2WGNB

Pseudomonas aeruginosa icp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
132
structure length
132
Chain Sequence
MGSSHHHHHHSSGLVPRGSHMQKPVVTLDDADDCSPLKLTQGQELVLTLPSNPTTGFRWELRNPAASVLKRLGPEVYSNSEEDSGLVGSGGESTWRFRVAASGDDRLELVYRRPWEKDAEPAESFSCAIQVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Dynamics of Pseudomonas Aeruginosa Icp
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase inhibitor
molecule keywords INHIBITOR OF CYSTEINE PEPTIDASE COMPND 3
total genus 10
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wgnB01
2NQDA 2C34A 2H7WA 2OULB 2NNRA 3CBKB 3PNRB 3M88A 3CBJB 3M86A 3E1ZA 2WGNB 2FO8A
chains in the Genus database with same CATH superfamily
4UTCA 3GDBA 4MXWH 1WTGT 5E2VL 5BMFL 4MJ5B 4Z6AT 3GBML 1LQSR 1NFKA 3WFZA 2R0ZL 1F90L 1YMMB 2QVIA 4IKLA 4KRNA 2QKIA 5F7YC 4Y9CA 5JOFA 5DQDH 5JHDE 2EDHA 1V27A 3FU3A 1YYLL 2WLMA 3D39A 4TQ8A 1ONQB 4H20L 2YD6A 3TJHC 3KGSA 2B3IA 1AGBB 2GEQA 2EEBA 2FATH 2HFFA 3TBCA 1R0AL 2WNXA 2UVEA 1AC0A 4MX7A 4E9VA 2UZYA 2W9DH 5EU6E 1N10A 4LHQB 4F5CA 5I1KL 3FU7A 3PUUA 1XGRA 4HKBB 1CFNB 1HL8A 4GO8A 2HLAA 1IAIH 1KTJA 2F19L 4XZ4A 4WWPA 1A9BA 4JRYA 3AAZA 3QRGL 4JFEE 4MFHA 5TDNA 1H5BB 5BS0E 4N5UA 4YPJA 3TVMD 3QYMA 4LRNH 1Z0NA 2K7PA 3WJJC 3ZMNA 2DB8A 3HG1D 4FKKA 1HC1A 3A3YB 1ZVNA 1EIBA 1FRGH 4GINA 1JN6A 5GS1A 5F9OL 3T04D 2WQAA 5BJTA 3F7LA 3Q5TA 1MRDH 2GK0B 1I9RL 2PW1A 5KYNA 1JXKA 4WI2A 4HF5H 1WP6A 4HK3N 4W1TA 4YHPA 1NLDH 3HUJE 1NPUA 5HY9A 2CUMA 2NW2A 1FYTB 3ZLQC 4LLUA 2CPCA 3CXDL 4L5FE 4NP4L 5F71A 4OZHF 5IWLC 1Z9NA 2IG2H 3VI3B 1HILB 4FCAA 2C26A 4L4TA 3IS0X 4OCLC 2A83A 2VKXA 2Q0ZX 4KVPA 3FB7B 2W80C 3P3YA 4YSTA 3O8XD 3CPLB 4KY1H 3KM1A 3G6AB 1FPTH 4AC4A 4PVLA 2OL3A 4ENED 3IDMA 1VEPA 1GZHC 3RYMA 1AMXA 4HX1B 1U8LB 2J5LB 5G55A 4UOZA 4Y4HC 4X2UA 5EF1A 1A64A 1DJHA 3B2UD 4X6BA 3GMNA 2X0WA 3GT6A 4I9WE 2FX7L 3ALWA 3MV01 5IBTH 2EUXA 2YUWA 1I9IH 3BFWA 1GCFA 1F11B 4XP5H 1YUHA 1EJ6A 1Z66A 1TU2B 1FE8L 2G4GA 4H4NA 3LPWA 3GHPA 3U9UA 2ZG1A 3AJ7A 4G7RB 3B2VH 1WZMA 4GBXC 4ZQKB 5F7DA 3SOBL 5BRZB 5I82A 4I87A 3O4OC 4Y5XB 2WLYA 4RNRA 3VFOA 4NO2A 3CDFA 2UVFA 2UWEA 4C83B 5HGAA 1UXWA 3HBPA 4OSUH 4RIRA 1T5XA 4JZJC 2IDSA 3S8WA 4UAHA 2R4RL 2CWRA 1CYGA 1KTCA 4FQXC 5LGKA 1NGZA 2YSTA 4X7FC 1GSKA 1IBZA 2VXQH 4QWWC 4N2NA 2X2YA 1QRNA 3EFFA 1J11A 5IT2H 1UD4A 1T0MB 4WK4B 1NDTA 2BW5A 1A3QA 4Z7AA 3P9MA 2VIRB 3TZVA 4BFBD 5JW3L 3GS4A 1FORH 3N1MC 4B7IA 3I9PA 5KSUB 1K4DA 3HE7A 4H25B 4W9EC 5T5NF 3WEXB 3T6WA 4IK7A 5B39A 3J2PA 4UM8B 4OI8A 3SE9H 2BNRB 5HVHC 5KVDE 2CBTA 1M6OB 4MGXA 2P1YA 4OF8A 2DS4A 2X4NB 4X50A 5KBDA 4WTWA 4F8PA 1RUQH 1PEWA 2A9BA 3HCVA 5L88H 4NQXB 3PDOA 3GLAA 4HBCL 1K8DB 3QEUB 3DSNA 2FJGB 3THML 1CURA 1VGKA 4OCSH 1HDMB 4FA6A 3C5SA 3D9AL 2DH2A 3TBSB 1HHGA 3CN1A 3OR6A 1XIWB 3SHSA 1KGJA 5CS7A 1YCSA 5C07D 5I66A 3MXWH 3ZUNC 2XV0A 2XWBA 2JKTM 4GPVA 1HDMA 4U6VL 5F9JB 3P9WB 4Q0XL 5A16A 2NLJA 3WY2A 4Y19B 1PY4A 1VSCA 3BAJA 1J5IA 2JWYA 3MV8E 3HG1E 4FQCL 5JIMA 3VFWA 2XZCL 2J8HA 3FQ2A 4AQZA 4GP8B 3U7AA 1MJ7H 3OAZH 2X70A 2VLJD 5FA4A 3TYGH 4BE5A 2B8OT 1GC1H 5HJ3A 5KVGL 3GMPA 2Z92A 3NJKA 3NAAH 4K5PA 5E2JA 4AJYV 4PJEB 5C0DB 2Q8BL 2WXNA 1N26A 4KQ4L 5DUPH 1Q94A 3CSGA 1MFMA 5E2VH 1T6BX 3NGBC 5FS5A 3TCLB 4M6NL 4F1ZA 2QSCH 2X4PA 5T1DH 2WANA 3SJVA 1ECYA 2P5WA 4MCNA 3BRFA 5IB4A 3H8NA 4KZCA 1IM3B 2AJXL 4PJDE 1OM3L 3HS0A 1Q72L 1INEH 2H3NA 2GEEA 2XYCA 1IKOP 3J07A 5BZWA 3PAVA 3QCTH 4M02A 1OCCB 2BVEA 3HS9A 5FFLA 4HG4K 1EHLH 4A39A 3VI3E 1F90H 3LS5L 4PJ9A 3MQIA 3BKYL 3VXRD 1YECH 2VDLL 1RLBA 1FYTE 3AFLA 3FOMB 1UD3A 2MH4A 4Z18A 3W82A 3CH1A 5E00B 4LCUB 4APQD 4GQRA 3PQYD 4P2AA 3JV4A 1KCWA 1AQDA 4JO4H 4C8XA 4Z7NB 5C97A 3QHFH 1PNDA 2VQTA 2L7JA 3NFSH 3QDJE 2W38A 1EEYB 1TOXA 1QBAA 1R3HA 3QAQA 5EO9A 1MFCH 4H8WC 1PY9A 2DMHA 1IGTA 1YAIA 3T8MA 5KS9E 3OMZA 1S7WB 2D7NA 4GFXA 4RRPG 3ARTA 2D03H 5C0FA 1JXDA 1A4BA 4QRFA 4X4ZA 5BRZD 3T0VA 2RIKA 4B9GA 4M03A 5FV2A 3SO3B 5L2KB 2GFBA 4PEEA 5JLZA 3N0AA 4PRNB 1QSFE 4HXBL 2E8ZA 4O4YH 3PL6C 3SZ6A 2AF2A 2CDGB 3SCMB 1AR1B 3HMXA 3WTVA 1JZFA 5IUSA 2PO6C 3ZGIA 2NXZD 2FO4A 2F7IA 1GXEA 2CDFA 3RDTB 4RGOL 3Q48A 4W68A 2I60L 4WHTB 4HJTA 1D9KA 5KYYA 4QKXB 1M56B 3L1FA 3TC9A 4KI5C 2WNWA 3PNRB 3W0WE 5E6SB 1UKQA 4TSBL 3FRPG 5FIEA 3K2UH 5L9DL 1LO2H 1RJLB 4G9FB 4GUPB 1WBYA 4G6ML 1PG7H 2HFEA 4C47A 5D1QB 2GSIB 5IB2A 4ZOCA 1UM6L 2EEDA 4KUZL 5ID0B 2A2QT 4A6YB 4HJ0C 1Y7VA 2H1LM 1CDUA 3NA9L 1K8IB 5HXMA 4M7LT 4YGAB 2Z4QA 3W0WB 1W0VB 1AGBA 1DJWA 4HFUH 4NKIH 4I3GA 5AYTA 3R06A 3BAYA 3R19A 3S2CA 2XOTA 5JOPD 2HJFB 4QRPD 4PYGA 4U1GC 2LLLA 1WBYB 2QLVB 3QQNA 2X6AA 4ZUTA 4N8PA 5IR1B 3K1DA 3JBG7 1KB3A 3IMVA 5JOFB 2QSQA 3IBOA 4AEHH 1HHHB 2Y24A 4W70A 5FDWB 1TVBB 2R1WA 4LEOA 3WIIL 1H8LA 3LRHA 4NIYE 1AIZA 1OAUL 3C09B 3SGDI 2A7BA 2HKFH 4W9HC 1HCFX 5DT1L 2R59A 5IQ9A 3QIUD 2APSA 3VXTB 1AP2A 4MA1B 2V7NA 4JMNA 4RFNC 4KJWC 2NY5C 1XTLA 2IPTL 3JWNH 4KOBA 3EJPA 4DP9X 3F58H 4XPTL 5D1ZD 1DZBA 2CR6A 3MFGB 4ZW8A 3OMAB 3GKZA 1WAPA 4XNUL 4X9BA 3PWJA 4LLMA 2XIBA 3ZDZB 4L18A 3ISYA 1BIIA 1C16A 1BFVL 1T5WB 3Q43A 5MENA 3FYIB 1RKRA 3QUYC 1E9QA 5LBSA 4M48H 4TUJA 5CLYA 2HP4A 1LHZA 2DLGA 2Q2LA 