2WGNB

Pseudomonas aeruginosa icp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
132
structure length
132
Chain Sequence
MGSSHHHHHHSSGLVPRGSHMQKPVVTLDDADDCSPLKLTQGQELVLTLPSNPTTGFRWELRNPAASVLKRLGPEVYSNSEEDSGLVGSGGESTWRFRVAASGDDRLELVYRRPWEKDAEPAESFSCAIQVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INHIBITOR OF CYSTEINE PEPTIDASE COMPND 3
publication title Structure and Dynamics of Pseudomonas Aeruginosa Icp
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase inhibitor
total genus 10
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wgnB01
2NNRA 2NQDA 2OULB 3PNRB 2WGNB 3M86A 3CBJB 3E1ZA 3M88A 2FO8A 2H7WA 2C34A 3CBKB
chains in the Genus database with same CATH superfamily
3NJMA 2B59A 4WEUD 3PXJA 2OQJA 4FG6C 5DS8A 5KBDA 5FFGA 2BLFA 2R29H 4F8OA 3A24A 2C7UA 1J05A 2FX8H 1S78D 1HIML 4FF9A 2V8LA 5AZEH 5D1XC 5D2LA 4DK6A 4URKA 5JUEH 4P2RE 2R1WB 2NR6A 4R7LA 4AGOA 3HFMH 3PUUA 3D30A 4OZIB 2EDTA 4OI9A 3V5DA 1CO1A 1Z9OA 3MCKB 1NLDH 1MHEA 3FOMB 5EUOA 3B7SA 4LLMB 3T8XA 3LD8C 3ROOA 5E5MA 4FE9A 4M7JL 5D93B 1YA5A 1G9MH 3D9AH 3M7FB 4PJBF 5FO9A 4A66A 4ORZC 5HYSA 1QR1A 2AC0A 4FXKC 3TT1L 2WKLA 2WQUA 4AK2A 4ZOAA 4ICWA 3NDYE 2AQ1A 4NQXA 2X6VA 4P4RA 5TGBB 3V5KA 2NYZA 4AH2A 5C0CA 4KAQH 5D9SA 2V17L 5C6TL 3NJLA 1TFPA 4BZ2L 2DYPD 4MFHA 3QWRD 3CC5A 1KLFA 2IH8A 3G9VA 2OZ4H 5MI0B 3LKSB 4OM1L 1D3CA 3WMSA 1S9KC 2W95A 2GSMB 1ZLSL 3NCFB 2ZJSH 2XICA 2ENYA 2PETA 4DZ8A 4CSTA 3MRHB 4B96A 4H5SA 5AG8A 1I1RA 1PVHA 1YZZA 1E5UI 2VLRB 3PDOA 4MA1C 2F1BA 2PR9A 1R5VA 4MVBD 3VD9A 2UUDK 2YSTA 1CYXA 3H85A 2ZZUT 5D1QA 3ZZSA 4P59L 1U30A 1JGUH 4QDGA 5KYWB 4XZUB 2Z65C 4CC4A 3QXUA 3X12A 3D3VE 3MXVL 4XPFH 5FKAA 4Z7WF 3IU4H 3N0PB 4A6YL 2P45B 1M6OB 1DBAH 1FDLH 2KC0A 1WUZA 2IALA 4HGWB 3U4BH 4LP5A 5GRUL 1FF5A 3DETC 4PMFA 3CXDL 3RWIB 4E41E 1UA7A 4YC2C 3G6JE 5HHQB 1KZQA 4HCIA 5GGTL 4AQEB 3SKMB 1G9NL 5HGBB 2ZOOA 2AQSA 2IBZY 2PTUA 2A4CA 1BQHA 4HWEH 4XNDA 3NCWA 1HNFA 3BWAA 1WFOA 3BAIA 5CEYB 3RWEB 2I9TB 3ULUH 3CVHA 5EIIA 4RGMB 4B9FA 2R69L 4HIJB 4AVHA 1XGPA 2R59A 3TFBA 3QNYA 1S9WB 5F0PB 3MYZA 3H3BC 2BSDA 4O9HL 5AOZA 5HI3C 3T6VA 3V4LA 1U8CA 5HJGA 4G80B 4BK5A 3N43B 1JAEA 3EDEA 4Y1AA 1G9HA 4MB5A 5JHLA 1TITA 2OMYA 1ZLUH 4FFTA 2RMNA 3H3PL 3BEVB 1JXJA 4QHUB 1UT1A 5E2VH 1CXHA 4UDUA 5IB3B 2G9KA 3NFNA 1F18A 1H9VA 1XIWD 3LPWA 4OVVA 2GAZA 4ABQA 1FUNA 2CK0H 2FQDA 5DC9B 3TZVA 2C9RA 1TZOA 3TA3B 5J1AB 4Z18A 1FQ9C 1JN6A 2AV7A 2Q8BL 3GNML 2YK1L 4Q97A 1CE6A 4P8QA 4X5QA 5LBSH 1ZSDB 2AV1B 1U21A 1C08A 1I3UA 1IM9D 2VLJD 3O4OC 5E1HB 2IVFC 5H8DA 1XD1A 4U1JB 1ZVSA 4NERA 3MBEA 4PJ7A 3E1F1 4DAGL 2P8MB 2VM3A 4JPVL 5EO9B 1TXKA 3PWJA 4P57A 4NFDA 1RZGB 2PKDA 1BZ8A 4XNQB 2I85A 2I32A 3KPSE 5I6OA 1IQWL 1QSFD 2EKSB 2XPGA 3EGXA 3QDJB 2C9AA 2IMMA 2VXSH 5MEPB 4JY4B 1VIWA 3BP5A 4LQFL 5ISZE 3L3JB 4I0PB 5K59F 2E6QA 2X4TA 4WEBH 3RFRA 5I6LA 1AE6H 5E0FA 2WBJC 5FK9A 5E00A 3LNIA 3C5JB 2YN5A 5FOBB 1YN6B 1MJ8L 3SDCC 2WMPA 4D3CH 5I1GL 4KQ3L 3MJGX 1FGNH 4X5WA 3QEQB 5LCVA 4LBAA 3GWJA 2WTOA 7FABL 5DO8A 3WLBA 4N8VA 1JNLH 1TKWB 1V27A 2CDGA 1GGYA 3V0EA 4X8CA 3W3BA 2XA8H 4Q9RL 1PAMA 1K5WA 1F4HA 5BRZE 2NLJB 1WAAA 1T1YA 5DHDA 2UY7B 1PLAA 4JO3H 1Y0LB 3O9WD 2NY4D 2K4AA 1IGIL 4J6IA 3TJHD 4ANWA 5BO1H 1KT2A 1DLFL 4AG4L 3POHA 5CP7B 1ES0B 1ZV2A 2YAQA 1I1AC 3STZA 4NZRL 3ESPA 4K71C 2V2WA 1A6VH 1NCGA 3NPZB 1KGUA 1GOGA 5K1NA 3VFSA 3RY6C 3BVVA 3P73A 4YXLL 3QFJA 1A9BB 3MROB 4UNVA 2CNYA 2WW8A 4G59C 3ZKMD 5I1HL 2PWEA 2MHAA 3JV4A 3BW9B 3CXFA 5E2WH 5IUCA 4E9XA 1P4LB 3U0TB 2Z8SA 2FSDA 2CHNA 4ZODA 3LEVH 1EGJA 1IC0A 5L4FA 1NAMH 3GRWL 2ZUQB 4JPIB 1ACZA 3SY6A 5EC2B 2EDBA 4CGTA 2M1KA 2CJ3A 3O3BA 5E1QA 5BZWA 3VFRB 3ZTNL 5LNDA 4XB8A 5F7KC 2GJ6D 2VXUH 3G5YA 2F54E 1ITBB 3ARFC 4LSUH 3ZYJA 4Y2DC 3DV6B 2OL3B 3EO9L 3B7TA 3QQNA 4YDZA 4XOAA 4L3FA 5AKVA 4M4PA 5TE7L 4AXWB 4XC3H 5DHVA 4X0NA 1A6PA 1LK3H 1JI2A 1QAWA 1INDH 3QWQB 1EXUB 4M48L 5JW3H 5J7CC 3HI5H 4TL5A 2XWBB 4JFEE 3C5ZB 1AR1C 3PQYA 4UIMA 1W16A 1XZ0B 4AYBA 2D3NA 2OCCB 1T20A 2XQYA 3SJVB 4P9MH 1AZVA 1Q9KA 4YJZL 4DN3H 3VMNA 1M7DB 1CU4L 5ILTH 4TTDC 3SCMA 4FXGA 4XPBH 2B3IA 4QXGH 4MAYA 1AHMA 4LL1A 3CU7A 2MCPH 3W0WA 3IJ9A 2CGRL 3V7AE 1MIMH 5I1DB 3BKJL 3HC3H 3V4PL 4I48A 4NYLB 3TN0A 1MWOA 3QYCA 2BP0B 2PCFB 4MJ5B 4QXUL 2GCYA 5FAAA 1OHZA 4YHPB 3HAEG 3RGBA 5F96H 1JYXA 1U95A 4X5XB 2VXVH 3UOAB 3UJJL 3NJIA 3HR5A 5JNYB 2AAVA 4ANXA 3GIZL 2PYFA 4HCRA 2F0CA 1EZLA 2FNBA 3G3LA 1MWAH 2OSLB 3B9KD 2YD4A 1JPFB 5DHEA 2A74A 2PXYA 4L1LA 3NP3A 3C2SA 4YOKA 4EN3A 3VAEA 2X41A 1M9WA 3Q6FB 4XAKD 1THAA 4KKBC 4MLSA 2YGQA 4XVTL 1HESA 3FSOA 2PCPA 4NQED 1IAII 1T6WA 4AVJA 2CJSA 4DN4L 1P4BH 4JHZA 1FNLA 1OGTB 4LCCB 4NN5C 1BEXA 1SDYA 2XKSA 1GY1A 4KRPC 4QTIH 4MMYB 3JBG7 1M2OA 4BFOA 2O4EA 3ECUA 4NX0A 3UBXG 4J5VA 1HC1A 1MCNA 1YUKB 4Y4FB 3QIWB 1UM6L 5CLYA 4WFEE 1AANA 1R75A 4OFPA 5BNXD 2CLVB 1I85C 1J1PH 4UTAA 4N2NA 1F6FB 2AABH 2GY5A 4B95C 4R2GC 2D03H 5FECB 5HPMA 3CLFH 3VG0H 1M1XA 2PW2A 1PYWA 3LS5H 4G8AC 35C8L 3DOSB 1A6AB 5D5MF 3T4AC 2ZXEB 4MNHA 2DDQH 2V2TA 2OYKA 1OAQH 1SMOA 2HLAB 3A5VA 4G8IA 1HDMA 4ZNEA 4DESA 2J4WL 4WCYL 5IZ7A 3PGDB 1O9VA 2XFGB 4J3TA 2J2ZB 4C56D 1D7DA 