2WGSA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor.
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
475
structure length
463
Chain Sequence
KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMINE SYNTHETASE 1
publication title Structural Basis for the Inhibition of Mycobacterium Tuberculosis Glutamine Synthetase by Novel ATP-Competitive Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 150
structure length 463
sequence length 475
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2009-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2wgsA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 2wgsA02
4S0RA 3ZXVA 4GVZA 1HTQA 4GW2A 3JU6A 1QK1A 2WHIA 1SD0A 2D3CA 2J1QA 4RF6A 4XYCA 2D3AA 2WGSA 1F52A 1I0EA 4LNNA 5J99A 4S17A 4Z9MA 4RF9A 1HTOA 3FKYA 4LNFA 4ACFA 3DRBA 3L2DA 3JPZA 3L2EB 4Q2RA 5J9AA 2BVCA 1CRKA 2LGSA 1P50A 1F1HA 1M15A 1VRPA 3JU5A 4HPPA 2CRKA 4RF7A 1P52A 3L2EA 4BG4B 3DREA 4AM1A 1BG0A 2D3BA 4GW0A 4LNIA 4GVYA 1G0WA 3B6RA 2GLSA 4BAXA 2QC8A 1RL9A 4RF8A 4BG4A 3NG0A 3ZXRA 1QH4A 4BHLA 2OJWA 4LNOA 1LGRA 2UU7A 4LNKA 1FPYA 1U6RA 3M10A 3JQ3A
chains in the Genus database with same CATH superfamily
4US9A 4FLHA 1IGCA 2N9EB 2J0JA 3P4PB 2KFJA 1VDVA 2PKOA 1TT4A 4ZDVA 4ANXA 3WCQA 1MVKA 1WR6E 3DVNV 2CJOA 4GSWA 1M4VA 2FCQA 3DREA 2LHEA 2M0AA 4I6PA 2BYTA 3ABVB 4LNOA 3ZNID 1MI0A 4EUTA 1E10A 1SXTA 2D3GA 1V8CA 4K3BA 3ZW3A 5CHWA 1C4CA 2DZKA 2KVRA 1RFAA 5D3DA 3ONSA 1WJUA 1WR1A 2KAJA 4FHKA 4GW0A 2WNMA 4O1NA 3IAM1 5D7GA 4JX1C 3L0WB 1FCCC 4KVGB 3R8BA 2ICIA 1L5PA 4RF0A 2OHFA 1SE4A 1JROA 3R7QA 1SBBB 3VRBB 4GDLA 2LZ6A 1IBXA 3V3XA 3P4QB 1QOAA 4C4VB 2VRRB 2PVGC 1K50A 1I4XA 2MCNB 2MBQA 1WYWB 3W1SC 1NDDA 1F9JA 2O6VA 1S1QB 4M00A 3DHHC 2LEKA 3W5VB 1P1AA 2WXQA 1WY8A 1F2RC 1SB3C 3KUDB 4N9F4 3OLMD 2KDEB 3J9CA 1SE2A 1B1ZA 2JZPA 2Y5CA 2L0FA 3MTNB 3HM3A 3OWEB 4A9AA 4K3CA 4JWUC 2BVCA 1H4RA 3P4SB 5I4DA 2K39A 4RGNA 3ZGZA 4E71A 2KKCA 1R4NB 2K8CA 2MHJA 2BB6A 2BGFA 4WH4A 3CSTA 2SEBD 2VZKB 2KZRA 2K6QA 3V60A 1YQ3B 2HDEA 2MJ3A 1QF6A 1D5XC 1A70A 3LB8C 4LK0M 4YTMB 5L95C 4J6IA 2DZMA 4WWPA 2XEWA 3R2IA 1WRDB 2BS3B 2K3UA 1T6BX 3GOEA 1ENFA 3GZNB 1YNTE 4HLEA 1QOFA 3AE1B 2Z0DB 4BOZB 4A3PA 2IYDB 3KLSX 5LXIB 5CTRC 1MG4A 2MJEA 3OAWA 3RT3B 2CHXA 4KIKA 4B6WA 2ZW1A 2MBOA 1QT9A 4GXBA 2XNAC 1M15A 4BZAA 5DPTA 2I38A 4NNJB 2Y5BB 4IWOA 1TTNA 3N32A 3MP9A 2CS4A 5D6JB 3PRZA 2N9LA 3NJTA 1TS3A 4C00A 3RNBC 3U52E 3SD5A 2KMAA 3KQ4A 5D94A 3ZLZA 3A9JA 3X23A 2E3TA 4MH8A 1T3QA 4HWIB 2K9XA 5HG2A 2FIDA 4DDGD 3IG5A 3U4EG 3BK2A 1ZW7A 1K51A 3RNGC 1VZ7A 2N7EA 1E90A 3AE8B 4DDID 4DHZE 3Q2AC 5TSSA 5LNK1 3JYUA 1KLVA 1ZP0B 2OOBB 1MFWA 2H89B 2RPQA 1PGBA 3Q3OC 5JXVA 3Q8BA 2KQ4X 3ZNZB 2KX3A 2BB5A 3RZFA 1XCQL 2NPTB 3PZ8A 2L7RA 2ZZPB 2FCSA 2ZVOA 1LGRA 4HPLB 1E5WA 1SE3A 2CU3A 1ZPSA 4MGIE 1CJEA 1OQYA 1YN5A 1D6EC 3T3OA 3K9PB 3SDLC 2M4NA 2BWES 2LJ5A 3NS1A 2D3BA 2FUG1 3ETRA 3NZUA 3M95A 3N1YC 3P1MA 1FFVA 3VXWA 3JQ3A 1C76A 3UIPB 3FAHA 4A90A 1AARA 1KFYB 2KD0A 1C4PA 2O2VA 2WLBA 1TS5A 2C7HA 4M8MA 3RCZA 3E9SA 2RMMA 3WAMA 2QSDA 4KX6B 2DBYA 4C7YA 2LFIA 2KX0A 2N4FA 2WDRB 2XK5B 3KUZA 1HZ6A 3H1UA 4YWGG 4B0EA 3IT6B 2KWCA 4HVBA 1JALA 3DCGA 3NUHB 5HKHA 4DK5A 2BYFA 3VRAB 1SGHA 1P0RA 3P2BA 3DBRI 2WX1A 1D3ZA 3L13A 2JYEA 3MHSD 1UELA 4ANUA 1KM7A 3AE9B 4W9JA 3C8YA 1RLFA 