2WGSA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor.
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
475
structure length
463
Chain Sequence
b'KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMINE SYNTHETASE 1
publication title Structural Basis for the Inhibition of Mycobacterium Tuberculosis Glutamine Synthetase by Novel ATP-Competitive Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 150
structure length 463
sequence length 475
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2009-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2wgsA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 2wgsA02
2UU7A 1FPYA 4S0RA 2OJWA 1M15A 3L2DA 4BAXA 1HTQA 1BG0A 1CRKA 4RF8A 4HPPA 3ZXVA 2BVCA 4XYCA 4GVYA 4AM1A 1F1HA 3JQ3A 1P52A 4ACFA 4LNFA 1RL9A 3JU5A 5J9AA 2J1QA 1HTOA 1SD0A 1U6RA 1VRPA 3L2EA 3DREA 3M10A 4LNNA 3DRBA 4BG4A 4BHLA 4LNOA 4GVZA 5J99A 3FKYA 2WHIA 3ZXRA 1G0WA 4RF9A 1QK1A 4GW2A 4LNIA 4Q2RA 3NG0A 2QC8A 1F52A 1LGRA 4LNKA 4RF6A 1QH4A 3JPZA 2D3BA 2GLSA 2D3CA 4S17A 2CRKA 1I0EA 3JU6A 3L2EB 4RF7A 4Z9MA 4BG4B 3B6RA 2WGSA 4GW0A 2LGSA 2D3AA 1P50A
chains in the Genus database with same CATH superfamily
2A5UA 4HDQA 2LRUA 3EFUA 2JXXA 2QMTA 1C4CA 3AMZA 4GLSC 1JWAD 3H1UA 4K81A 2MBBB 4XWTA 4P1CC 4A20A 3P4SB 3VFKA 5FR3A 4AJYB 2C7NB 4N59A 1I4GA 2KJHB 4KZCA 4WJOA 3LN7A 2V4LA 3L13A 3ZUNA 3MP9A 3NVZA 4BG4A 5HI1A 3IBEA 4E3CA 4GW2A 2GWDA 4M0WA 1PUTA 2GBNA 5LXIB 1BMLC 1P7EA 2LMCA 1YJIA 4JL9A 3NOBA 1OGWA 3TJPA 3NZUA 1OTRB 2W55A 1KJTA 2KDFB 5AZFA 1P98A 5BMHA 3UIPB 2ICIA 2WXOA 3FKYA 1OQYA 3QK0A 2XNAC 4MACA 2N1WA 3U8ZA 4RF6A 2E3TA 4US8A 1DGJA 2JQRB 2ZCCA 3W1SC 4BAXA 3UQBA 2WDRB 1WMHB 4WWMA 4BOZB 3PVLA 1WXSA 4ZOHC 2K1FA 2ZNVC 2CR5A 3KVFB 2KNBA 3B1LX 4PS3A 2Z59B 2JF5A 2IY1B 3WA0A 2XK5A 2RMMA 4YSXB 1WJ4A 4HCPB 3SFDB 4HXDA 1MPEA 4FBJB 2IGHA 1KM7A 3L17A 3L16A 4W9FA 3RT3B 4DXAB 4NZLB 5H92C 3EFCA 1C3TA 4B0EA 1SIFA 2DNFA 3Q8EA 4KKIA 1F2RC 1C4PA 2ZJDA 1XQQA 3MC9A 5C2TB 1RYJA 1TZ1A 1VR9A 4RF0A 1YN4A 1QQRA 3AE2B 4FA6A 2ZPYA 5BO4B 1ISNA 2K39A 4RGTA 1EF5A 3V62A 1AN8A 1S3SG 4WJPA 4KIKA 1ZGUB 1CZPA 2KFKA 3PHXB 1FNVA 2OHFA 5AEKB 1FPYA 1M15A 2X8XX 4GN1A 2KC2A 5CHFA 2G4SA 5MPOA 1JRUA 5CTRC 1V8CA 1FXTB 2GOWA 1P7FA 3M63B 2DYOA 2ZEQA 1HZ5A 4H2AA 2QEJC 3NZSA 1HEZE 4HWIB 4WURA 1FRDA 1F0ZA 4S17A 2LGXA 3RZWC 3MHZA 1P50A 4W9DA 2NTTA 3IT6B 3ZJVA 1WGGA 3NRZA 5G2NA 1TKYA 1FM0D 1F1HA 2KJ6A 2GI9A 3LB8C 1Y8RC 2ON8A 3HRDD 3AE3B 4E74A 3L54A 4ZHOA 5D6JB 3WCQA 2N9LA 1Q10A 2WXMA 4Q2JA 1QF6A 1HTQA 3RNBC 2BS3B 2JRIB 3BVGA 1L6VA 4ZRIA 2NBWB 1MVKA 2KWVB 3D32A 1E7VA 3R66C 1I7HA 1EU4A 4DHZE 4BFRA 2KZRA 1WJ6A 1P1AA 1CK1A 2AQ3B 3RNAC 3VTUA 3PPAA 3A9JB 2FIFA 2KX0A 1ET6A 3C8YA 2FCMA 2VRRB 1UELA 1DOYA 3CMMB 4XDCA 2ZW0A 3VRAB 4L2YA 4XGAB 4GSWA 1F2RI 1KLUD 3NHEB 2YEPF 4LNKA 2MBHA 4HKQA 2RDHA 2BT6A 2QHOA 2EKIA 1E7UA 3KUZA 2VZKB 2NMQA 4IWQA 2BKRB 4KZ0A 2PE9A 2DENB 3AN1A 2JXTA 3AE4B 2BYVE 1WJNA 2CS4A 2JZ3B 1SE3A 2KFJA 3C19A 2A4ZA 2B3AA 1MHHE 3DDCB 3W5UB 2ZW1A 3LYYA 1RRBA 3DBHB 3X23A 1E8ZA 1QILA 1BUIC 3UIOB 1F9JA 1MHXA 1SD0A 2PIAA 3DRBA 2PVOD 4W9HA 3EHVA 2MJEA 3AI5A 1WGDA 3RZFA 4REZA 1QOAA 1GG3A 2I1JA 2HTHA 1J19A 4AJWA 2WXNA 3CSFA 2BGFA 2MBOA 3A4SC 2X38A 4C7ZA 3OJ3A 4BVUC 1JALA 1J7CA 3AEFB 4BKSD 1DOXA 1I42A 4KGSA 1LGRA 2ACZB 1VDVA 2IO2B 2KTRA 3P4PB 1IPGA 2BYEA 2LRWA 2M0AA 3A1QB 4UDUC 4AM1A 5CHVC 2J0MA 1KH0A 3P1MA 1JRPA 4B6WA 2SEBD 3TCAA 2KDEB 3JVZX 1FO4A 3ZNGC 2DYBA 3K9PB 4LDTD 3ZJTA 5G5HA 1FXAA 4B9KA 1D5XC 2LD9A 4GDLB 2KMMA 3TEXA 5AZHA 1ZW7A 3QC8B 3IAS1 4ITKA 3Q6BA 1D5ZC 3PGEA 2JVCA 4NQLB 3KH0A 2Y5BB 1QK1A 4YXDB 2MRPA 4NNJB 4MJSA 2D3BA 2RR9A 1H8CA 4M00A 3A33B 4IOIE 3RN9C 5AUIA 4C4VB 1V9JA 4WWNA 1JMLA 4WWPA 1UWMA 1RAXA 2J42A 1IBXA 2NPTB 3Q8AA 4BHLA 1GB1A 1L6UA 2DYMA 1OEYA 2KO3A 5G5GA 4DDGD 4NAWB 2LWPA 1SSNA 1JWBD 1YQ3B 3N3KB 4URKA 1UUPA 3P42A 5BYSA 4BOSC 4I6NB 1SE9A 2WX0A 2LGSA 5E6PA 4KGTA 3BZDB 3VDZA 4US9A 2BBCA 1LXDA 2FBWB 4A8XC 1LQBA 4ARCA 1XLOA 2G4DB 4ZHPA 3WIMA 3H6NA 1QKZA 