3SDDA 5J11C 2BOBB 1R0AH 3IPEA 5EDXA 1TYEB 3S5LB 4HZLA 2WO3B 5DK0B 3T0ED 4NPYA 3KLAA 4U1LB 4TM9A 4LHUB 1OTSC 2ZXQA 2HYMA 3DX7B 4O02B 4XBGB 5FO2A 5I75C 4JFHD 5IESL 3U6XS 3HE6D 1JYXA 1CBJA 2C9XA 2FT7A 3ZKQD 43C9A 1E8YA 4FG6C 1Q94B 3RUGA 4KKPA 2HT3D 2YA2A 2OYLA 1H3VA 2BSRA 2OCJA 3P4MA 4NQVA 5C6WH 4M61A 3DVNA 2VAJA 4G3YH 4HIXH 1X9UA 1TJGL 3UIYA 1YEKH 3AC0A 1I3GL 1UYWL 2J5LC 3WLWC 3N44F 3HPJB 3ATAA 3BVNB 4HU2A 2K6ZA 3HI5H 2OV0A 4YDMA 1LE9A 1I7UB 2H3NB 4JQIL 4NCDA 3JZ7A 4NFBA 1WD9A 2Y3AA 3MCLL 5EZLB 3EZ8A 2OW7A 3S8FB 3B8SA 5T3ZD 3VTMA 2ZAGA 2WZ0A 3R0MA 5LXGH 4XP9H 3L2NA 4YHIB 2BCKA 3U2SA 3NFNA 4KITB 2XZCH 3T0XA 4PW4A 4BQCA 1S78C 2BHFA 4G7YL 5D71L 4A1RA 2HX9A 1DQIA 4PCSA 3RX8A 2WTPA 5DD3H 1IFHH 2J56A 4RDQG 3EBIA 5GISL 5D7LD 3RWIA 3K8LA 1AO7E 2CUHA 3GO1H 2F74B 4HJUA 4YDVA 1P6FA 1Y1DA 4KX7A 3KS0J 4CC4A 4OJYA 5B7EA 2C5DC 2AK4E 2LFEA 5FGCB 4Z0BH 2A6JB 1HZLA 4AGOA 4ODSH 1BLIA 5IW1B 3GSNA 5D1XE 5IB4B 4OZIE 4LVEA 3TO4B 1NUDA 1LDPL 4OCNC 1HSAA 4PS4L 5DZVA 3ULUL 4UM9B 5HJDA 3OPZH 2VZOA 3DUUB 1U95A 3P54A 5IHZA 4TOYL 1U3HB 5HDLA 3AT0A 1E7UA 3HI6H 4KGLA 5D1QD 5DA4A 5CD5D 3PXHA 3QH3A 3IMBA 3NJGA 4FA7B 4ISVB 1PKQE 2OJEB 2DMKA 2UX6A 3T6QC 1FP5A 3ARDD 4EI5A 3BKYH 3GIVA 5D7JB 4UV7H 5C0JA 1YYML 4CRPA 2DQJH 2XT1B 2XX1A 2HRHA 4AQEA 4E0RB 2X7LB 4JHUA 4B27A 5AB0A 4ISVA 1SZNA 2I60H 4TSCL 1UXMA 1IARB 4NAQA 4G42B 4JFHE 5DYOB 2DLTA 4R9HA 4F92B 2NW3A 2DLHA 3A5VA 3GB7B 4FFVD 4JRLA 3B4NA 1VZHA 1WTLA 4X83A 3CLWA 3AXHA 2ZKXA 5J4MA 1DUYB 1JWMB 1R5IA 1BEYH 1IBGH 1LO3L 3TO4A 3IDXH 3EJYC 2FYVA 3VXQA 1NGZB 4LHUG 3QORA 1CBVH 4PGDB 1BF8A 4ZNCD 3R4RA 4NUGH 1QO3B 1OGPA 2WXQA 3P0VH 2BSED 3D85B 5IJVB 4XVUC 3K2UL 2R1YB 5J7CC 1NWPA 1H3XA 4Z7UA 1CLOL 1DANT 1H9VA 2EDYA 3QQ3B 3MRNA 2I9LA 4MLSA 4NGHH 3VTAA 1E90A 3TT1H 4BFJA 5E70A 4JO8A 2W1NA 2GI7A 3OX8B 4HJEA 1G94A 1WBXA 2PTTB 3D39D 4TTDC 3D6GA 2DJ4A 1AY1L 3F7RA 3OF6A 3LZNA 4PJ8D 3UTTB 2F53D 3VA6A 1BBDH 1GPOH 2E7MA 3TN0D 5HI3D 3DRQA 1TZIA 4MNGE 3LKPA 5DHEA 2FECL 3BGMA 3MLXL 2G75A 4I85A 4JGUA 4KQ4H 3DGCR 5DK2B 4L2LA 4Z9KB 3SDYL 4W6XB 5E23A 2NY1C 4C54A 2MSPA 3RGBA 3KCPA 5I18H 3ZKMD 3ATEA 3FCSA 3HG3A 2VDPL 5BQ7A 3P73A 2LU7A 3RJOA 1AGEB 5CMAA 4OCXH 3BH9B 1NCNA 5I1IL 4FQIL 1BFVH 3MNVB 4CVXB 1FFQA 1FVCA 3VFTB 3ZSSA 1GIGL 1IGMH 4LSQH 3AMKA 2WIMA 3P9LB 1V54B 4FRWA 4YPGA 3C08L 5DD5L 1XGYL 2GJ6D 1KZYA 2YOAA 1IL1A 4MJIA 4N2LA 5LGJB 5FGCE 5SWZA 3ES6B 4MMXB 1JNJA 5D8JH 2BP0A 2I9TB 1L0YA 3L3JB 1E2ZA 1T1WA 3SGKA 3BP4B 4WNSA 3JWDH 3KZ8A 3QDJA 1J9TA 3EDDA 2Q8AL 1JPTH 5F0JB 3OKLB 5JMOC 4G9DB 2AJVL 2DLIA 3CFJB 3JT0A 4XCFH 5EULV 1Q0EA 1JCVA 4Q4IA 5FF6B 3SYAA 5I0WA 4CC0A 3WL9B 2VB5A 1A7QH 5I1JL 1N59B 1PLCA 5IEHB 5HY9B 4AXWA 1HSAB 1PFCA 4EDXB 5BVJB 5JXEA 2GHZA 4CSZA 4F57L 3QJRB 2CKNA 5SV3A 3GM8A 4B9ZA 2XVKA 3O4LB 4LPCA 2EDXA 2X1WL 3EOYG 5E99L 1D5ZA 5CM1A 1C08A 5LXVA 1V3LA 3ULVD 4YC2C 1CVSC 5KBMA 3QORB 5KSAA 1K9TA 3T3ME 5CEZD 1MH5A 4XNBA 4RAUB 4IHBA 1XF1A 5FWRA 1K4CB 1L3WA 4XNMB 1AD9B 2ZKMX 4AENB 4AV5A 1JERA 2KZ1B 3VCLB 3ZR6A 4JVWA 2WBJD 3VGFA 4JN1L 5CHNA 2PTVA 4F58L 2HTKD 5EUOE 3P4NA 4LOVA 2AITA 4O2CB 4WEEA 5JHLA 3LH2H 4OCYL 4JFFA 3B9KB 1GGUA 2DL9A 4WJG3 2X3AA 5J6SA 1OSZB 4YHOH 5CINL 5ID0A 3LIUA 4RESB 1F56A 3OKOA 5ANMA 5DLML 2YQBA 3OKNB 5KYUA 3SEPA 4Z7OE 5BXFB 1K85A 5JR1H 1TCMA 1WBZA 2E9WA 2J4WL 3NRPA 3ULSA 1AS6A 4JFWA 1P1VA 1A7PH 1H6UA 2IPKB 4ZSOA 5JHDD 3IRZA 3NOIA 3RX7A 3L95B 1ZOXA 2EXYD 3SKOB 5BNXD 1J5OH 4ZW7A 4GOSA 3D0LA 4OCMC 1JV5A 5GSVB 1I9JH 4H8PA 1OP3K 3RP1A 1NUNB 3QZWB 2AS5M 1IM3A 4DH2A 5FXCH 1J7VR 5BUAA 1AZUA 1H3PL 4FX5A 5H94A 3VMPA 4J3UA 3S4SG 5EUKB 5T5FA 4OD3L 1JWUB 1F13A 1HT6A 5C09E 4S1RH 2BVUA 3AB0B 3C6LA 4P2CG 2DQGH 3ATDA 5GZOD 4NQEA 4H20H 3QXAA 5BZZA 5EIIG 1XGUB 1AH1A 1XF4A 4FQJL 3Q8EA 3AVEA 4PREB 3UGEA 1C16B 4FTVA 1DFXA 4R90H 1BD2E 4PR5B 3WBDA 5CCHE 5LDUA 5A2CA 4KNTA 4R4BA 1G6RB 4PJFF 2XWTB 3MKKA 2GI0A 4U1GB 3JVFC 1QATA 4NAJA 2ALWA 2IF7A 3GMLA 1S2EA 1TLMA 1ZTXE 4AUUA 3QUKB 1N6QH 3QHZH 4LRNL 3BZ5A 4P5TD 3M8OH 4KTDL 4LCWE 2C9PA 3T2QA 4ZMWA 2WQUA 2D4FA 1TETH 2ERJB 3AY4A 4XC1L 1A0QH 1LE5B 3GMQB 4ANWA 3DO7B 3BO8A 3VFUB 1WWCA 3IETB 3FSVA 2BVTA 2FQDA 3V9EA 3S5ZA 5AAWA 4A7QA 1GSMA 3HRZA 1CPUA 4X7DC 1I1RA 4LVOC 3WTSA 1PZSA 1E42A 1WS8A 3GXMA 2WHVA 1N3NB 3JYCA 3KDMB 4F8TA 4ODUB 4OSUL 4QTHA 3MJ7B 3ZDXE 1DN0A 1N0LB 1AE6H 3VXRA 5IW3A 1TQTA 4H44C 5F1NB 1DFBL 4D9QE 2FUQA 3MA9H 4QR7A 2P5EB 1AR1C 1KTRL 2VLLA 2FTAA 3IT8D 4G43B 2BX5A 4YHML 1GGBL 4UM9A 3SDYH 4LDCA 4HIJA 1G1CA 5IT2L 4PRBA 2CXGA 5AZ2H 2BP3A 1RJLA 3P0VL 5CR1A 1A6AB 2OTPA 3VD3A 1JVOA 3HC2A 1NL0H 1PCSA 4JQIA 1MAMH 3BUTA 3DOHA 3VFRB 4B0MB 1KLFB 3IJEA 1G9ML 4FG0A 5DU7A 3VXSB 5LGHL 3DX2A 3VA2C 5EORL 1KF9B 3H9SE 5AG9A 2UYLA 1QA9A 2UXGA 4G8FB 1X9QA 1PX4A 3ZYJA 4DP5X 5C3IA 1OP9A 4X5WB 3P11L 3HNTL 5JDSA 4YSEA 1T0MA 2BCKB 5KTEH 2NSQA 3SPCA 1AKJB 2J71A 2WUBH 4H8VA 3HC4L 3RI5K 4IRJA 4OLXH 2V2TA 5K69A 3DV6B 3APNA 1MLCB 4HUWA 1P7KB 5BZDB 5AVQB 1ETJA 1LE9B 4J3SA 4XCFL 4HIEA 4N0CC 3S4SB 5JUEL 1SXBA 1JK8B 2WQWA 4GIPD 4L4TD 1O7DC 1SJEA 3KLLA 4ZFOB 4MQSB 1KJMB 5DVOA 3AREB 2Z6FA 1KB5B 2UUDH 5CZXC 5E8PB 3EYOA 3D09A 3U0TA 