5EE9A 2ZNVC 1N62A 2Z59B 1TT5B 1OEYA 4PYUA 1CZPA 3L10B 3A4RA 4NJCA 5BO4B 1FCLA 1J7BA 5TR5A 3AXCA 3UF8A 1HQRD 1JWAD 2KFKA 4L2YA 4RM8A 5EE1A 4AQ7A 1V80A 2CR5A 1K8RB 3BYYB 1FFUA 4IM3A 2KDMA 3V62A 2B3AA 1JW9D 2MP2B 1E7VA 2YLMA 2X38A 4RM9A 3QWZB 3ENEA 4W9KA 3QJZA 3IHPC 2WDVB 4DXGA 1PGXA 2IDYA 1SIJA 4ZRIA 1E8YA 5H92C 3QX1A 2FCMA 2GLSA 2LXAA 3IFWB 4XGAB 2L83A 1Y8RC 3U7DA 2PE9A 2J4XA 3ZQ4A 3A1QA 2IO0B 5E6OA 4BFRA 3PO0A 3Q8CA 4EZJA 3ZNHB 3SR6A 1NENB 1I0EA 5FKAC 1QZEA 1XT9B 2GOWA 1Q5WB 3AEEB 3N30A 2J7QB 3VHTC 3DBHB 2ON8A 1VJKA 4RGMA 3BY4B 3IXSA 2JF5A 2TSSA 1EWYC 1D4BA 4K81A 3AU5A 4ZYNA 2K6DB 3U7ZA 4YTNB 1T0QC 3UIOB 4W9EA 2MBBB 1XO3A 4ANVA 3I5JC 3PV1A 2IJ0A 3EFUA 4EFOA 2WXKA 2X8XX 1KOTA 1UUPA 4W9CA 1MG8A 1M94A 2GBMA 2V3SA 3DPDA 1T5XD 4LCDE 3AH7A 1FNUA 1YJJA 2L1AA 2GWCA 4GOCA 1FNVA 2WX0A 3LVVA 2WP9B 1KF6B 2K5PA 3WALA 3BK1A 2Q5WD 3ZTCA 3PLUA 5AZGA 4IWPA 3L2EA 5MPOA 2QDFA 3TCAA 1WE7A 1R4NI 3CWIA 4YXDB 2MBEA 1NI2A 2FIFA 5HI1A 3GE8C 2J0MA 2ZPYA 4GDKA 3W9CB 1UNSA 1IP9A 5JHBA 1LM8B 3H8HA 2WXPA 1KH0A 2RD0A 1E8XA 3VVWB 1GPXA 3JW0X 1UH6A 1I4GA 4M0WA 3B1LX 1U6RA 3GZNI 1GOZA 2Z8LA 2D32A 1WGRA 2G9HD 3RNFC 1ROEA 1F52A 1ZUD2 1TYGB 4II2B 5IO9A 1ZXIA 4XWTA 2LVOA 1L4ZB 3VTVA 3AE6B 4ZRJA 3B2FA 4KZCA 1YJ1A 5D3IB 2G4SA 4M8NA 1JQ4A 2N9KA 2PPHA 3DWGC 3PZDA 3SHQA 2KJ6A 3NOBA 3SU8X 4FHJA 3A9KB 5BYQA 2BBCA 2K0PA 2D2QA 2D10A 2WHIA 4J3OD 3I9V1 1FXAA 5E6PA 2JU6X 2R2QA 3AE4B 4NAWB 4ACFA 1XLNA 3KWLA 1WXAA 3DVGX 4RFBA 3LDZE 2FNJB 2KACA 4AM1A 2MLBA 2J53A 2LASA 3TUOA 2AYOB 2ACZB 5KHOA 5G55A 3QIJA 4HRSA 3FC4A 3DOWA 4WJPA 2QHOA 1V5TA 1GC7A 4BKSD 4X57B 2KT7A 2RDBC 4NPNA 2L05A 4LJOB 2BS4B 4L1BA 1WF9A 1IYFA 4AUQC 2VH1A 4BAXA 1Q1OA 4LNFA 4MJSB 1I42A 4LDTB 1SE9A 2WGSA 5J99A 2KTRB 5CHVC 2BYVE 4KZ0A 4BKTA 5AUKA 2IGHA 4NAMA 2E6XA 4ZRQA 3M62B 5BMGA 1G0WA 2KMCA 2D07B 1TIFA 1VA6A 2KVZA 1U4AA 3VQIA 1AW7A 4WAAA 4RF6A 2D3AA 1TJEA 1WRIA 4K7UA 1IBXB 2CU1A 3MC0B 2PVOD 3CMMB 1V81A 2MW5A 4JGHB 1VRPA 3HVDA 3DBLB 2M0XA 4FN2A 2O6VB 3AE3B 4CHKA 3DHGC 2UWQA 1I4QA 2INDC 1XLPA 4AP4C 4WWOA 3QQ8B 1OQQA 4MH0E 4MSQB 3TEZA 1YQBA 2A5UA 2BPSA 1R7SA 1FNWA 3RNEC 2KJRA 4EZKA 1TKGA 4NY0A 2K22A 3QAQA 5FK9C 4ARCA 2JZ3B 3ZXVA 1YMHE 3H7SA 4NJ6A 5C1ZA 2MX2A 3NHEB 3TSSA 2QMTA 2NMQA 2WXLA 4BBNC 1F1HA 2DLBA 2MEKA 4G11A 4IG7B 1WIAA 4W9DA 4ZRKA 2WXJA 4II3B 3DBSA 4E74A 2KTFA 1QK1A 2JVCA 2DENB 2KC1A 3WAPA 1ZE3D 4RF9A 4MACA 2D5GA 1UBIA 3JSVA 2JY6A 2HJ8A 3ZVVA 2WU5B 1B9RA 4HKQA 1E9MA 2KWDA 5GXGB 5IOIA 1XLOA 4IC7B 4LNKA 4WWNA 2M19A 2K25A 4WWMA 4MM3A 1MPEA 4KIKB 2JX5A 3Q3MC 2IO3B 1OQRA 1RYJA 2QCZA 3AULA 1JWSD 3W2DA 5BYRA 4OZBA 1N6ZA 3IG8A 3OJ3A 1OTRB 1RRBA 1YX5B 2IO1B 2WDTB 5J9AA 3MFGA 3PRMB 3TEXA 1YQ4B 1L7YA 2QIEB 3RULA 2NTTA 2N0SB 3DBHI 4PT5A 4KKIA 4IDIA 3BVZA 4DXAB 1GG3A 3ZDMC 1A5RA 1V1PB 1UD7A 4S0RA 1WJ4A 4F7ZA 2R2OA 3NZ3A 4IM2A 3PT2B 1TY0A 1FXTB 1L4DB 5H8YE 2RDGA 1F77A 2EKIA 3T8MA 2NS5A 1QILA 3WA0A 1HXYD 2LGIA 3N20C 3UQAA 2KHWB 2KWUB 2LUEA 1TY2A 4W9LA 3RYTA 2C5LC 1I4PA 1N5WA 2NBWB 3ZUNA 5EE0A 1GJZA 1P9DU 3WIMA 4IWQA 3PRPB 3ZDTA 2WXNA 4EZLA 2PE6B 4K7WA 3KUCB 4DHJB 2L0TA 3KH0A 4AJYB 2WXOA 4LLGM 3VAWA 3ZRCA 1Q10A 3K9OB 2QJLA 3RN9C 1FM0D 1WX7A 1TS2A 3PTFC 4M02A 1SF0A 2PW9A 3BVGA 3B9JA 4XE0A 4HCPB 3EHVA 2AWTA 1N61A 1K52A 2XN9C 3NVYA 3KYDD 1WX9A 3VTWA 1VLBA 2VZKD 4GB9A 3C19A 3ZKJC 