1TT5B 4WAAA 2LFIA 3TIXA 2E6XA 1N5XA 4CO7A 2CRKA 2KLGA 4KSLC 2N9XA 1EM7A 5IO9A 5L83A 3V6CB 3SD5A 3NZ3A 1RFAA 1B9RA 3Q3OC 1C1YB 2L0TA 1M4VA 1SE2A 2KOXA 1JW9D 4F8CB 3ZTDA 2CJOA 3T9LA 1EO6A 2LI5A 3UI3A 1HZ6A 3BVMA 1K52A 1TS5A 2V0GA 5CX3A 1K50A 3N1ZC 2N9EB 2WYQA 3U52E 4K7WA 3WANA 2UWQA 3BVZA 2AQ2B 1OQQA 4HPPA 3AEBB 1I4HA 3ALBA 2KXJA 2IO1B 1X1MA 3KW5B 2NS5A 1E6EB 4GU2A 1KLGD 1WM3A 4RM8A 3NS1A 3A9KA 4P16A 3ZYYX 2AWTA 3Q8CA 2D33A 1FRRA 2K8HA 4K1RB 3WAPA 2CHXA 2N9KA 3KYDD 2MWSB 2INCC 4KV2A 1V5OA 2KMAA 3KUDB 4ANWA 4B95A 1WJUA 3NVYA 2I1KA 1T3QA 3MJWA 3VHTC 3M3JA 3P4QB 1DOIA 5LNK1 2EMSA 2JZZA 3DBSA 2KJRA 5D3IB 2WQYB 4J3OD 3U7DA 3PZ8A 5FK9C 4W9LA 3DBRB 3VAWA 4C80A 1XCQL 3X0WA 2IDYA 3DHIC 4JWSC 2J0KA 4HEA1 4TV3A 1L5PA 2ZCBA 1WRDB 2KK8A 2KKCA 2KC1A 1L0XB 4MM3B 2K22A 2O2VA 3HM6X 3H7PB 2MSED 1UBQA 4BKSA 4N58A 2OJRA 3HM3A 3ZO5B 3OAWA 1VLBA 2NR2A 3W2DA 2D5GA 4GB9A 2O6VD 4ZRJA 4XX5A 1WYWB 4JLCA 4YTMB 3APCA 2EKEC 3IHPC 1V1PB 4EOYA 5T8IA 3ZGZA 3BYYB 4NJ6A 5EE3A 3IVFA 1VRAB 2IJ0A 3Q8BA 2N9PC 1RL9A 3KYCD 2XEWA 3ZDTA 1ZKHA 4W9CA 1TBEA 3RUIB 5JHBA 3PT2B 3K9OB 3ZLZA 1PGXA 2MP2A 4BKGA 1SJED 2FUG1 2N1VA 2BTEA 1T5XD 2N7DA 5DPRA 3FILB 3VXWA 2NBUA 2CHWA 3OWEB 1FNUA 2QDFA 1K8RB 2AQ1B 3RNFC 4GDKB 3DVGX 4XWWA 3O13A 1Z5SB 2INPE 3PRPB 1XLNA 4QAYA 4RH6A 2YLMA 3EUB2 1KTKA 1CQVA 1QLBB 1TS4A 3ZNHB 1L7YA 2MLBA 1UGJA 1TGZB 5I4DA 3DHGC 1N5WA 4A6QA 1PFDA 4II3B 2ASQA 1NYQA 4G50A 4LNNA 3MJ5A 5E6JA 2EELA 4PYUA 1WR6E 3DVNV 2WS3B 2LXAA 2GRIA 3I3TB 2WXLA 2WU5B 3VUWA 2BB5A 2LVQA 1RLFA 4N6EB 4ZDVA 1ZPSA 3E56A 2MQJA 3R2IA 2C60A 4LJPB 3KUCB 2K6DB 5GMVA 3IG3A 1EWYC 3ZRFA 1ENFA 2N7EA 3L2EB 4AWJA 4Z9MA 3N20C 3QAQA 1DYQA 3B2GA 3JW0X 5EE9A 5EDSA 1WM2A 2WLBA 2L32A 2QIEB 2M17A 4WQOB 1PDXA 3TMPB 3ZDMC 5J2RA 4BBNC 4FN2A 4JWUC 3PO0A 1WZ3A 3DCGA 1G6JA 1WWTA 1V49A 2FCQA 2Z0EB 1OEYJ 3BIID 3DPDA 2LVOA 4MH8A 2INDC 4MELA 2OJWA 3N9YC 4IUMB 2PPHA 3N30A 1FFUA 2SAKA 1KFYB 1WGRA 4NPNA 2J52A 2KDMA 3OG5A 1KF6B 2IGDA 1SJHD 2ONQA 4JX1C 1YMHE 4TKNA 1YNTE 4OVZA 2WXHA 1XT9B 3CIRB 2GMIC 1A5RA 2D3AA 4FLHA 4K3BA 3VQIA 1WYGA 2CU3A 2KVZA 2KTRB 3OLMD 2QILA 2K6QA 4EFOA 3B0AA 5JHAA 2GBRA 4D2KA 4I6PA 2VH2A 3RNCC 3AM9A 4W9IA 3IG8A 2MHJA 2OOBB 1L4ZB 2KX3A 4JE3B 2WX1A 4HCNB 1AWDA 1YX6B 2LZ6A 3JQ3A 2HJ8A 4YWGG 3RMKC 2JSVX 1N62A 1KLVA 3BK2A 3V60A 2IO3B 1NVID 1Q1OA 1SEBD 5IKCM 1WI0A 1TTNA 4MJSB 1WE6A 2IY0B 3BYTB 1I35A 2M19A 2O6VA 2JWZA 3DWMA 3TEZA 3GE8C 4LCDE 1FD6A 1ZXHA 1YQBA 4KX6B 3JU6A 3AB5A 3TBLD 1LM8B 3Q3FA 1E8YA 2L0FA 5FKAC 4NJ7A 4PYZA 3RPFC 2WP9B 2N0SB 3IFWB 3SR6A 4JGHB 4JPSA 1KOTA 4B0MA 1WXVA 3ONSA 3ZIMA 1C76A 1WE7A 3APDA 3NG0A 5CHWA 2K8BA 4OHJA 4P1BC 5JH5C 4IM2A 3I63C 3QX1A 3DVNU 3AU5A 4WIPA 3NVWA 1P9DU 5G55A 3Q2AC 1WX7A 2KQSA 3DHHC 3DREA 1TKEA 1GC6A 2IBIB 2K3UA 2L83A 1TT4A 1R4MB 4YTPB 3P63A 4CQNA 1VZ8A 2HJ1A 3DBHI 4FXCA 2G9HD 4XYCA 4XE0A 2LHEA 1H4RA 5EE1A 1YN3A 2V1YA 4MSQB 1U6RA 2WDQB 2L8JA 3R7RA 5IA7A 2WHIA 1G0WA 3P2BA 3MC0B 2KWCA 1BT0A 3TSSA 3C0RB 4M01A 2ZVOA 3DOWA 1WZ0A 3R7QA 1R4MI 4A90A 5GXGB 3RNGC 1XCTL 1NDDA 2JPHA 3ENEA 3SDLC 1QOGA 2BWFA 2WWZA 3Q3MC 3ZKJC 1D6EC 3M10A 1L2NA 2L05A 3EGRA 3B9JA 5D7GA 1ZOYB 2JWUA 3W1SA 1MG4A 2EMTA 4ARIA 3QA8A 1GC7A 4JIOU 4PT5A 1T0YA 3V05A 2DZIA 1C78A 1CMXB 3R3MA 4DHJB 1P3QU 1FNWA 3IAM1 2UU7A 3RFZB 5HFYA 2GBJA 2H88B 3JSVB 3RNEC 4L1BA 4W9KA 3WAMA 3JU5A 2CU1A 3PZ7A 4W9EA 3I5JC 1XD3B 4OZBA 1A70A 3QHTA 3PLVA 3AECB 2DAFA 2AX5A 2BS2B 1XO3A 1SGHA 4GMVA 2DZKA 1TS3A 2JU6X 3TL5A 1EUVB 1UF0A 1WXAA 1Z2MA 1C79A 4ICUA 1YOVB 1GNUA 3ETRA 1T0SC 3J9CA 5C23A 4DQOC 2KHWB 3I9V1 3KWVA 4A3OA 1UBIA 5TR5A 3A9JA 2JY6A 4MEMA 2PW9A 3L4PA 4WWOA 2IGGA 4GXBA 3ABVB 1E9MA 1RFKA 3QIJA 4HDOA 1KRHA 3RD2A 3H9DA 5DPWA 2KAJA 5AZGA 2CJNA 1TZOA 3AEAB 5BMIA 2RPVA 3AH7A 2KN5A 3L08A 1IGCA 3GZNB 3ZTCA 4IM3A 2WU2B 1K53A 4KGRA 1S1QB 3AE7B 4BG4B 2M56B 4HJKA 1NENB 1WY8A 3CF6E 3EA6A 4RGNA 4WQMA 1WGKA 1QT9A 4II2B 4ZYNA 1ACCA 4M0WB 1SE4A 1OFFA 2MP2B 3VH4B 5C3JB 2BW2A 1IP9A 1JWSD 1V81A 2IPKD 3GZNI 3KWLA 4ZRPA 1VRPA 4P7IA 5IOIA 