2WGSA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor.
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
475
structure length
463
Chain Sequence
KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Inhibition of Mycobacterium Tuberculosis Glutamine Synthetase by Novel ATP-Competitive Inhibitors.
pubmed doi rcsb
molecule keywords GLUTAMINE SYNTHETASE 1
molecule tags Ligase
source organism Mycobacterium tuberculosis
total genus 150
structure length 463
sequence length 475
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2009-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2wgsA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 2wgsA02
1P50A 4BAXA 2WHIA 3B6RA 4RF7A 2D3AA 2QC8A 4S17A 2D3BA 4GVZA 1FPYA 3L2EB 4GW2A 4RF9A 3L2DA 1I0EA 3NG0A 1RL9A 4XYCA 4HPPA 4Z9MA 4AM1A 4LNOA 3JU6A 4Q2RA 5J9AA 4LNIA 1SD0A 1HTQA 5J99A 4LNFA 4S0RA 3ZXRA 1HTOA 4BG4B 1QK1A 2LGSA 1M15A 1VRPA 4LNKA 3DRBA 3JPZA 2J1QA 2OJWA 1F52A 2D3CA 2WGSA 4GW0A 1G0WA 4RF8A 4RF6A 1BG0A 1QH4A 1LGRA 2CRKA 3DREA 3JQ3A 4GVYA 1U6RA 3ZXVA 1CRKA 3M10A 2BVCA 4BG4A 2GLSA 2UU7A 1P52A 3JU5A 3L2EA 3FKYA 1F1HA 4BHLA 4ACFA 4LNNA
chains in the Genus database with same CATH superfamily
3TCAA 4L2YA 1A5RA 1SGHA 2FCMA 3GE8C 2HD5B 1IGCA 3UF8A 2YEPF 3VXWA 4IKGA 3L17A 2KXJA 2V1YA 1GNUA 3MHSD 3ZRFA 2BBCA 2C5LC 3AN1A 2CKHB 5CTRC 3V62A 1ZUD2 4MM3A 3R7QA 4RGNA 3GP7A 3PSEB 4MGIE 2RDHA 2YVCA 1FIQA 1T0RC 4ACFA 4PS7A 1ZPSA 1A70A 2AYOB 4GW2A 3PTFC 3ZRCA 3MTNB 3U7ZA 4USAA 4FADA 3QHTA 1YQBA 2LJIA 4HCPB 3SDLC 4KIKA 3QCAA 3NVZA 5LNK1 3ZXVA 4JL9A 5BMHA 1SE9A 3DBHB 2LD9A 3BYTB 4US9A 3VUWA 1NYRA 4MJSA 2E3TA 3A1QA 4KDIC 1GPXA 1HZ6A 2HDEA 4KGRA 4W9LA 4IW0A 2J1QA 4RGOS 1GG3A 3FILA 2DLBA 1NEKB 2K0PA 2LGDA 3APCA 1FFVA 2DX5B 3IVFA 1V4GA 3EC8A 3RUIB 2RDGA 3O13A 4GU2A 2FIFA 1ET9A 2IPKD 1TY0A 1JWMD 3TEXA 1XD3B 1J8CA 3A4RA 1C76A 1EUVB 4A6QA 3U8ZA 1N63A 2LVOA 4JWUC 1SE2A 3M10A 3MP9A 1UD7A 2V9HA 3AMZA 2MP2B 4OVUA 1K52A 4KZCA 4PT5A 2G4SA 2REXA 3VVWB 3OAWA 4M0WB 3SFDB 2KFJA 2Q5WD 1TS5A 1WFYA 1N5WA 1F2RC 1XLQA 4Q2JA 1L0XB 3QARA 4HXDA 1WM2A 1IGDA 2ICIA 2KDFB 2KMCA 4ZRJA 1PQSA 4A3PA 2IO1B 2Y3AA 1C4AA 4HLEA 4RF9A 1MVKA 3VH4B 5JXVA 4OVVA 1VDVA 3U2SC 3KUDB 4OZBA 1I4HA 2BS3B 1WXVA 2JPHA 2XBBC 4DXFA 1OQQA 5E6NA 1TTNA 2MBBB 3P1MA 1FNWA 4W9CA 1E8XA 4LTUA 2AQ3B 2N9PC 3N1ZC 3T8MA 1XQQA 4N6EB 3D32A 1JCKB 2DAFA 2WHIA 3L2EB 2MP2A 1BUIC 4IOIE 3ZTCA 1WWTA 2JY6A 2N9LA 1GUAB 2ONQA 3NY5A 3VUXA 3WAMA 3WIMA 4IM3A 3Q3JA 3ZUNA 4M01A 1ZDVA 2X38A 4ZHPA 3W1SA 2FUG1 3LVVA 2BKRB 3WANA 1E90A 2NBVB 3LB8C 4FJYA 2K9XA 1UELA 2QCZA 3BINA 2B3AA 3M95A 4YL8A 3PT2B 1JMLA 2W54A 1UH6A 2QEJC 3W5UB 3AEAB 2A4ZA 1UWXA 1YJJA 4WJOA 1T0SC 2O2VB 1K8RB 1XLNA 4GOCA 1B9RA 3BWUD 1P52A 3A9KB 1L4DB 4E71A 4A90A 1E0ZA 2QC8A 4RGMA 4WH4A 2KLGA 3C8YA 5D94A 4CQNA 3DDCB 1P1AA 4IM2A 1ROEA 1FNVA 1K50A 2J52A 2V4LA 3DVGY 2LGYA 4ZRKA 2MRPA 5TR5A 4TUUA 3N1YC 2XNAC 2LWPA 3HUIA 3ZQ4A 2YLMA 4C4VA 3DVNU 3B6RA 1SJED 2L00B 1E5WA 3A9JB 3KUZA 2K6DB 4TQ0A 1E7PB 2L83A 4NJ7A 4KX6B 1RL9A 4GMVA 3IT4B 3DBRB 2DNFA 4OZCA 5FR3A 3P4PB 2CHZA 3AXCA 2O2VA 4XDCA 2MJDA 3JVZX 3APFA 4PS3A 1F1HA 2D07B 2AQ1B 2AQ2B 3Q8AA 2K5PA 4W9KA 5L95C 3A9KA 3S2AA 4M8MA 1FFUA 4B6WA 4AS1A 1WM3A 4WJNA 1TS4A 3LVWA 1KLVA 4C80A 2RMMA 3O65B 2K22A 1QOBA 3UGBB 3VAWA 3AE8B 2ACZB 4ANUA 1FNUA 2BTEA 3ZLZA 2DYOA 1VCBA 4KVGB 3RNGC 3H8HA 2PIAA 1XO3A 4JLCA 2K8BA 3RZFA 1R4NI 5D6JB 3QWZB 2KJRA 2KTRB 4NY0A 3CSFA 4K7WA 2NTSA 3N20C 1R8GA 1JWAD 4EFOA 2UU7A 1KTKA 1PDXA 1UWMA 1OEYJ 5DCNA 3SHQA 4IDIA 2L05A 3L2DA 2KWCA 1QK1A 2PE6B 2ZZPB 1I7HA 1TKYA 4MACA 1Y56A 3HK0A 1NI2A 1I35A 4OHJA 2ZVNA 1LO5D 4W9HA 3PS6A 4ZHOA 1FD6A 5E6JA 1FPYA 3RYTA 2NVUI 4FJVB 4KGTA 2BYFA 2BYTA 2MWSB 2EKIA 1VRPA 1FEHA 1TJEA 4KKIA 1V49A 4WAAA 4WQMA 2KDBA 3IG5A 2KTRA 3PZDA 5I4DA 1N61A 2KYWA 2JRIB 2JRHA 4TQ1A 4BAXA 4ANXA 2QJLA 1UGMA 2INCC 3PPAA 3AB5A 3TSSA 2ZCBA 1CQVA 1D5MC 2DZMA 3NOBA 3EUB2 3DWMA 3OJ3A 1J0GA 1L4ZB 2G3QB 1IYFA 1E8ZA 2IO2B 2J7QB 3JSVB 4GGQA 2MBEA 