A 2DCZA 1GSLA 4F3JA 2YZ4A 2NQYA 1PZ7A 5DG2A 5BNNA 2ZGOA 3U10A 1ZBA3 4Y5Z0 1FNYA 4EV0A 2RS13 4C0BA 3ZIWA 3ZSMA 1J3QA 3GZAA 3JBG1 4MUVA 2WNVB 3ATGA 3N3HA 1RUH3 1OA2A 4AEMA 4YVSC 2PHXA 3EBRA 4GKXA 4XFFA 3TN92 1EAH3 2PQQA 5BNOB 2RM22 3WP4A 1N3QA 2XJPA 2A6ZA 1F5JA 3E5XA 3KZ4C 4Y1XA 3RWNA 1A8MA 1HQLA 4LLFA 4XTMA 5KC6A 4AQTA 5JPMB 4CDQB 2IXLA 3T1MA 3UKVA 1VBA2 2BUKA 2ENRA 3TWIA 2GU9A 3NV2A 4JGZC 1G9CA 3E6BA 1Q8VA 1QJY2 5EYXA 3AMNA 4DFSA 1PHMA 1TME3 3BCWA 5FREA 3ZFGA 4RHV3 3CNAA 1L3JA 1R1A1 1CAUB 1ALYA 1GQGA 1UMZA 3ZFEC 1G7YA 4LBKA 4URTA 4D69A 5IT6A 1W6QB 1RUC2 4KH9A 1EPWA 2PYTA 1A6CA 3VBSB 3GHMA 1C1FA 3RS6A 4LEJA 4E9KA 1CJPA 4YFWA 3RYKA 1LHUA 3VKMA 1C28A 3VKNA 1CAVB 1W6OB 2VGDA 1KS5A 4IV1B 2P2KA 1VLNA 1HQNA 2Q4SA 1POV0 1DZRA 4BWOA 1XNDA 2CGOA 1BEV2 4L11A 4OUSA 4K40A 5AC92 3NKTA 5C8CA 1C8M1 5JDBA 4YZ5A 4SLIA 2G4IA 1WMEA 2P34A 4Q4Y3 1WMDA 4HKOA 3W9AA 2ZAAA 3VZKA 1LCLA 1PO12 1HRV1 1PNFA 4JGYB 1KDMA 1RB8G 2GMPA 3AXDA 3KGLA 3ZXDA 3L2YA 1S0CA 2HWC1 1RUF1 3POSA 5FOJB 3JB4C 2JX9A 1GFF2 1QOOA 4R52A 2GNTA 2YGLA 1PVXA 2UY9A 2WNUA 2Q8OA 3SH5A 2WIIB 3ZX7A 3AYDA 1J58A 1U5IA 3VDDC 1YNAA 2JG8A 3TBDA 2EIGA 4ZKTB 3KS7A 4LT5A 2ZABA 2R061 5GZGA 4HETA 1BMV1 3B9CA 2ZGQA 5C9AA 5AVAA 2X29A 1H1AA 4LO8A 3E97A 4I09A 3WVJA 1KFUL 1YUDA 4NWVA 1AX0A 4KU8A 4QQLA 1S2KA 2GC2A 1R1ZA 1SDWA 2P37A 3JBG3 3ZVXA 1VBB2 2EXJA 4XIKA 3AKPA 2QZ2A 4C1XA 1CESA 1RVF1 4PDWA 1H4HA 3GHNA 3OTFA 3AKTA 1NA1A 2UWCA 3MLLA 4GWNA 3D6EA 1H9WA 1PGL1 5FQ0A 1PK6C 3J4UH 3S30A 3IBMA 4AHWA 2R071 4HBNA 1TNRA 2EXIA 2NMOA 1DGRN 4CP0A 3WNXA 4XETA 1VBD2 3P3PA 1BK1A 1XYNA 3ZSEA 4QQHA 4QQPA 4KWLA 4I30A 4IV3C 1ZRFA 