1TZOA 3RFZB 2RR9A 5DPRA 1XLQA 3PHWB 1P7EA 3PHXB 4XWWA 2N1VA 4NQKE 2GI9A 2DHZA 5C23A 1JWMD 1E6EB 1MJDA 1WXMA 3DVNU 4RF8A 1WWTA 2YEPF 3DQVA 2BYEA 3RUIB 4UDUC 3MC9A 3Q8EA 1ET6A 2MH7A 2KN4A 2IGGA 1P7FA 2N9XA 2Y3AA 2KLCA 4JL9A 3QCAA 4C7ZA 4HPPA 2BKRB 1N60A 3N1XC 2MBHA 3LXFA 4PYZA 5EE3A 3B08A 2LGYA 2NPTA 4WURA 3P4RB 1FRRA 1WJNA 3X0WA 2C60A 1HTQA 2C9WB 2L8JA 3OG5A 1VZ8A 1C78A 3VFKA 2KFKB 4BOSC 1WGHA 1ZGUB 3BYTB 2ZEQA 1V86A 2JZZA 3DHIC 4ANWA 1D5MC 2LRWA 1NYQA 4RF7A 4G50A 5BYSA 3HUIA 4RNAA 3HIZA 1BG0A 1SJHD 2RPVA 2AEHA 4MEMA 4BG4A 2K8BA 2QEJC 1XF5L 2DX5B 3AE7B 4GGQA 3PGEA 2W3RA 4W9FA 1YIWA 1WXQA 3BZDB 2FAZA 1J19A 1I4RA 2WWZA 3I3TB 4H2AA 4B95A 4A20A 1IGDA 2HTME 2BWFA 3TEYA 4XDDA 3B6RA 1RL9A 2INCC 1GC6A 5CHFA 1Z2MA 4DXFA 2XK5A 3GB1A 3PLVA 3V61A 4GVZA 1FRDA 1YN3A 4DBGA 5IP4D 2DZIA 3RMKC 3GP7A 3NVZA 2J42A 5IKCM 2YVCA 2NR2A 1E8ZA 4R3DA 2WDQB 2WXFA 5IA7A 1C1YB 4JE3B 1ZDXA 5EDSA 2CKHB 3RZWC 3RD2A 4ITKA 2DAFA 1AYFA 3AM9A 1QH4A 4JPSA 2R61A 3U8ZA 4IW0A 5J17A 1IPGA 2KDBA 3HM6X 2JYTA 3EUB2 3IVFA 3M63B 1C9FA 2V3PA 3W1YA 2GBNA 3NRZA 2L00B 2V3NA 1P52A 1JRPA 2WU2B 1VZ6A 3FILB 2JT4B 3NVWA 2ZNVB 3DVGY 1PQSA 3EFCA 2KDFB 4PS7A 1PGAA 2MP2A 3O13A 2DYBA 2L3ZA 1CMXB 1XCTL 2V1YA 4KSKC 1T0YA 3UI3A 2QILA 3KYCD 3FKYA 1RFKA 5J2RA 3ZJTA 1STEA 2PLPA 4OZCA 4FADA 1WX8A 2IY0B 4L23A 5C2TB 5BMIA 2LRUA 2C7NB 4USAA 2NBVB 3PSEB 5JZEB 1CK1A 3ZTDA 1D5ZC 1FPYA 2KANA 4F1SA 3LJ3A 1L6VA 4GDKB 3ZJUA 1T0RC 4TQ0A 1HE8A 2N7JA 2G1EA 3PREA 1KLGD 1YD8U 2RGFA 4P16A 1WMHA 3Q3NC 1MHXA 1K53A 2W3SA 1WH3A 3AEAB 4NZLB 4RGOS 4HJKA 2NTSA 1V2YA 1IUEA 3H7PB 1I4HA 2KK8A 3BWUD 2GBKA 2AL6A 1V9JA 4XX5A 4BBNF 2LGSA 3AEDB 3L4PA 2AQ3B 2N9PC 1RAXA 1G6JA 1FEHA 1L0YB 4P7IA 1WSPA 2DYMA 1OEYJ 3AI5A 2LHDA 3APCA 3V6CB 1JCKB 2KQSA 1UWMA 3HVZA 4ZRPA 1J7AA 1WXSA 1PFDA 2EMSA 1WI0A 4BKSA 4DQOC 3ZRFA 3AU4A 4CYEA 3Q14C 3NZTA 5AEKB 4OZAA 2M8SA 4A8XC 1EM7A 1ET9A 4S17A 4REZA 1XD3B 3T3NA 2JQRB 3JPZA 1BMLC 3P42A 3B2GA 4BVUC 3AN1A 2BT6A 2SAKA 4YSXB 1DOYA 3R3MA 4TQ1A 1YJIA 1ACCA 5DPSA 2HTHA 2LGXA 2J52A 1HEZE 2YEPB 1WM3A 3M10A 2HD5B 2J1QA 4ICUA 2L76A 2Z0EB 2ASQA 4F8CB 4NQLB 2LJIA 4Z9MA 4MSMB 1NVID 2WXMA 4FA6A 3Q69A 4N59A 2I1KA 2WXHA 2IPKD 2AL3A 2KYWA 3BIID 1CQVA 2V9HA 4JIOU 2EELA 1H8CA 3DWMA 3NY5A 4GW2A 3A9KA 1ZOYB 4HEA1 1Q0WB 4QAYA 4HCNB 1V1OA 2ZJDA 2IGDA 3DBRB 3KWVA 2VH2A 2IY1B 4FULA 3EA6A 4FJZA 3LN7A 5KHQA 3MJWA 1WZ3A 3PZ7A 4HKZE 1GUAB 2KDIA 1NI3A 4GDLB 3N9YC 3HK0A 4PS8A 2MSED 2CRKA 1LQBA 3A33B 5IN7A 5E6NA 3EGRA 2B76B 4HXDA 3UINB 2W55A 5CX3A 5JH5C 4A3OA 3GS2A 4G3XB 4MJSA 1ZXHA 3SEBA 3TMPB 3ZYYX 4KGRA 2FBWB 1SJED 1C77A 1VRAB 2KO3A 2KTRA 1CRKA 3Q3FA 3NS8A 2NBUA 3C0RB 4KSLC 1DYQA 3M3JA 1V97A 2LUMA 2M17A 1FXIA 2WXIA 2D3CA 2L32A 2EKEC 3JSVB 4MDKE 3ZJVA 2AQ1B 1KRHA 1WGKA 4Q2JA 4ASWC 3RNCC 2RDHA 2INPE 2M56B 4LNIA 1GAQB 4MM3B 3R66C 1EF5A 2JXXA 4BHLA 1DGJA 1L2NA 4LDTD 2DYOA 3RPFC 4IOIE 2WXRA 2G4DB 3QA8A 4GMVA 3LVWA 2JRIB 2LWPA 1N63A 2KXJA 2ZPNA 4K7SA 3MC8A 1GB1A 1HZ5A 1JWBD 1R4MB 4C4VA 2D33A 3VH3B 2PJHA 3CSFA 2LMCA 4HPMB 3V05A 3AEGB 1TBEA 2ZVNA 1L0VB 4OHJA 1KTKA 1RWSA 2KWVB 3LYYA 2INNE 4OVUA 1BT0A 3MHZA 4LTUA 3O65B 2JPHA 2O6VD 3IG3A 3ML8A 4W9HA 2BQQA 4US8A 3PVLA 3APFA 4W9IA 1WM2A 3I57A 3U30A 2BS2B 4AOFA 1Z5SB 4ZYSA 3A9JB 1L0XB 1LXDA 2RSUA 1E0ZA 1SIFA 4FJYA 2IO2B 4YSZB 3V6EB 1I7HA 