5IAAC 4BKSD 2YEPB 2KWUB 1FRRA 4HDQA 2WS3B 2LZ6A 1UUPA 4S17A 4ZYNA 4BFRA 1H4RA 1KLGD 4B95A 2J53A 1OGWA 4X57B 4MGKE 1WGRA 4NZLB 2AL3A 5CX3A 2KDMA 2B76B 3ZGZA 3BYYB 3N9YC 3M3JA 2KQSA 1D5XC 3ZVVA 3K9PB 1RWSA 2Z59B 3IXSA 4JX1C 3U30A 3VQIA 2H89B 3DCGA 4II2B 3L08A 2GBNA 2I2YA 4AP4C 4BOZB 1LM8B 4JGHB 4GSWA 1IUEA 3DBLI 3KYDD 2L32A 4NQLB 1F2RI 3TJPA 1Q1OA 1MHXA 2WXFA 4W9IA 2LVPA 1BT0A 1EF5A 2XEWA 3VTUA 2GI9A 1T3QA 3NRZA 3JU5A 4WWOA 1RRBA 2RPQA 1WYWB 3I9V1 3JSVA 3ZDMC 2JX5A 2I1JA 3AE5B 4OVZA 3HM3A 2E6XA 1SIFA 1SE3A 5LLIA 2FCSA 1WGKA 1TIFA 4I6LB 3RNAC 2V3NA 2LUMA 5GMVA 3X0WA 4DXAB 2WDVB 3GZNI 4PS8A 1GAQB 3M62B 3NZUA 5IOIA 4JE3B 4K7SA 1V1OA 5EE3A 1J7AA 3B9JA 3HIZA 2WXIA 2NTTA 1GOZA 1GJZA 1R4MI 3VUYA 3OJ4B 2DYBA 2PKOA 3Q8EA 1JW9D 3AEEB 4CHKA 1SXTA 3AE3B 3ENEA 4LCDE 2VRRB 1HA5A 3SD5A 2QDFA 1SF0A 1SSNA 2PEAA 1KLUD 2FBWB 1WGHA 2KX0A 2D3BA 2ZVOA 1EF1A 1MG4A 4GB9A 4G11A 3Q69A 1JRUA 2G4DB 4XZ4A 1J19A 2L52A 3RZWC 4BZAA 4FULA 2NS5A 3QA8A 1WIAA 1ENFA 3AM9A 4NAWA 3DREA 2RGFA 2G45B 4KZ0A 5IP4D 1RM6C 4TMAB 2QIEB 1MFWA 1B1ZA 3PRMB 1PGXA 4ZOHC 4MT5A 1STEA 2KDIA 1JWBD 2I1KA 2KTFA 5DPWA 3DVNV 1EO6A 4HKZE 3V60A 4KGSA 3P42A 5D7GA 1K51A 5LXIB 3NVYA 1BMLC 1P0RA 2MBQA 2BPSA 4F1SA 1RYJA 2KANA 2NPTB 1VJKA 3Q3FA 3AECB 4XYCA 3PHXB 3FILB 5DPTA 2Z0DB 4JQWC 2LXAA 3AU5A 2BS2B 5IA7A 1JROA 3ECIA 5CHFA 1YN3A 4RF0A 1AN8A 2ZPYA 4DHZE 1FXTB 2INDC 2K3UA 3QK0A 2PJHA 2FUHB 1J7BA 2MQJA 3JU6A 1N60A 5AZGA 2MSED 3LDZE 1ISNA 3ALBA 1WE6A 2KLCA 3PVLA 5T8IA 2J0KA 4XWTA 1I4GA 2C7HA 3Q8FA 2I38A 1E8WA 2RSUA 3MC9A 3U52E 4A3OA 3H7SA 3UINB 1NVID 3B2GA 1FCCC 1V8CA 2JYEA 2NPTA 3L0WB 4B0EA 4KSKC 2KJ6A 3Q2AC 3NZTA 2JZ3B 4P1CC 4M8NA 4ARIA 4HJGE 2Z8LA 4K1RB 3HRDD 1WF9A 1X1MA 1SB3C 4F7ZA 4HPLB 2CHWA 2TSSA 5JHAA 4II3B 2WXMA 2OHFA 4RNAA 3SU8X 4YT0B 5IO9A 2V4IB 2GOWA 4XE0A 1SE4A 4KKJA 2ZNVC 1KH0A 3I5JC 4RGTA 1TKGA 1HEZE 2KN4A 2GBRA 2WXQA 4EZKA 1EWYC 1V80A 3KYCD 2Y5CA 2RD0A 5C2TB 5EDSA 4QAYA 4WJQA 3W1YA 4DK5A 1P7FA 3C19A 3R3MA 5G5HA 2GBMA 3AH7A 4HPMB 2KACA 2Y5PA 1BXTA 3ZDTA 5J2RA 4BG4B 2IY1B 1V86A 2L1AA 2FAZA 5D3IB 1E9MA 2W3SA 4XDDA 1N5XA 1AWDA 4ICVA 3Q8CA 4YSZB 3C0RB 1FMAD 3KH0A 1IP9A 1WXSA 1VD2A 1TS2A 1XCTL 2JXTA 1L6VA 4C4VB 3PHWB 5HKHA 4YTPB 3UQBA 5EE0A 1V5OA 2OEDA 4UDUC 1WRIA 1VR9A 3PV1A 4WWPA 2IDYA 3E56A 1EU4A 5C23A 1MI0A 3L16A 2WWZA 4REZA 2IGGA 3N3KB 3H7PB 1J7CA 3UQAA 3E9SA 1WR1A 4J3OD 3I57A 2LFIA 2DENB 1FCLA 2CU1A 1P98A 4RFBA 3IG3A 1TYGB 4J6IA 4BG4A 1G6JA 3V6EB 2V3SA 1ET6A 3P4RB 1UZXB 2D2QA 4LNNA 3VTWA 4ZRPA 1VZ6A 3RNFC 2KQ7A 3J9CA 2C60A 3R2TA 5MPOA 1EWCA 3NZ3A 4W9FA 4FBJB 4AJWA 3EFCA 1CJEA 4TV3A 3DWGC 2IGDA 1M94A 3TMPB 1Q5WB 2GB1A 4BOSC 4H2AA 3IAS1 3IT6B 1PYWD 4XX5A 3ML9A 4F8CB 1TS3A 2GRIA 3SR6A 1F77A 5KHOA 1YD8U 2BGFA 3UIOB 1VRAB 3T9LA 3AE9B 2ZW0A 1QF6A 3VTVA 5EE1A 2PPHA 1C4PA 4AQ7A 3IFWB 3QC8B 2KDEB 4RMAA 2X8XX 4FA6A 3KVFB 2LI5A 5BYRA 3LYYA 1C77A 1ZXIA 1GB4A 3AULA 3H7PA 4A9AA 4RM8A 4ITKA 4MH8A 2PLPA 2BS4B 2WXGA 2K8CA 3RN9C 2WU2B 3NVVA 2WX0A 2RPVA 1E8YA 2XK5B 2RR9A 4EE2A 1MG8A 2WXKA 4B9KA 4EZLA 4IWPA 2V0GA 3KQ4A 4RCOA 1WGDA 4C00A 3H6NA 1MJDA 3TIXA 3KUCB 1V5TA 1WGGA 4ANVA 4LJOB 5HG2A 2ZCCA 3W9CB 2WXLA 3W1SC 5IN7A 2UWQA 3CMMB 2BYEA 2N1VA 2VH2A 4ZYSA 1QOFA 2CS4A 3P4SB 3V05A 4DWFA 4WURA 1T0YA 4M02A 5J9AA 1I4PA 4MELA 1WSPA 2WDTB 1L6UA 2KN5A 1K53A 1ZXHA 1YN4A 2J0JA 2LJ5A 1WXQA 1P9DU 2XK5A 3MC8A 5C1ZA 1YJ1A 2PW9A 4HEA1 2A5UA 4HDOA 3DPDA 1C3TA 1KFYB 1KM7A 2KMAA 4EKUA 4NAMA 1UBIA 4YSXB 3AEBB 2IYDB 3BVZA 1R4NB 2N0SB 1ZOYB 4A20A 2WQYB 3TEWA 4FHKA 2K1FA 1GC7A 1FXIA 1IPGA 4RH6A 2LGSA 3PO0A 4HROA 2O6VB 1MPEA 4RF6A 1Z5SB 1WJUA 1Q0WB 4IG7B 1I42A 3GE3C 4DHJB 2ASQA 2KFKA 2AEHA 3X23A 3ZIMA 1NI3A 4LDTB 4I6PA 3PRZA 3HVZA 2LVQA 4IUMB 1IBXB 1G0WA 3RMKC 2IZVB 1D4BA 2CRKA 2KO3A 4IM0A 2GBKA 3AV8A 1YMHE 4K81A 4TKNA 3VRBB 1WMHB 1Z2MA 2NCNA 4KV2A 3N32A 5FKAC 1TT4A 2MHJA 1KF6B 4K7UA 3CIRB 4LNKA 2ZEQA 1NDDA 5LXHA 4G0NB 4YSYB 2D11A 2M8SA 2N7JA 4ASWC 2O6VA 4W9JA 3WAPA 4NPNA 2WLBA 4W9DA 3IAM1 2KX3A 2M19A 4IWOA 3I3TB 2OOBB 1YX5B 