5LK5A 3A0KA 1FOD3 5EWSA 4QM8A 2X8KA 4K1YA 3WHUA 1OMIA 1X82A 3T1LA 2EVXA 2FMDA 3PNAA 4GKYA 1QXRA 1UAIA 2AH2A 2QDRA 5GZCA 5J36A 4Q4V3 1AYM3 4MZUA 2BNOA 1RUJ3 2CV6A 5CFDB 1VALA 5AFEA 3UJOA 4B4RA 4EN0A 2WT2A 2D93A 2IXJA 4TYSA 2QQPA 4PIZA 5ACA3 1VIWB 2XJUA 3NW4A 3VGIA 4NOTA 4XEZA 1MQTB 2YHJA 5GALA 5I0TA 4B3NA 5BYNA 1H1IA 4DNYA 1O4YA 3GBGA 3SCGA 3NAPB 1TMF2 5CG8A 3DKWA 3VBUB 1LHWA 2QFEA 1OSGA 2VULA 4YM3A 1WW6A 1HXS1 4Y22B 5FO9B 1UN1A 1MVEA 1QKQA 1SBDA 1MS4A 3GZTB 1NY71 1QXPA 1AYN2 2DU0A 1I9RA 2JE9A 3CO2A 3H0OA 4YGCA 4XW3A 3ZFGC 4RR3B 5I91A 3I59A 3OF1A 1ZZ7A 3WQ1A 3WP6A 2WSVA 2FZ1A 3ZO0B 5J7MA 2H0BA 2RS31 4YZ2A 1FXZA 1IHMA 3WW4A 1J1TA 1OOPB 5C8WA 1EV12 1RC6A 2DVGA 2C0ZA 4YGDA 5FMOL 4QGLA 4GXLA 3QLQA 3RI8A 1GYKA 1H2NA 3MIGA 2JG9B 3WZ1A 4AHYA 1YYNA 2AREA 2BEOA 3HD8B 3M1HA 5BNPA 1TQ5A 2E9QA 4GH4C 3WXPA 1AL21 4G9SB 2RMU1 4RD7A 5KXBA 3IPVA 3V65A 2GN3A 1ZRCA 4Y1YA 1MS1A 3PVNA 4Q4W1 1ULEA 2R042 3DGTA 5BXXA 3B94A 5GLTA 1BYHA 1LEDA 1F9KA 1LOCA 2WWSA 1LEMA 4H3WA 5IK4A 1D4M2 4CTEA 1LB2A 3JU9A 2E7QA 2GN7A 1ULCA 4HK8A 4CDXA 1BCXA 5B2GB 1DQ4A 5J3UA 2PLV1 4Y20A 1UU5A 3WD5A 1PZ9A 1Q3EA 4Q0VA 5KXEA 4CP2A 4YVWB 4AF9A 2VOKA 1UKGA 4K8FA 3LAGA 2XVGA 3JD72 2QUOA 5C9AC 5FOBB 3ILNA 4TWTA 4FXKB 3RG0A 1AXKA 1ULGA 4AQ6A 2WFF2 1H30A 4AQ2A 1J3RA 1AJKA 3KB5A 4RGAA 1QJY3 4CDWA 1SACA 3ZXEA 4COWA 3ZN6B 1G8WA 1QJZA 3AYEA 2BFUS 4BQ1A 1PIV1 5CU1A 1DIWA 1R091 3PVEA 2XPJA 1QJX3 5EV7A 1OD5A 3WY6A 4GMP1 1OQDA 2E6VA 1PGW1 2GNBA 5JMCA 4RQPA 3GYDA 1HV0A 1RUC3 2Z5WA 1X8EA 1AR62 4DB5A 4PDWC 1NCQB 4W6YA 4MXVA 4N53A 1V00A 3OGGA 3VBOB 4IESA 1I5ZA 1NA1C 1ZBE1 1C8NA 4YZ3A 2HWE3 1BXHA 1ND2B 1N1YA