4MGZE 2LXCA 3HVDA 4A3PA 1XLPA 3VH3B 1ZDVA 1FXIA 2WXKA 1AARA 4M02A 4ZRKA 1JWUD 2G1EA 4DDID 3HIZA 4LLGM 5KHOA 3L2DA 2PKOA 2L1AA 3ECIA 4M8MA 2K9XA 2W82A 2PLPA 2FUHB 2WNMA 3FAHA 3VUYA 2NVUI 4HPMB 4BZAA 5DPSA 4KDLB 1YN5A 2R61A 2WDVB 3URYA 2K0PA 4E71A 2D10A 1VZ7A 3FC4A 1YJ1A 2KWUB 3NUHB 4M8NA 1XEEA 1UWXA 4XDDA 4BBNF 4G11A 4NAMA 1E90A 2IYDB 2XK5B 3BK1A 3TEYA 4DXGA 4RNAA 1L4DB 1TJEA 1ZE3D 2KTFA 3A1QA 4FHKA 4RF1A 4RF7A 2PJHA 4WJNA 1PGAA 3Q3NC 4G3XB 4S0RA 4ANXA 2LASA 2J7QB 1ZP0B 3ZXVA 4GVYA 1NBFC 1RWSA 2BPSA 3BY4B 5D2MB 1EF1A 3P4RB 4WJQA 1V4GA 1GB4A 4P6VF 4OZCA 4LNIA 1HE8A 3B08A 3H8HA 4GDLA 2NCNA 2XBBC 1D4BA 4ICVA 1J8CA 3DVGY 4NJCA 3Q8FA 2HDEA 1M94A 3L0WB 1VCBA 1FCCC 4KIKB 3S2AA 2REXA 4RF8A 4YSYB 4EEWA 2OEDA 2KFKB 3DBRI 1UD7A 3I57A 4TQ1A 3ML8A 1UZXB 4IC7B 4GOCA 2Z8LA 2L76A 4TMAB 3PZDA 1L0YB 1JROA 2RDBC 4C4VA 4NY0A 2NTSA 1MJDA 2K8CA 1HXYD 3VR8B 3DWGC 4OVUA 2Y5CA 2NPTA 4EE2A 1WXMA 2XN9C 4J6IA 4USAA 4NAWA 1TYGB 3PHWB 1AW7A 1SF0A 3IG5A 3EECA 2KN4A 1VJKA 1TKGA 2Q5WD 4CHKA 1ET9A 3R2TA 1WX8A 2LGYA 3LXFA 4IM0A 4WH4A 3ML9A 1GPXA 1V5TA 2MBEA 1IYFA 1Q0WB 1WF9A 1QOBA 3AEEB 3AE5B 3ZNZB 2L00B 4ZRQA 2V3SA 1N63A 2CHZA 1V86A 1F77A 1V6EA 2KQ7A 2QJLA 1UGMA 4MGKE 4HKZE 1MFWA 5IP4D 2L52A 2CKHB 3AE9B 4ACFA 1E8WA 3IT4B 2D3GA 5BYRA 5J99A 4A55A 4TUUA 2O6VB 4MGYE 4KSKC 4BKTA 3NJTA 4C56C 2FCSA 2I38A 3B6RA 3AXCA 3KLSX 1ZDXA 2BVCA 2Y3AA 1P52A 1TS2A 3VUXA 1EU3A 2AEHA 4NQKE 3T3NA 3HHMA 3ZNID 2N4FA 2QC8A 2MA9B 4FJZA 1V80A 4HK2A 4IG7B 1OQRA 3GP7A 3O65B 3AEDB 4EZJA 2Y5PA 2LVPA 2M0XA 3GS2A 2Z0DB 4LNFA 5J18A 5DPTA 5IN7A 2D32A 4HRSA 2C7HA 1VD2A 1RM6C 3AULA 3WAOA 2JX5A 5AUKA 4FADA 4ZYSA 2JYTA 3W9CB 2C9WB 2KT7A 3PS6A 1NI3A 3PRZA 2C5LC 2W54A 4XC2A 4LTUA 4K7UA 1QOFA 3PV1A 2M1MA 3QARA 1R4NB 2WXFA 3UF8A 3M95A 3MC8A 3ZXRA 1AYFA 4MM3A 4MGIE 4C7YA 1WGHA 3H7PA 2WXIA 1WFYA 1R8GA 4YT0B 1IGDA 1C77A 2G45B 1Y56A 3JYUA 2PTLA 4O1NA 4LK0M 1I4RA 3KQ4A 1FCLA 1R4NI 4LNOA 2DAJA 2BF8B 1V1PA 5DCNA 1N60A 2BB6A 4DHZB 3CWIA 1UH6A 2D11A 2GLSA 2LUMA 3GE3C 4YSZB 1I0EA 2HE7A 3IXSA 4XZ4A 5TSSA 3AE1B 4MDKE 2INNE 2NBVB 2ZPNA 4RGOS 2VZKD 1FMAD 2PE6B 2ZNVB 3UQAA 5J9AA 2M8SA 4G0NB 1T0RC 5LLIA 1D5MC 1FIQA 3QQ8B 1R7SA 4DK5A 3FILA 2BKFA 2L3ZA 2WXJA 1J0GA 4GDKA 2GWCA 1WGYA 1L0VB 2GB1A 5H8YE 5JZEB 2LGIA 4A9AA 4JQWC 4IW0A 4RGMA 5IAAC 1TY0A 3SEBA 4RCOA 2KANA 2KWDA 4F7ZA 3EC8A 1STEA 1YX5B 1IBXB 3UINB 1PGBA 5C1ZA 1WMHA 3JPZA 2D07B 3NVVA 3RCZA 3VVWB 3PTFC 2WXGA 1J7BA 1HQRD 2J0JA 3U2SC 2LHDA 2JYEA 3AU4A 2DBYA 1JQ4A 2JZPA 2K5PA 2MJDA 2N7JA 1SXTA 2GBMA 4CYEA 1WIAA 2D3CA 3ZRCA 1XF5L 2LEKA 3ZVVA 5E6NA 1LO5D 4IWPA 2DZJA 5D94A 5E6OA 2V9HA 2L7RA 1BG0A 4FULA 2RPQA 3ZQ4A 2DHZA 3AV8A 3E9SA 3L2EA 3QCAA 1JCKB 1JWMD 1I4QA 4MSMB 4DHJD 1GUAB 4HROA 3V6EB 2KLCA 4ASWC 1QZEA 2DZMA 4AP4C 2C7MB 3V3XA 2AL3A 1WH3A 4FHJA 2V3NA 3OJ4B 3NY5A 1N61A 1SIJA 1XLQA 4MH0E 4ANUA 1LFDA 4AOFA 3Q69A 1E10A 4MT5A 1E7PB 1P0RA 1CJEA 5KHQA 3RULA 1WSPA 3N1XC 3H7SA 2AYOB 4FJVB 4YL8A 4GW0A 1B1ZA 4HJGE 3MHSD 4RFBA 4FJYA 3APFA 2BS4B 1T6BX 3A9KB 1T0QC 1HA5A 1E5WA 3MFGA 4IDIA 4RF9A 2IO0B 1ZXIA 1SB3C 2MJ3A 3Q3JA 4GGQA 2HD5B 2H89B 1PYWD 2FCNA 4LJOB 4EZLA 2KACA 3PSEB 2TSSA 4EKUA 2VH1A 2V4IB 1MG8A 4C00A 4AS1A 1ESFA 2G3QB 2J1QA 4IWOA 2DLBA 3R8BA 4TQ0A 5FR6A 2GBKA 1C9FA 4PK1A 2KDBA 1Q5WB 4N9F4 5BMGA 5JXVA 2MW5A 1NEKB 2FAZA 2I2YA 1E0ZA 2K25A 2RDGA 1HTOA 5HKHA 2R2OA 2KYWA 2O2VB 3AE6B 2JUOA 4YTNB 2PEAA 4WAFA 4OW0A 1GAQB 2PVGC 3A4RA 4GIVA 4RM9A 3V61A 4W9JA 3AE8B 3LJ3A 2FIDA 3HUIA 3U4EG 2FNJB 3UGBB 1XXGA 3GOEA 4HVBA 2RGFA 4F1SA 2MX2A 3T3OA 1VZ6A 2RSUA 3N1YC 4KVGB 3MTNB 2YVCA 4W9GA 1IUEA 1TY2A 1I4PA 3AEGB 3DQVA 2ZVNA 4OVVA 4RMAA 1WXQA 3SU8X 3LDZE 2MH7A 1WX9A 3LVWA 2QSDA 4DBGA 4LDTB 4TSSA 3TUOA 2V3PA 4I6LB 1BXTA 2KQ4X 3PRMB 2WDTB 2R2QA 3ZW3A 3GB1A 5HG2A 3U7ZA 1PQSA 5EE0A 1TIFA 5L95C 3LN6A 1WR1A 3BWUD 5BYQA 2KVRA 3QJZA 4KKJA 2UYZB 3BINA 4ANVA 2MEKA 3SFEB 4DXFA 2MCNB 1FEHA 4K3CA 4KDIC 4R3DA 2KMCA 2WXQA 3L10B 3HVZA 3HK0A 2JRHA 1YQ4B 2KDIA 3ZJUA 2DWQA 3VTWA 3W5VB 3T8MA 1GJZA 1V97A 