4NAWB 1WY8A 1HTQA 2K6QA 3EGRA 2UYZB 4FLHA 2VH1A 3TEZA 1T0QC 1WX7A 2CR5A 3NUHB 2JZPA 2WXHA 3L10B 3ETRA 3ZNZB 4PYZA 5JH5C 3RCZA 1IBXA 1C79A 4C56C 4BHLA 1EU3A 2FCQA 4OW0A 2J42A 4CO7A 5D2MB 5D3DA 4BVUC 2O6VD 1I0EA 3AU4A 2K8HA 1V6EA 1SBBB 1WMHA 3NVWA 1AW7A 4FXCA 3ZTDA 4RF8A 5C3JB 3PZ7A 4YXDB 5L83A 4WJPA 4DHJD 2LGXA 2GLSA 2HTHA 2JU6X 2MBHA 2WU5B 4LDTD 1FM0D 2WXJA 1E6EB 2LHEA 4BKTA 5AZHA 3DBLB 4WIPA 3ZJUA 3NG0A 1OQRA 4HCNB 4GLSC 3B08A 2N9EB 1WH3A 4AUQC 1GC6A 1NBFC 3ZXRA 3L13A 2KT7A 2GWCA 3EHVA 2DHZA 1QILA 4G3XB 2L7RA 2QILA 1YNTE 1I4QA 1Y8RC 2EELA 4MH0E 4G50A 1L5PA 4LLGM 2WNMA 1AARA 3R7RA 2AL6A 2XN9C 3B0AA 1V97A 3GZNB 1QQRA 3TBLD 2BW2A 2D3CA 2L3ZA 1OTRB 1WZ3A 2HE7A 3P4QB 1HQRD 2EMTA 1KRHA 4GIVA 5AUIA 1R4MB 5G2NA 2JWUA 3OLMD 2D3AA 5DPRA 1T6BX 3LN7A 1WX8A 3DBHI 3WA0A 4HVBA 2LXCA 4AM1A 3PZ8A 3VDZA 3L54A 3MJ5A 1RFAA 1OEYA 1QLBB 2LGIA 3MC0B 4W9EA 4GDKB 3Q3OC 2WYQA 3NJTA 1WI0A 2MLBA 3ONSA 1VZ8A 3IBEA 2KVZA 3RT3B 1CK1A 2CJOA 2KNBA 1T5XD 1YJIA 4ARCA 1TZOA 1WXAA 4L23A 2BVCA 2DZIA 3VR9B 3WAOA 4DBGA 4A55A 4MSQB 2CJNA 1NYQA 4GVZA 1HXYD 1RLFA 2PMVA 1QT9A 2LEKA 3LXFA 4C7YA 1D6EC 3TL5A 4NJ6A 2C7NB 3T3OA 3CWIA 1BG0A 1Q10A 3BVGA 3ZNGC 1C78A 4HK2A 1OQYA 2INPE 4A8XC 5G55A 2QMTA 1L0YB 5AEKB 2MJEA 2M0AA 1FO4A 4Q2RA 4LNIA 2C7MB 3ZYYX 1ZDXA 4GDKA 5IKCM 2JXXA 1LXDA 3L4PA 1C4CA 2BWES 1H8CA 2K39A 4TSSA 4ZRQA 3DHHC 4OZAA 3JYUA 3EA6A 2N7EA 4MGZE 2CU3A 4NQKE 2KJHB 5E6OA 3FAHA 4E3CA 1P50A 4IWQA 1TY2A 4N59A 5HHDG 1JQ4A 3IG8A 3AEDB 3NS1A 3Q3NC 3DRBA 1U4AA 1D3ZA 3KW5B 5JZEB 2PTLA 3RNBC 3LN6A 1MHHE 1TKEA 1V1PB 1XCQL 3BK1A 3TUOA 1P3QU 1ZE3D 4FN2A 3U7DA 3N30A 1M4VA 1UF0A 3PREA 5BMIA 1YN5A 3I63C 5BYQA 2SAKA 1GB1A 4DXGA 3H9DA 5E6PA 2D3GA 3EECA 2NBWB 2KWVB 2KC1A 1V81A 3GOEA 3AI5A 4M00A 1CRKA 2LMCA 4DHZB 4MGYE 4D2KA 4GN1A 2JT4B 1WRDB 4N58A 1KJTA 1P7EA 2JYTA 3UIPB 4KDLB 1TBEA 4LNFA 2NR2A 4HRSA 1HZ5A 4WWMA 2J4XA 5GXGB 1DOYA 2JUOA 4W9GA 4BKGA 4JWSC 1N62A 3BVMA 3QIJA 2WDQB 4BBNF 4BBNC 1V2YA 4WWNA 1V1PA 3QX1A 2KWDA 1YX6B 4FHJA 3AE7B 4ICUA 4EZJA 2QSDA 4LNOA 3AE2B 3MFGA 1QOAA 4MEMA 4M0WA 3DBRI 3U4EG 3Q6BA 1V9JA 2MCNB 2FCNA 2MX2A 3CSTA 1DGJA 5HI1A 3HHMA 3VFKA 3PRPB 1SEBD 3FKYA 2R2QA 2JVCA 2BB6A 2V3PA 3AE6B 1XEEA 1LQBA 4ZDVA 4DDGD 4HWIB 3AE4B 3SEBA 3Q14C 2OJWA 1F52A 4PYUA 1VZ7A 2ZW1A 3M63B 2KOXA 2GBJA 3B1LX 3OWEB 1JRPA 2BWFA 1VLBA 2MBOA 2PVGC 3DQVA 5KHQA 1C1YB 5BYSA 2KAJA 3WALA 5BMGA 3A33B 3RULA 1E7VA 1I4RA 4US8A 2INNE 3PLUA 2JZZA 5HFYA 4E74A 1XF5L 2KQ4X 1R7SA 1HTOA 1D5ZC 3L2EA 2MW5A 2KKCA 4JIOU 2EMSA 2DZKA 4DDID 1NENB 4HKQA 2MA9B 3ZNID 3ZKJC 4WAFA 2WX1A 2CHXA 2D32A 4RF7A 3IHPC 1WJ6A 1E10A 1UNSA 1EM7A 3ZJTA 2IJ0A 5CHVC 2WXNA 3KWVA 2C9WB 1RFKA 5BO4B 2M17A 2NBUA 2DAJA 2JQRB 1L0VB 1TT5B 2N7DA 2KVRA 1VA6A 5DPSA 3Q3MC 1WYGA 3HM6X 2BKFA 2JWZA 1ESFA 2KMMA 3MJWA 3ML8A 2L76A 3EFUA 2BB5A 4LK0M 1ZP0B 1LFDA 5TSSA 4XWWA 1SD0A 4S0RA 2WP9B 2MH7A 5J17A 4AJYB 2G1EA 1ZW7A 2KD0A 4RF1A 3VRAB 2M1MA 3UI3A 2LRWA 2DWQA 3DHGC 3RD2A 3DHIC 2AX5A 2LUEA 1CMXB 2L0TA 4P1BC 3AEFB 2PE9A 3H1UA 3R66C 2IO0B 3KLSX 3BY4B 4MSMB 3A9JA 1C9FA 3JPZA 4XGAB 1YQ4B 5AUKA 2Z0EB 5JHBA 3VH3B 2GWDA 2PVOD 4YTNB 3W2DA 2KFKB 2MEKA 4R3DA 2DBYA 4XC2A 2HJ8A 2BT6A 4YWGG 1DOIA 1WZ0A 3BIID 2LASA 3QJZA 4FJZA 1FXAA 5CHWA 1WXMA 2FNJB 1M15A 3HVDA 4K3CA 4EUTA 4P16A 4GDLB 2G9HD 4GVYA 2BF8B 1S3SG 5G5GA 3V3XA 3R2IA 1ZKHA 2K25A 2RDBC 1L7YA 1CZPA 3DOWA 1ZGUB 3FC4A 4BKSA 1DYQA 5FR6A 2BYVE 3NZSA 4EEWA 1QZEA 3RPFC 3NHEB 1UGJA 2JF5A 1ACCA 1PFDA 3DBSA 3DVGX 2GMIC 2JSVX 2L8JA 4HPPA 4RM9A 3RNEC 4JPSA 1F9JA 3JW0X 2IBIB 1XT9B 3ZNHB 2KK8A 2N9XA 4MDKE 3PLVA 4YTMB 4P6VF 1WE7A 2VZKB 3CF6E 3WCQA 2HTME 2N1WA 5H92C 2KHWB 1XLOA 3BZDB 1WJ4A 3T3NA 3AE1B 2W82A 1L2NA 2AWTA 2ZPNA 3LJ3A 1OFFA 2WXPA 4GDLA 1PGAA 2LHDA 3BK2A 4CYEA 1QOGA 4URKA 3V6CB 1SIJA 1PUTA 4PK1A 4IC7B 5AZFA 2QHOA 4C7ZA 3A4SC 3AEGB 5H8YE 1HE8A 2DZJA 2Y5BB 4AOFA 3APDA 1QKZA 3VHTC 4O1NA 4ZRIA 1YOVB 1E7UA 4I6NB 2SEBD 3RNCC 1JALA 3ZW3A 2WGSA 3QAQA 3ABVB 1RAXA 2IY0B 2W3RA 3P63A 4K3BA 2M56B 3P2BA 3ZO5B 2FIDA 4GXBA 