4G7SB 5KVEL 1U30A 3HI6L 4X42A 3IGKA 5E99H 2BNQD 3HZMA 4Y4FA 4CW1A 3WUWA 4YDIH 3IFLH 2XY1A 5DRWB 2B5IB 1UJTA 2F58L 3QNYA 4RRPM 1KWGA 5MEPA 3GUTB 3SCMC 2CO1A 3MV7D 1CGVA 5C0CE 4OGAC 3LB6C 2EYRA 4J3XA 1XD1A 3BKMH 3KHQA 3ULUE 5DCCA 3MXWL 4JLRB 3V7AG 1CLYL 1FDLH 4PJ7A 3DRQB 5A6MA 1QTSA 4Z7QF 1EMTH 3HG1B 1A7QL 1UFUA 2GBAA 2DI9A 2R9HD 4Z77A 2VXVH 3QNYB 1I8LC 4ZDHA 4UB0H 4L1SA 5F7MC 3LSOA 4PG9B 5E9AA 4HJJL 4XTRD 5EOTA 4OFYA 3MNDA 5FCUL 4BD4A 3QNFA 4OZIB 5D1XB 5F0PB 4JFQA 5CR8A 2TRYA 3C9NA 1AGFB 3FQXB 2F8VA 3U0TB 4LOEA 4Y1AD 3WIFA 1BM3L 2PXYC 1NCAH 2WJ7A 4HWZA 4QY8B 2R1XA 1FH2A 3QA3A 2Y36L 1ONQA 1C9SA 1TMQA 1UQSB 2FUTA 2VN6A 3H3PH 4K0OA 4U1IA 5TK2A 2EIZA 1OXYA 3FB8B 4BH8A 4W6YB 3CZGA 3QUML 5KBNC 2NY6D 2YEZA 4JHBA 2YUXA 1DBKL 4GQQA 2WXRA 5EOTB 2EILB 3RHWK 2WPGA 5CLXA 1KJ3L 2BIIA 2Z91A 3CXHK 4G6FD 4Y19A 3LZFL 4YXLL 4DKDC 2VLRD 3QQ9D 2W9EH 2WTOA 1O5DT 1R6VA 2YO3A 1E4XH 3QIBB 3CFCH 3W3BA 1NIFA 4P2QA 1G1KA 1XIWA 2APBA 5JDSB 1U91A 3BEVA 3O8XC 1ZT1B 3ZHKA 4HS8L 1JMZA 1R3LA 3OSVA 2YBRB 3QIUB 3I6LD 4RGMC 1S9VA 5C0BB 3RIKA 4AM0B 4NDMA 2A73B 3ZR5A 2XFXA 5SV4A 5D1ZB 2IALA 4HAFA 1NMBL 5IHUL 4M1GH 4DNLA 4L3AA 2OI9B 3LHPH 4YBQC 2X4SB 2TSAA 4R83A 3FSWA 4G5ZH 1G0XA 1DVXA 3L4UA 4J8RB 4AMKL 5BW7A 1BZEA 1SYVB 2W5PA 2VLRE 2ZIDA 5TPWL 1U2YA 1TQCB 1YPZB 3B9KC 4S0SD 3V6OC 4KNQA 1WC7B 2VXQA 4UT6L 5HGGS 1H15B 3OAWA 1G43A 1FBIL 3GK8L 5E9DA 5CP7A 1IQDB 2FH6A 1S7XB 2OR9L 4U49A 3QUGA 4WU5B 1X9RA 2B77A 4M7ZC 4Q9CA 4LF3B 2CDEA 3SYCA 3TLRA 1U92B 3D33A 3OLDA 2Q6WA 1HI6A 2Y7LA 3STBA 2XN0A 2Z7WA 3QEHB 4YH6A 2A77L 5I74C 4CVUA 1I1CA 5GGVL 4P2RE 4EI0A 4NQDA 1J9QA 4IBZA 4ATWA 3VD7A 5CSZB 3GZPA 3SBWA 4DZ8B 1FO0B 3DO7A 2IJ0C 3MA7B 2GJ6B 5E94B 4NQEE 1S7TA 3DI2B 3EGSA 1KXQE 1RJZA 4I7ZC 4PB0H 5C08D 4XVJH 3CZFB 3L9BA 1OHZA 4QRSA 3S37H 3BXNB 1RI8A 4ZXBA 2NY5H 4YGVA 3MLYH 3IWVA 3TN0A 4QRTB 3ZZLA 4G8EB 1BX2B 4AMWA 4S0TD 2EIBA 2IWKA 3BKJH 3WN5C 2G5BB 2OBGA 2VNCA 4U1JA 2GIMA 4CVWA 5HYQA 4QTFA 1PGRB 5E0QA 1GY2A 4IOIA 2N4IA 2P5WE 3TH3T 3RGVA 4A38A 5EC2A 1XH3A 4GW5A 2ZSWA 4QJ3B 5GRZA 3WHXA 4OFDA 2ED7A 2F68X 4FYTA 3VG9C 4R7LA 1ITCA 4O5LL 5D6CA 2VLLB 1O9VA 2F5AH 1XXFC 3DGDA 2E4TA 2ZSVB 1THAA 4OZ4A 5FCSH 1GC1C 1KBKA 2DL2A 2KDYA 3MBEA 4PJ9D 4X6DB 1C1EH 3VI3A 1JZDC 4XNYL 1QNIA 2G9HA 4EZJA 4ZMZA 3I3DA 5DJCA 4DWHA 2CKBH 3FFDA 2JELH 1GOGA 5GZND 4WI6A 5EWIL 1ET5A 2R2HA 2DQDL 4J8QA 2O6CA 1JGVH 1A9EA 3A23A 1T5XB 4WO4B 4M29A 2WD0A 2C4XA 3GJFH 2YXFA 4HFWB 2J1KA 1SEQL 4EBQL 3B6SB 4NN5B 3EADA 1DBBL 4GT7A 1UWEL 2DMBA 2X6BA 5JUEH 2HFGL 4MJ2A 4WJ5A 4D8PB 1MIML 3QUXD 4YDIL 3IU4L 1MJ8H 1QLEB 1SJMA 4AX3A 1QLFB 1OSYA 2VDRL 5E4EB 3M07A 1NTDA 1UYWH 5TTRA 3WUZA 5AOJA 3QI9D 4K9JA 4JRXD 5IKCB 4HS3A 3QWRA 4HHGA 5ERWA 3DX1A 3S36X 4MRCA 4IGBC 1C5DA 3MCYA 3L8QA 5I66B 2VLJA 3TFKD 4NO0A 2PPDA 5A43C 2YPLE 2P42B 3V0EA 1DJIA 2V5TA 1S5IL 1OIOA 1CFVH 4WUUB 3C60C 4NUJA 5DC0A 4N0UA 3WUWG 5B3JF 1IEAB 3HE6B 3EJZC 3QG6A 1IIKA 5D1ZI 1Z5LB 2E7LC 3TH2T 4PW9A 2PO6B 3QHFL 1AR2A 3NIGE 2DQCH 2XVLA 5T3XH 4NNYA 1FGVH 5TDPA 4EDXA 3IFLL 1TTUA 4JFDB 5F89A 5GIRA 4U1SB 3LN9A 3VGAB 3PWUA 5JXAL 3RY5A 3ARGB 3W5MA 3TT3L 5E0FA 4Z7VF 4JJHA 4P4RB 1CGXA 3ZZ1A 2IQAA 2V3FA 4PPTA 4I0PB 2A9CA 3LIZH 2CJUH 3PPEA 4U1JB 1HSBB 4FFTA 2WWMD 3BHBB 4NDMB 2H0EA 3QORC 1T1XB 4JRYB 5TDNB 1TCRB 3CHPA 3L3HA 4WU5A 3VFSA 4K7FA 1NICA 4PJDB 4HZAA 3B9KA 3V6OA 1I3RA 2P24A 4PJGB 4AKQA 2DTML 4KKCD 3VSQA 5DDHA 1MCCA 4L4VD 5HHOE 4OJDH 5HVFB 4KKAC 1AD0A 3H9HB 1TQUA 3VE0B 3WNIA 3ZDZF 3US1A 3VYOA 4DO4A 4UYPA 4GRWB 4KV5E 1J8HB 1ORQB 2XA8H 4IOFC 1BZ9A 3QARA 1MAKA 3MU3A 4BCZA 1BAGA 2JB5H 5CGYD 1N7ML 3OGOE 1AI1H 3QUMH 1GS7A 5FDYA 4M5YL 2Q6WB 1XVSA 1AVAA 3O4LA 5EORH 4P9HC 4XWOD 1SN2A 1BFTA 2Z35B 5C3TA 1Y07A 5BVJA 3EO0A 1IUZA 3EOAA 4YXLH 4HETA 5GXBB 5CJOH 4U2YA 2D0HA 2KT6A 4FQ2H 4RRPA 1K2DA 1BQRA 1QMUA 2EE9A 3CVHB 4JFOB 1PYWA 4N28A 1J88A 1NMAH 4LMQI 2DIAA 2GJPA 3MV9D 4FJZA 3RPKA 2Y25A 5FF6A 2NMSA 4MXVE 1TTGA 5DJ8B 3BN9C 4PY8J 3HAEB 3GJFA 4HWEL 1PYWB 4IU2A 4TUUA 3BSZH 4F80A 1X5KA 4NRXA 4XCYA 4NT6B 5F6HI 3L9YA 4M1DH 1D3CA 1FUNA 2XWZA 1YRKA 2CK0L 3R1GH 2JJWA 2GTQA 3TBYB 5EU6A 1MCDA 2JKSA 3JVGC 4QD2E 2ITCA 3GJEB 2EYRB 4E68A 2F18A 4MJ6B 4AW7A 4E9LA 2BNRE 3P9LA 4LFHD 4N9OB 2BSEA 4IQHA 4XVJL 5LN8A 3OAYK 3VRJB 5TPWH 3VXOB 4QJ5B 2X2IA 3MLYL 3P69A 4XNZB 5AVXB 2MTPA 1ZLSL 3VXME 1AO7A 1Z9SB 3CLEH 1XSKA 4A04A 5CBEB 4GXFA 5E6YA 3FO9A 1FNGA 4NO5B 4O51A 3W9DA 3MV9E 1JMXA 4ODXA 2OXGB 2DKMA 3RZCB 3MXVH 3AG4B 3OL2A 5E8OB 1T6WA 4WUUD 5IBTL 3MRMA 2YA1A 2AEPL 5B7FA 5AD0A 2VZTA 3MFFB 1I9IL 2K4AA 2YARA 2ZUTA 2PUQT 3QPQC 2VTFA 3MOQA 3EJCA 1NCBL 3B2XA 3QA3B 3V9FA 3EO9L 4JB9H 1G6VK 5CGMA 3NSXA 4D0CB 1A6PA 4R4NC 1Q9LB 4OLVL 3EYUL 3D3VD 5M95B 1AS8A 3D18B 3ZXAC 2RBLA 3QB7C 1WZ1L 2XQYK 5ICUA 5EZJB 3BWUC 4IKJA 3LD8C 1VCAA 5AUMA 2OXHA 1XBDA 5DJ2A 1D7DA 2EDOA 3MRHA 1VFBA 4OGYL 1RPUA 3ZTJG 2ITFA 3EFDH 4PJFA 4OF5A 1DVFA 3FFOA 4AITA 1BBJA 1PLBA 3DUSA 35C8L 1J87A 4G70B 2WLLA 4JPSA 2GYSA 2H6PB 5FO9A 4I3RH 3TP4A 3D2UB 4JG1H 4NNXA 4X7TA 1UM4L 5D4QA 5F9DC 3ZE2F 4Y5VA 2WP3T 4ALAC 3UG5A 2FLBT 2WLLB 4Y16C 5E9DE 1UASA 2NY2C 3LH9A 1HH9A 4Y2OB 