1F52A 4PS7A 3RYTA 3VTVA 1C4AA 4AUQC 4K7SA 4IKGA 2QCZA 2LUEA 3PLUA 1ZUD2 3M62B 4L23A 2LJIA 2BYFA 1MI0A 2ZZPB 1CRKA 2IZVB 2BWES 3N32A 4EUTA 2BYTA 1J7AA 3NS8A 3QWZB 1E8XA 2LGDA 1I4XA 2MBQA 1YD8U 3WALA 3NZTA 3PREA 1D3ZA 1GOZA 4OZAA 4Q2RA 1V1OA 2B76B 1K51A 3TEWA 2J53A 1NI2A 4DWFA 5HHDG 1EWCA 1SBBB 3DBLB 1UNSA 4GVZA 2W3RA 2PMVA 4AQ7A 2JT4B 4X57B 3Q14C 3RI7C 2AL6A 4HLEA 5D3DA 3SHQA 3CSTA 3B2FA 2W3SA 1NYRA 3JSVA 2WXPA 4HPLB 1U4AA 1V2YA 4PS8A 2D2QA 2WXRA 2W9NA 1YIWA 3U30A 1WRIA 2J4XA 3LVVA 2LJ5A 1VA6A 1N6ZA 5J17A 2HTME 2BQQA 3DBLI 4EZKA 3VRBB 2YEPB 1ROEA 2RD0A 2M4NA 2DX5B 5LXHA 3W1YA 1FFVA 1YJJA 3VR9B 2FE8A 2WGSA 1QH4A 2KD0A
chains in the Genus database with same CATH topology
2UU7A 1FPYA 4S0RA 2OJWA 1M15A 3L2DA 4BAXA 1HTQA 1BG0A 1CRKA 4RF8A 4HPPA 3ZXVA 2BVCA 4XYCA 4GVYA 4AM1A 1F1HA 3JQ3A 1P52A 4ACFA 4LNFA 1RL9A 3JU5A 5J9AA 2J1QA 1HTOA 1SD0A 1U6RA 1VRPA 3L2EA 3DREA 3M10A 4LNNA 3DRBA 4BG4A 4BHLA 4LNOA 4GVZA 5J99A 3FKYA 2WHIA 3ZXRA 1G0WA 4RF9A 1QK1A 4GW2A 4LNIA 4Q2RA 3NG0A 2QC8A 1F52A 1LGRA 4LNKA 4RF6A 1QH4A 3JPZA 2D3BA 2GLSA 2D3CA 4S17A 2CRKA 1I0EA 3JU6A 3L2EB 4RF7A 4Z9MA 4BG4B 3B6RA 2WGSA 4GW0A 2LGSA 2D3AA 1P50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU7 A;  1FPY A;  4S0R A;  2OJW A;  1M15 A;  3L2D A;  4BAX A;  1HTQ A;  1BG0 A;  1CRK A;  4RF8 A;  4HPP A;  3ZXV A;  2BVC A;  4XYC A;  4GVY A;  4AM1 A;  1F1H A;  3JQ3 A;  1P52 A;  4ACF A;  4LNF A;  1RL9 A;  3JU5 A;  5J9A A;  2J1Q A;  1HTO A;  1SD0 A;  1U6R A;  1VRP A;  3L2E A;  3DRE A;  3M10 A;  4LNN A;  3DRB A;  4BG4 A;  4BHL A;  4LNO A;  4GVZ A;  5J99 A;  3FKY A;  2WHI A;  3ZXR A;  1G0W A;  4RF9 A;  1QK1 A;  4GW2 A;  4LNI A;  4Q2R A;  3NG0 A;  2QC8 A;  1F52 A;  1LGR A;  4LNK A;  4RF6 A;  1QH4 A;  3JPZ A;  2D3B A;  2GLS A;  2D3C A;  4S17 A;  2CRK A;  1I0E A;  3JU6 A;  3L2E B;  4RF7 A;  4Z9M A;  4BG4 B;  3B6R A;  2WGS A;  4GW0 A;  2LGS A;  2D3A A;  1P50 A; 
#chains in the Genus database with same CATH topology
 2A5U A;  4HDQ A;  2LRU A;  3EFU A;  2JXX A;  2QMT A;  1C4C A;  3AMZ A;  4GLS C;  1JWA D;  3H1U A;  4K81 A;  2MBB B;  4XWT A;  4P1C C;  4A20 A;  3P4S B;  3VFK A;  5FR3 A;  4AJY B;  2C7N B;  4N59 A;  1I4G A;  2KJH B;  4KZC A;  4WJO A;  3LN7 A;  2V4L A;  3L13 A;  3ZUN A;  3MP9 A;  3NVZ A;  4BG4 A;  5HI1 A;  3IBE A;  4E3C A;  4GW2 A;  2GWD A;  4M0W A;  1PUT A;  2GBN A;  5LXI B;  1BML C;  1P7E A;  2LMC A;  1YJI A;  4JL9 A;  3NOB A;  1OGW A;  3TJP A;  3NZU A;  1OTR B;  2W55 A;  1KJT A;  2KDF B;  5AZF A;  1P98 A;  5BMH A;  3UIP B;  2ICI A;  2WXO A;  3FKY A;  1OQY A;  3QK0 A;  2XNA C;  4MAC A;  2N1W A;  3U8Z A;  4RF6 A;  2E3T A;  4US8 A;  1DGJ A;  2JQR B;  2ZCC A;  3W1S C;  4BAX A;  3UQB A;  2WDR B;  1WMH B;  4WWM A;  4BOZ B;  3PVL A;  1WXS A;  4ZOH C;  2K1F A;  2ZNV C;  2CR5 A;  3KVF B;  2KNB A;  3B1L X;  4PS3 A;  2Z59 B;  2JF5 A;  2IY1 B;  3WA0 A;  2XK5 A;  2RMM A;  4YSX B;  1WJ4 A;  4HCP B;  3SFD B;  4HXD A;  1MPE A;  4FBJ B;  2IGH A;  1KM7 A;  3L17 A;  3L16 A;  4W9F A;  3RT3 B;  4DXA B;  4NZL B;  5H92 C;  3EFC A;  1C3T A;  4B0E A;  1SIF A;  2DNF A;  3Q8E A;  4KKI A;  1F2R C;  1C4P A;  2ZJD A;  1XQQ A;  3MC9 A;  5C2T B;  1RYJ A;  1TZ1 A;  1VR9 A;  4RF0 A;  1YN4 A;  1QQR A;  3AE2 B;  4FA6 A;  2ZPY A;  5BO4 B;  1ISN A;  2K39 A;  4RGT A;  1EF5 A;  3V62 A;  1AN8 A;  1S3S G;  4WJP A;  4KIK A;  1ZGU B;  1CZP A;  2KFK A;  3PHX B;  1FNV A;  2OHF A;  5AEK B;  1FPY A;  1M15 A;  2X8X X;  4GN1 A;  2KC2 A;  5CHF A;  2G4S A;  5MPO A;  1JRU A;  5CTR C;  1V8C A;  1FXT B;  2GOW A;  1P7F A;  3M63 B;  2DYO A;  2ZEQ A;  1HZ5 A;  4H2A A;  2QEJ C;  3NZS A;  1HEZ E;  4HWI B;  4WUR A;  1FRD A;  1F0Z A;  4S17 A;  2LGX A;  3RZW C;  3MHZ A;  1P50 A;  4W9D A;  2NTT A;  3IT6 B;  3ZJV A;  1WGG A;  3NRZ A;  5G2N A;  1TKY A;  1FM0 D;  1F1H A;  2KJ6 A;  2GI9 A;  3LB8 C;  1Y8R C;  2ON8 A;  3HRD D;  3AE3 B;  4E74 A;  3L54 A;  4ZHO A;  5D6J B;  3WCQ A;  2N9L A;  1Q10 A;  2WXM A;  4Q2J A;  1QF6 A;  1HTQ A;  