3RI7C 1WR6E 1YIWA 2WDRB 5EE9A 3MHZA 2WXRA 2W9NA 1TZ1A 2DYMA 3K9OB 5J99A 1WJNA 4ANWA 2IO3B 2W55A 2N4FA 2ZNVB 1U6RA 2R2OA 3QQ8B 1F0ZA 2ZJDA 2M0XA 4P7IA 2HJ1A 4NJCA 2KC2A 3KWLA 1WX9A 5FK9C 4Z9MA 4N9F4 2VZKD 1YQ3B 3PGEA 3NS8A 2BQQA 3VR8B 4HJKA 2EKEC 3R8BA 1QH4A 1LGRA 2M4NA 3W5VB 3OG5A 5J18A 1XXGA 4LJPB 1KOTA 3N1XC 1DOXA 2NMQA 1PGBA 1WGYA 2KZRA 4NNJB 4AWJA 4MM3B 1UBQA 4DQOC 2FE8A 2L0FA 1S1QB 1JWSD 3RFZB 1I4XA 3ZJVA 3JQ3A 3GS2A 1XLPA 2IGHA 2J0MA 1FRDA 3GB1A 3Q8BA 4L1BA 4B0MA 2MJ3A 3TEYA 2D5GA 2LRUA 3URYA 1AYFA 4KSLC 3B2FA 2H88B 4KIKB 2WXOA 1N6ZA 3V61A 4GW0A 2N9KA 4EOYA 1SJHD 2D10A 2ON8A 3SFEB 4WQOB 2D33A 4MJSB 3A1QB 2R61A 2OJRA 1JWUD 1TGZB
chains in the Genus database with same CATH topology
1P50A 4BAXA 2WHIA 3B6RA 4RF7A 2D3AA 2QC8A 4S17A 2D3BA 4GVZA 1FPYA 3L2EB 4GW2A 4RF9A 3L2DA 1I0EA 3NG0A 1RL9A 4XYCA 4HPPA 4Z9MA 4AM1A 4LNOA 3JU6A 4Q2RA 5J9AA 4LNIA 1SD0A 1HTQA 5J99A 4LNFA 4S0RA 3ZXRA 1HTOA 4BG4B 1QK1A 2LGSA 1M15A 1VRPA 4LNKA 3DRBA 3JPZA 2J1QA 2OJWA 1F52A 2D3CA 2WGSA 4GW0A 1G0WA 4RF8A 4RF6A 1BG0A 1QH4A 1LGRA 2CRKA 3DREA 3JQ3A 4GVYA 1U6RA 3ZXVA 1CRKA 3M10A 2BVCA 4BG4A 2GLSA 2UU7A 1P52A 3JU5A 3L2EA 3FKYA 1F1HA 4BHLA 4ACFA 4LNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P50 A;  4BAX A;  2WHI A;  3B6R A;  4RF7 A;  2D3A A;  2QC8 A;  4S17 A;  2D3B A;  4GVZ A;  1FPY A;  3L2E B;  4GW2 A;  4RF9 A;  3L2D A;  1I0E A;  3NG0 A;  1RL9 A;  4XYC A;  4HPP A;  4Z9M A;  4AM1 A;  4LNO A;  3JU6 A;  4Q2R A;  5J9A A;  4LNI A;  1SD0 A;  1HTQ A;  5J99 A;  4LNF A;  4S0R A;  3ZXR A;  1HTO A;  4BG4 B;  1QK1 A;  2LGS A;  1M15 A;  1VRP A;  4LNK A;  3DRB A;  3JPZ A;  2J1Q A;  2OJW A;  1F52 A;  2D3C A;  2WGS A;  4GW0 A;  1G0W A;  4RF8 A;  4RF6 A;  1BG0 A;  1QH4 A;  1LGR A;  2CRK A;  3DRE A;  3JQ3 A;  4GVY A;  1U6R A;  3ZXV A;  1CRK A;  3M10 A;  2BVC A;  4BG4 A;  2GLS A;  2UU7 A;  1P52 A;  3JU5 A;  3L2E A;  3FKY A;  1F1H A;  4BHL A;  4ACF A;  4LNN A; 
#chains in the Genus database with same CATH topology
 3TCA A;  4L2Y A;  1A5R A;  1SGH A;  2FCM A;  3GE8 C;  2HD5 B;  1IGC A;  3UF8 A;  2YEP F;  3VXW A;  4IKG A;  3L17 A;  2KXJ A;  2V1Y A;  1GNU A;  3MHS D;  3ZRF A;  2BBC A;  2C5L C;  3AN1 A;  2CKH B;  5CTR C;  3V62 A;  1ZUD 2;  4MM3 A;  3R7Q A;  4RGN A;  3GP7 A;  3PSE B;  4MGI E;  2RDH A;  2YVC A;  1FIQ A;  1T0R C;  4ACF A;  4PS7 A;  1ZPS A;  1A70 A;  2AYO B;  4GW2 A;  3PTF C;  3ZRC A;  3MTN B;  3U7Z A;  4USA A;  4FAD A;  3QHT A;  1YQB A;  2LJI A;  4HCP B;  3SDL C;  4KIK A;  3QCA A;  3NVZ A;  5LNK 1;  3ZXV A;  4JL9 A;  5BMH A;  1SE9 A;  3DBH B;  2LD9 A;  3BYT B;  4US9 A;  3VUW A;  1NYR A;  4MJS A;  2E3T A;  3A1Q A;  4KDI C;  1GPX A;  1HZ6 A;  2HDE A;  4KGR A;  4W9L A;  4IW0 A;  2J1Q A;  4RGO S;  1GG3 A;  3FIL A;  2DLB A;  1NEK B;  2K0P A;  2LGD A;  3APC A;  1FFV A;  2DX5 B;  3IVF A;  1V4G A;  3EC8 A;  3RUI B;  2RDG A;  3O13 A;  4GU2 A;  2FIF A;  1ET9 A;  2IPK D;  1TY0 A;  1JWM D;  3TEX A;  1XD3 B;  1J8C A;  3A4R A;  1C76 A;  1EUV B;  4A6Q A;  3U8Z A;  1N63 A;  2LVO A;  4JWU C;  1SE2 A;  3M10 A;  3MP9 A;  1UD7 A;  2V9H A;  3AMZ A;  2MP2 B;  4OVU A;  1K52 A;  4KZC A;  4PT5 A;  2G4S A;  2REX A;  3VVW B;  3OAW A;  4M0W B;  3SFD B;  2KFJ A;  2Q5W D;  1TS5 A;  1WFY A;  1N5W A;  1F2R C;  1XLQ A;  4Q2J A;  1L0X B;  3QAR A;  4HXD A;  1WM2 A;  1IGD A;  2ICI A;  2KDF B;  2KMC A;  4ZRJ A;  1PQS A;  4A3P A;  2IO1 B;  2Y3A A;  1C4A A;  4HLE A;  4RF9 A;  1MVK A;  3VH4 B;  5JXV A;  4OVV A;  1VDV A;  3U2S C;  3KUD B;  4OZB A;  1I4H A;  2BS3 B;  1WXV A;  2JPH A;  2XBB C;  4DXF A;  1OQQ A;  5E6N A;  1TTN A;  2MBB B;  3P1M A;  1FNW A;  4W9C A;  1E8X A;  4LTU A;  2AQ3 B;  2N9P C;  3N1Z C;  3T8M A;  1XQQ A;  4N6E B;  3D32 A;  1JCK B;  2DAF A;  2WHI A;  3L2E B;  2MP2 A;  1BUI C;  4IOI E;  3ZTC A;  1WWT A;  2JY6 A;  2N9L A;  1GUA B;  2ONQ A;  3NY5 A;  3VUX A;  3WAM A;  3WIM A;  4IM3 A;  3Q3J A;  3ZUN A;  4M01 A;  1ZDV A;  2X38 A;  4ZHP A;  3W1S A;  2FUG 1;  3LVV A;  2BKR B;  3WAN