1ZVYA 3QDMB 5B1BB 5IKCA 5DD6A 3EOTH 2CR3A 1INQB 3NQIA 2HJFB 2OSYA 5DYFA 4WI0A 2GB2A 3WFEL 4YSUA 3REVB 1G1KA 3EJRA 1S5HA 2R4RH 4MQ7B 2XTJE 3QDGE 3D52A 4MD5B 5IB2B 1JZGA 3CZEA 3O45B 4WWOA 3TIDA 1WWCA 3IM1A 2DS4A 2X10A 3BOVA 2D7TL 4NUQA 2OW6A 5FOJA 1UFUA 3FOLB 3D4YA 4KO5A 3OKKB 4HHGA 2FJFA 1OAUL 5DRZA 4FQHB 1OP3K 1UJ3A 4QRPD 3KGTA 5IT2L 4IKJA 4O51A 1S7SB 4X4MA 1ACYL 3TYGH 4GP5B 2ZUSA 3ALPA 4BFJA 3CJJA 4M29A 1OPOA 4POZD 5D93C 3PHAA 3CFTA 1J48A 1DVFD 3LMJL 5AVUB 4OF0A 3OGOE 2LVCA 4ZAKA 3DVFA 1MKFA 4Y19A 1RZJC 3N91A 3FT4B 1MCJA 2D0GA 4L1TA 1NSNL 3SDDA 1TYRA 2IWFA 3D18B 3X11A 5D7LE 5GZNA 2Z8VC 5JHDA 5MI0C 3MRMA 3WL9A 3WFDL 5A3IC 3FO2A 4HXBH 1NCAL 2ZYRA 1CFBA 1UD6A 4S0TD 3T1FB 4AQAA 1IGTB 4BE5A 4N2IA 4JREB 1AG0A 4Z78A 1EO8H 1GSMA 5IBUB 5AVXB 3MU3A 3GSNB 4HLZG 1AJ7H 2DBJA 4CVXB 3TNNA 3P40A 2QPFA 1ZA3A 4ZMYA 5DZNA 2F8VA 4OZIE 5DJ8B 2DQUL 4JK0D 5CKAA 3FFDB 4LGSB 4XXCC 3NK4A 5SWSB 1QMUA 3OLGA 4YDKL 1OQOA 2O5ZH 3V0DA 3OAUL 4XN9A 4ZOCA 4JVUA 3HUJE 4IRSB 1U58A 2JKRM 2F53E 5C2UB 1YYMH 3LPOA 5ACZB 1MCRA 1H3PL 2ZWYA 4HSCX 5I23A 1DCEA 2Y07L 2X2IA 1PD6A 3QCTL 4H88H 1ACCA 5JQHC 4PSPA 3JUZA 2FECL 4NPYB 2PPCA 4EUPG 3PNWA 4JFDA 5EOTB 3DKHA 3FBQA 4LKCA 1UXWB 4N2GA 3NFPA 1RU9H 2FYVA 2E9WA 4HETA 3OAZH 3IFOA 3GEFA 1J11A 2LVEA 4U33A 3HHSB 4TPRL 4XB7A 3QIUB 5C09A 1BOGB 4X9IA 3Q44A 3ZTJG 4XCYB 3ZRCC 5FGCE 4G83A 3MA7B 2VH5L 1T89C 3WUWG 2IWEA 5BZXA 3QR2A 3KJ4C 4EXKA 1TVBA 5F7YC 1MJ7H 5HDOA 3RU8H 4FNQA 1XTLA 4LLVB 4RGMC 2DQJH 7CGTA 4OBRA 3NACL 4Z3FA 4X8JA 3LN5A 2DQDH 3FUHA 4G7VL 2R1YA 1OZTG 3QQ3A 4Q14A 5DWUH 2FSEB 3NZ8B 2OAAA 2XG4B 4L9DA 4NQVA 1K3ZA 2OM5A 4WFHD 2YIHA 4I85A 4JFZL 2YGVA 1CF1A 1U3ZA 3A6CH 3ZT6A 3B5HA 1DN0B 1RULL 2CO2A 2WGNB 2WINB 3ELAT 1XEUA 3CZUB 3IDXH 4AZUA 1J0IA 2FATL 3WHE0 3HE7A 5C86A 4HJEA 3P9WB 3GS7A 4YAQA 1WGVA 2HVKA 3QS2A 5E9DA 4W9ZA 3DBXA 4K23H 3TA3C 4HH9B 3UAJC 4DP4X 2Y06H 3F5WB 2P52A 3IT8D 3AG2B 1B0IA 5E9NA 2VSMB 4WW2A 3U7AA 3GMQA 5AAMA 1H15B 2WTRA 5AVTB 1P2CA 1XO8A 1Y18A 1TETL 3WV0A 5MEOA 2DYSB 2FO4A 5CLZA 3WS3B 2CDEA 1TQWA 2EH8H 5D72H 2B5IB 4LVOB 2HH0L 3EH3B 3WHE1 2VUYA 1XR8A 1PY0A 3IYLW 4FCAA 1HU8A 2N0KA 5DLMH 4HA1A 1D7BA 3GI8L 3BT2H 5H37A 1MCKA 3C60D 2IAMD 4I9WD 5E9AA 4YDNA 5JR1L 5GS2H 3S9DB 1FFPB 2B1OA 1U93A 4ZX5A 3RJDA 4BKTC 1QFWL 3O8XD 4RMVA 1W8NA 4N0YH 3D12B 1BD2A 1GZPA 4NQSB 2GABA 4BSWB 3HG2A 2IQ9L 3OAYK 2BRRH 4NQUA 2Z9TA 1NPJA 1VACA 3UJTL 1USZA 3DUSB 1ACXA 5DVPA 4M6ML 1JCVA 2DYPB 4FYTA 5KSBF 3DX6B 4KKRA 3MV9D 2GI0A 2R4SL 4H20H 1JHTB 1D5BA 3Q1SH 4QOKA 4HJJL 4WWNA 3AQZA 4TXVB 1JTTA 5ABAA 3KPLA 3V6BR 1U3HB 2YQ3A 1HYSC 1FI8C 4F37K 5A16B 3TL5A 5KN5A 5C2BL 1ET8A 4XT1C 1OTUD 3W1ZA 3GJFB 1GSKA 4JANB 3BVNA 5BMFL 3P9MA 1K2DB 1B4JL 2VN7A 5FW8A 4XWOC 3BO8B 1KTJA 4R90H 1P1ZB 2QHRH 4H0IA 1W80A 1SFDA 2AEOA 1T2QL 3MXWH 4TLKA 4GAYB 4APXA 2PPDA 4JQVA 1A7QH 2ZG3A 2QQNH 1I8KA 1JG9A 1OSZA 1ONQA 1NDTA 1MAKA 3ZHNA 1SJHB 3QEUB 1EUTA 1OZUA 3QJOA 1MF2H 2GKIA 1A7OH 4Q6IB 5FO8B 2MOVA 2FWSA 2XKNA 2E7DA 4PJ8A 2GC7C 2HCZX 4GRLC 2JJTA 3O6ML 1DLHA 4NPKA 3TJPA 1LEGA 2WKOF 2KI6A 5DO2D 2ZUQC 4PGDB 2X38A 1YC7A 2W9DH 4AY0A 1IM3A 3QXDA 2J88H 3IXAB 2KT6A 2W60B 3VFWB 2ZP9A 4U7SA 1RHHB 2LHAA 3P4MB 4WJ5B 4XOEA 4DPBX 1WAPA 3ZMRA 4G1MB 3TX4A 1GKOA 4NENA 5CINH 2PN5A 1BYNA 5CJOL 4RNRA 3LH2L 3UTTD 2W9EH 4BSVA 5BW7C 4WI8A 4O58L 3WJJA 3FK3A 3MLYH 5DYOB 3UBGA 1TUPA 3R1GH 3CMOL 1Q1JL 4LSSH 2JKJA 1AXTL 1CGVA 1SOKA 2ITCA 2EXYC 3H0TB 4MSWB 2YQGA 3O11B 2KLSA 4IRZH 2OS7A 5GRYA 1VADA 4PAZA 1H3VA 4N0UE 4LRNL 3L45A 3VX1A 3ZYZA 1KDJA 3UC0L 4KPHH 3BQUD 1RFDL 3T9WA 2EEFA 4J3UA 2G2NA 1XIWB 2O6PA 4E68A 1TLKA 4PW9A 1S8DA 4P2RA 5F3BA 3L5IA 3JTSB 4QD2E 2G9HA 1P5VB 3ZMNA 2BMKB 4OKVB 2VLJB 1IM9B 2Q3AA 5CJ8A 5I8CB 5B3NA 2X2UA 2Y7SA 4LESA 2NYYC 2MQGA 1EZSA 4OUUB 4WV1B 5HGAB 3G04B 4HIXL 2MEJB 2VW6A 1S7XB 1W72L 4NCC1 1TTFA 2M83A 1K6QH 5ESAA 3STLA 1WV7T 2C1PA 1JERA 3N9GL 4LP4A 4WI2A 3DK0A 1RK1B 5IHUL 4YNYA 4WDIA 1KCVH 2VZUA 4JFUA 5I74B 3WY3A 3LQZA 4KDTA 3S37H 1HZHH 4KC3B 5L0QB 1E4XH 1UZGA 1QSFB 2YWZA 3BJLA 4MS8D 4WEEA 4DZBA 1I9JL 3L1GA 1YEJL 5IQLA 3W38A 4LCCC 3L3GB 4NZFA 5EO1B 1T1ZA 5C9KA 4Z7QE 4N1CA 4U1SA 3UG3A 4K8RL 3UC2A 1Y6KR 4HFUL 5FYKH 1F6AB 3QQ9D 2Y1VA 3SEPA 3CK0L 3S7GA 1DQQA 1MNNA 3U7YL 4G8FA 4N3UA 4G1EA 4JFOA 5F97E 4Y4FC 1EMTH 4XCCH 3MJWA 4UV4H 3PWPA 5GJTH 2AJYL 5TQ2L 3RA7L 3H7LA 4F33B 5JOPD 3D3VA 5KS9B 3D69A 4WI7A 1XEDA 4PRID 3TBVA 4X6EB 4BA0A 2ZWNA 3EH4B 4F5CE 1ZHKA 4K55A 4NUGH 1KCWA 2YAHA 4PRPE 3SQRA 2XY2A 3MNWA 5E99H 2MJWA 1YO4A 1NGPL 2BNQE 3R0NA 1F2QA 4QEGA 2ZKHL 1BVKA 4UQ3B 2OMZA 3WTYA 2NY4B 4NQDA 4DP7X 3EZ8A 2DD8L 4OSUH 3TGXA 3VXRE 1XCTB 1NC4D 4XP5H 2AQRA 3SPJA 1F8TL 5AWNL 3ZE2B 1A0QL 3DYMA 1UH3A 1PLGH 3JVFC 3NA9H 3QO1A 4HG4J 1T1WB 4UT6A 4YSSA 3HLKA 1TZGH 3EH2A 3MRDA 5GS0C 3ZQXA 4DERA 4LOUC 3MJ9H 2A3TA 4E9LA 5D1ZA 5L88L 5F1OB 2X9YA 3QJVB 2Y69B 1TNMA 4K0OA 1CUOA 2VB5A 5GGSA 1GYUA 2IGTA 1U42A 4PFEA 3SSGA 1FE8H 2FEDC 4N6RA 2VQ1B 5GS1A 3T0ED 4TRPH 2JNZA 3QWOA 5GGUA 3BISA 1OW0C 1DVZA 3MN8A 4AE1A 1XGQA 2YSSB 4LNRA 6FABH 1XF5A 2BNRD 2F2HA 2WQWA 4ZW5A 2EC9U 4OZHE 5ABDE 4A7GA 2GJ6B 4F2FA 2YJQA 5AW0B 