3RNB C;  2BS3 B;  2JRI B;  3BVG A;  1L6V A;  4ZRI A;  2NBW B;  1MVK A;  2KWV B;  3D32 A;  1E7V A;  3R66 C;  1I7H A;  1EU4 A;  4DHZ E;  4BFR A;  2KZR A;  1WJ6 A;  1P1A A;  1CK1 A;  2AQ3 B;  3RNA C;  3VTU A;  3PPA A;  3A9J B;  2FIF A;  2KX0 A;  1ET6 A;  3C8Y A;  2FCM A;  2VRR B;  1UEL A;  1DOY A;  3CMM B;  4XDC A;  2ZW0 A;  3VRA B;  4L2Y A;  4XGA B;  4GSW A;  1F2R I;  1KLU D;  3NHE B;  2YEP F;  4LNK A;  2MBH A;  4HKQ A;  2RDH A;  2BT6 A;  2QHO A;  2EKI A;  1E7U A;  3KUZ A;  2VZK B;  2NMQ A;  4IWQ A;  2BKR B;  4KZ0 A;  2PE9 A;  2DEN B;  3AN1 A;  2JXT A;  3AE4 B;  2BYV E;  1WJN A;  2CS4 A;  2JZ3 B;  1SE3 A;  2KFJ A;  3C19 A;  2A4Z A;  2B3A A;  1MHH E;  3DDC B;  3W5U B;  2ZW1 A;  3LYY A;  1RRB A;  3DBH B;  3X23 A;  1E8Z A;  1QIL A;  1BUI C;  3UIO B;  1F9J A;  1MHX A;  1SD0 A;  2PIA A;  3DRB A;  2PVO D;  4W9H A;  3EHV A;  2MJE A;  3AI5 A;  1WGD A;  3RZF A;  4REZ A;  1QOA A;  1GG3 A;  2I1J A;  2HTH A;  1J19 A;  4AJW A;  2WXN A;  3CSF A;  2BGF A;  2MBO A;  3A4S C;  2X38 A;  4C7Z A;  3OJ3 A;  4BVU C;  1JAL A;  1J7C A;  3AEF B;  4BKS D;  1DOX A;  1I42 A;  4KGS A;  1LGR A;  2ACZ B;  1VDV A;  2IO2 B;  2KTR A;  3P4P B;  1IPG A;  2BYE A;  2LRW A;  2M0A A;  3A1Q B;  4UDU C;  4AM1 A;  5CHV C;  2J0M A;  1KH0 A;  3P1M A;  1JRP A;  4B6W A;  2SEB D;  3TCA A;  2KDE B;  3JVZ X;  1FO4 A;  3ZNG C;  2DYB A;  3K9P B;  4LDT D;  3ZJT A;  5G5H A;  1FXA A;  4B9K A;  1D5X C;  2LD9 A;  4GDL B;  2KMM A;  3TEX A;  5AZH A;  1ZW7 A;  3QC8 B;  3IAS 1;  4ITK A;  3Q6B A;  1D5Z C;  3PGE A;  2JVC A;  4NQL B;  3KH0 A;  2Y5B B;  1QK1 A;  4YXD B;  2MRP A;  4NNJ B;  4MJS A;  2D3B A;  2RR9 A;  1H8C A;  4M00 A;  3A33 B;  4IOI E;  3RN9 C;  5AUI A;  4C4V B;  1V9J A;  4WWN A;  1JML A;  4WWP A;  1UWM A;  1RAX A;  2J42 A;  1IBX A;  2NPT B;  3Q8A A;  4BHL A;  1GB1 A;  1L6U A;  2DYM A;  1OEY A;  2KO3 A;  5G5G A;  4DDG D;  4NAW B;  2LWP A;  1SSN A;  1JWB D;  1YQ3 B;  3N3K B;  4URK A;  1UUP A;  3P42 A;  5BYS A;  4BOS C;  4I6N B;  1SE9 A;  2WX0 A;  2LGS A;  5E6P A;  4KGT A;  3BZD B;  3VDZ A;  4US9 A;  2BBC A;  1LXD A;  2FBW B;  4A8X C;  1LQB A;  4ARC A;  1XLO A;  2G4D B;  4ZHP A;  3WIM A;  3H6N A;  1QKZ A;  1TT5 B;  4WAA A;  2LFI A;  3TIX A;  2E6X A;  1N5X A;  4CO7 A;  2CRK A;  2KLG A;  4KSL C;  2N9X A;  1EM7 A;  5IO9 A;  5L83 A;  3V6C B;  3SD5 A;  3NZ3 A;  1RFA A;  1B9R A;  3Q3O C;  1C1Y B;  2L0T A;  1M4V A;  1SE2 A;  2KOX A;  1JW9 D;  4F8C B;  3ZTD A;  2CJO A;  3T9L A;  1EO6 A;  2LI5 A;  3UI3 A;  1HZ6 A;  3BVM A;  1K52 A;  1TS5 A;  2V0G A;  5CX3 A;  1K50 A;  3N1Z C;  2N9E B;  2WYQ A;  3U52 E;  4K7W A;  3WAN A;  2UWQ A;  3BVZ A;  2AQ2 B;  1OQQ A;  4HPP A;  3AEB B;  1I4H A;  3ALB A;  2KXJ A;  2IO1 B;  1X1M A;  3KW5 B;  2NS5 A;  1E6E B;  4GU2 A;  1KLG D;  1WM3 A;  4RM8 A;  3NS1 A;  3A9K A;  4P16 A;  3ZYY X;  2AWT A;  3Q8C A;  2D33 A;  1FRR A;  2K8H A;  4K1R B;  3WAP A;  2CHX A;  2N9K A;  3KYD D;  2MWS B;  2INC C;  4KV2 A;  1V5O A;  2KMA A;  3KUD B;  4ANW A;  4B95 A;  1WJU A;  3NVY A;  2I1K A;  1T3Q A;  3MJW A;  3VHT C;  3M3J A;  3P4Q B;  1DOI A;  5LNK 1;  2EMS A;  2JZZ A;  3DBS A;  2KJR A;  5D3I B;  2WQY B;  4J3O D;  3U7D A;  3PZ8 A;  5FK9 C;  4W9L A;  3DBR B;  3VAW A;  4C80 A;  1XCQ L;  3X0W A;  2IDY A;  3DHI C;  4JWS C;  2J0K A;  4HEA 1;  4TV3 A;  1L5P A;  2ZCB A;  1WRD B;  2KK8 A;  2KKC A;  2KC1 A;  1L0X B;  4MM3 B;  2K22 A;  2O2V A;  3HM6 X;  3H7P B;  2MSE D;  1UBQ A;  4BKS A;  4N58 A;  2OJR A;  3HM3 A;  3ZO5 B;  3OAW A;  1VLB A;  2NR2 A;  3W2D A;  2D5G A;  4GB9 A;  2O6V D;  4ZRJ A;  4XX5 A;  1WYW B;  4JLC A;  4YTM B;  3APC A;  2EKE C;  3IHP C;  1V1P B;  4EOY A;  5T8I A;  3ZGZ A;  3BYY B;  4NJ6 A;  5EE3 A;  3IVF A;  1VRA B;  2IJ0 A;  3Q8B A;  2N9P C;  1RL9 A;  3KYC D;  2XEW A;  3ZDT A;  1ZKH A;  4W9C A;  1TBE A;  3RUI B;  5JHB A;  3PT2 B;  3K9O B;  3ZLZ A;  1PGX A;  2MP2 A;  4BKG A;  1SJE D;  2FUG 1;  2N1V A;  2BTE A;  1T5X D;  2N7D A;  5DPR A;  3FIL B;  3VXW A;  2NBU A;  2CHW