A;  1E90 A;  2NBV B;  3LB8 C;  4FJY A;  2K9X A;  1UEL A;  2QCZ A;  3BIN A;  2B3A A;  3M95 A;  4YL8 A;  3PT2 B;  1JML A;  2W54 A;  1UH6 A;  2QEJ C;  3W5U B;  3AEA B;  2A4Z A;  1UWX A;  1YJJ A;  4WJO A;  1T0S C;  2O2V B;  1K8R B;  1XLN A;  4GOC A;  1B9R A;  3BWU D;  1P52 A;  3A9K B;  1L4D B;  4E71 A;  4A90 A;  1E0Z A;  2QC8 A;  4RGM A;  4WH4 A;  2KLG A;  3C8Y A;  5D94 A;  4CQN A;  3DDC B;  1P1A A;  4IM2 A;  1ROE A;  1FNV A;  1K50 A;  2J52 A;  2V4L A;  3DVG Y;  2LGY A;  4ZRK A;  2MRP A;  5TR5 A;  4TUU A;  3N1Y C;  2XNA C;  2LWP A;  3HUI A;  3ZQ4 A;  2YLM A;  4C4V A;  3DVN U;  3B6R A;  1SJE D;  2L00 B;  1E5W A;  3A9J B;  3KUZ A;  2K6D B;  4TQ0 A;  1E7P B;  2L83 A;  4NJ7 A;  4KX6 B;  1RL9 A;  4GMV A;  3IT4 B;  3DBR B;  2DNF A;  4OZC A;  5FR3 A;  3P4P B;  2CHZ A;  3AXC A;  2O2V A;  4XDC A;  2MJD A;  3JVZ X;  3APF A;  4PS3 A;  1F1H A;  2D07 B;  2AQ1 B;  2AQ2 B;  3Q8A A;  2K5P A;  4W9K A;  5L95 C;  3A9K A;  3S2A A;  4M8M A;  1FFU A;  4B6W A;  4AS1 A;  1WM3 A;  4WJN A;  1TS4 A;  3LVW A;  1KLV A;  4C80 A;  2RMM A;  3O65 B;  2K22 A;  1QOB A;  3UGB B;  3VAW A;  3AE8 B;  2ACZ B;  4ANU A;  1FNU A;  2BTE A;  3ZLZ A;  2DYO A;  1VCB A;  4KVG B;  3RNG C;  3H8H A;  2PIA A;  1XO3 A;  4JLC A;  2K8B A;  3RZF A;  1R4N I;  5D6J B;  3QWZ B;  2KJR A;  2KTR B;  4NY0 A;  3CSF A;  4K7W A;  2NTS A;  3N20 C;  1R8G A;  1JWA D;  4EFO A;  2UU7 A;  1KTK A;  1PDX A;  1UWM A;  1OEY J;  5DCN A;  3SHQ A;  4IDI A;  2L05 A;  3L2D A;  2KWC A;  1QK1 A;  2PE6 B;  2ZZP B;  1I7H A;  1TKY A;  4MAC A;  1Y56 A;  3HK0 A;  1NI2 A;  1I35 A;  4OHJ A;  2ZVN A;  1LO5 D;  4W9H A;  3PS6 A;  4ZHO A;  1FD6 A;  5E6J A;  1FPY A;  3RYT A;  2NVU I;  4FJV B;  4KGT A;  2BYF A;  2BYT A;  2MWS B;  2EKI A;  1VRP A;  1FEH A;  1TJE A;  4KKI A;  1V49 A;  4WAA A;  4WQM A;  2KDB A;  3IG5 A;  2KTR A;  3PZD A;  5I4D A;  1N61 A;  2KYW A;  2JRI B;  2JRH A;  4TQ1 A;  4BAX A;  4ANX A;  2QJL A;  1UGM A;  2INC C;  3PPA A;  3AB5 A;  3TSS A;  2ZCB A;  1CQV A;  1D5M C;  2DZM A;  3NOB A;  3EUB 2;  3DWM A;  3OJ3 A;  1J0G A;  1L4Z B;  2G3Q B;  1IYF A;  1E8Z A;  2IO2 B;  2J7Q B;  3JSV B;  4GGQ A;  2MBE A;  5IAA C;  4BKS D;  2YEP B;  2KWU B;  1FRR A;  4HDQ A;  2WS3 B;  2LZ6 A;  1UUP A;  4S17 A;  4ZYN A;  4BFR A;  1H4R A;  1KLG D;  4B95 A;  2J53 A;  1OGW A;  4X57 B;  4MGK E;  1WGR A;  4NZL B;  2AL3 A;  5CX3 A;  2KDM A;  2B76 B;  3ZGZ A;  3BYY B;  3N9Y C;  3M3J A;  2KQS A;  1D5X C;  3ZVV A;  3K9P B;  1RWS A;  2Z59 B;  3IXS A;  4JX1 C;  3U30 A;  3VQI A;  2H89 B;  3DCG A;  4II2 B;  3L08 A;  2GBN A;  2I2Y A;  4AP4 C;  4BOZ B;  1LM8 B;  4JGH B;  4GSW A;  1IUE A;  3DBL I;  3KYD D;  2L32 A;  4NQL B;  1F2R I;  3TJP A;  1Q1O A;  1MHX A;  2WXF A;  4W9I A;  2LVP A;  1BT0 A;  1EF5 A;  2XEW A;  3VTU A;  2GI9 A;  1T3Q A;  3NRZ A;  3JU5 A;  4WWO A;  1RRB A;  2RPQ A;  1WYW B;  3I9V 1;  3JSV A;  3ZDM C;  2JX5 A;  2I1J A;  3AE5 B;  4OVZ A;  3HM3 A;  2E6X A;  1SIF A;  1SE3 A;  5LLI A;  2FCS A;  1WGK A;  1TIF A;  4I6L B;  3RNA C;  2V3N A;  2LUM A;  5GMV A;  3X0W A;  4DXA B;  2WDV B;  3GZN I;  4PS8 A;  1GAQ B;  3M62 B;  3NZU A;  5IOI A;  4JE3 B;  4K7S A;  1V1O A;  5EE3 A;  1J7A A;  3B9J A;  3HIZ A;  2WXI A;  2NTT A;  1GOZ A;  1GJZ A;  1R4M I;  3VUY A;  3OJ4 B;  2DYB A;  2PKO A;  3Q8E A;  1JW9 D;  3AEE B;  4CHK A;  1SXT A;  3AE3 B;  3ENE A;  4LCD E;  2VRR B;  1HA5 A;  3SD5 A;  2QDF A;  1SF0 A;  1SSN A;  2PEA A;  1KLU D;  2FBW B;  1WGH A;  2KX0 A;  2D3B A;  2ZVO A;  1EF1 A;  1MG4 A;  4GB9 A;  4G11 A;  3Q69 A;  1JRU A;  2G4D B;  4XZ4 A;  1J19 A;  2L52 A;  3RZW C;  4BZA A;  4FUL A;  2NS5 A;  3QA8 A;  1WIA A;  1ENF A;  3AM9 A;  4NAW A;  3DRE A;  2RGF A;  2G45 B;  4KZ0 A;  5IP4 D;  1RM6 C;  4TMA B;  2QIE B;  1MFW A;  1B1Z A;  3PRM B;  1PGX A;  4ZOH C;  4MT5 A;  1STE A;  2KDI A;  1JWB D;  2I1K A;  2KTF A;  5DPW A;  3DVN V;  1EO6 A;  4HKZ E;  3V60 A;  4KGS A;  3P42 A;  5D7G A;  1K51 A;  5LXI B;  3NVY A;  1BML C;  1P0R A;  2MBQ A;  2BPS A;  4F1S