2FCNA 1V4GA 2C7MB 3CIRB 4TMAB 1Y56A 3WAOA 3JVZX 4TKNA 1DOIA 2EMTA 5C3JB 1ZKHA 2LVPA 2V4LA 1RM6C 1PYWD 3P63A 3VDZA 2KN5A 4FBJB 3TL5A 2KLGA 4CQNA 3VR8B 3QHTA 2GRIA 1V49A 3Q6BA 3TEWA 3ZIMA 1V1PA 1OGWA 5G5GA 3W1SA 1LO5D 4RCOA 4FJVB 2UYZB 4TUUA 4Q2RA 4HDOA 3U2SC 4IKGA 4EEWA 4XC2A 4KDIC 3DDCB 4OVVA 4GN1A 4ZHOA 3VTUA 5AZFA 4YTPB 2GWDA 5IAAC 2O2VB 3R2TA 4MGKE 2D11A 3AECB 4A6QA 2LI5A 1N5XA 1UWXA 2NCNA 1WJ6A 1KLUD 2G3QB 1QOBA 1TKEA 3PS6A 4ZOHC 4ZHPA 2REXA 2XBBC 3PPAA 4YSYB 5HHDG 4URKA 3VH4B 1OFFA 3H9DA 3B0AA 2WYQA 2G45B 3L16A 4N6EB 2QC8A 2KNBA 1X1MA 3ECIA 2JUOA 3APDA 3CF6E 5J18A 3KVFB 4FXCA 4YL8A 3AEBB 3S2AA 4ICVA 2IBIB 2AX5A 4B0MA 3ZNGC 4BG4B 2GBRA 1KJTA 1WXVA 4GVYA 4TV3A 2W54A 2OJWA 2K8HA 1WGGA 1YX6B 2DWQA 2MQJA 1E8WA 4DWFA 1V5OA 3AE2B 3LN6A 1NYRA 2MJDA 1WGYA 3ZO5B 3IT4B 2MA9B 3MJ5A 1ZDVA 4KGSA 4GLSC 2IZVB 4EOYA 1LFDA 4DHJD 3NVVA 4XZ4A 4JWSC 5FR3A 3IAS1 5HFYA 3TBLD 3E56A 1PUTA 4EE2A 2OJRA 3W5UB 3GE3C 1E7PB 2I1JA 4XYCA 4OVZA 4RGTA 2L52A 2JXTA 3R7RA 1T0SC 2LD9A 1SSNA 1YN4A 2MRPA 4HDQA 4P1BC 3NZSA 3AMZA 5G5HA 2KQ7A 4P6VF 1I35A 2JWZA 3A1QB 1L6UA 2KJHB 3HHMA 2CHZA 4BKGA 4RMAA 5DPWA 4GIVA 5GMVA 2PTLA 1QLBB 1GNUA 1AN8A 4P1CC 5L83A 2N7DA 1QKZA 3Q3JA 3UQBA 1P98A 4K1RB 2FE8A 3DBLI 1TGZB 1R8GA 1VCBA 2CJNA 2AQ2B 4C56C 4AJWA 5FR6A 1WE6A 1FMAD 1C4AA 4HK2A 2LVQA 4WJQA 2FUHB 3Q8AA 4M01A 1UZXB 4ARIA 2PEAA 2Y5PA 4A55A 1WYGA 3VR9B 3AB5A 3I63C 1TS4A 4W9GA 5AZHA 2KOXA 4KV2A 1S3SG 1BXTA 3BVMA 2W82A 2A4ZA 5LLIA 1V6EA 1PDXA 4TSSA 3D32A 2V4IB 1HTOA 2ZCCA 3L2DA 1WMHB 3L08A 3L2EB 4IM0A 2ZCBA 2LXCA 4LJPB 4KGTA 4MGZE 4WQMA 3EECA 3VUYA 2UU7A 1VD2A 4PK1A 3WANA 2DNFA 4HJGE 1WFYA 1SD0A 1ISNA 2GBJA 1QOGA 4LNNA 4E3CA 1VR9A 3N3KB 4I6NB 1EU4A 3A4SC 1C3TA 2BKFA 1C79A 2PMVA 4M0WB 4DHZB 4EKUA 2JRHA 4MELA 4D2KA 1R4MI 3FILA 4C80A 3ML9A 2DAJA 3QC8B 4JQWC 5DCNA 1XQQA 2I2YA 3AEFB 2N1WA 2HJ1A 2K1FA 1P3QU 3DRBA 1JRUA 1P50A 1EWCA 3JU5A 3RNAC 2ZW0A 1XXGA 5E6JA 1UBQA 1J0GA 3T9LA 2WS3B 2GB1A 2M1MA 1YOVB 5JHAA 4N58A 4IUMB 2PIAA 4WJNA 1FIQA 2MWSB 3L17A 3AV8A 2KC2A 2OEDA 1EO6A 4PS3A 3OJ4B 3IBEA 1F2RI 3KW5B 3BINA 4OW0A 3VUWA 3NG0A 3ZXRA 4RF1A 2NVUI 3QARA 4RH6A 1JWUD 4NJ7A 1HA5A 1NEKB 4WJOA 2BTEA 1WGDA 2CHWA 3H7PA 1BUIC 3N1ZC 3SFDB 5T8IA 1XEEA 4HROA 1SEBD 4YT0B 2H88B 4KDLB 5BMHA 4JLCA 1NBFC 4WIPA 2WQYB 3ALBA 2V0GA 3TJPA 4GU2A 1WZ0A 4I6LB 2BW2A 1MHHE 1FD6A 1F0ZA 2W9NA 2DZJA 1QQRA 5G2NA 3URYA 4AS1A 3Q8FA 4KKJA 1EF1A 2JSVX 1J7CA 4G0NB 1AWDA 1EU3A 1E7UA 2LGDA 2BF8B 3UGBB 3AE5B 3VUXA 2JWUA 3QK0A 1J8CA 2WXGA 1TZ1A 3EC8A 4AWJA 2HE7A 1JMLA 5D2MB 3RI7C 1EUVB 2GMIC 3JU6A 3SFEB 5AUIA 4CO7A 3L54A 4MGYE 1GB4A 2ONQA 2KMMA 4B9KA 1ESFA 4XDCA 3H6NA 1UGJA 1UGMA 4NAWA 5LXHA 4WQOB 1DOXA 1TKYA 3TIXA 1FO4A 4WAFA 1UF0A 2J0KA 3HRDD 4MT5A
chains in the Genus database with same CATH topology
4S0RA 3ZXVA 4GVZA 1HTQA 4GW2A 3JU6A 1QK1A 2WHIA 1SD0A 2D3CA 2J1QA 4RF6A 4XYCA 2D3AA 2WGSA 1F52A 1I0EA 4LNNA 5J99A 4S17A 4Z9MA 4RF9A 1HTOA 3FKYA 4LNFA 4ACFA 3DRBA 3L2DA 3JPZA 3L2EB 4Q2RA 5J9AA 2BVCA 1CRKA 2LGSA 1P50A 1F1HA 1M15A 1VRPA 3JU5A 4HPPA 2CRKA 4RF7A 1P52A 3L2EA 4BG4B 3DREA 4AM1A 1BG0A 2D3BA 4GW0A 4LNIA 4GVYA 1G0WA 3B6RA 2GLSA 4BAXA 2QC8A 1RL9A 4RF8A 4BG4A 3NG0A 3ZXRA 1QH4A 4BHLA 2OJWA 4LNOA 1LGRA 2UU7A 4LNKA 1FPYA 1U6RA 3M10A 3JQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S0R