2DBJA 4PGCA 1DSWA 4UUJB 3DBSA 1MCHA 4Z7VE 4L4VE 3DOIA 2ZX9A 3I6KB 4PJIA 5PCYA 5I5MA 3P77B 3IE9A 1BG9A 3ARDB 4UT7L 5FYJD 1ZHBA 5FX3A 1I53A 2EO7A 1T2JA 4GXUM 2NCEA 4RMTA 4U1MA 3LEXB 4KC3B 4E42A 4N26A 4Z7WE 4PJXB 1EEUA 5EUOF 1JTOA 4CDHA 1QVOB 5DHYB 3T65A 3NK4A 5I73B 1P6WA 2MCPL 3L9RB 7PAZA 2V2XB 3P3TA 2XWEA 3C5ZC 2EO1A 3BVNA 4U6VH 1P5UB 4LXFA 3H6JA 4KQ3L 5IY5B 3FCUB 1E9PB 1ACZA 4HOZA 5BS0B 1HWWA 3ARVA 4JFEB 4LSRL 2PW2A 2NNRA 4JO3L 3ILEA 1ZJAA 2ZUYA 2XPGB 3O4LD 1NANI 2OJZL 1EEZB 3MRKB 3OKMA 3RURA 5GGUA 1SJVA 2OYMA 3VD4A 2LTQB 1JPSL 4GXVL 3ASOB 3HG0A 2VH5L 3BAEL 4Z76B 3IMWA 2F5BH 1SQ2N 2VDPB 3IMUA 2EDFA 2UWEE 2WM0A 3HJEA 4JO1H 4P5RA 3T0WA 1E8WA 2XNAB 2EH8H 4X6CF 4MJ4A 4LLQB 4OI9A 5FWQA 1WS7A 3D50A 3MV9B 4PGEA 4XN2A 2HMID 4BRVA 4YDVB 4AT6A 5I73C 4OZHE 4BH7B 2JJTA 3NESA 1CGYA 1HXKA 3IFNH 5HDQL 1W16A 2IVFC 3MUGA 4U6HA 2KH2B 2X9ZA 4PV8B 5C0AE 5AAWC 4DGUA 3OMNB 3DX9B 3ZRFC 12E8H 4K3HA 4EAEA 4G11A 2J1ZA 1GJUA 4AMXA 5IVOA 2RTTA 5EU3A 1ZHKA 5TE7H 3HW7A 3SE6A 3MOAH 1INQA 4BK8A 4F9PA 1HJCA 3JTSA 1CN4A 1K2DB 3DROB 1KPRB 1JV2B 4PJAE 4ZMLA 1RZJC 3B7SA 3I50H 2OLDA 4NSKB 1SOXA 4DVRL 3K2KA 4M8VA 1CLVA 1PSKL 1TTRA 4JPKH 2WQ8A 5DUBB 1J5OL 1QSFA 5FECB 1HKFA 1FORL 1WBZB 1U58A 3ARBC 3F84A 4HJIA 4XP5L 5FM5M 5DO8A 3W39A 4HDIB 4NYLA 3SN6N 2BWDA 4OT1H 3PP3H 2AJYL 1MREH 3U46B 2GUOB 2CZNA 3BXNA 3VD5A 1NGQL 4N8VA 4ZOAA 5K93A 5IQ7L 3IJSB 3DTDA 3QUKA 4HBCH 4IW4C 5JIKA 4O9HL 3F7YA 5EN2B 2MQGA 4JEGB 5L2JA 1XF2B 4I2XA 1NCJA 4NIKB 3F05A 2P28B 3GRGA 2X12A 5CWSA 5ESVA 5GJTL 4WKZB 1QWHA 3ME0A 4UOQA 1XCQA 3RVXD 4OD1L 3GNML 3HVDA 2NY4D 4GW4A 4WKXA 3TN0C 3U25A 5HI3C 3VCLA 3VW3H 3WJLA 5C07B 4HW6A 2BNQB 2UY7A 4Y2DD 4Q0XH 4P2RD 4J4PA 3CH8A 4P99A 1FZKA 2XWRA 4H2AA 4DVBB 2IEPA 2Z8VC 4F5CE 3S3CB 4FL4C 5MEOA 2V8LA 1LO5B 1HEHC 3CFTA 4LAJH 3HAEA 2XLLA 1ZE3H 5C07A 3DUSB 3G04A 3O3UN 3DGGA 3O9WC 4PVMA 3UJTL 2BDNH 4ELME 1H15A 3TA3A 4G9FD 1D2PA 1CR9L 5IMKA 2X41A 5DS8A 5TDPB 3VX1A 4BK5A 5FOBA 4HOXA 3DX8B 1EGJL 4OLYH 3ZE2E 3EO9H 1BQHB 3L95A 2CR0A 4X8CA 2CK0H 4H26B 1K5NA 1ZV2A 5D8JL 2HT4D 5IOKA 1KBBA 1MSPA 1RUML 2DD8L 3B5HA 4QNPF 5I15H 2BFVL 6FABH 1D9KC 2X3CA 1RZQA 2VDOL 3FOLB 2R39A 4G80A 1X5FA 4YHYB 1HQRA 4NM8H 2H41A 4IMKC 2C34A 1FF5A 4MCZB 4TQHA 5AFAA 3C5XA 3ESNA 1KNOB 3NRQA 1SJHB 5AVUB 3RA7H 5FPIA 4X4XA 4LP5A 1AKPA 3AS3A 1BQHA 4KVCL 1KEGL 4WNQB 2NOYA 3KAAA 2IO5A 5IROD 1W72B 2P24B 4PJGA 4LK4A 3CFEB 4LVNC 2GBTA 2WLHA 4TSAH 2J4WH 4FDWA 2VMDA 1A3LH 4H8HA 4OLUH 5KYXB 2WWKO 1SYVA 4ZDHB 3QIWC 1XGTA 4GKOA 5DLLA 3RUGE 3IKCB 4Z77B 5FEBA 2DQHL 3E38A 5IMLB 2ZKHH 1JF1A 1A47A 2J2ZA 1U8JB 1I1AC 3STZA 4N3UA 2G75B 1O9ZA 2AXHA 2BP0B 3MGTB 2Q2EB 2VN7A 3FQ1A 4AQ8A 4QYOB 3WNNA 1TENA 4LSSH 1UCTA 4PJDF 5KVMC 3GLDA 3PHAA 5JW4Q 5AZUA 5AVWB 2P5EA 2EC9T 4L8DB 4N8CL 5IEHA 1NC4B 3S3JA 1MIEL 4DO6A 1TIUA 4R5XA 3IDYB 4A37A 3GSVB 4BFRA 1X7SA 2YD2A 3CVCA 1F6AA 2Y5TA 3BWUF 3J7HA 3CVHA 4GBXD 5GJSH 2JTDA 2O5XL 3HPLA 1KTDB 1XIWC 3H85A 3F7QA 4MQXC 4X6CA 1YJDL 2BZ7A 4XAWH 4XPHL 1U8HA 3HB3C 5AKRA 2J88L 4MMXA 4ZO7A 3KW7A 4PI0A 2R56L 4DN3H 4IRZA 5T1LB 1YMHA 3KYMA 2O5NA 1AJ7L 4PGEB 2C1PB 2UZIH 5JYLA 1YEEH 1M53A 4NENA 2EXYC 4U3XA 4UOW0 4HYTB 1CICC 1NMAL 4XPGH 4LARH 2WWKT 3U0WH 4E42B 1YEKL 3RWEB 1BG1A 3VXUE 4YSRA 3JV4B 1E5AA 2NDGA 3QJQB 4JCMA 1XB8A 4N6RB 3NTCH 1RY7B 3ULUC 4WWKD 3ELQA 4XPAH 4JKKA 3QFDA 2B2XH 2VXSH 3N91A 3DO3A 5D72L 1AQKL 4ZAKC 2VXTH 4EN2A 3WEMA 3QC6X 1DSYA 4RWHA 4FLRA 2UY6A 4WUKH 1BA9A 4ZTPL 2YC1A 3QCUL 3PREA 1I7RB 1W6WA 2J8UA 2B14A 3BDYH 2CDEB 4YSSA 3QZPA 3CIAA 5D7LB 4ZW6A 5I9QC 3M17A 4NKDB 1H5BC 3IXTA 3VU1A 2CHWA 4Z76A 3D0AA 1KT2A 3D08A 3H7LA 4WGVB 2EDTA 3N9GH 4LSVH 3U30B 3ZK0A 3PP4H 4K5MA 1ZCRA 2XC8A 2WZPD 4MNQD 3O0LA 5DRNA 1LP9F 1NCWH 2VERA 4QRPA 4HCRA 3COOA 4BUHA 1SBBA 5E8PA 4XN5A 4PS4H 4WI9A 3EH1A 3RTQA 3ULUH 5HPMB 1IBFA 2CIIB 2FJFB 1SXSA 1PF3A 1IBGL 4WCYL 1DQQA 1CLZL 5EZIH 2VLRB 4NNXB 2EJ1A 2V5MA 5I30L 1UD8A 4WFFE 1XV8A 3I3BA 3MREB 4P04A 4WWID 4YSPA 1T2QL 1QBML 4OJAA 4Y5YA 2VABA 2Z93A 3GNMH 2WC7A 4L4JA 1RK1A 4FNUA 4QHKJ 2EXWD 2VABB 3KPRE 2XWDA 1OW0A 2PCXA 4ODHH 4AVJA 4L1BA 1VF5C 2QADC 3DSNB 2ZCKL 3QO1B 5K9QI 4OZFH 4K73A 4NUPA 3IRCA 3GXDA 4M56A 3FB8A 4BH8B 5HBBA 2O61B 4Y4FD 1FLRH 4IMKA 5IESH 3IMRA 3ROOB 1UQSA 2F8IA 1MFUA 1CF8L 3KJ6L 3P4OB 4G1EA 3QAZC 2HLFD 5T1LA 25C8L 4MXVF 5AW3B 3LX9A 4BFNA 2NX5D 4TXVB 1A9EB 1WT5C 3UTPD 5E8EA 4EF3A 2FWLB 1ZGLP 4RMQA 1CFBA 2EAEA 1XO8A 3U48A 3WV0A 3C6EA 4Z7NF 2BW4A 1T22B 2D7TH 4CSTA 2FEEL 2YUVA 4UDUA 1KIQB 3VWJD 5C8JA 3B7TA 2M2DA 1ZHNB 43CAB 4NGHL 1ZE3C 3GKWH 3IU3B 5L4JA 2YN3A 3C6LC 4M6AA 3EHBB 1YEJH 4JG0H 3G6JB 4IU3A 4MMYA 3LPGA 3UJJH 4JZJA 4GUQA 5L8LB 2ICWJ 2KQNA 4FTVB 1T5WA 2NY1B 3HRZB 4GXUN 3ETTA 1EHNA 2LVCA 5G4MA 3UTTD 4YR6A 2PPEA 4YEEA 2V33A 1I8KA 3KPMB 4FD0A 4KXBA 3O3EA 3RIFF 1NCAL 1A9BB 2CLZA 3CAFA 4D9RE 5J6HB 3SB3A 3LTVA 4ODSL 2Q7YB 2C3VB 3VG9B 4G83A 1DEEB 5D55A 4R0LA 4ATTA 1RUMH 2DD8H 2XZAH 5EA0L 1MJ8L 3L17A 1ZVSB 3EDFA 3PWVA 5F6IC 3KYKL 2NTSP 3B34A 1E5ZA 1T66D 3L4ZA 3HPJA 4MNQE 4QHNB 1JPGB 4XAKD 4KJQD 4B5ZA 3PYCA 3GFUA 1K4CA 2AQ2A 5MENB 2HX7A 1BECA 1Q90A 3E8UH 4WW2B 4CGUB 