A;  3OWE B;  1FNU A;  2QDF A;  1K8R B;  2AQ1 B;  3RNF C;  4GDK B;  3DVG X;  4XWW A;  3O13 A;  1Z5S B;  2INP E;  3PRP B;  1XLN A;  4QAY A;  4RH6 A;  2YLM A;  3EUB 2;  1KTK A;  1CQV A;  1QLB B;  1TS4 A;  3ZNH B;  1L7Y A;  2MLB A;  1UGJ A;  1TGZ B;  5I4D A;  3DHG C;  1N5W A;  4A6Q A;  1PFD A;  4II3 B;  2ASQ A;  1NYQ A;  4G50 A;  4LNN A;  3MJ5 A;  5E6J A;  2EEL A;  4PYU A;  1WR6 E;  3DVN V;  2WS3 B;  2LXA A;  2GRI A;  3I3T B;  2WXL A;  2WU5 B;  3VUW A;  2BB5 A;  2LVQ A;  1RLF A;  4N6E B;  4ZDV A;  1ZPS A;  3E56 A;  2MQJ A;  3R2I A;  2C60 A;  4LJP B;  3KUC B;  2K6D B;  5GMV A;  3IG3 A;  1EWY C;  3ZRF A;  1ENF A;  2N7E A;  3L2E B;  4AWJ A;  4Z9M A;  3N20 C;  3QAQ A;  1DYQ A;  3B2G A;  3JW0 X;  5EE9 A;  5EDS A;  1WM2 A;  2WLB A;  2L32 A;  2QIE B;  2M17 A;  4WQO B;  1PDX A;  3TMP B;  3ZDM C;  5J2R A;  4BBN C;  4FN2 A;  4JWU C;  3PO0 A;  1WZ3 A;  3DCG A;  1G6J A;  1WWT A;  1V49 A;  2FCQ A;  2Z0E B;  1OEY J;  3BII D;  3DPD A;  2LVO A;  4MH8 A;  2IND C;  4MEL A;  2OJW A;  3N9Y C;  4IUM B;  2PPH A;  3N30 A;  1FFU A;  2SAK A;  1KFY B;  1WGR A;  4NPN A;  2J52 A;  2KDM A;  3OG5 A;  1KF6 B;  2IGD A;  1SJH D;  2ONQ A;  4JX1 C;  1YMH E;  4TKN A;  1YNT E;  4OVZ A;  2WXH A;  1XT9 B;  3CIR B;  2GMI C;  1A5R A;  2D3A A;  4FLH A;  4K3B A;  3VQI A;  1WYG A;  2CU3 A;  2KVZ A;  2KTR B;  3OLM D;  2QIL A;  2K6Q A;  4EFO A;  3B0A A;  5JHA A;  2GBR A;  4D2K A;  4I6P A;  2VH2 A;  3RNC C;  3AM9 A;  4W9I A;  3IG8 A;  2MHJ A;  2OOB B;  1L4Z B;  2KX3 A;  4JE3 B;  2WX1 A;  4HCN B;  1AWD A;  1YX6 B;  2LZ6 A;  3JQ3 A;  2HJ8 A;  4YWG G;  3RMK C;  2JSV X;  1N62 A;  1KLV A;  3BK2 A;  3V60 A;  2IO3 B;  1NVI D;  1Q1O A;  1SEB D;  5IKC M;  1WI0 A;  1TTN A;  4MJS B;  1WE6 A;  2IY0 B;  3BYT B;  1I35 A;  2M19 A;  2O6V A;  2JWZ A;  3DWM A;  3TEZ A;  3GE8 C;  4LCD E;  1FD6 A;  1ZXH A;  1YQB A;  4KX6 B;  3JU6 A;  3AB5 A;  3TBL D;  1LM8 B;  3Q3F A;  1E8Y A;  2L0F A;  5FKA C;  4NJ7 A;  4PYZ A;  3RPF C;  2WP9 B;  2N0S B;  3IFW B;  3SR6 A;  4JGH B;  4JPS A;  1KOT A;  4B0M A;  1WXV A;  3ONS A;  3ZIM A;  1C76 A;  1WE7 A;  3APD A;  3NG0 A;  5CHW A;  2K8B A;  4OHJ A;  4P1B C;  5JH5 C;  4IM2 A;  3I63 C;  3QX1 A;  3DVN U;  3AU5 A;  4WIP A;  3NVW A;  1P9D U;  5G55 A;  3Q2A C;  1WX7 A;  2KQS A;  3DHH C;  3DRE A;  1TKE A;  1GC6 A;  2IBI B;  2K3U A;  2L83 A;  1TT4 A;  1R4M B;  4YTP B;  3P63 A;  4CQN A;  1VZ8 A;  2HJ1 A;  3DBH I;  4FXC A;  2G9H D;  4XYC A;  4XE0 A;  2LHE A;  1H4R A;  5EE1 A;  1YN3 A;  2V1Y A;  4MSQ B;  1U6R A;  2WDQ B;  2L8J A;  3R7R A;  5IA7 A;  2WHI A;  1G0W A;  3P2B A;  3MC0 B;  2KWC A;  1BT0 A;  3TSS A;  3C0R B;  4M01 A;  2ZVO A;  3DOW A;  1WZ0 A;  3R7Q A;  1R4M I;  4A90 A;  5GXG B;  3RNG C;  1XCT L;  1NDD A;  2JPH A;  3ENE A;  3SDL C;  1QOG A;  2BWF A;  2WWZ A;  3Q3M C;  3ZKJ C;  1D6E C;  3M10 A;  1L2N A;  2L05 A;  3EGR A;  3B9J A;  5D7G A;  1ZOY B;  2JWU A;  3W1S A;  1MG4 A;  2EMT A;  4ARI A;  3QA8 A;  1GC7 A;  4JIO U;  4PT5 A;  1T0Y A;  3V05 A;  2DZI A;  1C78 A;  1CMX B;  3R3M A;  4DHJ B;  1P3Q U;  1FNW A;  3IAM 1;  2UU7 A;  3RFZ B;  5HFY A;  2GBJ A;  2H88 B;  3JSV B;  3RNE C;  4L1B A;  4W9K A;  3WAM A;  3JU5 A;  2CU1 A;  3PZ7 A;  4W9E A;  3I5J C;  1XD3 B;  4OZB A;  1A70 A;  3QHT A;  3PLV A;  3AEC B;  2DAF A;  2AX5 A;  2BS2 B;  1XO3 A;  1SGH A;  4GMV A;  2DZK A;  1TS3 A;  2JU6 X;  3TL5 A;  1EUV B;  1UF0 A;  1WXA A;  1Z2M A;  1C79 A;  4ICU A;  1YOV B;  1GNU A;  3ETR A;  1T0S C;  3J9C A;  5C23 A;  4DQO C;  2KHW B;  3I9V 1;  3KWV A;  4A3O A;  1UBI A;  5TR5 A;  3A9J A;  2JY6 A;  4MEM A;  2PW9 A;  3L4P A;  4WWO A;  2IGG A;  4GXB A;  3ABV B;  1E9M A;  1RFK A;  3QIJ A;  4HDO A;  1KRH A;  3RD2 A;  3H9D A;  5DPW A;  2KAJ A;  5AZG A;  2CJN A;  1TZO A;  3AEA B;  5BMI A;  2RPV A;  3AH7 A;  2KN5 A;  3L08 A;  1IGC A;  3GZN B;  3ZTC A;  4IM3 A;  2WU2 B;  1K53 A;  4KGR A;  1S1Q B;  3AE7 B;  4BG4 B;  2M56 B;  4HJK A;  1NEN B;  1WY8 A;  3CF6 E;  3EA6 A;  4RGN A;  4WQM A;  1WGK A;  