1LXMA 3OMIB 4GQPH 4NZJA 1E6JL 4BQBA 1UTDA 4BK8A 1KYUA 1OT1A 1KUMA 2P5WB 3A23A 3DXAD 3WIHH 2WO3B 2WLLB 4Z7AA 2UX6A 1C9SA 3WO4B 2DI8A 4PG2A 2ATKB 4CRPA 1FG2B 3L9YA 4JO2L 4ODSL 4GW4A 5CZVL 1YJDH 1HEJC 1CGWA 4YK4B 2W9LA 3EYOB 4GKSB 5ADOL 2CR6A 2Z31A 3BGFB 2IPTH 3T0DA 4F9PC 2FE0A 2HRHA 2PYEE 4U49A 1FZKB 2P5EE 5B1CA 3EYSL 4JREC 3PV6A 1J0ZA 5ITFB 2CA3A 1DJWA 1ZXQA 3RWDB 3TBWA 1G7JB 1KELL 1OQXA 4EI6B 4DKEH 2ICCA 4HPYL 2J6EH 2ZE0A 4DVBB 4QRFA 4X0KA 3AQDA 2IAAC 4I8DA 1TEGA 3CHOA 3ZOAA 5MEND 3KPSA 3DX7A 3S5LA 3VFTB 4TQEL 5CCJA 4LLDA 5DI8B 4YHKH 1AHWB 4CADB 1EJOH 2VC2L 4IRSC 1P84J 3B9KB 5G2NA 4EBQH 1MFEL 2A73A 3MACH 4N3TA 5L7XL 1ZY9A 1LP9A 2APXA 2OZNA 5IW1B 1ASQA 4J3WA 5IFHH 4P2AA 5L4JA 2NQCA 3I50H 4H4NA 3X1FA 2JKXA 1EHKB 4NQEB 4LSRL 5EEYA 2IIJA 2ORBL 2R2CA 2QMJA 4G3YH 5HHPB 1A2YA 1FYHB 1T7YA 3L5WB 3STBA 2OTUA 4YBHA 4F1ZA 4L0PB 3CFQA 2F7IA 1QWUA 4AI7A 1CIUA 2AEWA 1I3VA 1MZZA 4PV1C 1G0DA 2CSPA 1O7VA 12E8H 1KB5A 1MEXH 2AJZA 2QQKL 3DTDA 3QIUC 4UM9D 5I8KL 2XA3A 3GMRB 2BXZA 5IVZA 1FSKC 1B2WH 5GS2D 4F8NA 2E8ZA 3V2AR 3OJ2C 2PO6A 1SLXA 3QIBD 5CR8A 4ZFOA 4S1RH 2ARJQ 1LMIA 4L8SB 1BF8A 1FL6A 4CKQA 2P7TB 4JR9H 2APTA 2XC8A 4N8PA 4URTB 3KPPA 1N0XL 5CMAB 3SDAA 4HUXA 3RFZB 2R2EA 1WCQA 3QJHA 2P8PB 4G6KL 3U46B 3MCLL 1FCGA 4AUYA 5KVGL 3OZ9L 1ZS8B 5TE4L 3DROB 3LYRA 1NGQL 4LVEA 3A4AA 4O4YH 4RVBA 4MCMA 4X98B 4JFYB 2VLKA 4WI5A 2YPKA 4B7IA 2VRKA 3KHOA 3DX8B 1KCLA 4Y1SA 4AK1A 4ZW7A 3GKZA 3MLSH 1RK0A 3TEYA 3VFMA 3TO4D 5AW8B 2H8PA 1KEML 1NDMB 3ML8A 3R06A 4FTDA 5DRWA 2A4EA 5B1AB 4IOIA 1RZKH 1MFMA 1VSCA 2C3VA 2FQEA 4C83B 1X5HA 1R47A 4OGZA 4XVUD 1FP5A 5EORL 5IW6A 1S78C 4YDJA 2N01B 5FW6A 4GXUM 2F54A 4JAMA 3LZLA 3LRHA 4XP4H 1SBSH 2QKIA 3HOGA 3IKCA 4YQXH 4K3HA 5KG9A 3P11L 4N25A 2CCLA 4QRPB 3TASA 1AG6A 4LVOC 4PLNC 1J9CT 1AH1A 4BWTA 2XZQH 2B14A 4QHMB 1XGRB 2QQLL 5FHAL 1FCCA 2ZSWA 3KWWA 2F18A 2Z34A 6PCYA 4HKXA 5HPOA 4KMTL 2CJUH 2J1KA 5ELIA 1DVFB 3O2WL 3WDIA 3FZUD 3Q3GB 4O2CA 1XD0A 4ODUB 3EXJA 3BH9B 5DEZA 4ODTH 1Q94A 1YN7A 3RURA 2FD6L 3BKML 3AWFA 2JB5H 4MLIA 2Y1AA 3MUGB 2C4FU 1J18A 5INDB 4D9QE 1N2RA 4PWEA 1AY1H 2W0FA 4PJAB 4F91B 1LO3L 1HWWA 2CD0A 1W2KT 1WS7A 2BP3A 2R9HD 1PZ5A 1U4EA 2OJEA 1J87A 2WYZA 3HC0A 5E6SB 2J5LB 2WZAA 5SV3A 4BK4A 4E9SA 3B6SB 1MCOL 5KOVC 5IOPA 5KVMC 3W2DH 3OZLA 2J3SA 4KQ4L 2XWTA 2VN4A 1E4KC 2O6EA 3T0BA 4EDWH 4MVBC 3O3DA 1LNUB 2OYLA 1UXMA 2ODIA 5IBUG 3E6HB 5JPMB 4WK2B 1MOEA 2F5AH 3WEAA 1J5CA 1XXDC 4R7NB 4OZGF 4QRRE 1DE4A 2WXLA 1H6EA 2AZAA 1OP5K 1JZ5A 2HKFL 1AS7A 1MLCA 5DJ2B 3RI5K 3WS6A 2BS8A 43CAB 3N06B 4G5ZH 4FKKA 2V5MA 1UWGH 2DQEH 3QUGA 3FT3A 4NKIL 3HBPA 4ODHL 4QUOA 5A2IH 1ZHLA 3VSUA 1MAMH 4WGWB 4UYPA 2WGXA 3LZPA 5LGHL 1N3NB 4YZWA 4WSKA 2V33A 3EJTA 4ONOA 4MRCA 2AZUA 1FVDA 4JPWL 4Q6IC 5IB5A 3ZDYB 4FC3E 4NP4L 1KJVB 5C0IA 2W94A 2EE6A 2EECA 3L1OL 4KNQA 3RWJB 4QNPE 4KY2A 1C5CL 1CQKA 4I1PA 5J8OA 4MZIA 3DX9A 1DVTA 1ZSHA 4JHVA 1IFRA 3QXAA 1TMQA 4WJG3 1ZEAH 2XOTA 2KL6A 2ZXCA 1KPUB 5E1GA 1LD9A 2BIHA 3LKQA 3V0FA 1MFCL 5F1IA 4ZMNA 2VM9A 3VGGA 3LJ3A 2QL1A 3D2UD 5F7NC 4BH7B 4PY8J 2HTLC 5TQ0L 5FYKD 4EI5A 4XMLH 2ZF8A 3HVDA 1V3JA 5HP5A 1BYOA 3VI4B 3QDGA 1RZ7H 2B1HH 1AI1H 4I4WB 5GRXG 1IGCL 3VXUD 1MRFH 3OV6A 3PHQB 4Z0BL 1F02I 3CN1A 1GMIA 5JW4M 4Q9QL 3N41B 3QEGH 1G7HB 3Q9QA 2MPAL 4NCC2 2LLLA 1XIWC 5C7ZA 2RQEA 4RWYL 3RWGB 1IAIH 3ARDA 1XH3B 4B9GA 3KPQA 4QAMB 4LF3B 3LRGA 1QASA 4G43B 4WHTA 3D7PA 1IBGL 4YDLB 3FRPB 3GPSA 1PG7W 1Q9WB 2WCSA 3E6FA 3L3HB 3ILQC 1ICTA 4UAOB 3LRKA 1NBYA 4PJCB 4WV1C 2NOYA 3L9RB 3ZDXF 4XBPA 3KVQA 4YXHH 3TBSB 4BCXA 1E9OB 4ZUTA 1E8ZA 3C60B 1BP3B 2IAMB 3CVDA 5JORB 5I74C 1DN2A 5IW3A 5HVHB 5I30L 5D7LA 4HX1B 4XC1H 2V9UA 4BM7A 4JZJC 4HKBB 5AW2B 3O8XB 5SWZE 3OPZH 3RVTD 3QC6X 1GGUA 5CILL 5EBWB 2FJGA 4XP9L 3FTGA 4OLYL 1TG8A 1HHJA 4YIQB 2LLNA 4FNUA 4PTTA 1QD0A 1DUZA 1I7ZA 3QA3A 2ZUVA 4GI9A 3MV9B 1C8QA 2WJ7A 1THCA 5TFSL 2X4SB 2D7NA 4N1EA 1KJ3H 1OWWA 4H44C 3O6FD 3K6NA 1S3KH 1JD7A 3D5OF 2HLFD 2YXVA 2VLJE 1KC5H 1T4KB 2XN9E 4MD0A 1R3KB 4A2DA 5K9JH 2HMID 2VISB 5ADPH 4U6XB 5DJ6A 1HKLH 4GYBA 1AFVL 2Q8AL 5A40E 3DTXA 4DQOH 3MRNB 3BVUA 4UOW0 3MV8D 4JPKH 3O9WC 2NY4C 4W70A 3TJHC 4M5SA 2YXFA 3T2QA 4YWGH 4PRNB 15C8H 4NO2A 3GBNL 1ZE3C 4WI6A 5IEKA 3LXUX 5T5FL 2FECI 3HC4L 4EIZC 5J1SC 4QHLA 1LE5B 4PWGA 4F2MB 1EVTC 1T0MA 2FRGP 3IXTA 4Z0XB 4ENZA 1SQMA 4UOW1 1D9KA 2BM3A 4P2CG 3ZKMC 3GBLA 3ASOB 5D6CA 4W9JC 2R15A 2QSQA 1RHFA 2Y7MA 3LKRB 4R8WH 2AGJH 2H0PA 1KCKA 4LLYA 5DS2A 1Y7VA 5D71H 2DWTA 1MWAB 3I6GA 4Z95H 4AGNA 4S1QL 5KS9E 4AMKL 4NCDA 4UT7H 1UFGA 3WTSA 3G6DL 2NX5D 1WHOA 3HA0A 2FYYA 4TSCL 3UZQA 1BAGA 5K9KA 3MLUL 1CICA 1MCPL 3NABL 1MFAL 1UENA 4G70B 4DVRH 1MY5A 1U8OA 1CDGA 2J8HA 3GTNA 4OD3L 3UTTB 4UQCA 4KXBA 4EOWL 4DEPB 5FM8A 1PKQE 2WUBL 1T66D 1T7ZA 1XL4A 2HPOA 2VQ4A 3MNVB 4J1UB 4XH2A 4KI5C 5I9QB 1F97A 4LKXA 5B38B 4HVBA 3UIZA 2UZXA 32C2B 4CJ0A 5KJ4A 2HRPL 5I1EH 3C6LD 3U4EA 3PP3H 4YK4C 4YGVB 3W39B 3HE6D 3BGFC 3QUXA 4AEIH 2ESVE 3B2VL 3LIZL 1JTPA 3S35X 5IBTL 1SLUA 3BRDA 1NCWL 3BQUB 2FBJH 4AQ1B 1JXDA 1WBZB 3GRGA 5TD4A 4TUKL 4EVNA 1VKXA 4YDVA 2B08A 1KN4H 3GMPB 1IGFH 4L8DA 5DVKA 4MBRA 3B9EA 4KNUA 3GSNL 