1F3JA 2BVOB 3GUFA 1XCWA 1ILSA 4Q74A 1IM9D 2VR3A 4HUWB 1SHXA 1XGQB 2BH0A 3I9AA 2D3JA 4KVCH 3QWNA 4NRXB 1JYWA 3GSNL 3QJFB 3QIBC 4HJ0D 4P48A 2WBXA 5FKPB 4IDJL 4TULH 4X5WA 3D9AH 1TJMA 4G8GE 1T0NA 4OJFL 2YD1A 2D8KA 2DQHH 4QUOA 2QKIC 5FO8B 2V8MA 3PJSB 3SDCC 1HWGB 1QI3A 1WAAA 4DQAA 2FZ3A 2WO2B 4MA7H 2YOCA 3E2HB 5F7EH 2ZXCA 2D4DA 4NPKA 4D2NA 3F85A 4R26L 2I26N 1MCJA 4N8CH 2KL6A 1JPST 1RZIA 3NAAL 2BRRL 1B4JL 5DQJA 3L3GA 1E4XL 3LVEA 1NCHA 1J0HA 1PNCA 3QEQB 5IV2A 4A7VA 3KYOA 1W0VA 4NRZB 5ACZA 1KBPA 2FX8L 4ERSH 4KO6A 3QQ4A 5I8EB 1GOHA 2BZDA 4H1LG 1Z3GH 1HHIB 3KLHC 4FG2A 3A24A 3WL9A 2G0KA 3P4NB 2C3GA 1DDTA 5I1LA 3RJDA 4CGTA 4LBAA 2BVYA 5E1AA 5IB2B 2IGFL 3FU5A 3U46A 1AXTH 4BFEA 1HYSD 2G3NA 2CAKA 5DMJB 4APXB 2B2XL 2VXSL 2Q10A 3SD2A 4X9YA 5C0JB 1F8TH 5E5MB 3QPXL 1MEXH 3KEHA 1JHLL 5DMKB 1W0WB 4PWIA 1C08B 3SDCB 4NS0A 1IC4L 1ADWA 2AQ1A 3HR5A 1G9EA 3EW3B 4BK5C 3SGEH 1ZV5A 3KW8A 3OJVC 3GK8H 3EDEA 4YX2H 2H9GA 3L48A 4UINL 3QJHB 5HHME 1NKOA 4P46D 2A9DA 2LU4A 4NKMA 4NQDE 4QIRA 5ESQA 1A1OB 3TJEH 1ZLEA 5MEOB 1YN7B 4XCEB 3FTGB 5JPMB 4NCC2 5D6DA 1FJ1A 1I9JL 5KSVB 1BQUA 1FZKB 2EADA 3NIDF 4UMGA 2YD5A 1JNHA 5AW9B 3ARWA 4KXAA 1M1XA 4X8GA 2EVHA 3BGMB 4JQVA 2XXCB 1NAMB 1WIUA 3P02A 1T7XA 3VU2A 1A14L 3LEYH 1RZ7L 5C0IA 5DQ9B 5D7SH 2EIDA 3HHSB 1G9HA 1U33A 4JFXB 1LWJA 3VD9A 1VGEH 1J18A 3EBAA 2PF6A 4FQJH 3KPRD 4LFHG 1ZS2A 3GTNA 4FHKA 5INCB 1MCPL 4M62L 1P1ZB 4W9DC 1Z9PA 2PTTA 2ZUQC 3L2MA 4PP2B 3WKML 4KWUA 1EO8H 3ZKXC 1BYNA 4DPAX 4P2OC 1MPAL 4ZFGH 4J2XA 1N68A 2HVBA 1TLKA 5G5DB 3TO4C 2CBPA 1F3DH 3QHZL 1U58B 3W39B 4DUXA 4KK5D 3QDGE 1U3ZA 4NWTL 1QO3A 4OIIL 1DL7H 5CZVL 3MLWH 3A4DA 4Y16B 1E6JH 1JCKA 1E30A 4LSDA 1GC1L 4GLRH 2V2XA 2E7HA 43C9B 2VISA 3W2DL 1FYHB 3LNFA 1AZNA 1TXKA 3I85A 3WNOA 4PLNC 2DM2A 3VUAA 5I6MA 4OVUA 4EN3A 1G9MC 2YRZA 3LNHA 3N06B 3TEUA 3ZOAA 3L4XA 1CD8A 2BHUA 1F02I 4LVHC 3ULVL 4AL8C 5IB3A 1YEGL 3RWCA 4FFZH 4MVBC 3D5OF 1I8KB 3KPMA 1ZLWK 3GEFA 4PV8A 4NQCB 4B3EA 2ZOKA 2NTFA 2OJ1A 1ZT7B 3KMDA 1P5VB 1M7DB 1VADA 2PNDA 1W9XA 2KI6A 2OMUA 5D7KD 1BIIB 3C5ZB 4ETQA 5EEVA 3CD4A 1I1AA 2QT6A 3OJDA 2EDMA 4ELKB 4M8QB 1LD9B 2VDLB 1SFHA 4PJIE 3CG8A 4EXPX 4PJHA 5HPMA 3C5ZA 4ETQB 2Q5BA 1DQLH 5IVXF 1VADB 3F7VA 4AM0Q 4WF7A 5EFIB 4DAGL 3CZJA 4AXWB 4LKXA 4JG1L 4HUXA 1A7PL 3KPSB 4V1DB 3EGSB 3QFGA 4JDTL 4JO5A 3U2SB 2J8OA 4P5KA 4NLHA 3T3MF 1RP8A 2CHZA 1JG9A 1RIVH 2Z93B 3UROR 4ANUA 2PCPB 2Z31D 3TFKC 5IW1A 5D7KE 3EJYD 1ZLDA 3PJLA 3P4LA 1H3PH 3LYRA 5J5EA 2QDWA 1T1WB 3QEHA 2FBJL 2IH3A 3QUYB 3FFCE 3F12A 1L7IH 5D1ZC 1NBCA 3QBTB 1RMFH 5ABZA 3AG1B 2ADGA 4H88H 5ALBL 4IRSA 3R06B 3UC0L 5E08H 3WEXA 2VWEE 3EJRA 1GTFA 2Z4QB 3BCFA 3QH3B 2IAMD 1V5JA 1OAXH 4XBEL 4P2QB 4DGWC 4Z3JA 1JZ5A 3WTUA 3JV6A 1BEXA 3EKCA 4PJIB 3P40A 3A6BL 1CD1B 2AQNA 2XZAL 3EYVB 3L3GB 3QUHA 4M93C 5EA0H 4DGVL 1HTYA 4PCTA 3KXFD 5CBEA 1KEML 3PGCA 3H3BC 4WI8A 4AJVA 5GQBA 3LDBB 4G9FA 4GUPA 4JFYB 4XCNA 1CGWA 4U2ZA 1SVBA 4FQ2L 2YMXH 3NSCA 1SF5A 3PE9A 1IVLA 4JL2A 1G7PB 2EUZA 4MAYC 1NFDA 4XC1H 3NCCB 3H9ZA 3HMWL 4PRHB 1GZPB 2Q76A 2BOLA 4NB7A 5J3HC 3ESOA 4TVPH 3GZKA 4JO1L 4S1RL 4QLWA 1AGFA 1KXTB 3FTXA 2EC8A 2ALAA 2ZUQB 4GAYB 4CMMB 4ZZKA 1VKXA 1BOYA 2CLVB 1J8KA 2VDNL 2LT9A 2XFGB 4AZUA 5ADOL 2N0MA 1NC2A 5EZJA 1FFPB 1DANU 3ETBF 5EUKA 1KGWA 5SWZE 5J12B 3CZNA 2XYBA 4EE2A 2Y5QA 3KLAB 2X3BA 4U1LA 5HVGB 1OLZA 4NQSB 3JTTB 4PJFE 4N6QA 4L23A 1G7MA 3DARA 1BGXH 5IJVA 3RVWD 5K1JA 1IGYA 1R46A 4MMZA 3CPUA 3MRJA 4M5SA 4F7PA 1ZHLA 3CLEL 5C7XL 1HOEA 3HB3B 5EH1A 1FNLA 1BSIA 2Q9OA 3LZPA 3D30A 3VG0L 1F4AA 4CC1A 3S3SA 4GEIA 1UOWA 1FLTX 3L3DB 5AW6B 1YEHH 1MOEA 2CRZA 2VE6A 4PVBA 1Z3GL 4ZTOH 3WFCL 1B88A 3EFOB 1G0DA 4LU5H 3BJ91 1MCOL 5EF3A 1XD0A 2X5PA 1OWWA 4MBOA 3HZVB 3HR6A 3V5DB 2Y07L 2F53E 1NC4A 3MODL 1IMHC 2DPKA 1A7OH 5DMGD 4GAYA 3LIZA 4AOFA 1TEGA 2QVFB 2X89D 4PCYA 2Q87A 3PS6A 5D7SL 1CL7I 3P0GB 4GRLA 4QRRA 4TUJB 1EFXB 4UF7C 5ID1B 3A6OA 3S9DB 4K94H 2VSKB 4LLYB 4Q89A 4OFYD 3MN8A 2X4TB 5LBGA 4K8RD 1H8OA 3FUFA 1HNYA 1MF2L 2J2ZB 2J6EH 4ZRGA 1F6AB 1JS4A 3QIWB 3UBFA 3D4GA 3MRFB 2CRIA 1A21A 2SODB 4K23H 2DV6A 4KZEL 2I69A 2JI3A 2VQ1A 5H2BA 5KYWB 4NZDA 3DSFH 3PWUB 2YPLD 4L8DA 1JYNA 1DR9A 4JVUA 3TIEB 1F6FB 4D8OA 4J3TA 1KYUA 3QULA 3ZHNA 2P4AB 3AREA 1GS6X 2FHBA 3CFJA 3TA4D 3KH4A 4R4FL 1BAFH 1T7YA 4GAJH 1JZ8A 2YPKB 4U6XA 1BJ1H 4M48L 3U4BH 1CXIA 3F8UB 1F3JB 4NXSA 1FAKT 3MRRB 4KTEH 3PY9A 3RFZC 3SYQA 1DL7L 5DURB 1L9OA 4BK4A 4IDJH 2RFXB 4G6JL 4S1SH 3HVNA 4AG4H 2GJJA 4JREC 2ENJA 2NY0D 5AVSB 2CO7B 4WU7A 2CCWA 3H1ZA 2E9IA 3TJPA 1X7QA 4F9LC 3IJSA 5C2BH 4XVUD 4KDTA 2WSPA 4PRNA 2B08A 3QEQA 5IV2B 4QTIL 3TEWA 3ABGA 3BPLB 1JVKA 2ZT9C 3WG7B 2CO6A 5F7EL 2CBQA 2GSIA 2VN4A 2E56A 4HEPG 4ALAL 1KULA 1KLFA 1K3IA 1OE1A 4NZTH 3RPIA 4P4KA 4M4RA 5FYKL 4F2EA 3T77A 2R2CA 4G6AD 4NZUH 4AL8H 2IIJA 4Y1TA 2ADYA 5C7ZA 3DPBA 3L3OC 1BMZA 3CK0H 4K7PY 5D7IA 5DUBA 1RERA 3RUGF 1EDQA 4QRPB 5A6LA 4A2FA 2A4ZA 2KQMA 3LKSA 1WCQA 4MWFB 4QEGA 2A5UA 5ESVB 2IBBA 3NCYP 5HHXH 3TA3B 3GXFA 4FXKC 3WEBA 4JPVL 5EIQA 4RDBA 5D71H 1E4XI 1RH8A 2GJ6E 3WNJA 3A21A 1Q9WA 1NC2B 4WEUD 4K9EL 1CIUA 3U1SL 4Z7QE 1MRCL 2N59A 5DZAA 1MIEH 1QTYT 4CMMA 5BMFH 