1QT9 A;  4II2 B;  4ZYN A;  1ACC A;  4M0W B;  1SE4 A;  1OFF A;  2MP2 B;  3VH4 B;  5C3J B;  2BW2 A;  1IP9 A;  1JWS D;  1V81 A;  2IPK D;  3GZN I;  3KWL A;  4ZRP A;  1VRP A;  4P7I A;  5IOI A;  4MGZ E;  2LXC A;  3HVD A;  4A3P A;  1XLP A;  3VH3 B;  1ZDV A;  1FXI A;  2WXK A;  1AAR A;  4M02 A;  4ZRK A;  1JWU D;  2G1E A;  4DDI D;  3HIZ A;  4LLG M;  5KHO A;  3L2D A;  2PKO A;  2L1A A;  3ECI A;  4M8M A;  2K9X A;  2W82 A;  2PLP A;  2FUH B;  2WNM A;  3FAH A;  3VUY A;  2NVU I;  4HPM B;  4BZA A;  5DPS A;  4KDL B;  1YN5 A;  2R61 A;  2WDV B;  3URY A;  2K0P A;  4E71 A;  2D10 A;  1VZ7 A;  3FC4 A;  1YJ1 A;  2KWU B;  3NUH B;  4M8N A;  1XEE A;  1UWX A;  4XDD A;  4BBN F;  4G11 A;  4NAM A;  1E90 A;  2IYD B;  2XK5 B;  3BK1 A;  3TEY A;  4DXG A;  4RNA A;  1L4D B;  1TJE A;  1ZE3 D;  2KTF A;  3A1Q A;  4FHK A;  4RF1 A;  4RF7 A;  2PJH A;  4WJN A;  1PGA A;  3Q3N C;  4G3X B;  4S0R A;  4ANX A;  2LAS A;  2J7Q B;  1ZP0 B;  3ZXV A;  4GVY A;  1NBF C;  1RWS A;  2BPS A;  3BY4 B;  5D2M B;  1EF1 A;  3P4R B;  4WJQ A;  1V4G A;  1GB4 A;  4P6V F;  4OZC A;  4LNI A;  1HE8 A;  3B08 A;  3H8H A;  4GDL A;  2NCN A;  2XBB C;  1D4B A;  4ICV A;  1J8C A;  3DVG Y;  4NJC A;  3Q8F A;  2HDE A;  1M94 A;  3L0W B;  1VCB A;  1FCC C;  4KIK B;  3S2A A;  2REX A;  4RF8 A;  4YSY B;  4EEW A;  2OED A;  2KFK B;  3DBR I;  1UD7 A;  3I57 A;  4TQ1 A;  3ML8 A;  1UZX B;  4IC7 B;  4GOC A;  2Z8L A;  2L76 A;  4TMA B;  3PZD A;  1L0Y B;  1JRO A;  2RDB C;  4C4V A;  4NY0 A;  2NTS A;  1MJD A;  2K8C A;  1HXY D;  3VR8 B;  3DWG C;  4OVU A;  2Y5C A;  2NPT A;  4EE2 A;  1WXM A;  2XN9 C;  4J6I A;  4USA A;  4NAW A;  1TYG B;  3PHW B;  1AW7 A;  1SF0 A;  3IG5 A;  3EEC A;  2KN4 A;  1VJK A;  1TKG A;  2Q5W D;  4CHK A;  1ET9 A;  3R2T A;  1WX8 A;  2LGY A;  3LXF A;  4IM0 A;  4WH4 A;  3ML9 A;  1GPX A;  1V5T A;  2MBE A;  1IYF A;  1Q0W B;  1WF9 A;  1QOB A;  3AEE B;  3AE5 B;  3ZNZ B;  2L00 B;  4ZRQ A;  2V3S A;  1N63 A;  2CHZ A;  1V86 A;  1F77 A;  1V6E A;  2KQ7 A;  2QJL A;  1UGM A;  4MGK E;  4HKZ E;  1MFW A;  5IP4 D;  2L52 A;  2CKH B;  3AE9 B;  4ACF A;  1E8W A;  3IT4 B;  2D3G A;  5BYR A;  5J99 A;  4A55 A;  4TUU A;  2O6V B;  4MGY E;  4KSK C;  4BKT A;  3NJT A;  4C56 C;  2FCS A;  2I38 A;  3B6R A;  3AXC A;  3KLS X;  1ZDX A;  2BVC A;  2Y3A A;  1P52 A;  1TS2 A;  3VUX A;  1EU3 A;  2AEH A;  4NQK E;  3T3N A;  3HHM A;  3ZNI D;  2N4F A;  2QC8 A;  2MA9 B;  4FJZ A;  1V80 A;  4HK2 A;  4IG7 B;  1OQR A;  3GP7 A;  3O65 B;  3AED B;  4EZJ A;  2Y5P A;  2LVP A;  2M0X A;  3GS2 A;  2Z0D B;  4LNF A;  5J18 A;  5DPT A;  5IN7 A;  2D32 A;  4HRS A;  2C7H A;  1VD2 A;  1RM6 C;  3AUL A;  3WAO A;  2JX5 A;  5AUK A;  4FAD A;  4ZYS A;  2JYT A;  3W9C B;  2C9W B;  2KT7 A;  3PS6 A;  1NI3 A;  3PRZ A;  2C5L C;  2W54 A;  4XC2 A;  4LTU A;  4K7U A;  1QOF A;  3PV1 A;  2M1M A;  3QAR A;  1R4N B;  2WXF A;  3UF8 A;  3M95 A;  3MC8 A;  3ZXR A;  1AYF A;  4MM3 A;  4MGI E;  4C7Y A;  1WGH A;  3H7P A;  2WXI A;  1WFY A;  1R8G A;  4YT0 B;  1IGD A;  1C77 A;  2G45 B;  1Y56 A;  3JYU A;  2PTL A;  4O1N A;  4LK0 M;  1I4R A;  3KQ4 A;  1FCL A;  1R4N I;  4LNO A;  2DAJ A;  2BF8 B;  1V1P A;  5DCN A;  1N60 A;  2BB6 A;  4DHZ B;  3CWI A;  1UH6 A;  2D11 A;  2GLS A;  2LUM A;  3GE3 C;  4YSZ B;  1I0E A;  2HE7 A;  3IXS A;  4XZ4 A;  5TSS A;  3AE1 B;  4MDK E;  2INN E;  2NBV B;  2ZPN A;  4RGO S;  2VZK D;  1FMA D;  2PE6 B;  2ZNV B;  3UQA A;  5J9A A;  2M8S A;  4G0N B;  1T0R C;  5LLI A;  1D5M C;  1FIQ A;  3QQ8 B;  1R7S A;  4DK5 A;  3FIL A;  2BKF A;  2L3Z A;  2WXJ A;  1J0G A;  4GDK A;  2GWC A;  1WGY A;  1L0V B;  2GB1 A;  5H8Y E;  5JZE B;  2LGI A;  4A9A A;  4JQW C;  4IW0 A;  4RGM A;  5IAA C;  1TY0 A;  3SEB A;  4RCO A;  2KAN A;  2KWD A;  4F7Z A;  3EC8 A;  1STE A;  1YX5 B;  1IBX B;  3UIN B;  1PGB A;  5C1Z A;  1WMH A;  3JPZ A;  2D07 B;  3NVV A;  3RCZ A;  3VVW B;  3PTF C;  2WXG A;  1J7B A;  1HQR D;  2J0J A;  3U2S C;  2LHD A;  2JYE A;  3AU4 A;  2DBY A;  1JQ4 A;  2JZP A;  2K5P A;  2MJD A;  2N7J A;  1SXT A;  2GBM A;  4CYE