A;  1RYJ A;  2KAN A;  2NPT B;  1VJK A;  3Q3F A;  3AEC B;  4XYC A;  3PHX B;  3FIL B;  5DPT A;  2Z0D B;  4JQW C;  2LXA A;  3AU5 A;  2BS2 B;  5IA7 A;  1JRO A;  3ECI A;  5CHF A;  1YN3 A;  4RF0 A;  1AN8 A;  2ZPY A;  4DHZ E;  1FXT B;  2IND C;  2K3U A;  3QK0 A;  2PJH A;  2FUH B;  1J7B A;  2MQJ A;  3JU6 A;  1N60 A;  5AZG A;  2MSE D;  3LDZ E;  1ISN A;  3ALB A;  1WE6 A;  2KLC A;  3PVL A;  5T8I A;  2J0K A;  4XWT A;  1I4G A;  2C7H A;  3Q8F A;  2I38 A;  1E8W A;  2RSU A;  3MC9 A;  3U52 E;  4A3O A;  3H7S A;  3UIN B;  1NVI D;  3B2G A;  1FCC C;  1V8C A;  2JYE A;  2NPT A;  3L0W B;  4B0E A;  4KSK C;  2KJ6 A;  3Q2A C;  3NZT A;  2JZ3 B;  4P1C C;  4M8N A;  4ARI A;  4HJG E;  2Z8L A;  4K1R B;  3HRD D;  1WF9 A;  1X1M A;  1SB3 C;  4F7Z A;  4HPL B;  2CHW A;  2TSS A;  5JHA A;  4II3 B;  2WXM A;  2OHF A;  4RNA A;  3SU8 X;  4YT0 B;  5IO9 A;  2V4I B;  2GOW A;  4XE0 A;  1SE4 A;  4KKJ A;  2ZNV C;  1KH0 A;  3I5J C;  4RGT A;  1TKG A;  1HEZ E;  2KN4 A;  2GBR A;  2WXQ A;  4EZK A;  1EWY C;  1V80 A;  3KYC D;  2Y5C A;  2RD0 A;  5C2T B;  5EDS A;  4QAY A;  4WJQ A;  3W1Y A;  4DK5 A;  1P7F A;  3C19 A;  3R3M A;  5G5H A;  2GBM A;  3AH7 A;  4HPM B;  2KAC A;  2Y5P A;  1BXT A;  3ZDT A;  5J2R A;  4BG4 B;  2IY1 B;  1V86 A;  2L1A A;  2FAZ A;  5D3I B;  1E9M A;  2W3S A;  4XDD A;  1N5X A;  1AWD A;  4ICV A;  3Q8C A;  4YSZ B;  3C0R B;  1FMA D;  3KH0 A;  1IP9 A;  1WXS A;  1VD2 A;  1TS2 A;  1XCT L;  2JXT A;  1L6V A;  4C4V B;  3PHW B;  5HKH A;  4YTP B;  3UQB A;  5EE0 A;  1V5O A;  2OED A;  4UDU C;  1WRI A;  1VR9 A;  3PV1 A;  4WWP A;  2IDY A;  3E56 A;  1EU4 A;  5C23 A;  1MI0 A;  3L16 A;  2WWZ A;  4REZ A;  2IGG A;  3N3K B;  3H7P B;  1J7C A;  3UQA A;  3E9S A;  1WR1 A;  4J3O D;  3I57 A;  2LFI A;  2DEN B;  1FCL A;  2CU1 A;  1P98 A;  4RFB A;  3IG3 A;  1TYG B;  4J6I A;  4BG4 A;  1G6J A;  3V6E B;  2V3S A;  1ET6 A;  3P4R B;  1UZX B;  2D2Q A;  4LNN A;  3VTW A;  4ZRP A;  1VZ6 A;  3RNF C;  2KQ7 A;  3J9C A;  2C60 A;  3R2T A;  5MPO A;  1EWC A;  3NZ3 A;  4W9F A;  4FBJ B;  4AJW A;  3EFC A;  1CJE A;  4TV3 A;  3DWG C;  2IGD A;  1M94 A;  3TMP B;  1Q5W B;  2GB1 A;  4BOS C;  4H2A A;  3IAS 1;  3IT6 B;  1PYW D;  4XX5 A;  3ML9 A;  4F8C B;  1TS3 A;  2GRI A;  3SR6 A;  1F77 A;  5KHO A;  1YD8 U;  2BGF A;  3UIO B;  1VRA B;  3T9L A;  3AE9 B;  2ZW0 A;  1QF6 A;  3VTV A;  5EE1 A;  2PPH A;  1C4P A;  4AQ7 A;  3IFW B;  3QC8 B;  2KDE B;  4RMA A;  2X8X X;  4FA6 A;  3KVF B;  2LI5 A;  5BYR A;  3LYY A;  1C77 A;  1ZXI A;  1GB4 A;  3AUL A;  3H7P A;  4A9A A;  4RM8 A;  4ITK A;  4MH8 A;  2PLP A;  2BS4 B;  2WXG A;  2K8C A;  3RN9 C;  2WU2 B;  3NVV A;  2WX0 A;  2RPV A;  1E8Y A;  2XK5 B;  2RR9 A;  4EE2 A;  1MG8 A;  2WXK A;  4B9K A;  4EZL A;  4IWP A;  2V0G A;  3KQ4 A;  4RCO A;  1WGD A;  4C00 A;  3H6N A;  1MJD A;  3TIX A;  3KUC B;  1V5T A;  1WGG A;  4ANV A;  4LJO B;  5HG2 A;  2ZCC A;  3W9C B;  2WXL A;  3W1S C;  5IN7 A;  2UWQ A;  3CMM B;  2BYE A;  2N1V A;  2VH2 A;  4ZYS A;  1QOF A;  2CS4 A;  3P4S B;  3V05 A;  4DWF A;  4WUR A;  1T0Y A;  4M02 A;  5J9A A;  1I4P A;  4MEL A;  1WSP A;  2WDT B;  1L6U A;  2KN5 A;  1K53 A;  1ZXH A;  1YN4 A;  2J0J A;  2LJ5 A;  1WXQ A;  1P9D U;  2XK5 A;  3MC8 A;  5C1Z A;  1YJ1 A;  2PW9 A;  4HEA 1;  2A5U A;  4HDO A;  3DPD A;  1C3T A;  1KFY B;  1KM7 A;  2KMA A;  4EKU A;  4NAM A;  1UBI A;  4YSX B;  3AEB B;  2IYD B;  3BVZ A;  1R4N B;  2N0S B;  1ZOY B;  4A20 A;  2WQY B;  3TEW A;  4FHK A;  2K1F A;  1GC7 A;  1FXI A;  1IPG A;  4RH6 A;  2LGS A;  3PO0 A;  4HRO A;  2O6V B;  1MPE A;  4RF6 A;  1Z5S B;  1WJU A;  1Q0W B;  4IG7 B;  1I42 A;  3GE3 C;  4DHJ B;  2ASQ A;  2KFK A;  2AEH A;  3X23 A;  3ZIM A;  1NI3 A;  4LDT B;  4I6P A;  3PRZ A;  3HVZ A;  2LVQ A;  4IUM B;  1IBX B;  1G0W A;  3RMK C;  2IZV B;  1D4B A;  2CRK A;  2KO3 A;  4IM0 A;  2GBK A;  3AV8 A;  1YMH E;  4K81 A;  4TKN A;  3VRB B;  1WMH B;  1Z2M A;  2NCN A;  4KV2 A;  3N32 A;  5FKA C;  1TT4 A;  2MHJ A;  1KF6 B;  4K7U A;  3CIR B;  4LNK A;  2ZEQ A;  1NDD A;  5LXH A;  4G0N B;  