1JDAA 2DYSB 2P8MA 2VR4A 3BP5B 3CFKB 4XNYH 3RGVC 1L5GB 2A9AA 4HK3J 1XGYH 1N8OE 2JXMA 4F7CB 4B9YA 4WO4C 4ZQKA 3F62A 5F7DB 1XCQB 1CB4A 2Q7AA 1JGIA 3QUMA 2IOOA 3LZQA 3M86A 2VJ8A 4LLDB 4GG6E 3WKNA 3TEZA 3T8XA 5HVWA 1V3JA 1JPTL 1R5IB 2Q7YA 2VZ1A 3EIFA 3HUJA 2MCAA 5FK9B 4X5QA 4Z0BL 4A2HA 4AUYA 3DVIA 1G7IB 1WF5A 1G84A 2G60L 3TCLA 1RK1B 4RX4D 4C57C 4QXGH 5FYLL 2ZXAA 1NH6A 4H8QA 4IJ3B 5DYOA 3RTLA 2E6QA 3VTTA 1ZT4B 4FFWD 5CUSH 4LPXA 2ZWSA 3TCTA 3A22A 4JR9L 5KSAC 2FHFA 3QEUA 1NC4D 5IEKA 3ECWA 3UPCA 1RU9L 3AGVA 4NC0B 3T09A 1HINH 1WVZA 3QHTC 1XF5A 4JZJB 5BZWB 5IOPB 3V0AC 1ZAGA 2OCCB 4DPBX 3SE4C 1JGEA 4UAOC 5I17A 4KZ0A 1WEJH 4PRAA 4OM1H 3BPLC 2AVFA 2V4LA 3VB8A 1BOGB 2X6MA 4ZTPH 1ES0A 2X4UA 1WC7A 4YHPB 2C1OB 4HKJB 2R56H 4ZBJA 3PNWA 2XPGA 4DKTA 1WSST 5C0EA 5KVFH 3HHSA 2G2RA 2GY5A 2X2HA 1IKFH 1OAKL 2B59A 2CALA 1SRDA 3MRCA 1U8KA 2IAMB 5JW5A 4BH7A 3H2QA 1X5XA 5I0VA 2MMXA 4UQEA 1ZLUK 2WQSA 4QRUB 3S37L 5KSBA 4AEEA 4LU5L 1BEYL 2NSXA 4MB3A 3UPAA 4LSPL 1E27B 2XCMC 1XGTB 4DKAA 3TT1L 1GH7A 5K39B 3AMLA 1CIDA 1BVNT 4HSAC 2A74A 5GRUL 1LO0H 1FVCB 5AVTB 3K74B 4BBWA 5BV7H 2ADJA 2P45B 3QWOB 5LCVA 2QZ5A 2VDOH 2XIDA 4WFHD 4JRYD 4QHUB 2ZF8A 3GPEA 5ACMA 4EJ1C 4JAMA 5ADPL 1YAZA 3ROLA 3ZQ9A 1QBMH 2NY4C 2F0CA 2WYTA 5DEFB 3AQXA 4UIKL 2A4CA 2WIIA 3ILPA 4XB7A 3VXRE 4JHWL 3C75A 2VISB 2R2BB 3RFZA 1RZKL 4F8QA 4XXCA 3WO4C 1DQQB 3KYMB 4Y9GA 5IQLA 2EKSB 5EU7E 2J1YA 3JWOC 1X5HA 3ZN6A 3DJRA 5BRZA 1KTDA 5CAYB 4L3EE 4MAUL 4CVXA 4HG4J 2OXGA 1KY6A 5I0DA 1E0OB 1DBML 1PL3A 3QQDB 2KLRA 3CLFH 3PXJA 4GAJL 5DQJB 4NO3B 3IU4H 2QL1A 5EZIL 4MB5A 3EJUA 3SGJC 3QDAA 1JNNL 2B20A 2BFVH 6FABL 2L0DA 3VRJA 4WVRA 1PD0A 1MJUH 2NW2B 2R69A 1RPKA 2PXYD 4O5LH 1BZ7A 4D7PA 4FFYL 3QDJB 3O6LL 1CGUA 2YC1B 3FT0A 1A7NL 4LOUC 1SBSL 5HGDA 4QRQA 1ZTXL 3LN4A 4Z7NE 5C0IB 1Z0MA 4N24A 3V5HB 4XAKE 1USZA 3WI9A 3GS0A 1NFDB 3BP6A 2DEXX 1IEHA 3G5VB 3IFPA 5LAXA 4DP6X 4HEME 1D9KB 3K4ZA 1KCRH 3G6AA 3MRMB 3T3PB 2CDFB 1CF1A 2W88A 3B7YA 4HUCA 2YAPA 1IGFH 2AKRA 2XN2A 3QJOA 1NDMB 5F8RC 2XVGA 5DO2D 2BFGA 2MOGA 5GGRB 2RCSH 4TPRH 1AHWC 1RVFH 4CA4A 3MJWA 1SLXA 4GSUA 3QIWD 2ZKHL 3WNKA 4TNVK 2ZCZA 4G6KL 1UHVA 4A63A 3OJ2C 3HBZA 4G8IA 1UKSA 4MAYA 4HKZB 3II1A 3GHEH 4KTEL 1L9MA 3BISA 3E2HC 4F33B 3NZ8B 5T1KA 3MJ9L 1AKJD 4MAYB 3L5IA 5C0BE 3VFGL 3OG4B 1RXLA 3RDTD 1KIRB 4WV1C 4AY0A 3L6FB 4FQHB 1LGVA 4DEPB 1BVLB 4JDVA 3BYYA 4IYKA 3ZSTA 1KPVA 5L0QC 1NMCC 3WFHA 4J12A 2HXAA 4X9FA 4RQQB 4RWYH 5GRJL 1GGTA 4MX7B 4TLTA 4UOJA 4PRPD 3QWOA 4JPVH 3GSUA 1SHMA 1RURH 3QQ4B 5I8EA 3UGUA 4BSVB 5IJDC 1VGKB 1TCRA 1WO2A 3JXAA 4H1LB 3HS0C 4X6FA 4AQEB 2VXUL 3DXAB 1HZHL 2B0SH 2WZPA 1OD9A 3WY4A 4N9GB 3NIGF 5J1AA 3CJJA 4W81A 2XG5A 3H56A 4JFTA 3V0GA 4LVOB 5AWNL 3VD0A 2O61A 5DVPA 1NEZB 4R90L 4UM8A 4YE0A 4XNDA 1MCOH 3KLDA 1U8KB 2IAMA 4HAKA 3ARGA 5ETUB 1OO2A 2ZZUT 4G43A 2ZUSA 5T3XD 3LKOA 2EVIA 3CE1A 1U2HA 5EZLA 3QCTL 2Y69B 1PQZB 3BUIA 4LE8A 4AYSA 1TETL 2P80A 2RA1A 1B4RA 1OAJA 3SDXA 1CGSH 1U8MA 2PYEA 1KFAL 3QUZD 4HOMA 3PXLA 4UANA 4UT7H 4H8UA 3ULVE 5E5RB 5DHMC 3N41B 2E9JA 2QKIB 3FT1A 3OQ3B 2ZCLL 5DMIL 3EYQD 4PGZA 4N2EA 1E28A 3IETA 2NLJB 3V5KB 5KW9H 1AD0B 2ITDB 2VC2B 5I5IA 3GMQA 1P69B 4HU8A 3OGCB 2AXJA 4TLUA 5K39A 3UAJD 2DQIL 2ZWKA 2LOEA 2KZBA 5F44A 1P1ZA 4HK0A 2XN9E 3IJEB 1Z32X 1LO2L 3FQRB 3T08A 5DWUL 5G4NA 2DLFL 1JGUL 3O3EB 5FOJA 5AL8A 3HUJF 3O6KL 3LRMA 3VFMB 4AV0A 3V6FA 3F5WB 2OMUB 2F5BL 2PCFB 1D6VH 4FE9A 2VLKB 4K55A 2AJUH 3BSZL 3ARPA 1NCBH 4XN8A 1QUNA 2JB6B 3RL1A 5I23A 1A2YB 3N41F 5CWSB 1AXTL 1MREL 4NQED 4N6RA 1G6RH 1P4BH 2F7QA 1OZUA 2AQRA 5CJQL 3V4PH 4ZMVA 3REVA 4UTAH 3IXTB 4N2HA 4OKVB 5E8NA 1NGXA 3VXSE 3RKPA 5D6CB 1KV7A 2VSCA 4QHKI 3QUZA 1ERNA 4NRYB 6CGTA 3M45A 4OLWH 3CZLA 1ZLSH 4OD1H 1AGCA 5MHSE 1PLGL 1O9WA 4RIRB 1YMHB 3RGVB 1QWUA 3S96B 1NOAA 1KMGA 2YJQA 3IJYB 4JM0A 1H0DB 3KL3A 4YHMH 5F1SA 2E47A 1F4WL 2Z31B 3N85H 4PVNA 2ZUVA 4Y4HB 1OCWL 4UV4L 5CLWA 2WBKA 5JW4N 3S3PA 5IR1A 2Y06H 1NAMH 2XWJB 1M42A 3V52L 4UZSA 1O7VA 4ODXB 3RZWA 3BFQG 5IKCA 2AEPH 5C0AB 2I7SA 2Y2TA 1L6PA 2XV2A 3U30C 2WXKA 5KTEL 1VEMA 1XTMA 2NYKA 5DD0L 3MLWL 1CDBA 1T80A 3VFNB 3QJHA 5AB9A 4ZPVA 4U7SA 1ZLWH 1SBSH 3JV5A 1DCEA 3VWJC 4JB9L 5EC1A 4OJEH 4ONOA 4WJKB 5ANME 1G6RA 3FUKA 1EHLL 2QGEA 3UC2A 1ODUA 1ZKAA 3B6SA 3I75B 3N2JA 4UUJA 2HAZA 4CU6A 3SDCA 5T1JA 4PRPA 1AD9A 3GSNH 4FTDA 5EU6B 4WO4A 3RQ3A 4AENA 4ZO6A 5IHHA 2EACA 4F20A 3HZKB 3K3QA 1J0KA 4HWUA 1C7TA 2DWTA 4FOMA 3PDOB 2BHZA 3L3OA 5GZNA 2JJVA 1F1AA 1MKFA 3CFDA 4OGYH 1OHQA 4H26A 5LO7A 1JSYA 2BNRA 3SDDC 1NBQA 5FKAB 1A1OA 1B0IA 2DM3A 3SBQA 5KYXA 1CK0L 3BLBA 3U36B 1WFMA 1V7NL 1QBLH 2M8XA 3N1FC 5DRNB 5DJ2B 1FGNL 1MRFH 1KIPA 3NEOA 5D4HA 4A6YA 1CICB 2OTUA 3VXTA 3VWKC 2QVMA 1EQWA 3JUYA 4P59H 1B2WH 1BZOA 4IOFD 3KWXA 2JVUA 1T66C 4ZSOB 4FQQB 4HT1H 4HH9B 4P3WA 2ED9A 3K2IA 3L7EB 3BSGA 4JRXA 4TL5A 5BO1H 1OARL 4J3VA 3TWCL 4Q6IA 3DETD 4HWBL 4D0CA 1IVTA 2XRAL 2EZ0D 4M6OH 5AALA 5DHVA 1IAMA 2OMNA 2YN5A 4UDTA 1MNUL 1R3LB 3QIUA 4U0RC 1IILE 4FFZL 4DGYL 4XODA 2X0UA 3IAQA 3C6SB 3FSAA 4ZYKB 1M71A 3H9SA 2OMXB 5G2NA 3R8BB 3X1NA 2IH1A 2PWGA 4IS6A 3RDJA 4X7SL 5FYKE 4RSYA 2N56A 5J6HA 5ALBH 3C2SA 