A;  1WIA A;  2D3C A;  3ZRC A;  1XF5 L;  2LEK A;  3ZVV A;  5E6N A;  1LO5 D;  4IWP A;  2DZJ A;  5D94 A;  5E6O A;  2V9H A;  2L7R A;  1BG0 A;  4FUL A;  2RPQ A;  3ZQ4 A;  2DHZ A;  3AV8 A;  3E9S A;  3L2E A;  3QCA A;  1JCK B;  1JWM D;  1I4Q A;  4MSM B;  4DHJ D;  1GUA B;  4HRO A;  3V6E B;  2KLC A;  4ASW C;  1QZE A;  2DZM A;  4AP4 C;  2C7M B;  3V3X A;  2AL3 A;  1WH3 A;  4FHJ A;  2V3N A;  3OJ4 B;  3NY5 A;  1N61 A;  1SIJ A;  1XLQ A;  4MH0 E;  4ANU A;  1LFD A;  4AOF A;  3Q69 A;  1E10 A;  4MT5 A;  1E7P B;  1P0R A;  1CJE A;  5KHQ A;  3RUL A;  1WSP A;  3N1X C;  3H7S A;  2AYO B;  4FJV B;  4YL8 A;  4GW0 A;  1B1Z A;  4HJG E;  3MHS D;  4RFB A;  4FJY A;  3APF A;  2BS4 B;  1T6B X;  3A9K B;  1T0Q C;  1HA5 A;  1E5W A;  3MFG A;  4IDI A;  4RF9 A;  2IO0 B;  1ZXI A;  1SB3 C;  2MJ3 A;  3Q3J A;  4GGQ A;  2HD5 B;  2H89 B;  1PYW D;  2FCN A;  4LJO B;  4EZL A;  2KAC A;  3PSE B;  2TSS A;  4EKU A;  2VH1 A;  2V4I B;  1MG8 A;  4C00 A;  4AS1 A;  1ESF A;  2G3Q B;  2J1Q A;  4IWO A;  2DLB A;  3R8B A;  4TQ0 A;  5FR6 A;  2GBK A;  1C9F A;  4PK1 A;  2KDB A;  1Q5W B;  4N9F 4;  5BMG A;  5JXV A;  2MW5 A;  1NEK B;  2FAZ A;  2I2Y A;  1E0Z A;  2K25 A;  2RDG A;  1HTO A;  5HKH A;  2R2O A;  2KYW A;  2O2V B;  3AE6 B;  2JUO A;  4YTN B;  2PEA A;  4WAF A;  4OW0 A;  1GAQ B;  2PVG C;  3A4R A;  4GIV A;  4RM9 A;  3V61 A;  4W9J A;  3AE8 B;  3LJ3 A;  2FID A;  3HUI A;  3U4E G;  2FNJ B;  3UGB B;  1XXG A;  3GOE A;  4HVB A;  2RGF A;  4F1S A;  2MX2 A;  3T3O A;  1VZ6 A;  2RSU A;  3N1Y C;  4KVG B;  3MTN B;  2YVC A;  4W9G A;  1IUE A;  1TY2 A;  1I4P A;  3AEG B;  3DQV A;  2ZVN A;  4OVV A;  4RMA A;  1WXQ A;  3SU8 X;  3LDZ E;  2MH7 A;  1WX9 A;  3LVW A;  2QSD A;  4DBG A;  4LDT B;  4TSS A;  3TUO A;  2V3P A;  4I6L B;  1BXT A;  2KQ4 X;  3PRM B;  2WDT B;  2R2Q A;  3ZW3 A;  3GB1 A;  5HG2 A;  3U7Z A;  1PQS A;  5EE0 A;  1TIF A;  5L95 C;  3LN6 A;  1WR1 A;  3BWU D;  5BYQ A;  2KVR A;  3QJZ A;  4KKJ A;  2UYZ B;  3BIN A;  4ANV A;  2MEK A;  3SFE B;  4DXF A;  2MCN B;  1FEH A;  4K3C A;  4KDI C;  4R3D A;  2KMC A;  2WXQ A;  3L10 B;  3HVZ A;  3HK0 A;  2JRH A;  1YQ4 B;  2KDI A;  3ZJU A;  2DWQ A;  3VTW A;  3W5V B;  3T8M A;  1GJZ A;  1V97 A;  1F52 A;  4PS7 A;  3RYT A;  3VTV A;  1C4A A;  4AUQ C;  4K7S A;  4IKG A;  2QCZ A;  2LUE A;  3PLU A;  1ZUD 2;  3M62 B;  4L23 A;  2LJI A;  2BYF A;  1MI0 A;  2ZZP B;  1CRK A;  2IZV B;  2BWE S;  3N32 A;  4EUT A;  2BYT A;  1J7A A;  3NS8 A;  3QWZ B;  1E8X A;  2LGD A;  1I4X A;  2MBQ A;  1YD8 U;  3WAL A;  3NZT A;  3PRE A;  1D3Z A;  1GOZ A;  4OZA A;  4Q2R A;  1V1O A;  2B76 B;  1K51 A;  3TEW A;  2J53 A;  1NI2 A;  4DWF A;  5HHD G;  1EWC A;  1SBB B;  3DBL B;  1UNS A;  4GVZ A;  2W3R A;  2PMV A;  4AQ7 A;  2JT4 B;  4X57 B;  3Q14 C;  3RI7 C;  2AL6 A;  4HLE A;  5D3D A;  3SHQ A;  3CST A;  3B2F A;  2W3S A;  1NYR A;  3JSV A;  2WXP A;  4HPL B;  1U4A A;  1V2Y A;  4PS8 A;  2D2Q A;  2WXR A;  2W9N A;  1YIW A;  3U30 A;  1WRI A;  2J4X A;  3LVV A;  2LJ5 A;  1VA6 A;  1N6Z A;  5J17 A;  2HTM E;  2BQQ A;  3DBL I;  4EZK A;  3VRB B;  2YEP B;  1ROE A;  2RD0 A;  2M4N A;  2DX5 B;  5LXH A;  3W1Y A;  1FFV A;  1YJJ A;  3VR9 B;  2FE8 A;  2WGS A;  1QH4 A;  2KD0 A; 
#chains in the Genus database with same CATH homology
 2UU7 A;  1FPY A;  4S0R A;  2OJW A;  1M15 A;  3L2D A;  4BAX A;  1HTQ A;  1BG0 A;  1CRK A;  4RF8 A;  4HPP A;  3ZXV A;  2BVC A;  4XYC A;  4GVY A;  4AM1 A;  1F1H A;  3JQ3 A;  1P52 A;  4ACF A;  4LNF A;  1RL9 A;  3JU5 A;  5J9A A;  2J1Q A;  1HTO A;  1SD0 A;  1U6R A;  1VRP A;  3L2E A;  3DRE A;  3M10 A;  4LNN A;  3DRB A;  4BG4 A;  4BHL A;  4LNO A;  4GVZ A;  5J99 A;  3FKY A;  2WHI A;  3ZXR A;  1G0W A;  4RF9 A;  1QK1 A;  4GW2 A;  4LNI A;  4Q2R A;  3NG0 A;  2QC8 A;  1F52 A;  1LGR A;  4LNK A;  4RF6 A;  1QH4 A;  3JPZ A;  2D3B A;  2GLS A;  2D3C A;  4S17 A;  2CRK A;  1I0E A;  3JU6 A;  3L2E B;  4RF7 A;  4Z9M A;  4BG4 B;  3B6R A;  2WGS A;  4GW0 A;  2LGS A;  2D3A A;  1P50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...