A;  3ZXV A;  4GVZ A;  1HTQ A;  4GW2 A;  3JU6 A;  1QK1 A;  2WHI A;  1SD0 A;  2D3C A;  2J1Q A;  4RF6 A;  4XYC A;  2D3A A;  2WGS A;  1F52 A;  1I0E A;  4LNN A;  5J99 A;  4S17 A;  4Z9M A;  4RF9 A;  1HTO A;  3FKY A;  4LNF A;  4ACF A;  3DRB A;  3L2D A;  3JPZ A;  3L2E B;  4Q2R A;  5J9A A;  2BVC A;  1CRK A;  2LGS A;  1P50 A;  1F1H A;  1M15 A;  1VRP A;  3JU5 A;  4HPP A;  2CRK A;  4RF7 A;  1P52 A;  3L2E A;  4BG4 B;  3DRE A;  4AM1 A;  1BG0 A;  2D3B A;  4GW0 A;  4LNI A;  4GVY A;  1G0W A;  3B6R A;  2GLS A;  4BAX A;  2QC8 A;  1RL9 A;  4RF8 A;  4BG4 A;  3NG0 A;  3ZXR A;  1QH4 A;  4BHL A;  2OJW A;  4LNO A;  1LGR A;  2UU7 A;  4LNK A;  1FPY A;  1U6R A;  3M10 A;  3JQ3 A; 
#chains in the Genus database with same CATH topology
 4US9 A;  4FLH A;  1IGC A;  2N9E B;  2J0J A;  3P4P B;  2KFJ A;  1VDV A;  2PKO A;  1TT4 A;  4ZDV A;  4ANX A;  3WCQ A;  1MVK A;  1WR6 E;  3DVN V;  2CJO A;  4GSW A;  1M4V A;  2FCQ A;  3DRE A;  2LHE A;  2M0A A;  4I6P A;  2BYT A;  3ABV B;  4LNO A;  3ZNI D;  1MI0 A;  4EUT A;  1E10 A;  1SXT A;  2D3G A;  1V8C A;  4K3B A;  3ZW3 A;  5CHW A;  1C4C A;  2DZK A;  2KVR A;  1RFA A;  5D3D A;  3ONS A;  1WJU A;  1WR1 A;  2KAJ A;  4FHK A;  4GW0 A;  2WNM A;  4O1N A;  3IAM 1;  5D7G A;  4JX1 C;  3L0W B;  1FCC C;  4KVG B;  3R8B A;  2ICI A;  1L5P A;  4RF0 A;  2OHF A;  1SE4 A;  1JRO A;  3R7Q A;  1SBB B;  3VRB B;  4GDL A;  2LZ6 A;  1IBX A;  3V3X A;  3P4Q B;  1QOA A;  4C4V B;  2VRR B;  2PVG C;  1K50 A;  1I4X A;  2MCN B;  2MBQ A;  1WYW B;  3W1S C;  1NDD A;  1F9J A;  2O6V A;  1S1Q B;  4M00 A;  3DHH C;  2LEK A;  3W5V B;  1P1A A;  2WXQ A;  1WY8 A;  1F2R C;  1SB3 C;  3KUD B;  4N9F 4;  3OLM D;  2KDE B;  3J9C A;  1SE2 A;  1B1Z A;  2JZP A;  2Y5C A;  2L0F A;  3MTN B;  3HM3 A;  3OWE B;  4A9A A;  4K3C A;  4JWU C;  2BVC A;  1H4R A;  3P4S B;  5I4D A;  2K39 A;  4RGN A;  3ZGZ A;  4E71 A;  2KKC A;  1R4N B;  2K8C A;  2MHJ A;  2BB6 A;  2BGF A;  4WH4 A;  3CST A;  2SEB D;  2VZK B;  2KZR A;  2K6Q A;  3V60 A;  1YQ3 B;  2HDE A;  2MJ3 A;  1QF6 A;  1D5X C;  1A70 A;  3LB8 C;  4LK0 M;  4YTM B;  5L95 C;  4J6I A;  2DZM A;  4WWP A;  2XEW A;  3R2I A;  1WRD B;  2BS3 B;  2K3U A;  1T6B X;  3GOE A;  1ENF A;  3GZN B;  1YNT E;  4HLE A;  1QOF A;  3AE1 B;  2Z0D B;  4BOZ B;  4A3P A;  2IYD B;  3KLS X;  5LXI B;  5CTR C;  1MG4 A;  2MJE A;  3OAW A;  3RT3 B;  2CHX A;  4KIK A;  4B6W A;  2ZW1 A;  2MBO A;  1QT9 A;  4GXB A;  2XNA C;  1M15 A;  4BZA A;  5DPT A;  2I38 A;  4NNJ B;  2Y5B B;  4IWO A;  1TTN A;  3N32 A;  3MP9 A;  2CS4 A;  5D6J B;  3PRZ A;  2N9L A;  3NJT A;  1TS3 A;  4C00 A;  3RNB C;  3U52 E;  3SD5 A;  2KMA A;  3KQ4 A;  5D94 A;  3ZLZ A;  3A9J A;  3X23 A;  2E3T A;  4MH8 A;  1T3Q A;  4HWI B;  2K9X A;  5HG2 A;  2FID A;  4DDG D;  3IG5 A;  3U4E G;  3BK2 A;  1ZW7 A;  1K51 A;  3RNG C;  1VZ7 A;  2N7E A;  1E90 A;  3AE8 B;  4DDI D;  4DHZ E;  3Q2A C;  5TSS A;  5LNK 1;  3JYU A;  1KLV A;  1ZP0 B;  2OOB B;  1MFW A;  2H89 B;  2RPQ A;  1PGB A;  3Q3O C;  5JXV A;  3Q8B A;  2KQ4 X;  3ZNZ B;  2KX3 A;  2BB5 A;  3RZF A;  1XCQ L;  2NPT B;  3PZ8 A;  2L7R A;  2ZZP B;  2FCS A;  2ZVO A;  1LGR A;  4HPL B;  1E5W A;  1SE3 A;  2CU3 A;  1ZPS A;  4MGI E;  1CJE A;  1OQY A;  1YN5 A;  1D6E C;  3T3O A;  3K9P B;  3SDL C;  2M4N A;  2BWE S;  2LJ5 A;  3NS1 A;  2D3B A;  