5JHLH 1IC5L 1DDHA 1J8HA 1TZHB 1Q0XL 2IDUA 4TQPA 1AGEA 1T83C 1RIHL 4Z3HA 5F93C 2XZAH 4B50A 2CIIA 4IHOA 2BERA 4CW1B 1YSOA 3BMWA 5TH2A 4AM0A 1N64H 2GTWA 2P5WE 3BLKA 1AHWC 3CSYB 1CXKA 5D7JD 1XF2A 2Q5BA 1XDTT 1IL1A 2JVUA 3TEWA 3B9KC 4FXTA 5B7FA 1AQDA 1QFWI 3TF4A 3HMXL 4KXDA 3AY4A 2X40A 4GMSL 4PMEA 2N7SA 3C5SA 4GT0A 3ISWA 3M88A 3WO3B 1EO5A 2EEAA 1WC7B 4FQQB 4WWKA 1HYRC 4NQQA 4HEME 2X4QA 5BPPA 1WITA 1JGEA 2A9MH 2CBTA 5I66A 3UAFA 2ZICA 4FABL 4OCXL 3GKWH 4NKOA 4L1BA 3ROLB 3SIKA 4LSQL 3CDGA 4Y16D 1RXLA 3O3UN 1QZ1A 2YLKA 3ERXA 3L3KB 2QKSA 2CHXA 4YHIB 5E6IA 1ZCRA 3D08A 1G9MC 1TF4A 5I76B 3PL6D 4NLAA 2E86A 5GRZA 2EUXA 5JW5B 3HNVL 4PRIB 4L8SC 2E7LA 2MQCA 1XQ4A 3UTSA 2DYRB 2ZP0T 3A22A 3TNMB 3ZTDC 2GT9A 3MGOA 1F90H 3BPCA 3QNXB 2PPEA 3SYOA 5LNGA 3RFZC 1EEUA 4U3SA 1DJZA 3UYOD 3IJEA 3MX0B 4MJJA 5LCVH 3RWFB 2AK1H 1IC4H 1SEBA 3VYOA 1NC4B 4I88A 1BMZA 5AAWC 2EXTA 5K1JA 3KYNB 3DJZA 1IBFA 3ARXA 2YXWA 5DD5H 3AS2A 3U9WA 1I8IB 4AYFA 3WEMA 1X5YA 2I26N 3FU5A 4RSVA 5FYJH 3JV0A 3MLTB 1MCWM 5DQ9B 4LQ1A 1DQDH 2W07A 1SVCP 4L37B 3MRQA 4G8GE 4NO0A 1RIVL 3ARQA 4DUWA 3IPFA 4JN1L 3C9NA 3NIFB 3CX5J 2YBGA 3AW5A 4H40A 3NIGE 3BZ4B 1P6WA 3BE1H 4K5NA 3M07A 1QOKA 2AXGB 3H3KA 3T0EB 1NANI 2BY0A 4P05A 4X5PA 3BZDA 1F4YH 1PAZA 2YHGA 3MUUA 5DJAA 3ZYOA 1JV5A 4F7CB 1G6RL 4BXVA 2YD2A 2EC9T 3NCEB 4DSYA 5KOMC 5IREA 2X0WA 2DQTH 1DBBL 2UZIL 2ITEA 3DXAB 2VSDA 4POZC 1GGTA 2WIIA 1EGJH 1RUAH 4L3CB 1HFUA 3T0XA 4KO9A 1DVFC 4N0UA 3BX7C 1HHGA 1MAJA 4CAGA 2XN1A 3TS8A 2YA1A 3PJSB 5D5ME 1QLEH 4LDCA 1ETZB 4UANA 4AQ8A 4UYQA 4ATWA 4KH2A 4EZMA 3HG3A 2PWDA 1QZNA 3E8VA 1NL0H 5FM5M 1MREH 1ZTXE 1FLRH 4V2CB 1DUYA 4KI1A 2ZUWA 3B1UA 3VG9B 4IRJD 2BH0A 4M1GH 1NCJA 5DHVH 2J5LC 1T1XA 2F7RA 5A2FA 3ULUC 3OBAA 1W0YT 3AXHA 2F7OA 3U2SB 1EBPA 2JJSC 3IVKB 1BLNB 4L4TB 3BZFB 5FO2A 2I60L 3F01A 4PG9B 1H0DB 2YBRA 3WY1A 3UDWC 1FIGH 1M7UA 1TTGA 1NIEA 2FX7L 3P4OB 3LXAA 5MENB 4GOSA 3O0RL 2WXGA 3HMWH 4XTRD 1PY9A 5J5EA 2DLTA 3MNZB 4LPCA 4MA8L 3JWOL 5AOJA 2OMXB 5KVDE 2K7PA 4MJ4A 2G4GA 5BZDA 3LZFL 4WJKB 3OL2A 5KYXA 2FBOJ 2AK4D 4XN4A 4Q89A 2KZWA 3G5XA 2CKNA 2ZWKA 2C3HA 3RNQA 1A7NH 3P3SA 4G9FD 2DQ6A 3MBXL 4NZUL 1JNNH 2HG5A 1BM3L 4HCRH 3T2LA 4W4OC 5I1AA 2GBAA 1ET5A 3ECBA 2VDRB 5EHFA 3BRFA 4J4PD 5F0MB 3M1OA 1PGRB 4JDVB 1E5BA 1UHVA 5K9QI 3ZE2F 2ZOKA 4UM9B 2G2PA 4WW1A 2BNQA 1HH9A 2DKMA 4QYOA 4K15A 5H4ZA 3QIBB 2B20A 1JSYA 4P5TA 2NR6D 4TUJA 1GPOL 4N2BA 3VXRA 4D0BA 4MA7H 3BH8B 4KX8A 4YEFA 4JZOA 2OTPA 3RILA 5EU7C 2QZ5A 2HX8A 4LSPL 2W81C 5HY9B 4DH2A 2VITB 3VXNB 3VXQB 3GMOB 2VM4A 1J10A 1B90A 1YPZF 1DHKA 3KD4A 4X99B 1AQHA 4BEIA 4M7JH 3IPBA 5E8EB 3TV3L 3WNKA 2AJUL 4CMMA 1CFQB 4DNLA 3TT1H 4DTGL 4P49A 1I8MA 4P5MA 4R97B 2IANB 3TO4B 3W9DA 1WFMA 2YD3A 1EEZA 4IKIA 4OQTA 2V17H 5C6TH 2WBKA 4BZ2H 1G94A 5ALCL 4FYRA 2ENPA 4UILL 4TNEA 3VRIB 3LSOA 4KI5F 4OZHA 4OM1H 4JE4B 4AKPA 1M57B 3MRBB 3GS4A 4HBCL 2JV6A 5E8DL 1ZLSH 4YDLC 2UWEB 3V4UL 2BSBA 3QORB 4H0GA 5I8EA 1P4UA 3LAFA 3WELA 4YPGA 3TBYA 1OWRM 5D1QD 2IDSA 2EO7A 4MZ2A 5DWPA 1MG2C 2FZ3B 4GO9A 4P59H 3C60C 3MRGB 3MUZ1 1C8PA 1W0WB 3BVXA 3HPJA 1A9EB 3FSAA 4KKNA 4NC0B 4P5KB 4WO0A 4B9IA 3FB7A 5HVHC 3EYFB 3MXVH 3O8XC 4HU2A 2JKSA 4A6YH 2PYEA 5E8OA 1CGSL 1U41A 2XN2A 4HGKC 5GIRB 2EDDA 2HVJB 1NMAL 2C4FT 1EIBA 3P2BA 2DM7A 3VXPA 4UNIA 2J5WA 4R26L 2HKHL 4WNSA 1O7DC 4FL4B 3BAWA 5HHME 4OLVL 1JMZA 5GRUH 2WLIA 3L1EA 4IHBA 1TQVA 1HL4A 3CXDH 3GC3A 1PLBA 1LO4L 2OSWA 2GJPA 3C08L 1BEYL 3MOBL 5GGTH 1QUPA 2ZOUA 4I18A 1OTUC 1G9NH 4PJIA 3BYYA 1QSEA 3PABA 1L5GB 4AGMA 2MKWA 1E9PA 1H3XA 4XHJD 1KXVA 4DP6X 2R0ZL 3SPVA 5D7EA 2R69H 4X5LA 3OLEA 1R24B 3ME0B 2H9GB 3MOQA 5I2IA 3K3QA 1PZUB 1P7QA 4CSSA 3Q13A 4O9HH 1CE1L 3D1MC 1N12A 4G7RB 1F11B 5LN8A 4GKNA 5IHZB 1JZHA 1TJGL 1PSKL 3G7TA 3H3PH 2OR7A 3EJUA 5T3XH 2NUTA 4XX1E 2HFFA 2A6KA 1LO2L 5HGHA 2XG5B 4PBDA 4RISL 1I7TA 5DO2C 3WY2A 3FTVA 2OMTB 1MJUL 4HWZA 2BNUB 3DSFH 2NZ1A 4MA3B 2NW3A 2Q8BH 3CZJA 3GNMH 1CLZL 2YK1H 2DIBA 2VAAA 3RY4A 2BVOA 3ETTA 5HDBB 5K33A 2ZOTA 3MRJB 4OLUL 1A22B 3MBED 4XNUL 3K91A 2XJLA 2YD5A 3RKDD 1HXYA 3D2UB 4DEPC 3HJ0A 2Y72A 2Y5TA 4FI7A 4JPVH 4DAGH 1PW3A 2HT3D 2H3NB 4JCMA 1ZK5A 1FORL 1I1FA 1Y1UA 4MMZA 3GEWB 3FQRA 3GSRA 3VXUB 1GZHA 2GTZA 4ZYKA 3FQWB 3MJ8A 4F2ME 2G75A 4HDIA 5DQJA 2P44B 2DJSA 1GS8A 3MNMA 4ANKA 2V3DA 1E4HA 4LQFH 3BQUC 4AQ1C 1UEYA 5LBVA 3HZKA 3P3UA 4J3SA 4OW6A 3H6JA 4WO4A 2E9JA 2DLIA 3ZSSA 2VJXA 4BFIA 3D6GA 5EC1B 4ZSOE 4DGIL 4XXDB 2OTWA 3V0AC 1N68A 1MJ8H 1XF4A 2L04A 4NRZA 2FT6A 3CVCA 3HZMA 4IM8A 5I1GH 1QPXA 2X4UA 4KQ3H 3V9EA 5H35B 4PCKA 5JOFA 3OM3B 3CN0A 3RVVC 3CH1B 4U1LA 7FABH 3EOBA 2PCXA 1UQSB 4ZZKA 4L18A 1R3HA 3FRPG 4WFGE 4HU8A 3WTWA 3TO2B 4A2EA 1O7SA 4KJQD 4UQBA 4AYGA 3ULUF 3QAZB 5FYJD 3VXTB 1U8LB 1FH5L 4MWFB 4NNYB 4BDVA 4F7KA 4Q9RH 1MW1A 1NMCB 3PWVA 3KXFE 3RKPA 1CI3M 4K5OA 4X7CC 5LWYL 1RL1A 1LWRA 3KLAA 4DF9A 5DF0A 1ADQL 4D7BA 3BP6A 3EGSA 3SD2A 4YUEL 3HG1A 3TN0D 4MS8C 2H7WA 1IGIH 3CDCA 4DWHA 4J2QA 1DLFH 4AG4H 1BPVA 5E23A 3IFLL 3GSOA 4U1GC 3QE5A 4R4BA 4BHUI 3ZDWA 3QG6B 4JGJA 4NZRH 3OGCA 1W0VA 3QQ9C 4HWBA 5H37H 1VGEL 4Y7OC 2GSIB 2Z4TA 3VTAA 4GG6B 3WKPA 4YXLH 5DK3A 3WJLC 1E40A 