3QUXB 1L6XA 3MGOB 3LNIA 4MD0A 4UDTB 1CDIA 1EJOL 1L3NA 1MFBH 5DEZA 4YL9A 3Q1EA 3SDCD 3L5WB 1S5HB 2UX7A 3WFBH 3I6GA 3VVWA 2AV1B 4AIOA 5D2LB 4G7VH 4Y5VB 4RA0C 3BGFB 2VMJA 2NYYD 1TZHA 2ATPA 4TNFA 5FYJL 3FFCD 1F1DA 5FUOH 4LSUH 2OFQA 4J3OH 3T1FB 3WO4B 1JPGA 5DS1A 3ISWA 2N01B 4P2YA 5MERA 4Q97A 3I3EA 3ASWA 1TZIB 3AADB 3BC9A 4PUBH 1WT5A 3IDNB 1KBGH 1T21A 2X4RB 3KGRA 3GBMH 4KNUA 4GB9A 4BZ1H 2PMZA 2Y5TB 1NSNL 1TQWA 2CLZB 3ILDA 5FFOA 4B9PA 3NJHA 2EDKA 4KROD 1OPGL 2E7CA 3B56A 3OPZL 4UQ2A 4JM2D 4WI5A 2JTYA 2XQYA 4GRWF 3BP4A 1HXMA 4GG6F 4EI6A 5KEZA 5EU4A 4B97A 1LEKA 5I1HH 5MERB 1R3IH 2BVPB 4K71C 4U4IA 4PRPB 4ODVH 5J06A 4WW2A 4GRLB 2O4EA 4QRRB 4X4ME 2VL5B 4R4ND 4MAUH 5HYFA 1EZLA 1JVLA 1QSEB 1IAKB 4ZUUA 1WHPA 2DQIH 2VYRE 4ZMQA 3NJXA 5T8IA 1J9CT 1N5AB 4YN3A 5AQ0A 1D5BB 2BINA 4FQXA 3A47A 1VFAB 4ADGA 2EEFA 4NBZB 2UZXB 1MJJA 1HL9A 5GGUB 1LQBC 1VJSA 3H9HA 3DHMA 1CD1A 3EYVA 1X5ZA 4PWEA 3CWGA 2VZUA 3NH7L 1FRGL 2NW3B 3PP4L 1P4LA 3WXVH 1N5AA 3IAPA 3CMOH 3CXHJ 1WGVA 3MO1B 3O81A 4Z1PA 4WFGE 1A3ZA 4DK6A 1Q1PA 1GYUA 4PGBA 4U6YA 3HE7C 3FZUD 1KC5L 4TTDD 4P06A 3V5HA 3C60B 3GDCA 2DDQL 4J6IA 1KFGA 1GR7A 2XZQH 3OZLA 2VDKL 4YSUA 1U8QB 2DWSA 1MXDA 4BA8A 4KZDH 2ZYSA 4X5PA 1CL7L 3LQAL 1NEPA 1WE5A 5A1AA 5BOJA 4ZS6D 3GUTA 4OZIA 4NM4H 3DROA 3SDXF 3RTQB 2OJEA 2ADIA 1WA0X 3UBXB 3G9AB 5ISZB 2KHAA 4MSWB 3SD5A 2OA9A 5EU3B 3QNZB 3BEWB 4KVNH 4K3EH 3UDWC 4MJID 4FNQA 1MLBB 1WISA 1HXYA 5EIIA 4S0HA 3MRNB 3WXWL 4P2OD 4DUVA 3VQMA 1U95B 4N1EA 2R1YA 3PAUA 2ILLA 4NN7C 2AEWA 2F1EA 3DJZA 3VWJA 3BUDA 3P0YL 4I48A 1Z5LA 4XNAA 4J3OF 4U1KB 4N20A 5GS1C 4RVBA 3S4SA 4ANVA 1KB9J 4HUNB 2V9QA 2ZONA 2X4NA 2H1XA 1E4HA 2A6IA 5DJXB 5EB9A 3EBGA 3WY1A 3ZKNC 4FQXD 1ANUA 2VDQH 2YQ2A 1DVFB 3F6IA 4DP2X 5GS3A 2Y06L 4QO1B 1CLZH 4M7JH 2PR9A 4QHUA 3O9WB 3LQAC 2VDPH 1EFXD 2ZWLT 1HFUA 4G42A 5I8KL 1ETZB 2MWCA 1KT2B 3OR6B 4ODUA 4BYHA 3VXNA 3GO1L 1TQCC 2QQQA 4JHVA 4PM1A 4DK5A 3DOSA 3P3UA 1WWBX 1XCTB 1F86A 1BD2D 5DJXA 5HI4D 3V9CA 1EXUA 2XBZA 5ICYB 4Z95L 4NQXA 1TT6A 2RH0A 4R7XA 4AVHA 4B41A 2CJTA 1RSYA 1TNNA 2DKUA 1M6UA 2CRYA 3NRFA 4OM0L 5JIHA 1UWFA 4XMZA 4NHUB 1ZGLM 2A3TA 3NSDA 1AACA 5C08B 4Q14A 3VWJB 1P7QA 1H6EA 3VFUA 3KXFB 3N50A 4YQXL 4YZFE 2W0FB 2ORBL 5ACLA 3C12A 5ENWB 2DM4A 1O75A 2EIEA 1NGPH 3ZZSA 4WUUE 3MJ6A 3UG3A 1MJJB 3GSVA 1NEUA 3S36H 1RSFA 5CCKH 2Z31C 4KXDA 4GRMB 1A2YA 3CTTA 1OK0A 3AABA 1N3NA 5AAPA 2FJHB 2WVUA 1AZVA 3I9GH 4Y1AE 2F8OA 4W9FC 5DK0A 1RIHL 4PJBF 2R23A 3CFDB 4M8QA 3H4FA 4JW3A 1AZBA 4WSKA 1N64L 3OJMB 4R5VA 2YFOA 1T6VN 2X87A 4IIZA 3V6FB 4QRAA 3F01A 5I2IB 2IDUA 1NCCH 1Y18A 2Y1YA 3GKWL 1PKQB 4O02H 3BUYA 4NWUH 4TRPL 2VAAB 5F72S 3HAEG 5EOCH 3QJSB 1SVZA 3QFDB 5GS0H 1UOKA 1HE8A 4M6OL 2IAMC 3NYKA 2OTWB 5J12C 4GRLD 4QRRD 2CXKA 4WUKL 2FD6H 5T33L 4Q7DA 4ZMAT 4L8BA 4GS7B 4UBDD 5I75B 5SX4H 2VC2L 5AG8A 2GJ6A 2N7BA 1S9YA 1MHEA 2H8PA 3MV7E 4F8OA 3D0VB 2Q20A 1EBAA 4HA1A 4OQTH 5E6ID 4PD4J 4ZO9A 4KKQA 1OGAA 4K3JL 5D1QE 5K9KA 4JO4L 3GMNB 3FBQA 1N9PA 5DI8B 5MHSD 1UA6L 3MGTA 1BHGA 2XRAH 5AOZA 3ZE0B 1KBGL 2OI9C 3S96A 4NQVB 3U1PA 4EUPB 5AD0B 2ZG3A 3IDMB 2DJSA 2V5SA 2NR6D 4J7RA 3UAFA 3MR9A 2OL3H 2XICA 1MFCL 1RFDL 1UWXK 1BJ1J 3L54A 5B1KA 3MRQA 4MD0B 5IB5B 2VLME 1T3FA 1E5YA 4N0FA 1UVQB 2GIXA 3FF8A 4MRBA 1J0IA 3KGUA 4ZS7H 4UTBA 2QKSA 1Q8MA 4N8UA 5HHOD 3S37X 2DQ6A 5K1NA 4MA1C 3MV7A 3APCA 3MLRL 3S5LG 1XZWA 3O2DA 2JJSC 4M8RA 4I1NB 1RZFH 4KZEH 4BZ2A 1XDTT 4FC3E 1YY8A 3L2LA 4IBSA 1IB5A 1JTPA 4PN6A 3ZE1E 3MC0A 4NQEB 1EO7A 5KYUB 4PUBL 3CHXA 1GAFL 3IN2A 1WUZA 4XXCC 4RCAA 3WFDH 4BZ1L 3NH7H 2ZP0T 5T5NG 1XEUA 1SHSA 1EZVY 2LFGA 1DEDA 3NEEA 4XP1L 3MBXH 5HHNB 4ZODA 3RDTA 3D0LB 4YFLI 3UZEC 4O2FB 3C6SA 4Y1AA 4XP4H 1B9KA 3QFJB 4R7NA 2MQ3A 1T3FB 4BM7A 4GG6B 1DLHA 1JF6A 1U8PA 4HLJA 1TO4A 2AEQL 3ZPDA 1YEFH 2JK5A 3TV3H 3Q6GH 3B1UA 2AXGB 1AR1D 3H53A 3AROA 3WNLA 3L5WA 3L7EA 5E2TH 4KJPC 4ODHL 2R2EA 4GG6A 1U36A 1K5NB 3ARFC 4J3OG 4Z7QB 4FQCH 3GRBA 3WIFB 2APTA 3BFOA 3MLUH 1M9SA 4ZW3A 4QLRA 5D1XA 1BF5A 5LDSA 1CDHA 1DP0A 3IBEA 4QXUL 4IBQA 3SY6A 1FZMA 1XXDC 4LBEB 1NPJA 5CMAB 5EU6D 3O41A 3GBEA 1PIFA 4XI5D 2FQGA 5ETUA 5GGRA 5D1QA 4J8RA 1NCTA 1EPFA 2GBVA 3QZLA 3K6DA 1TO5A 1XIWD 3QRFM 2OMTB 2ZJSH 4JREB 4QRPE 4JKMA 2ADFH 1TF4A 4LT7A 4X8XA 3P0YH 5FV1L 3QG7H 1OLLA 3DVFA 5DUML 2IDCA 2QJDA 3MV9A 1CICD 3ZTDC 2J1WA 1MAML 2EE3A 2YBRA 5DJAB 4KVNL 2XBDA 3ZL1A 3ZKXB 43CAA 5KANG 1CD0A 1AZRA 4QTIH 5DYFA 5AW5B 3O3BB 5IBLC 1KXVA 3BH9A 5C6PB 4GYBA 5DLMH 3QQDA 3DX0A 3WFHB 4P23D 4F2MA 1F00I 2NQ3A 5BQ7B 2ZE0A 3ULVH 1EH9A 3TBBA 5I8KH 4NBXB 5AZ2L 2H1PL 3U0PB 4N0UB 2X88A 4AL8L 3WIIH 5C0FB 1PD1A 5JHBA 2Y2WA 3VQLA 1KLUA 4HHAB 4D0BA 4XN9A 4APQA 3BZFB 2HG5A 3VFTA 2QSCL 3OLEA 5IF0B 2FJHA 4CILA 4P5MB 3D0VA 3ARGC 3S7GA 3I2CL 2JIXD 5DD6A 3DV6A 3P3SA 1HE7A 4Y2DC 4YHKH 3OXSA 3ROLB 4Y8DC 1EA9C 3MTRA 2PWEA 2ZQKA 2GBUA 3B8YA 4F93B 3CH1B 2Y1AA 1M1SA 4BZ2H 3UJTH 5B3NA 2ITDA 4KFMA 1L9TA 4XN7A 3FOMA 4P4KD 5EEUA 2CGZA 1JPSH 4GXVH 1AHKA 2FX8H 2IFFH 4MBRA 1RIVL 3MUGB 4U6HB 2OAAA 2TAAA 4PRHA 3E80A 4R3SA 2JH2A 3VFPA 4BQBA 5CD5C 2IANE 2EH8L 1YDPB 4HUVA 5F7NC 1NIEA 4JO3H 1IBYA 1INDL 2N0KA 2XACC 4U1KA 1ML0A 3TCXA 