2FUG 1;  3ETR A;  3NZU A;  3M95 A;  3N1Y C;  3P1M A;  1FFV A;  3VXW A;  3JQ3 A;  1C76 A;  3UIP B;  3FAH A;  4A90 A;  1AAR A;  1KFY B;  2KD0 A;  1C4P A;  2O2V A;  2WLB A;  1TS5 A;  2C7H A;  4M8M A;  3RCZ A;  3E9S A;  2RMM A;  3WAM A;  2QSD A;  4KX6 B;  2DBY A;  4C7Y A;  2LFI A;  2KX0 A;  2N4F A;  2WDR B;  2XK5 B;  3KUZ A;  1HZ6 A;  3H1U A;  4YWG G;  4B0E A;  3IT6 B;  2KWC A;  4HVB A;  1JAL A;  3DCG A;  3NUH B;  5HKH A;  4DK5 A;  2BYF A;  3VRA B;  1SGH A;  1P0R A;  3P2B A;  3DBR I;  2WX1 A;  1D3Z A;  3L13 A;  2JYE A;  3MHS D;  1UEL A;  4ANU A;  1KM7 A;  3AE9 B;  4W9J A;  3C8Y A;  1RLF A;  5EE9 A;  2ZNV C;  1N62 A;  2Z59 B;  1TT5 B;  1OEY A;  4PYU A;  1CZP A;  3L10 B;  3A4R A;  4NJC A;  5BO4 B;  1FCL A;  1J7B A;  5TR5 A;  3AXC A;  3UF8 A;  1HQR D;  1JWA D;  2KFK A;  4L2Y A;  4RM8 A;  5EE1 A;  4AQ7 A;  1V80 A;  2CR5 A;  1K8R B;  3BYY B;  1FFU A;  4IM3 A;  2KDM A;  3V62 A;  2B3A A;  1JW9 D;  2MP2 B;  1E7V A;  2YLM A;  2X38 A;  4RM9 A;  3QWZ B;  3ENE A;  4W9K A;  3QJZ A;  3IHP C;  2WDV B;  4DXG A;  1PGX A;  2IDY A;  1SIJ A;  4ZRI A;  1E8Y A;  5H92 C;  3QX1 A;  2FCM A;  2GLS A;  2LXA A;  3IFW B;  4XGA B;  2L83 A;  1Y8R C;  3U7D A;  2PE9 A;  2J4X A;  3ZQ4 A;  3A1Q A;  2IO0 B;  5E6O A;  4BFR A;  3PO0 A;  3Q8C A;  4EZJ A;  3ZNH B;  3SR6 A;  1NEN B;  1I0E A;  5FKA C;  1QZE A;  1XT9 B;  2GOW A;  1Q5W B;  3AEE B;  3N30 A;  2J7Q B;  3VHT C;  3DBH B;  2ON8 A;  1VJK A;  4RGM A;  3BY4 B;  3IXS A;  2JF5 A;  2TSS A;  1EWY C;  1D4B A;  4K81 A;  3AU5 A;  4ZYN A;  2K6D B;  3U7Z A;  4YTN B;  1T0Q C;  3UIO B;  4W9E A;  2MBB B;  1XO3 A;  4ANV A;  3I5J C;  3PV1 A;  2IJ0 A;  3EFU A;  4EFO A;  2WXK A;  2X8X X;  1KOT A;  1UUP A;  4W9C A;  1MG8 A;  1M94 A;  2GBM A;  2V3S A;  3DPD A;  1T5X D;  4LCD E;  3AH7 A;  1FNU A;  1YJJ A;  2L1A A;  2GWC A;  4GOC A;  1FNV A;  2WX0 A;  3LVV A;  2WP9 B;  1KF6 B;  2K5P A;  3WAL A;  3BK1 A;  2Q5W D;  3ZTC A;  3PLU A;  5AZG A;  4IWP A;  3L2E A;  5MPO A;  2QDF A;  3TCA A;  1WE7 A;  1R4N I;  3CWI A;  4YXD B;  2MBE A;  1NI2 A;  2FIF A;  5HI1 A;  3GE8 C;  2J0M A;  2ZPY A;  4GDK A;  3W9C B;  1UNS A;  1IP9 A;  5JHB A;  1LM8 B;  3H8H A;  2WXP A;  1KH0 A;  2RD0 A;  1E8X A;  3VVW B;  1GPX A;  3JW0 X;  1UH6 A;  1I4G A;  4M0W A;  3B1L X;  1U6R A;  3GZN I;  1GOZ A;  2Z8L A;  2D32 A;  1WGR A;  2G9H D;  3RNF C;  1ROE A;  1F52 A;  1ZUD 2;  1TYG B;  4II2 B;  5IO9 A;  1ZXI A;  4XWT A;  2LVO A;  1L4Z B;  3VTV A;  3AE6 B;  4ZRJ A;  3B2F A;  4KZC A;  1YJ1 A;  5D3I B;  2G4S A;  4M8N A;  1JQ4 A;  2N9K A;  2PPH A;  3DWG C;  3PZD A;  3SHQ A;  2KJ6 A;  3NOB A;  3SU8 X;  4FHJ A;  3A9K B;  5BYQ A;  2BBC A;  2K0P A;  2D2Q A;  2D10 A;  2WHI A;  4J3O D;  3I9V 1;  1FXA A;  5E6P A;  2JU6 X;  2R2Q A;  3AE4 B;  4NAW B;  4ACF A;  1XLN A;  3KWL A;  1WXA A;  3DVG X;  4RFB A;  3LDZ E;  2FNJ B;  2KAC A;  4AM1 A;  2MLB A;  2J53 A;  2LAS A;  3TUO A;  2AYO B;  2ACZ B;  5KHO A;  5G55 A;  3QIJ A;  4HRS A;  3FC4 A;  3DOW A;  4WJP A;  2QHO A;  1V5T A;  1GC7 A;  4BKS D;  4X57 B;  2KT7 A;  2RDB C;  4NPN A;  2L05 A;  4LJO B;  2BS4 B;  4L1B A;  1WF9 A;  1IYF A;  4AUQ C;  2VH1 A;  4BAX A;  1Q1O A;  4LNF A;  4MJS B;  1I42 A;  4LDT B;  1SE9 A;  2WGS A;  5J99 A;  2KTR B;  5CHV C;  2BYV E;  4KZ0 A;  4BKT A;  5AUK A;  2IGH A;  4NAM