4GUPB 4NO5A 1IKOP 3HBQA 5I1HH 3KGRA 1H3TA 3O6FB 2C1OB 3MTRA 5F7DA 4QRRA 5DK0A 4JLRA 3P9LB 4JDZB 4MMXC 2AJ3A 1A1MA 3FB6B 4JO4L 4JL1A 2B0SL 3GRWH 4MYPA 4X42A 5EBGA 2X4NB 2FR4B 3ZDYF 1P7KA 4HV8B 4PJDF 2OCFD 3QULA 4TVUA 3TTYA 4CJ1A 1M6UA 4RIRB 4FA7B 2V7NB 3ZTNH 1SN2A 4GW5B 1V7NL 1NMBL 3EOAB 3WTVA 1WBYB 4BJLA 5DLLA 5IMKA 4MD4B 1QLFB 3MV8B 4PJBA 1MCWW 2R2BA 3EO9H 2R2HB 3AG4B 4A37A 3UTZA 3HPLB 5TE7H 3S4SB 3OXSA 5IMOB 1T6BX 4HHAA 4MNGA 1GMEA 3LY6A 2CAKA 4M48H 3FU7B 2H1LM 4A68A 4IJ3B 4GXUN 1CVSC 4LCWE 1ZTXL 2DQFB 3GDCA 4ZPVB 4Z7VB 2W0PA 1UZ8A 2YC1B 1CU4H 3VI4F 3W0WD 1WLHA 4ZX6A 4N24A 2VRQA 3QJTB 1S5IL 3FB8A 1Q1PA 2EIZB 1EH9A 2NY2D 2CGRH 1SDDA 3FQTB 4XR8C 1ZGLB 3BKJH 1SNRA 1R5IA 4H1LA 1OO2A 3V4PH 1QLRA 4PREA 3VGFA 4QXUH 3S88L 3HS0B 2RR3A 3U6RA 5EU3A 1SN5A 4LPTA 3K6SA 4C55A 1R17A 1DBML 1E27B 1L9PA 1FFNA 1FL5A 3FT9A 4Z7WA 5AVRB 3MJ7A 3SGEI 3UJJH 4F3FA 5KVDL 3GIZH 1OK0A 3OKEA 3OD3A 1FNGB 2VJ0A 2Y7QB 3O2DL 1U8JB 1SOXA 4PJ9B 4FYQA 3C6LB 4PJCF 1L6PA 3N40F 1I7UA 5GGRB 3HE6B 3KPMA 4XE5B 3RPIB 4XPGL 4XVTH 5EDSA 4BCYA 4PTUA 3T65A 4GBXA 3VG9C 4FRWA 3NIDF 4X4YA 4XP6L 2A9NL 1BQSA 3Q5YA 2ICWB 2Z92B 3MLZL 5C08E 4QJ4B 1AD9A 3T0EE 2IV9A 4YR6A 3DRQA 2EJ1A 3X17A 4FFYA 3TT3L 2L7EA 1R6VA 5ICZB 1UM6H 2X1OA 1B0RB 3F6JA 2OMVA 5ICXA 1YECL 5L4IA 1LEKA 5E4IA 1PQZB 3EBAA 1LQSR 1U8PA 3LKOB 3VFVA 5IJCC 5IF0B 1NH6A 5SWZA 4ETQB 5TE6H 2FO8A 1XXFC 3N42B 4GB9A 4PJ6A 4X6DE 4D9LL 4OCMC 3QPKA 4D0DB 1KPRA 3VWKA 2HXAA 35C8H 1KBGL 4RX4A 3OKDA 3ZL4L 5T3ZE 2CPUA 4V2BA 4DGUA 1GZQA 2J4WH 2H47C 4WCYH 3AREA 1BJMA 1CXEA 1TYEB 4JCLA 4P9HL 3APMA 4L5FE 4OGXL 1UXSA 3PPEA 3QQ4A 2I07B 2VAJA 3WFEH 2F61A 2I69A 3PXLA 1U0QA 2XN9A 3U6XS 4F7TA 2ADIA 1UATA 4PJ5E 1PL3A 4Y16B 3UPCA 1B88A 2EIJB 5CBEB 5ALBL 4JE0A 4LLWA 4L4TE 4PJGB 1QATA 2FIKB 4XB3A 5KYUA 4ZO9A 3F83A 3OB0K 2A6IA 3PL6B 5DUML 3TIEB 4RFEB 1R0AL 5DJ0A 4ZW8A 1ZT7B 2K45A 4FFWD 2X89A 3DIDA 4HZLB 5CEZE 3ZHKA 1OAUH 2JB6B 3ZIYA 4P2QD 2F9BT 4A38A 2F1AA 2NCEA 3B37A 5IT2H 2HFEA 5C9JA 3H9SB 1E9QB 2A0LD 4L0YA 1NCNA 1ITCA 1XFPA 4NJAL 3V9FA 4KKQA 2R23B 3V0VA 3D25A 2XXGA 2C5DC 4B9YA 1S9VB 5CJXA 3LMJH 1VZIA 1MNUL 2QSVA 1BQUA 3Q01A 4R97C 5LUMA 3TO4C 3N50A 3SDDD 3JTBA 2DMKA 2Z93A 4QRBA 3Q7JA 4HJTA 4HS3B 3AM8A 5GZND 2DQCH 1X44A 5JHDD 2XA8L 1FZMA 2O26U 3B1TA 4XXWA 3RIAF 3IN0A 4XVUC 3OKOA 1NGYA 3WFDH 3KZ8A 4XCEB 2G0LA 3WSQL 1NCAH 4KROB 2VZSA 1KYAA 3VI3B 4HYTB 1BJ8A 3QT2A 1RJLA 5BO1L 1MFBL 3RLSA 3K71A 1AGCB 1T04A 5DJXA 1TTRA 5AOIA 1CVRA 1XB8A 1MW0A 3V95A 5C0AD 1I1YA 1X5KA 4IMLA 4P46A 4KJYA 4MGXA 5HJ3B 1XBDA 3N3EA 3JTTA 2F8XC 3PGFL 1ZWIA 3WAJA 3M8OL 2EYSA 5IFJB 5IIEA 1UWFA 3CFIC 5GJSL 2EYTB 3FQUB 2ESVA 2JH2A 3II2A 4YDKH 5T3XD 4JFPB 1YYCA 3I6LD 1FG9C 3OAUH 5EIVA 5FGBA 5ID1A 5AW1B 2X12A 4J27A 3FYIB 3IDIA 3WAKA 3WEOA 2ZOLB 4KBPA 2CBMA 2IANE 1FL3A 1H3PH 3AB0B 3BKYL 4RMUA 3UPAA 5JMOC 4XVOA 4FL4C 2Y07H 3QCTH 3SO3B 3ZPDA 4YFLF 1URLA 2R9HC 1OGAE 2VR4A 4IRJB 4JFDD 1Z6JT 2CO6A 4PS3A 4X2UA 5IVNA 4AENA 3ZUCA 1CK0L 5EB9A 4BKSC 1AP2B 5I19L 3UAAA 5A2KH 1S7RB 4FD0A 1UYWL 5C09D 4WU5A 3BP7A 2NXZB 4KJPD 1PEZA 1JPGA 4TPRH 1R19A 3GD1C 4JJ5B 3PF2A 1QFOA 2VH5H 2AANA 2XX0A 4GW1B 1HE8A 4QY8A 3U36B 2W92A 3RZCC 3OJVC 1K5NB 4UNTA 4R96B 4ISVA 3F8UB 4C54A 2X4PA 3NACH 4XMPL 1RPUA 4C59B 1WSST 2XFXA 3LNDA 4H7VA 5ABZA 2VDPB 2X70A 1CC3A 1VCBC 3BHBB 5D1XA 1B3JA 4G7VH 2AK4B 4HKJB 4LCYA 4LMQE 3NAAL 4Y89A 1IV8A 2X3BA 3ZQWA 3AS0A 5E08L 3P2TA 3T8MA 4G9FB 1VDGA 2ICEB 2ADJB 5IR1A 4JFZH 4JRYA 2WXMA 4ZMZA 2B59B 3WTTA 3TCTA 2OQJB 1UACL 2CO3A 2TRYA 1RULH 2WAQA 3HE7D 3JSSA 4Z7IA 5I5JA 4NI3A 4HIIA 3POCA 5HHOA 1BQLL 4FXKA 2FATH 4OZ4A 4MAZA 5FB8A 2XCMC 1KENL 2XIIA 2X88A 3CZKA 1OANA 1PX8A 1TEFA 1G1YA 2FHBA 3TBBA 1KWGA 4WI4A 3BVWA 4OM0L 5D2LB 5E8PA 1FNSL 4AYID 5EZJA 4AC2A 1TETH 5IWLC 1PS3A 5D70L 1CL7L 3NIFF 1CYGA 1P4BL 4NQCE 5AW4B 2ZWZA 1Z3GH 3QO0A 4W9FC 2HH0H 3DMMC 3MBWB 5EUOB 3T8XB 3ROOB 4UIKL 3E0GA 5E5MB 3IDJA 3TU6A 1S7QA 3GI8H 5I17B 5FO9B 5HYSB 1QR1B 1G1CA 2D31A 4W9GC 4G8GA 4FNTA 3ETBJ 2BSTA 3FJTA 3GXPA 4QRQB 3T0WA 4NQXB 1BD2D 5JR1H 3F7VA 4L9LC 4P4RB 3V5KB 4AH2B 3TM6A 2TAAA 1QFWH 5D9SB 1ANUA 1CQYA 3L3DA 1EFXD 1IZJA 4F8LA 2IQ9H 3P02A 2COQA 3ILPA 4JZNA 4M4RA 4OFIA 4P2OC 2E7CA 3CC5B 1KLFB 4M6MH 2K1MA 3ARUA 1CIDA 1S46A 3L3IA 4QOKD 2R4SH 5CBAA 5CJQL 2AEPL 2H1PL 2HJKA 3ZE0B 3VD1A 2XX1A 4HJJH 2EDMA 5GGVL 5B1KA 3PDOB 3O41B 1R5VB 4IBUA 1CGTA 3QG7L 5DUBA 1V3LA 2JCCB 2WSDA 3ZE1B 5D1QB 4CSZA 5C2BH 3QAZC 4K5PA 2R0WL 5D5MA 2WWKT 3KPRE 3V6ZA 5BMFH 5J11B 1B4JH 1NMCC 2B8OT 4RDQG 5FKAB 3T5WA 4KK5D 4YSEA 1OF2A 2BW4A 4CDHA 1T2QH 3MAWA 3RVTC 2IALB 3APCA 1SHXA 2C9XA 4JM4L 2KMWA 4N90D 4G72B 5F1NB 3OKYA 5FKPB 5AW9B 3GBEA 4L3ED 4NM8L 5DC4B 5IQ9A 4HUWA 4J8RA 5F9JA 2BSRA 2GUOB 5F9AC 2L7JA 3O6MH 3GM8A 1KGYE 3QQDB 2ED7A 4AUJA 2HTKD 4W93A 2CWRA 4QKXB 1IM3D 2HMIC 2P26A 1QYGL 1IO4C 1YEDA 3BWAB 5D7SL 3BZEA 3KLDA 5IB1A 2EE3A 3RVXD 2EEBA 5JZ7D 1YJDC 3O2DA 1NANH 3CVHB 2ED8A 5EIIB 4UQ2A 1BYPA 2WZ5A 3HAEA 1XGPB 4GLRI 2EXWD 1E90A 5CLTA 5CJOH 1RZPA 2PR4L 3QNYB 25C8L 3LH2H 3WJMA 3TF7C 4RFNC 4JKWA 1ZVHA 5HHXL 3V55A 4O58H 5EOQL 4Y1AB 3CMOH 1N8ZA 1Q1JH 1SYVB 