4YSY B;  2D11 A;  2M8S A;  2N7J A;  4ASW C;  2O6V A;  4W9J A;  3WAP A;  4NPN A;  2WLB A;  4W9D A;  3IAM 1;  2KX3 A;  2M19 A;  4IWO A;  3I3T B;  2OOB B;  1YX5 B;  4NAW B;  1WY8 A;  1HTQ A;  2K6Q A;  3EGR A;  2UYZ B;  4FLH A;  2VH1 A;  3TEZ A;  1T0Q C;  1WX7 A;  2CR5 A;  3NUH B;  2JZP A;  2WXH A;  3L10 B;  3ETR A;  3ZNZ B;  4PYZ A;  5JH5 C;  3RCZ A;  1IBX A;  1C79 A;  4C56 C;  4BHL A;  1EU3 A;  2FCQ A;  4OW0 A;  2J42 A;  4CO7 A;  5D2M B;  5D3D A;  4BVU C;  2O6V D;  1I0E A;  3AU4 A;  2K8H A;  1V6E A;  1SBB B;  1WMH A;  3NVW A;  1AW7 A;  4FXC A;  3ZTD A;  4RF8 A;  5C3J B;  3PZ7 A;  4YXD B;  5L83 A;  4WJP A;  4DHJ D;  2LGX A;  2GLS A;  2HTH A;  2JU6 X;  2MBH A;  2WU5 B;  4LDT D;  1FM0 D;  2WXJ A;  1E6E B;  2LHE A;  4BKT A;  5AZH A;  3DBL B;  4WIP A;  3ZJU A;  3NG0 A;  1OQR A;  4HCN B;  4GLS C;  3B08 A;  2N9E B;  1WH3 A;  4AUQ C;  1GC6 A;  1NBF C;  3ZXR A;  3L13 A;  2KT7 A;  2GWC A;  3EHV A;  2DHZ A;  1QIL A;  4G3X B;  2L7R A;  2QIL A;  1YNT E;  1I4Q A;  1Y8R C;  2EEL A;  4MH0 E;  4G50 A;  1L5P A;  4LLG M;  2WNM A;  1AAR A;  3R7R A;  2AL6 A;  2XN9 C;  3B0A A;  1V97 A;  3GZN B;  1QQR A;  3TBL D;  2BW2 A;  2D3C A;  2L3Z A;  1OTR B;  1WZ3 A;  2HE7 A;  3P4Q B;  1HQR D;  2EMT A;  1KRH A;  4GIV A;  5AUI A;  1R4M B;  5G2N A;  2JWU A;  3OLM D;  2D3A A;  5DPR A;  1T6B X;  3LN7 A;  1WX8 A;  3DBH I;  3WA0 A;  4HVB A;  2LXC A;  4AM1 A;  3PZ8 A;  3VDZ A;  3L54 A;  3MJ5 A;  1RFA A;  1OEY A;  1QLB B;  2LGI A;  3MC0 B;  4W9E A;  4GDK B;  3Q3O C;  2WYQ A;  3NJT A;  1WI0 A;  2MLB A;  3ONS A;  1VZ8 A;  3IBE A;  2KVZ A;  3RT3 B;  1CK1 A;  2CJO A;  2KNB A;  1T5X D;  1YJI A;  4ARC A;  1TZO A;  1WXA A;  4L23 A;  2BVC A;  2DZI A;  3VR9 B;  3WAO A;  4DBG A;  4A55 A;  4MSQ B;  2CJN A;  1NYQ A;  4GVZ A;  1HXY D;  1RLF A;  2PMV A;  1QT9 A;  2LEK A;  3LXF A;  4C7Y A;  1D6E C;  3TL5 A;  4NJ6 A;  2C7N B;  3T3O A;  3CWI A;  1BG0 A;  1Q10 A;  3BVG A;  3ZNG C;  1C78 A;  4HK2 A;  1OQY A;  2INP E;  4A8X C;  5G55 A;  2QMT A;  1L0Y B;  5AEK B;  2MJE A;  2M0A A;  1FO4 A;  4Q2R A;  4LNI A;  2C7M B;  3ZYY X;  1ZDX A;  4GDK A;  5IKC M;  2JXX A;  1LXD A;  3L4P A;  1C4C A;  2BWE S;  1H8C A;  2K39 A;  4TSS A;  4ZRQ A;  3DHH C;  4OZA A;  3JYU A;  3EA6 A;  2N7E A;  4MGZ E;  2CU3 A;  4NQK E;  2KJH B;  5E6O A;  3FAH A;  4E3C A;  1P50 A;  4IWQ A;  1TY2 A;  4N59 A;  5HHD G;  1JQ4 A;  3IG8 A;  3AED B;  3NS1 A;  3Q3N C;  3DRB A;  1U4A A;  1D3Z A;  3KW5 B;  5JZE B;  2PTL A;  3RNB C;  3LN6 A;  1MHH E;  1TKE A;  1V1P B;  1XCQ L;  3BK1 A;  3TUO A;  1P3Q U;  1ZE3 D;  4FN2 A;  3U7D A;  3N30 A;  1M4V A;  1UF0 A;  3PRE A;  5BMI A;  1YN5 A;  3I63 C;  5BYQ A;  2SAK A;  1GB1 A;  4DXG A;  3H9D A;  5E6P A;  2D3G A;  3EEC A;  2NBW B;  2KWV B;  2KC1 A;  1V81 A;  3GOE A;  3AI5 A;  4M00 A;  1CRK A;  2LMC A;  4DHZ B;  4MGY E;  4D2K A;  4GN1 A;  2JT4 B;  1WRD B;  4N58 A;  1KJT A;  1P7E A;  2JYT A;  3UIP B;  4KDL B;  1TBE A;  4LNF A;  2NR2 A;  4HRS A;  1HZ5 A;  4WWM A;  2J4X A;  5GXG B;  1DOY A;  2JUO A;  4W9G A;  4BKG A;  4JWS C;  1N62 A;  3BVM A;  3QIJ A;  2WDQ B;  4BBN F;  4BBN C;  1V2Y A;  4WWN A;  1V1P A;  3QX1 A;  2KWD A;  1YX6 B;  4FHJ A;  3AE7 B;  4ICU A;  4EZJ A;  2QSD A;  4LNO A;  3AE2 B;  3MFG A;  1QOA A;  4MEM A;  4M0W A;  3DBR I;  3U4E G;  3Q6B A;  1V9J A;  2MCN B;  2FCN A;  2MX2 A;  3CST A;  1DGJ A;  5HI1 A;  3HHM A;  3VFK A;  3PRP B;  1SEB D;  3FKY A;  2R2Q A;  2JVC A;  2BB6 A;  2V3P A;  3AE6 B;  1XEE A;  1LQB A;  4ZDV A;  4DDG D;  4HWI B;  3AE4 B;  3SEB A;  3Q14 C;  2OJW A;  1F52 A;  4PYU A;  1VZ7 A;  2ZW1 A;  3M63 B;  2KOX A;  2GBJ A;  3B1L X;  3OWE B;  1JRP A;  2BWF A;  1VLB A;  2MBO A;  2PVG C;  3DQV A;  5KHQ A;  1C1Y B;  5BYS A;  2KAJ A;  3WAL A;  5BMG A;  3A33 B;  3RUL A;  1E7V A;  1I4R A;  4US8 A;  2INN E;  3PLU A;  2JZZ A;  5HFY A;  4E74 A;  1XF5 L;  2KQ4 X;  1R7S A;  1HTO A;  1D5Z C;  3L2E A;  2MW5 A;  2KKC A;  4JIO U;  2EMS A;  2DZK A;  4DDI D;  1NEN B;  4HKQ A;  2MA9 B;  3ZNI D;  