A;  2E6X A;  4ZRQ A;  3M62 B;  5BMG A;  1G0W A;  2KMC A;  2D07 B;  1TIF A;  1VA6 A;  2KVZ A;  1U4A A;  3VQI A;  1AW7 A;  4WAA A;  4RF6 A;  2D3A A;  1TJE A;  1WRI A;  4K7U A;  1IBX B;  2CU1 A;  3MC0 B;  2PVO D;  3CMM B;  1V81 A;  2MW5 A;  4JGH B;  1VRP A;  3HVD A;  3DBL B;  2M0X A;  4FN2 A;  2O6V B;  3AE3 B;  4CHK A;  3DHG C;  2UWQ A;  1I4Q A;  2IND C;  1XLP A;  4AP4 C;  4WWO A;  3QQ8 B;  1OQQ A;  4MH0 E;  4MSQ B;  3TEZ A;  1YQB A;  2A5U A;  2BPS A;  1R7S A;  1FNW A;  3RNE C;  2KJR A;  4EZK A;  1TKG A;  4NY0 A;  2K22 A;  3QAQ A;  5FK9 C;  4ARC A;  2JZ3 B;  3ZXV A;  1YMH E;  3H7S A;  4NJ6 A;  5C1Z A;  2MX2 A;  3NHE B;  3TSS A;  2QMT A;  2NMQ A;  2WXL A;  4BBN C;  1F1H A;  2DLB A;  2MEK A;  4G11 A;  4IG7 B;  1WIA A;  4W9D A;  4ZRK A;  2WXJ A;  4II3 B;  3DBS A;  4E74 A;  2KTF A;  1QK1 A;  2JVC A;  2DEN B;  2KC1 A;  3WAP A;  1ZE3 D;  4RF9 A;  4MAC A;  2D5G A;  1UBI A;  3JSV A;  2JY6 A;  2HJ8 A;  3ZVV A;  2WU5 B;  1B9R A;  4HKQ A;  1E9M A;  2KWD A;  5GXG B;  5IOI A;  1XLO A;  4IC7 B;  4LNK A;  4WWN A;  2M19 A;  2K25 A;  4WWM A;  4MM3 A;  1MPE A;  4KIK B;  2JX5 A;  3Q3M C;  2IO3 B;  1OQR A;  1RYJ A;  2QCZ A;  3AUL A;  1JWS D;  3W2D A;  5BYR A;  4OZB A;  1N6Z A;  3IG8 A;  3OJ3 A;  1OTR B;  1RRB A;  1YX5 B;  2IO1 B;  2WDT B;  5J9A A;  3MFG A;  3PRM B;  3TEX A;  1YQ4 B;  1L7Y A;  2QIE B;  3RUL A;  2NTT A;  2N0S B;  3DBH I;  4PT5 A;  4KKI A;  4IDI A;  3BVZ A;  4DXA B;  1GG3 A;  3ZDM C;  1A5R A;  1V1P B;  1UD7 A;  4S0R A;  1WJ4 A;  4F7Z A;  2R2O A;  3NZ3 A;  4IM2 A;  3PT2 B;  1TY0 A;  1FXT B;  1L4D B;  5H8Y E;  2RDG A;  1F77 A;  2EKI A;  3T8M A;  2NS5 A;  1QIL A;  3WA0 A;  1HXY D;  2LGI A;  3N20 C;  3UQA A;  2KHW B;  2KWU B;  2LUE A;  1TY2 A;  4W9L A;  3RYT A;  2C5L C;  1I4P A;  1N5W A;  2NBW B;  3ZUN A;  5EE0 A;  1GJZ A;  1P9D U;  3WIM A;  4IWQ A;  3PRP B;  3ZDT A;  2WXN A;  4EZL A;  2PE6 B;  4K7W A;  3KUC B;  4DHJ B;  2L0T A;  3KH0 A;  4AJY B;  2WXO A;  4LLG M;  3VAW A;  3ZRC A;  1Q10 A;  3K9O B;  2QJL A;  3RN9 C;  1FM0 D;  1WX7 A;  1TS2 A;  3PTF C;  4M02 A;  1SF0 A;  2PW9 A;  3BVG A;  3B9J A;  4XE0 A;  4HCP B;  3EHV A;  2AWT A;  1N61 A;  1K52 A;  2XN9 C;  3NVY A;  3KYD D;  1WX9 A;  3VTW A;  1VLB A;  2VZK D;  4GB9 A;  3C19 A;  3ZKJ C;  1TZO A;  3RFZ B;  2RR9 A;  5DPR A;  1XLQ A;  3PHW B;  1P7E A;  3PHX B;  4XWW A;  2N1V A;  4NQK E;  2GI9 A;  2DHZ A;  5C23 A;  1JWM D;  1E6E B;  1MJD A;  1WXM A;  3DVN U;  4RF8 A;  1WWT A;  2YEP F;  3DQV A;  2BYE A;  3RUI B;  4UDU C;  3MC9 A;  3Q8E A;  1ET6 A;  2MH7 A;  2KN4 A;  2IGG A;  1P7F A;  2N9X A;  2Y3A A;  2KLC A;  4JL9 A;  3QCA A;  4C7Z A;  4HPP A;  2BKR B;  1N60 A;  3N1X C;  2MBH A;  3LXF A;  4PYZ A;  5EE3 A;  3B08 A;  2LGY A;  2NPT A;  4WUR A;  3P4R B;  1FRR A;  1WJN A;  3X0W A;  2C60 A;  1HTQ A;  2C9W B;  2L8J A;  3OG5 A;  1VZ8 A;  1C78 A;  3VFK A;  2KFK B;  4BOS C;  1WGH A;  1ZGU B;  3BYT B;  2ZEQ A;  1V86 A;  2JZZ A;  3DHI C;  4ANW A;  1D5M C;  2LRW A;  1NYQ A;  4RF7 A;  4G50 A;  5BYS A;  3HUI A;  4RNA A;  3HIZ A;  1BG0 A;  1SJH D;  2RPV A;  2AEH A;  4MEM A;  4BG4 A;  2K8B A;  2QEJ C;  1XF5 L;  2DX5 B;  3AE7 B;  4GGQ A;  3PGE A;  2W3R A;  4W9F A;  1YIW A;  1WXQ A;  3BZD B;  2FAZ A;  1J19 A;  1I4R A;  2WWZ A;  3I3T B;  4H2A A;  4B95 A;  4A20 