1X4YA 4IJ3C 1AXTH 5LDUA 3QHFL 2GK2A 3MRLA 3QARA 3NCMA 2FLMA 5CD5D 4W81A 5B3JE 4UDUB 3NFNB 5DA4A 4LRNH 3SBWC 3UC0H 2J57A 1OAYL 2Q0ZX 2GAZB 1RFDH 4P2RD 4ZMTA 4P3DA 3I02A 1A4KA 4HFWA 1CJYA 1F86A 1KTBA 4E5XG 1JN6B 2AV7B 3L9EA 2EH7L 4U4IA 1Y1DA 1CE6B 4UTBL 1ZA6B 2Q86A 5DVMA 4ZMPA 1WS8A 2EDHA 3MREA 5D7KE 4XCFL 1C08B 4ECNA 2CO7A 3HS0C 1C5DA 1XZWA 4JRWA 3MBEB 2WBJA 3L7EA 1NDGA 1MCBA 3ARYA 5MERB 1JZ8A 1KN2L 3IJSB 3FO1A 2OPCA 4AC4A 4P57B 3PWJB 4BSJA 1TNNA 1CLCA 4HIXH 1T66C 1W8OA 1W72H 2NY3D 1OV8A 4ATTA 5CP3A 5T3ZL 1G84A 3N9GH 2VXTL 5IHUH 4XNXL 1F3DJ 4PR5A 2XPGB 3C6LC 2K8QA 3EGXB 2G3ZA 4G9DA 3VXOA 1YEFL 4RDQF 3DECA 1I75A 3BP5B 4BE6A 4L5FL 3QPQD 1I9JH 1YEJH 2VDNL 3EJZC 4AEFA 3N1PC 5B1JA 3SZKC 1QWHA 1YAIA 2VW7A 4EZKA 4K8RH 5FK9B 4HFUH 1MRDL 4AEHL 4N9OB 2WMPB 3CK0H 3U7YH 3FULA 5I0DA 4X5WB 2EE2A 1DZ0A 1I1AA 2Z1PA 3PWPD 4LEEA 1KACB 4ZMWA 4RWHA 2EIBA 4ZS6D 1LE9A 3D3VD 4I3SL 3WLBB 2AJYH 4XBGA 2CDGB 5TQ2H 3RA7H 3RY6A 1TCMA 3NPSB 2IJ0C 5DRXA 1L9QA 3PP3K 5CEZL 2NNXA 1RP8A 1RLWA 5JO5B 3VMPA 5D7JC 2KZBA 4LT7A 4APQA 1BIIB 1T1YB 2OFQA 1RZKC 1NGPH 1JYWA 4NQDD 1JFQL 5T1DL 2ZKHH 1KT2B 2XACC 1J0YA 2EDFA 4PGBA 2R7EA 4E41D 2ITDA 5C71A 2I9LA 1NCBL 4K73A 2DD8H 3BAYA 4DCQA 1TO5A 1KY6A 4NWTL 4JFFE 4JN2A 2YS4A 3A4DA 5GRWA 1OM3L 5AWNH 1O6SA 2V2WB 3STZB 1A0QH 3GSWA 3T2NL 3VQ1C 5D4JA 4EQ3A 2VXQL 4YE4H 3VFSB 2FVNA 3P73B 3FSVA 5GRJL 1DBKL 2VDRL 1KLGA 4Y16C 5JDSA 2LE9A 2MHAB 5L88H 3GZQA 2BWIA 3JV4B 3S36X 1RJZB 3CX2A 1A5FL 5C0FA 4WFFE 3DO7A 3RGVD 4GRMA 3PL6C 1FNFA 2IPUK 2WQAA 3J7HA 5DEGA 4BH8A 4F93B 2FLBT 4CUCA 3T77B 2Z35B 3O3BB 4FNSA 5J6SA 1OSEA 5BZWB 4JO5A 4JFQB 1S7UA 3OB8A 2X53A 3G5YB 2CBPA 3JWDL 5FM5O 2J25A 4B3EA 4L8CA 2AHIA 1QUNA 2ITFA 4XVJL 3EUUA 4V33A 3SGDI 4H20L 1E6JH 5DHVB 4PD4K 4FLRA 1T5WA 2ICWJ 1BZ9A 2ALAA 2HFGL 5HDBF 5CN2A 1EX0A 4UUJB 3KHQA 4UAHA 3S4SG 1EVUA 2EZ0C 3E3QC 3A67L 3HG4A 4JO2H 2MTAA 1T20B 3F7YA 2NZ9D 4FQLL 4ODSH 2H6UA 4PN6A 2Z31D 5CZVH 4ZXBA 1XMEB 3NCBB 1HNGA 1HE7A 3BXNB 3IDNA 1DVQA 5ADOH 4X5RA 1AGBA 1KTLA 1EFQA 5F7WC 4PJGE 3W0WB 1K8DB 2DEXX 2ZKWA 2WNGA 3EYSH 5EBMA 4EUPA 1G7MA 2BZ7A 5FF6B 4I48B 5IGXL 3T0VA 1KELH 3EW3B 2GCYB 2YARA 4KITB 1CYWA 2IH1A 3PREA 4HPYH 1U95B 3KPSD 4M1DL 4TUUA 1X9UA 3H9SE 3HR5B 5DVLA 3TYFA 4LSTL 2PYFB 4XGZA 3WUWA 4TQEH 5LG6A 1FZOB 1KIRA 1X4XA 2CJTA 2VC2H 3K0YA 2A74B 1MFEH 3QRLA 4ELDA 4EN3B 5L7XH 3AB0C 4BZ1L 4XE0A 2PCPB 1GYVA 2X6UA 3FTWA 1VFOA 4LAQL 4P4KD 4K3EL 4HSAC 4ZSOA 4FCHA 3GF8A 3SO3C 5JXAL 1D7FA 2ZXAA 3T4AA 4LSRH 4PHXA 4IRJC 4QHNB 2ORBH 3C6EA 3NG5A 2IMNA 5E94B 4HAFA 5JA8B 2FH8A 3DPBB 2WKOA 3GSVA 5BJTA 1YMME 2F7QA 3D39E 4WK0B 5CZXD 1ZLDA 2A6DA 1T4KA 5BRZD 5I8KH 2QQKH 5FA3A 3MA9H 3KXFA 4H13C 3WEBA 4NFBA 5HPMB 4YO0B 3CFKA 4IRZL 3UEQA 1M1XB 4XTRC 4GG6F 2PW2B 4OU3A 1PYWB 2DH2A 2JCWA 3BUTA 3OWRA 2YO3A 3I3DA 2LOEA 4P23C 3SDAD 4E9QA 3GK8L 4KPHL 5FS5A 2RJMA 4K5LA 3BKCL 3PRZA 1M9SA 1N0XH 3QJUB 4G8IB 4V11A 3FO0L 4U4BA 2DTML 4G6KH 3MCLH 5KVGH 3OZ9H 4J2XA 5TE4H 4G7SB 3WLWD 1E7UA 1NGQH 5FIEA 3DARA 4R84A 4WI0B 5TK2A 2ICEC 3IE4A 5BOJA 5CZKA 2ZX6A 1HT6A 2Y36L 2Q7YA 2OP4L 5AYTA 3D4ZA 4AJ0A 4CC1A 1DSFL 2MRYA 3NTCL 1KEMH 4J4PC 3TIDB 1NGWA 4FJYA 1JGDA 3MKGA 2BIMA 2G5BB 3QI9D 5DZVA 5EFIA 4N22A 3MNDA 4R7VA 2N3JA 3SHSA 1LVEA 1GA2A 2F54D 3P2DA 4E42A 4N0RA 2JK5B 2WO2B 5EORH 2XNAB 3Q2CA 4GRWE 4JJHA 3Q2NA 5T1MA 4LHQB 4F1SA 4X9FA 2QPSA 3F7PC 3WEXA 2MWCA 2NR6C 1AO7E 2QVMA 4HAKA 5B21A 1UJ3B 4FS0A 1YLBB 1HK6A 4Z77A 1BFVL 3N85L 2ERJB 4O51B 3P11H 1BVLA 4X4KA 3SKNB 4DOHE 3N44B 4AGQA 4JFED 2OMUA 4AVIA 3ATDA 1G7IA 3BLPX 4OF7A 4AYDC 2QQLH 4HIQA 5FHAH 4U0QB 1BMGA 3L2NA 4LCWA 4KMTH 3SY0B 4ZAKB 3VXSA 2AK4E 4G5AA 3U79A 3O2WH 2JLPA 5CGYD 1RUPL 2FD6H 3SDDB 2PCYA 3X11B 4XXCA 1KGCE 4X6CB 2XV0A 2C26A 4M8RA 4KXAA 5FUOL 4GEIA 1X5MA 5JHDB 4D7PA 4I2XE 3MRMB 1M6OA 3HHRB 1QSVA 3P0YL 1LO3H 3FO2B 3TA4D 2AEIT 4F8PA 1MCQA 2XZZA 3VU1A 4JM2A 4AQAB 2NZIA 4Z78B 1OTSD 3CFMA 4D94A 1MCOH 5F3FA 4DJMA 1A3QA 4PGCA 4KQ4H 2IQAA 3D0LB 3RWIA 1KTKE 5FYKU 5AALA 3FQ1A 5C0AB 3A4FA 3TWYA 3JVGC 3TNNB 4BYHA 5D1QC 7PCYA 3NA9L 5HHQA 1ZA3B 4CC4C 1JK8A 2MH4A 2WAHA 5J11C 3CLEL 3SDXB 2GYSA 4NN7C 2NDGA 5ITBL 3QXVA 5FWQA 5IBLC 4FA8A 5C7XL 2YUXA 3Q0HA 1UURA 2VWEC 2EDEA 1FO0L 4M7ZB 2HKFH 4PB0L 1U58B 2A7BA 2DAVA 1T89A 2Y7NA 5DRNB 4LOEA 3WHXA 3G5ZA 5CR1A 5C0CE 3Q2VA 5CEYA 4NKIH 4ODHH 2VE6A 5BRQA 5SX5H 4FNLL 2ZXDA 5ICYA 4L4JA 4HISA 3N42F 4NUPA 4OIAA 3K1DA 4WFED 5LGHH 4N28A 4UTBA 5H2BA 1Z7JA 1I8LC 3MJ6A 4JFDB 2FB4L 3ARGD 3TC9A 3NFPB 3JT2A 2OYPA 4JPWH 4C57C 4W9IC 1KBKA 4LLQA 3FUFA 3IKKA 3IFOB 3BSZA 4NP4H 4NSKA 5D2NB 3TP4A 3ZZLA 3L1OH 5HDQL 3H1ZA 3UYPB 3COOA 4HUUA 4WHYG 3S2CA 5C09B 2UZYA 4BQ9A 4ELKA 4X6DA 1C5CH 2VN5A 1UXLA 4RMTA 5IB3A 2HX9A 4LU5L 4KI5E 2Q3XA 1KB9K 1VAHA 3JWNE 1RMFL 4QKTA 4YXKH 3ULVE 1B2YA 1A25A 4X9GA 4XMTA 3EJYD 4JMNA 3TA3A 3UAJA 3U9UA 3LXBA 2E75C 4MAUL 1IEAA 1MFCH 3E1ZA 3LN5B 4X8JB 1R5WB 4Y9GA 3R7QA 1B6DA 2V9RA 3IETA 4EI5D 3FYEB 2CKBL 2R1YB 4K8RD 3WNJA 1UB6A 5TQ0H 1JF6A 2XTJD 2BIPA 3QDGD 4BK5C 1N7ML 4PJ5A 4JG5A 4NQVB 3SGEH 4NC1E 5ENWA 5EO9A 1YY9D 4WK4B 4HIHA 1BMWA 1IGCH 1UEMA 3EDKA 4Z7OE 4ANUA 3CN2A 