5J9PA 5MEPB 2EDDA 5C08E 2VRKA 4M5ZH 5A40E 2QTVA 4QNPE 3EOTH 4B7LA 1FIEA 5E08L 1TZGL 5E4EC 5IHZB 3VWKB 3WXVL 2JB6A 1QUNB 1UA6H 1UD2A 5B38G 2EXSA 4W4OA 1M3IA 4R96B 2X10A 2L8AA 2GUYA 4XMKH 3QDHA 5LAPA 3V5KA 5CSZA 5CU9A 4OF6A 3IB4A 1KB5A 1A6ZB 1S78D 1SUJA 4K2UH 3U7YH 3CHOA 2ZSWB 3BZ4A 3QQ9C 3U6RB 1JZ2A 3T77B 3ARRA 2O5ZL 3WKQA 2EIKB 3G9VA 4P5SA 1QHPA 4NJ9L 3NDZE 3Q06A 4AW4A 3GSRA 1ACCA 4PJFB 2AABH 3NUKA 1KFAH 4J3WA 2IGFH 1S8DA 3ULVF 4Z8FL 1XHHA 4JX0A 2GSGA 4N90E 3TWYA 2VXUH 3Q8AA 2XQYG 1IRAY 1ZLVK 2FECI 1YUHB 2YZ1A 1KXHA 5GPRA 3BH8B 3TX4A 3K71B 2DMGA 4HCFA 2XHNA 3D18A 4BDVB 2BMKA 1P5UC 4KHTH 4XXWA 1ET7A 1HIML 3ZZQA 1DVYA 1VENA 2AW2A 5F7UA 2WK2A 4L4TE 4MXQD 4JGMA 2A0LD 1QFPA 1ZK9A 5J1AB 3QR0A 4ZFGL 2R0WL 4F7CA 3ARFA 1KLUB 4HHAA 3KE0A 1TTBA 1UWGL 2KPNA 3W9EB 2DLFH 1K5WA 3FQXA 1QRNE 2K3HA 4N2BA 1DBAH 2VIRA 3TZVB 4YHLH 3OLIA 4YDJA 3NIDE 4O9HH 2C1OA 2X40A 4HKJA 4IRSC 1FC1A 4NO5A 4O51B 5GJTH 4RQQA 5E4AA 5F1NA 4M3JA 4WW1B 2X4OA 3I84A 1Z1WA 5BS0D 4HEPA 2AJYH 1LMIA 1QW9A 3QZWA 2VT0A 5BVPH 2W59A 3D8MA 4OCRH 1IC5H 5D2NE 3P2DA 2XG5B 5DTFB 5I6PA 4PJ7B 5TD4A 1HU8A 3B2VL 1GOFA 3MLUL 4KOCA 4P23B 4G7QB 3UO1H 3ATFA 2FVNA 1TZAA 1ZK5A 2EC9U 3ULUD 3GXUB 2R1XB 2H0JA 3GWJA 3CHQA 2AV1A 3NABL 3UG4A 3FONA 4OR1A 3MCKB 5EOQL 4OLWL 5FR3A 4XNQA 5E2TL 6PCYA 5E2UH 1IT9H 1KJ2L 2BS8A 4AYFB 4PRPE 1OCWH 4RGNE 4UV4H 1IGIL 2BLFA 3ATBA 4HGKC 2YEZB 2I27N 5J11B 2EDRA 2C1PA 3MA7A 3T0EB 3UJIL 3VVVA 3LKQB 2J6EA 1HQ4B 5DUMH 4EIZC 1XH0A 2NY7H 2EKSA 4OCXL 1T1XA 1FCCA 1MH5B 4WK2B 3I6GB 2P46B 3ILPB 1E4WH 3UTTA 3FN3A 2Y7QA 3WLBA 1V7MH 4TNEA 3CDCA 4WDIB 5EO0B 1B6UA 2OCFD 3IJHB 4YIQA 3VE0A 1GPOL 3TH4T 4PMEA 4NO3A 1PFOA 1YYLH 4BCYA 1HZHH 2JCWA 4XO4A 2YWZA 2J6WA 4NPYB 2V7NB 1O6TA 2KZWA 1M71B 4N2GA 4P2RA 5F7WC 1HS6A 1QBBA 5H2BB 3VFSB 3QCVH 2ADFL 3MJ9H 4QYOA 3MRLA 1DQLL 2R69L 3VRLE 5EEYA 1I8MB 3QG7L 4X9HA 3ZJAA 3NSJA 3QI9C 5HGDB 1DO6A 2ICEC 3MRIA 4E41B 3M1CA 2CR3A 1QOKA 4IGBD 4K07A 2XKUA 5EUOB 1L0QA 4E9QA 1G7LB 1S5HA 1X9LA 1BZ9B 1YZZA 4XX1E 2CO6B 1ZSHA 1IX2A 3OZKA 5F7HA 5GRVK 1WH0A 1JGLH 3ECUA 4ZMOA 3DRTB 1QW8A 3RVUD 1P2CB 1I9RH 4ZPVB 5LLIC 3AY4C 3G6JF 3NTCL 4GI9A 5C0CD 2HT2C 1HESA 1WV7T 5IB5A 3F12B 3TGXA 1KIUB 3TNMB 5KVDL 5D4JA 4GP4B 4BRJA 1UWEH 3TM6A 3QRLA 5CINH 1MLCA 2CNYA 4LAQL 3D3VA 1IGTB 2ENSA 3O8XB 1QBLL 3DO4A 4S1DD 5EBMA 1TQVA 4OIBA 3MRLB 5JXAH 2RMNA 2APFA 3BP7A 2VLJB 2J88H 1NC2D 4NRYA 3MBXL 4K7PL 2AJ3B 1NIBA 1SNRA 1SDAB 2IH9A 4JHZA 4PJBE 5EC1B 4V1DA 1CDYA 3KG5A 2OW6A 5I19H 3ESUF 1J48A 3A4EA 4KGJA 1CBVL 5C2UB 4GRWH 2WWMC 4FQLL 3JTSB 1FH5H 2MQ0A 3LQZB 4XPAL 4YDNA 3QORD 3N9GL 4LSVL 1WK0A 2VDNB 5D72H 5DWPA 1CFSB 1JZHA 1YEDB 2N1TE 2CO3A 4OZGF 1JJUA 5K5YA 1OGAD 2ZSVA 4OZ4B 2WWOA 3SKNB 4MASA 4XMPH 1YY9C 1NDGB 2VLKD 1NUGA 2EDNA 2P8LB 4BQ9A 3Q8CA 4KK5C 5EDSA 1DE4A 1FCGA 3D1MC 1ILUA 1Y18B 3QCUH 1DSFL 3UERA 3HZKA 2AXFB 4FCHA 1BW8A 4LCCB 3WKYA 2FCBA 1UFGA 1E65A 3MJGX 4ACTA 3SPGA 1VERA 1WDAA 3B2PA 4PGDA 5EHFA 3VGAC 3ZO0A 4KHXH 2VN3A 2HTLC 1TJIH 2WV3A 1I9EA 4K4KA 4JJ5A 1JHKH 3TYFA 3ZTNL 5IM7A 1XB3A 5H94B 2X42A 5C09D 4LKCB 2QPEB 4GJTB 4Y2LA 5JORB 1N6VA 2XX0A 1SN5A 4HC1L 2BSDA 4DN4L 5FHAH 3FONB 4NUGL 5DJYB 2MTAA 3LIZL 3UABA 5GZOC 2XA8L 3MMEA 1BVKA 3V0WH 4LASL 4JRWA 4YLCA 2NUPA 1WGOA 2IADA 2MPAH 5ILTL 3GSWA 2BC4B 1VDGA 3BAKA 1HJBC 5C92A 2R0KL 1F1GA 2EXTA 3GPSA 4JN2B 5AB1A 1S9XA 3WJMB 4U33A 4KMQA 1YLBB 2AJZA 1GS8A 4UQCA 4PLKD 3BX7C 15C8L 3TOPA 2APWA 4X9GA 5EWIH 4HOWA 3EYFA 3HIZA 2LHAA 3ZE1F 5L2KD 1WAAE 1MI5D 3HFFA 1KDJA 3MLZL 2L4OA 2ICEB 3EH2A 4JFPB 3UTSA 5I26A 1IV8A 4OFQA 3KJ6H 1JUFB 2FR4A 3C09C 4JRFA 3OAUL 2ZUUA 1OTTD 4LLMB 4IOIB 4WWKB 2LLGA 1DQJA 2QPUA 2MPVA 1UT1A 1RZKH 4X0KB 3KBHE 4AEHL 1M7XA 4BINA 1L0PA 4S1QH 5KS9A 1M7DA 1KGCD 2EYSB 1Q0YH 1HK6A 5I1IH 5DJ0B 3VRLF 3WMQA 1DO5A 4HIPA 3MLVH 1AFVL 2XWBB 1ID2A 2GC7C 5KYWA 3EF7A 5JHLL 3KL0A 4YHIA 3D39E 1MLBA 5EIIB 1OM9A 3FFCA 2CUAA 5D9SB 2DQMA 1KJ2B 5LGYA 4EDWH 3REWB 4FEIA 2ESVB 4QTHB 2HG0A 3EH4B 4OZGB 3T0AA 2ROXA 3K4DA 5AOIA 5HHOA 3X13B 4Y16A 4MJIB 5EOQH 3ZGHA 5LGJA 2Z8RA 4JGNA 3T6XA 2KERA 4ABVA 1BQSA 4KBPA 1ZV9A 4RBPK 2XG4B 2ZXBA 1UXSA 3G6JE 4FXGA 1MW3A 4DW2L 5I1LB 1A8ZA 1TZGH 3EJJX 3BESR 3N1PC 1BVOA 3FUDA 1X5YA 1C8PA 2CRMA 4PBWD 2R69H 4PRIB 3VGGA 2OQJB 5JO5A 2QADB 5I24A 5K9QG 2G5UA 4YHZH 4PG9A 1J86A 1UM4H 4RFNB 1G7LA 3QYNA 1M4KA 5D7LA 5B38A 2ORBH 3Q01A 4FQXB 1LK3H 3VJ6A 2EECA 2HH0H 3FUHA 1LD9A 1T83A 2LW3A 2FLMA 1MVUA 5DD1L 3QXWA 1BBJB 2WKGA 2F74A 5CCKL 3GLZA 5ISZE 4ZMPA 4QRQB 5ICZB 4OUUB 5EBWA 2CLRA 3RWGA 4PCKA 1Q72H 1NAKL 2CHNA 1BFOB 4XX5A 2AERT 2VO8A 2BO0A 2BPBA 3OD3A 4EUPG 2BP8B 2WP3O 2F54D 3G6DH 3LS4L 5AVYB 2BOCA 1U4FA 3FYEB 1N6UA 3ECQA 4DCQA 3S3DB 3WUWB 5KVDH 5IK3B 4XXWC 4YAQA 5TJWK 3AXLA 1RUAL 1UWYA 4WI3A 1Q9LA 4K3DL 4HXBH 4U7KA 2JJSA 1QLRB 3SCMD 3M46A 4QXTA 5IUCA 4UB0L 5I9QB 3ZQXA 2BXZA 1FFNA 3CC5B 1VPOL 1G7PA 2K6WA 2B1AL 1XR9B 1SMAA 2E3VA 1CXHA 3WIHH 2QV2A 1D5IH 1DQML 2E9GA 3NCFB 5CEXA 4IM8A 5DZLA 4QXTB 1T1ZB 4HWZB 4QY8A 4L8SC 1KDIA 4JM2F 4NQSA 4PJ5D 2V5RA 3X12A 1A0QL 4NQCE 5C0RL 4FNPA 4BFFA 5F9WC 4W9JC 2Q3ZA 2MIZA 4QRRE 2F54E 5GS2H 1WBXB 1R3KB