3ZKJ C;  4WAF A;  2WX1 A;  2CHX A;  2D32 A;  4RF7 A;  3IHP C;  1WJ6 A;  1E10 A;  1UNS A;  1EM7 A;  3ZJT A;  2IJ0 A;  5CHV C;  2WXN A;  3KWV A;  2C9W B;  1RFK A;  5BO4 B;  2M17 A;  2NBU A;  2DAJ A;  2JQR B;  1L0V B;  1TT5 B;  2N7D A;  2KVR A;  1VA6 A;  5DPS A;  3Q3M C;  1WYG A;  3HM6 X;  2BKF A;  2JWZ A;  1ESF A;  2KMM A;  3MJW A;  3ML8 A;  2L76 A;  3EFU A;  2BB5 A;  4LK0 M;  1ZP0 B;  1LFD A;  5TSS A;  4XWW A;  1SD0 A;  4S0R A;  2WP9 B;  2MH7 A;  5J17 A;  4AJY B;  2G1E A;  1ZW7 A;  2KD0 A;  4RF1 A;  3VRA B;  2M1M A;  3UI3 A;  2LRW A;  2DWQ A;  3DHG C;  3RD2 A;  3DHI C;  2AX5 A;  2LUE A;  1CMX B;  2L0T A;  4P1B C;  3AEF B;  2PE9 A;  3H1U A;  3R66 C;  2IO0 B;  3KLS X;  3BY4 B;  4MSM B;  3A9J A;  1C9F A;  3JPZ A;  4XGA B;  1YQ4 B;  5AUK A;  2Z0E B;  5JHB A;  3VH3 B;  2GWD A;  2PVO D;  4YTN B;  3W2D A;  2KFK B;  2MEK A;  4R3D A;  2DBY A;  4XC2 A;  2HJ8 A;  2BT6 A;  4YWG G;  1DOI A;  1WZ0 A;  3BII D;  2LAS A;  3QJZ A;  4FJZ A;  1FXA A;  5CHW A;  1WXM A;  2FNJ B;  1M15 A;  3HVD A;  4K3C A;  4EUT A;  4P16 A;  4GDL B;  2G9H D;  4GVY A;  2BF8 B;  1S3S G;  5G5G A;  3V3X A;  3R2I A;  1ZKH A;  2K25 A;  2RDB C;  1L7Y A;  1CZP A;  3DOW A;  1ZGU B;  3FC4 A;  4BKS A;  1DYQ A;  5FR6 A;  2BYV E;  3NZS A;  4EEW A;  1QZE A;  3RPF C;  3NHE B;  1UGJ A;  2JF5 A;  1ACC A;  1PFD A;  3DBS A;  3DVG X;  2GMI C;  2JSV X;  2L8J A;  4HPP A;  4RM9 A;  3RNE C;  4JPS A;  1F9J A;  3JW0 X;  2IBI B;  1XT9 B;  3ZNH B;  2KK8 A;  2N9X A;  4MDK E;  3PLV A;  4YTM B;  4P6V F;  1WE7 A;  2VZK B;  3CF6 E;  3WCQ A;  2HTM E;  2N1W A;  5H92 C;  2KHW B;  1XLO A;  3BZD B;  1WJ4 A;  3T3N A;  3AE1 B;  2W82 A;  1L2N A;  2AWT A;  2ZPN A;  3LJ3 A;  1OFF A;  2WXP A;  4GDL A;  1PGA A;  2LHD A;  3BK2 A;  4CYE A;  1QOG A;  4URK A;  3V6C B;  1SIJ A;  1PUT A;  4PK1 A;  4IC7 B;  5AZF A;  2QHO A;  4C7Z A;  3A4S C;  3AEG B;  5H8Y E;  1HE8 A;  2DZJ A;  2Y5B B;  4AOF A;  3APD A;  1QKZ A;  3VHT C;  4O1N A;  4ZRI A;  1YOV B;  1E7U A;  4I6N B;  2SEB D;  3RNC C;  1JAL A;  3ZW3 A;  2WGS A;  3QAQ A;  3ABV B;  1RAX A;  2IY0 B;  2W3R A;  3P63 A;  4K3B A;  2M56 B;  3P2B A;  3ZO5 B;  2FID A;  4GXB A;  3RI7 C;  1WR6 E;  1YIW A;  2WDR B;  5EE9 A;  3MHZ A;  2WXR A;  2W9N A;  1TZ1 A;  2DYM A;  3K9O B;  5J99 A;  1WJN A;  4ANW A;  2IO3 B;  2W55 A;  2N4F A;  2ZNV B;  1U6R A;  2R2O A;  3QQ8 B;  1F0Z A;  2ZJD A;  2M0X A;  4P7I A;  2HJ1 A;  4NJC A;  2KC2 A;  3KWL A;  1WX9 A;  5FK9 C;  4Z9M A;  4N9F 4;  2VZK D;  1YQ3 B;  3PGE A;  3NS8 A;  2BQQ A;  3VR8 B;  4HJK A;  2EKE C;  3R8B A;  1QH4 A;  1LGR A;  2M4N A;  3W5V B;  3OG5 A;  5J18 A;  1XXG A;  4LJP B;  1KOT A;  3N1X C;  1DOX A;  2NMQ A;  1PGB A;  1WGY A;  2KZR A;  4NNJ B;  4AWJ A;  4MM3 B;  1UBQ A;  4DQO C;  2FE8 A;  2L0F A;  1S1Q B;  1JWS D;  3RFZ B;  1I4X A;  3ZJV A;  3JQ3 A;  3GS2 A;  1XLP A;  2IGH A;  2J0M A;  1FRD A;  3GB1 A;  3Q8B A;  4L1B A;  4B0M A;  2MJ3 A;  3TEY A;  2D5G A;  2LRU A;  3URY A;  1AYF A;  4KSL C;  3B2F A;  2H88 B;  4KIK B;  2WXO A;  1N6Z A;  3V61 A;  4GW0 A;  2N9K A;  4EOY A;  1SJH D;  2D10 A;  2ON8 A;  3SFE B;  4WQO B;  2D33 A;  4MJS B;  3A1Q B;  2R61 A;  2OJR A;  1JWU D;  1TGZ B; 
#chains in the Genus database with same CATH homology
 1P50 A;  4BAX A;  2WHI A;  3B6R A;  4RF7 A;  2D3A A;  2QC8 A;  4S17 A;  2D3B A;  4GVZ A;  1FPY A;  3L2E B;  4GW2 A;  4RF9 A;  3L2D A;  1I0E A;  3NG0 A;  1RL9 A;  4XYC A;  4HPP A;  4Z9M A;  4AM1 A;  4LNO A;  3JU6 A;  4Q2R A;  5J9A A;  4LNI A;  1SD0 A;  1HTQ A;  5J99 A;  4LNF A;  4S0R A;  3ZXR A;  1HTO A;  4BG4 B;  1QK1 A;  2LGS A;  1M15 A;  1VRP A;  4LNK A;  3DRB A;  3JPZ A;  2J1Q A;  2OJW A;  1F52 A;  2D3C A;  2WGS A;  4GW0 A;  1G0W A;  4RF8 A;  4RF6 A;  1BG0 A;  1QH4 A;  1LGR A;  2CRK A;  3DRE A;  3JQ3 A;  4GVY A;  1U6R A;  3ZXV A;  1CRK A;  3M10 A;  2BVC A;  4BG4 A;  2GLS A;  2UU7 A;  1P52 A;  3JU5 A;  3L2E A;  3FKY A;  1F1H A;  4BHL A;  4ACF A;  4LNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...