4Z0BH 3HS9A 4Q9QH 3U30B 1UM4L 3HE7B 1N10A 1R4XA 1EJ6A 1A1OA 3ARDD 5EN2B 4GPVA 2HVKB 1HN1A 5E9DB 5EN3A 3DBXB 4RWYH 1RZQA 4QPEA 5DJZB 2DLFL 4WW2B 3GMQB 2WTRB 2XBTA 1P2CB 2DKUA 2P28B 3QUML 5MEOB 2FO4B 3V6OC 1IBGH 5C6WH 3TTSA 2CDEB 3MBEC 1U3JA 3IAQA 5JYMA 3C5JA 3ESUF 4ALAC 1XR8B 4G3YL 3N0AA 5I16A 1AQ8A 1DCLA 1L7IL 5BVJB 4HS6A 2DJUA 3V0GA 2DW5A 2HT3C 3F2LA 3VI3F 1BX2B 4GKZB 1TKWA 1UOWA 1YY8B 1A21A 5D7LD 1FNAA 2VZ1A 4ZRGA 3FH5A 3ZJAA 4U7KA 2YMXL 1QBLL 5I30H 12E8L 1BD2B 1GZPB 4Y1AE 5HYSG 3BIKA 1HEZB 3UCQA 2VKXA 2B9BA 1KXTA 1EEYB 1SFHA 3O4LE 3OKNB 2D4DA 4Y4KD 4EIUA 2J56A 1EFXB 4PWJA 1R9FA 1BBDL 4LARL 5CILH 3O6LL 4XP9H 4IEFA 1YEIL 4OV5A 1N59B 2ENJA 1HZKA 3VWJC 2E9IA 2E46A 2IADB 4S2SB 4KZDL 1VESA 3OTTA 4Q4IA 1WZAA 1D5BB 4YX2L 2ZUTA 3B2MA 2UY6A 4QOKB 4X6FA 5TFSH 4NNXA 1U9KA 3KPLB 3DSNA 1JPEA 2JTDA 4JFXB 4O4YL 4RDBA 5DFVC 4B0MB 1L9MA 4E36A 5AVYB 3T08A 3JUYA 3NPSC 2APFA 1A9BA 3EYUL 4PJ7E 4GI6A 4WTZA 2F53D 1JV2A 1DJIA 3BVNB 3P9MB 4KJQC 4OLWL 2XVKA 4GRLA 4HK3N 2NY0D 2Z91A 5A43C 1P4LA 3U0TA 3SYPA 2Q8AH 1AFVH 2H32A 3KYMB 3VRLF 1A9VA 1INEH 3NEXA 4APXB 5EC2A 1O6TA 3FO9B 1IIIA 5HYQA 4AM0Q 5AVVB 5DJDA 1WJ3A 1OGAA 4FMVA 3MTXA 3H2PA 1TCRB 1II4E 2QZQA 3I75A 3R19A 1ONQB 3GBNH 1KWKA 3DV6A 2OL3A 5CGMA 3UX9B 1CD8A 3DOHA 5T5FH 2ZSVA 3HC4H 5HXMA 1BG9A 3VJ6B 3EO0A 4FQXA 4M00A 2K6ZA 1RY7B 5G5DA 2DIJA 1DLHB 3FN0L 4MXWL 3R8BB 5CLWA 1N4XL 3GYRA 4DFIA 2CDFA 1HOCA 3SGKC 2Z64C 4H8UA 2YD7A 3SJVA 1JE6A 3UABA 1HSBB 1EBAA 2H0JA 2WNXA 3SO5A 1IM3B 3QGVA 3KL3A 3QXDB 1IC1A 1KXHA 1LWHA 4S1QH 1UD3A 4AMKH 5I1IL 4E0RA 1Q0YL 2JB5L 3WUZA 2UX7A 1CICD 1HXMA 1TQUA 3G6DH 3T3PF 1MCEA 4WU7A 3K6IA 3L6FB 4TSCH 1WK0A 3OR7A 5E8NB 1MCPH 3T2PA 3ZZ1A 5B8CC 3NABH 4RNRB 1FC1A 4BSVB 2R1XA 1M05A 1MFAH 4FOMA 1FN4A 4M6AA 4K7FB 2LT9A 1N6UA 4OD3H 1MCLA 2PCFA 1G9EA 1J8RA 1KBBA 4EOWH 3ULUE 1HHKB 3CIQA 2ITCB 2WUBH 1PG7X 4LFHD 3MRCB 3HR6A 4ONGL 3FCBA 4JJOA 3ZR6A 5JNYA 1VADB 2FWUA 1AKJA 2C8NA 2HRPH 2YUZA 3QUXD 4ZFQA 5FDYA 3X3GL 5EUOF 3QFJE 2WVUA 3LIZH 1JPFA 3FCUB 3PWUA 5IBTH 1NCWH 4GXVL 1IEBB 4P2RB 4N5ED 4OI7A 2DZEA 5F3BB 2KLTA 3Q6FA 4IBYA 4TUKH 5TPWL 5ACLA 3UG5A 1SY6L 1X3DA 2NY2C 4NQCA 2BX5A 4Z23A 4LCCA 1OGTA 2VL4A 1O5PA 3GSNH 1IC5H 1CL7I 4MMYA 4OY9A 1JZJA 2EXSA 1Q0XH 3TPKA 3SQOL 2A38A 1BOYA 1RIHH 4OZGA 1RI8A 4H0LC 3AUVA 4Y4FA 4ZW3A 5E4AA 3QZNA 4KRNA 5ESAB 3D33A 4KO7A 3IJYA 4XN5A 2Q20A 1FVEB 1WA0X 1XH2A 2NY3B 4WDIB 4YNYB 4PJDE 4C47A 3NESA 4GIOA 5K9OA 1ZDQA 3LQZB 2A74C 3TFKD 1FFOB 3HMXH 4BBWA 3QJXA 4GMSH 3PQYE 1YCSA 4WWKD 4P99A 3V0IA 3W9EA 4DZBB 2E76C 1G0XA 2JCCF 3ZE1F 3QHZL 2CLZA 2X4RA 4FEIA 4NBZB 4N2HA 1U36A 1U8IA 3UZEA 1T1ZB 4PCTA 1LO0L 1H3UA 4U1SB 4LE8A 2HLAA 3D51A 3FCSA 1DQQB 3GI9L 4FABH 4OCXH 5GISL 4ERSL 4G8FB 4G1EB 3SE9L 4GUQA 4JEGB 1INQA 1FYTE 3JYBA 4LSQH 3DA0A 3PWPB 5E6ID 2UXFA 3H6AA 4W6WB 4M03A 2BZCA 3D3VB 1SXCA 3FU6A 3TBVB 2BVTA 1ML0A 2VYRE 4MD5A 3OLDA 5AD0A 3HNVH 1MRFL 5C0GA 1A7PL 2RHEA 3BVDB 2SEBA 2XU9A 3ESOA 3MNWB 1IBYA 4I0PD 4AE0A 2L7UA 5HD8D 3WNIA 3QQXA 2OMZB 1OW0A 2H3XC 1YVLA 2DN7A 4NQDB 2VDPL 1A4JA 1BVOA 3RDTA 3G6JB 1S7SA 2RBLA 5DMIL 4N0CD 3LKPA 3QO1B 2ZAIA 5F7FA 3QJSB 3MRDB 3QH3B 2XIBA 1CDUA 2FHFA 4L1SA 4QHKJ 5FCSH 4U2YA 4C4KO 1AZRA 3IGFA 1KIQB 1XCQA 3GMLA 3GUFA 4FERA 4ZW6A 2AXFA 5GGSB 2YPVL 1RIVH 3ZDZB 5CO1A 4N6RB 3RGVB 1L0PA 2OR9L 5GS1B 2CGYA 1U92B 5FA4B 3QWOB 4ZOEA 5GGUB 3GO1L 2WUCL 4FFWC 1XGQB 2C7FA 5KUMA 2B4CL 3OPZL 4LNRB 5K39A 2XRAL 2BY2A 4F9PA 1CDIA 3CNKA 2QGEA 3KL5A 1IJ9A 3QUZD 2BS9A 4AIOA 1F4AA 1G6RH 5AAPA 1F4WL 4MJHA 4ENED 3HN5A 5BQ7A 2EKJA 1IKNC 1XMWA 1XR9B 4M02A 4ZQTA 1DBBH 2UZIH 4J6RL 3QS3A 1NFDE 3EXLA 4CVXA 3A21A 3MGTA 4GW4B 2WVTA 5DJ8A 5SWSA 5F7MC 3ZL2A 1WTLA 3PY9A 3WFCL 1G9NC 1MFDL 2Z31B 5EA0L 5GZNC 3UXFA 4IRSA 1JGLL 2ZTBA 4DQOL 1G7QA 4UMGA 1MVUA 3PV6B 1QFHA 1B3IA 5KTEL 2GSGA 3P4LA 1J8SA 3GHEH 3BLBA 3TBWB 1F56A 2ZYHA 4YHYB 1G4RA 4WNJA 1OT2A 2I60H 4PVMA 4X0KB 1B4LA 2CKBA 1PD0A 4X4ME 1ZV9A 5AEAA 1CMOA 3ULVL 2M26A 2P4AB 3KPSB 3DX7B 1HQRB 1U2HA 3F7LA 4GSUA 2FX7H 1QEXA 3IJHB 4LLDB 1ZD6A 3AVEA 2R39A 3O0RH 4EE2A 4M6OL 1W91A 5GGQL 5F6HJ 2IGFL 4R7DA 4M7ZC 4M1CD 4MA8H 3JWOH 2ED6A 4Y19E 2W65B 1OY3B 4OF3A 4H1LH 2R0KL 4WI3A 4NOFA 3IGAA 4XNYL 3EFOA 4KDWA 3LZFH 2AP2A 1GRWA 4GLRH 1BCIA 2Y4SA 2XWJA 4KFMA 4P4KB 4UT7L 4FXLA 4CNIB 1BWWA 1A2YB 3DC0A 1JRHL 1WAAF 1Z9SA 2OTUB 4KDVA 3MBXH 4NZUH 3RTLA 3QUMA 1BM3H 1XSIA 2CE6A 2FSEA 5D2NC 5LLIC 3VFNB 1T22A 4HJSA 1MY7A 1Q0EA 1KB5B 4PRPD 1IUZA 1CDJA 3OJMB 4KJPC 5BRZB 1DN0A 2DV6A 5IVZB 2BNQD 1PFOA 4O00A 2J7LA 4WTXA 4ZFOB 3QHTC 1FL6B 5ID0B 1NBZB 3VXRD 3CVHL 3ARWA 3I9AA 4IS6B 3T6QC 3SDAB 3A6BL 1GPOH 2DIEA 3KPPB 4HUXB 1DJYA 2R2EB 4XO9A 3WTUA 5F89B 4IKKA 3BAXA 4LSPH 4NI6A 5KANI 4F24A 3KL0A 1R3LB 2EO1A 1YEKL 4JS7A 4FLOA 3DPDA 1Z9PA 3SOTA 4NKDA 1DZBA 3FAXA 1IVLA 4GS7B 4UDTA 3BIBX 3TV3H 4JKLA 1RK0B 2AJUH 3H4FA 3QZWA 3ZIMA 4TMPA 4DTGH 2E59A 1Y07A 1N18A 3U30C 2XZAL 4JFDE 3GT6A 8PAZA 3R06B 3HE7C 3D06A 2MQ3A 5DRWB 3RVUD 4IOIB 2V3EA 2D3JA 2FNWA 2WIMA 3BDYL 1JZ4A 3GIVA 1U91B 2C3VB 4FFVD 3GHBL 3QI9B 2BP8A 1AS8A 5ALCH 2OX5A 5IW6B 1QEWB 4YDJB 4UILH 5A2JH 2F54B 4JAMB 1FPTL 3KLSA 2CGZA 4KX9A 5AAMC 3WKNA 1NFAA 4HC1A 1HAUA 4HBCH 5E8DH 3T4YA 5KG9B 1IKFL 2D73A 1YNTA 2BWDA 3V4UH 8CGTA 4K4KA 4ALAL 1SYSA 1RZIA 3GSQA 4BQ6A 1X5JA 1OLLA 2CLRB 1LHZA 1U2CA 4JFEB 1NBQA 1AYOA 2GJZA 2ZSWB 5LGKA 3LDBB 1GR7A 4HKXB 4CN4A 1KYOJ 5EU4B 5E6ZA 2QR0A 4O2CB 3KPOA 3L7FB 3GJFA 2PYED 2R56L 1Q94B 4AJWA 5DHYA 2P5ED 4RZKA 3CN3A 1S4IA 2GHZA 2WCPA 5AQ0A 1P1ZA 4KKCD 1CGSH 1VFAB 1ECYA 1IQDB 4Z3IA 3E7JA 1NMAH 4GAYA 1U2YA 2HVBA 2HKHH 1F90L 4R26H 5AENA 5LGJB 5E5LA 5IVXF 2OJEB 5DZLA 4OLVH 3AGWA 2JI1A 4TKWA 5E9DE 3VM7A 4CU6A 2C3WA 4HSQA 5IOPB 3HVNA 4Y2OA 2OSXA 3DIVA 1Y6MR 3QEUA 3RUGF 4N0FB 1LO4H 2J1YA 2XWTB 4JCWA 3O3DB 3C08H 2FT7A 1BEYH 3MOBH 1JWMA 1L7TL 3IWUA 3IK2A 5FO8A 3IMTA 1ZLWH 1PMYA 5IQOA 4KQ0A 5KYYA 1IX2A 3MLXL 1IFGA 5FFOA 3V4VA 2J8OA 1ETJA 3US1A 1MLCB 4X8GA 5G4NA 5D4IA 2AI0L 5I82A 4U1NB 3QRGL 4LMQI 3ZXAC 2BVPB 4OFDA 4YDIL 3Q8CA 2R0ZH 2LQRA 1XHHA 4KKPA 2EUWA 1P7QD 1IE4A 2BOCA 2IPKA 5DT1L 4X7DC 3SGDH 4MKTA 5CGTA 1JOIA 4G7YL 4NRYB 1CE1H 1GIGL 4IDLA 1FVDB 3B7YA 1A3RL 1FVCA 1QSZA 3FCGA 2ZUYA 1WE5A 1TQBC 4NT6A 3UO8B 5JW4R 4QOKE 1T3FA 1PSKH 1TJGH 5LKNA 4PGJA 3NJJA 5D7HA 1N19A 1LO2H 3LCYA 4PUBL 2HTKC 1JGIA 5JQ6L 1AGDA 1W72B 4RISH 5AKTA 5FYJU 1F3RB 1MJUH 3MRFA 2CO4A 1C1EL 5J9PA 1KF9B 2VSCA 3AT0A 4J12A 1XIWA 2Y6SD 3RVXC 5JZ7C 3WD5L 1CLZH 3T3MF 5A7BA 2ZPKL 5GRVK 4XPTH 1LD9B 3LKQB 4YPJA 3SD5A 4UBDC 4ADIA 3UROR 1M1SA 4OLUH 1H8SA 5DJYA 1O75A 2BVUA 4IGBC 4GQZA 3CXHJ 4XNUH 5IV2B 2EXWC 4EI5B 2EUZA 4FTVE 4PRAB 2XTJB 3QDGB 1OIOA 2DBLL 2XIDA 3WDJA 2F7PA 5E6RB 1AZZC 1KGWA 3RTQA 2OV0A 5HGAA 1FORH 3ENEA 3G04A 3NJFA 5CD5C 3ATEA 3BPLC 4N2OA 1GYWA 1RK1A 4H25A 4ZT1A 4WO4D 1AO7A 3ARDB 4JZJA 2SODB 3TBTA 4GIAA 3KPQB 1N6VA 4ZDHA 4M43L 3R0MA 3L3GA 4DGIH 1TYJA 2E8YA 3OKLB 3E6FB 4X6CF 3S96A 1ORSB 2EO9A 2GC4C 4NEHB 2AJSL 1NBYB 5C1MB 1BG1A 3WENA 1VGKB 1TJHL 4XBPB 5CF3A 1NWPA 1UM5L 3NZUA 4HUKB 2Z7UA 4D9QD 3L4YA 2NY3C 1FH5H 3JV6A 5D7LB 1EJ8A 5LWYH 5H37G 3FONA 4I2XA 4PJHF 5AOLA 1ADQH 1GOHA 4GH7B 4MNQE 4YUEH 2YPVA 2OR8A 5DZOA 4FA6A 2FJGB 3CPUA 3SN6N 3FTGB 3QPQC 4Y4KB 1E5CA 1HHJB 1HTYA 5C0DB 3SDXF 4HUVB 2WZPD 2FUQA 4OIIL 4PTTB 3IFLH 1V8HA 4V1DE 1DUZB 3TPUA 4KVPA 1I7ZB 3QA3B 3O9WA 3IE9A 4MA7L 4RRPG 1XCTA 3DO3A 3KPTA 1O5DT 1VGEH 3KDMA 1BAWA 2XXCB 5T33L 2ATPA 1WA1X 3EIFA 5EEZA 5J1TC 1T1WA 4ZS6C 4QRRD 3BMVA 3RX8A 1K8IA 3JZ7A 1OCZB 4UTAL 4MD0B 3V6FA 3VACA 4OT1H 1ETA1 4I13B 3FMGL 2WXRA 1DVYA 1L0QA 3HUJB 1QVOA 2F53B 4JO4H 5DJ6B 3KPNA 4KTGA 2B0SH 1MDTA 2NY0B 4DFHA 5JHAA 4DO6A 4G6AD 1QHOA 4A2FA 3D09A 2F6AA 3MV7E 4YHZL 1YPZA 4XPHL 1F41A 2A1WL 1V7NH 1NMBH 1JCKA 2P8LB 3RP1A 3FT2B 1HH6A 4J8QA 4NDMB 5AYUL 3BWZA 1XCWA 4UB0L 5LQBL 4GKOA 1PTZA 3U6XA 3ABGA 2GJ6A 1JF5A 4FKHA 5D6DC 4AIXA 3BDXA 2OJZL 4HH8A 1OCWL 4QHLB 5EG6C 1U3HD 1TJXA 3DHJA 1FAIL 1T0MB 3P0VL 3IXTB 43C9A 5BUAA 1KULA 5FGCB 1E8YA 3QUKB 4AX3A 1ZTXH 4MX7B 1BBJB 1UA6L 4OCRL 2XZCL 4LPYA 1FA4A 1H9DA 1NIAA 3RGVC 3KAAA 1KEGL 5GS1C 3PWPE 4LLYB 1I4FA 2CHDA 2QT6A 1TSRA 5KSVA 2P49B 4GKSA 3CDZA 4UV7L 5F9OL 1S5IH 1EHXA 3FAWA 3D8MA 1EZVY 2VC2B 1A8JH 3MODL 1HCFX 2CQVA 3UZQB 5I5MA 3E80A 5K9KB 1CICB 1FZKA 4Z7NE 4PJEE 4IBZA 5IHBA 3WN5B 3IN2A 4TSBL 1EDYA 5E7FA 4FEMA 3RL2B 1U8OB 2J1WA 5ITFA 3HJEA 3S88H 1TQCC 4EI6A 2WLYA 4Q6KA 4NQDE 4NZTL 1DBMH 4R6UA 3S3JA 1JZDC 4XH2B 5JPNC 1NGZA 1T83A 4LKXB 5KVDH 4MJ2A 5C92A 5JYLA 4HMEA 4PLJD 1NBCA 3U4EB 3VFTA 4KTEL 4IIQC 2NZ9C 3O2DH 3U82B 2Z31C 2XWEA 1AHWA 2HUHA 3IFPA 3QUXB 4AGPA 4AZ8B 3BD3A 3MMEA 5EZIL 3B9KA 1E5AA 4XPGH 4NKMA 3WKQA 7TAAA 1UH4A 5IW1A 4K7PX 2OMWA 3ZDZE 1G6VK 4EVNB 1VKXB 2R8SH 2R29A 3DHPA 5FUCE 4NNPL 3N1MC 5E56A 3ZKND 1KZYA 5E24E 4L8DB 4XP6H 2A9NH 5KAQG 5ESVB 2XWDA 4P5SA 4X8XA 1QNIA 3C5XA 3MLZH 1HINL 4KH9A 2BO0A 1FRGL 3BVTA 4Z7UE 4YHYC 4EKJA 5HHPA 1J8HB 4JQXA 2BSSA 4OGYL 3A47A 4KMQA 1AGEB 1ZIAA 3TT3H 5LHDA 3HFFA 4AQ1A 3H54A 1Q38A 2CIIB 1GH7A 3CHRA 4IHOB 3GGWA 4ANVA 5I24A 5IFAL 1YECH 5SWZD 1L3NA 1TDQA 2GTWB 2QELA 2QGDA 3KJ6H 1A64A 1N5AA 5LXGL 1IL1B 3O4LA 1SEQL 2H3KA 3GMRA 5C0JB 4HOMA 3VWKD 5GZOA 5T3XL 1AQDB 3D50A 2VERN 4D9LH 5KSUA 1HZLA 2EEDA 5HDLA 3REWA 1KBGH 2WLZA 4ELMF 3BSHA 5FGSA 3ZL4H 3GUTA 4WWKB 2X4QB 1FNEA 4P4KC 4LGRB 3DSFL 1JGVL 1JGEB 5I66B 3OMAB 3U46A 4BQ8A 2ICWI 3FCTA 4P9HH 2LU7A 4OGXH 3AWGA 4PLOB 2OZ4A 2XN9D 3IMSA 1P69B 4NKOB 1EERB 4OZFA 4C56A 4QRSA 3KCWA 1SMAA 2K9FB 2YAEA 4P2YA 2DWXA 4NHUA 5J6GB 4Y5YC 3SE3A 1BVNP 1CDYA 2DQGL 1GS6X 5CZXC 2WB7A 5E6IB 5ALBH 5F0JB 1F6LL 3NSDA 4IKNA 4WLCA 3SYQA 2EQDA 4GSRA 2FBRA 1TR7A 2X89D 4PQXA 5DUMH 3WKML 1R0AH 2E47A 5FCUL 4RMQA 2GT9B 3BPCB 4JNXA 3C75A 2HG0A 4U3SB 1GJWA 2WBXA 4DO4A 4ZMXA 3MDJA 1DVXA 2AEQL 1LP9E 4PJXF 3GBML 5E0QA 3FUKA 1SEBB 2JXMA 4NJAH 1X5AA 3ZZQA 3IDGA 3SDYL 2V7HB 3OQRA 1J5DA 3C2AL 4GS7C 5TDNA 4QHMA 1XGRA 4AYFB 1IB5A 2QVIA 1MNUH 5CLXA 2W07B 3MRQB 4NO0B 1DVFA 4Q9CA 3Q3GA 4YFEA 3C9NB 3UPRA 3QI9C 3S8GB 4IOSD 5HGDA 2JSFA 1YNLL 3V7MA 3VH8A 2D7MA 1HILA 1BAFL 1OGSA 2EEXA 4JHAL 1BV8A 2VR7A 3WSQH 2VZ3A 4JDTH 3UMNA 2UXVA 3HRZA 4U3HA 3KYOB 2K6WA 3SYAA 1AZUA 1MFBH 4AOFA 4TUOA 2Y24A 3NZHL 4P46D 5KAQF 3QUZB 3B6SA 1F58L 1SJEB 5A7EA 3LDBC 5IJBC 2JJSA 3WG7B 1NUNB