A;  1IGD A;  2HTM E;  2BWF A;  3TEY A;  4XDD A;  3B6R A;  1RL9 A;  2INC C;  1GC6 A;  5CHF A;  1Z2M A;  4DXF A;  2XK5 A;  3GB1 A;  3PLV A;  3V61 A;  4GVZ A;  1FRD A;  1YN3 A;  4DBG A;  5IP4 D;  2DZI A;  3RMK C;  3GP7 A;  3NVZ A;  2J42 A;  5IKC M;  2YVC A;  2NR2 A;  1E8Z A;  4R3D A;  2WDQ B;  2WXF A;  5IA7 A;  1C1Y B;  4JE3 B;  1ZDX A;  5EDS A;  2CKH B;  3RZW C;  3RD2 A;  4ITK A;  2DAF A;  1AYF A;  3AM9 A;  1QH4 A;  4JPS A;  2R61 A;  3U8Z A;  4IW0 A;  5J17 A;  1IPG A;  2KDB A;  3HM6 X;  2JYT A;  3EUB 2;  3IVF A;  3M63 B;  1C9F A;  2V3P A;  3W1Y A;  2GBN A;  3NRZ A;  2L00 B;  2V3N A;  1P52 A;  1JRP A;  2WU2 B;  1VZ6 A;  3FIL B;  2JT4 B;  3NVW A;  2ZNV B;  3DVG Y;  1PQS A;  3EFC A;  2KDF B;  4PS7 A;  1PGA A;  2MP2 A;  3O13 A;  2DYB A;  2L3Z A;  1CMX B;  1XCT L;  2V1Y A;  4KSK C;  1T0Y A;  3UI3 A;  2QIL A;  3KYC D;  3FKY A;  1RFK A;  5J2R A;  3ZJT A;  1STE A;  2PLP A;  4OZC A;  4FAD A;  1WX8 A;  2IY0 B;  4L23 A;  5C2T B;  5BMI A;  2LRU A;  2C7N B;  4USA A;  2NBV B;  3PSE B;  5JZE B;  1CK1 A;  3ZTD A;  1D5Z C;  1FPY A;  2KAN A;  4F1S A;  3LJ3 A;  1L6V A;  4GDK B;  3ZJU A;  1T0R C;  4TQ0 A;  1HE8 A;  2N7J A;  2G1E A;  3PRE A;  1KLG D;  1YD8 U;  2RGF A;  4P16 A;  1WMH A;  3Q3N C;  1MHX A;  1K53 A;  2W3S A;  1WH3 A;  3AEA B;  4NZL B;  4RGO S;  4HJK A;  2NTS A;  1V2Y A;  1IUE A;  3H7P B;  1I4H A;  2KK8 A;  3BWU D;  2GBK A;  2AL6 A;  1V9J A;  4XX5 A;  4BBN F;  2LGS A;  3AED B;  3L4P A;  2AQ3 B;  2N9P C;  1RAX A;  1G6J A;  1FEH A;  1L0Y B;  4P7I A;  1WSP A;  2DYM A;  1OEY J;  3AI5 A;  2LHD A;  3APC A;  3V6C B;  1JCK B;  2KQS A;  1UWM A;  3HVZ A;  4ZRP A;  1J7A A;  1WXS A;  1PFD A;  2EMS A;  1WI0 A;  4BKS A;  4DQO C;  3ZRF A;  3AU4 A;  4CYE A;  3Q14 C;  3NZT A;  5AEK B;  4OZA A;  2M8S A;  4A8X C;  1EM7 A;  1ET9 A;  4S17 A;  4REZ A;  1XD3 B;  3T3N A;  2JQR B;  3JPZ A;  1BML C;  3P42 A;  3B2G A;  4BVU C;  3AN1 A;  2BT6 A;  2SAK A;  4YSX B;  1DOY A;  3R3M A;  4TQ1 A;  1YJI A;  1ACC A;  5DPS A;  2HTH A;  2LGX A;  2J52 A;  1HEZ E;  2YEP B;  1WM3 A;  3M10 A;  2HD5 B;  2J1Q A;  4ICU A;  2L76 A;  2Z0E B;  2ASQ A;  4F8C B;  4NQL B;  2LJI A;  4Z9M A;  4MSM B;  1NVI D;  2WXM A;  4FA6 A;  3Q69 A;  4N59 A;  2I1K A;  2WXH A;  2IPK D;  2AL3 A;  2KYW A;  3BII D;  1CQV A;  2V9H A;  4JIO U;  2EEL A;  1H8C A;  3DWM A;  3NY5 A;  4GW2 A;  3A9K A;  1ZOY B;  4HEA 1;  1Q0W B;  4QAY A;  4HCN B;  1V1O A;  2ZJD A;  2IGD A;  3DBR B;  3KWV A;  2VH2 A;  2IY1 B;  4FUL A;  3EA6 A;  4FJZ A;  3LN7 A;  5KHQ A;  3MJW A;  1WZ3 A;  3PZ7 A;  4HKZ E;  1GUA B;  2KDI A;  1NI3 A;  4GDL B;  3N9Y C;  3HK0 A;  4PS8 A;  2MSE D;  2CRK A;  1LQB A;  3A33 B;  5IN7 A;  5E6N A;  3EGR A;  2B76 B;  4HXD A;  3UIN B;  2W55 A;  5CX3 A;  5JH5 C;  4A3O A;  3GS2 A;  4G3X B;  4MJS A;  1ZXH A;  3SEB A;  3TMP B;  3ZYY X;  4KGR A;  2FBW B;  1SJE D;  1C77 A;  1VRA B;  2KO3 A;  2KTR A;  1CRK A;  3Q3F A;  3NS8 A;  2NBU A;  3C0R B;  4KSL C;  1DYQ A;  3M3J A;  1V97 A;  2LUM A;  2M17 A;  1FXI A;  2WXI A;  2D3C A;  2L32 A;  2EKE C;  3JSV B;  4MDK E;  3ZJV A;  2AQ1 B;  1KRH A;  1WGK A;  4Q2J A;  4ASW C;  3RNC C;  2RDH A;  2INP E;  2M56 B;  4LNI A;  1GAQ B;  4MM3 B;  3R66 C;  1EF5 A;  2JXX A;  4BHL A;  1DGJ A;  1L2N A;  4LDT D;  2DYO A;  3RPF C;  4IOI E;  2WXR A;  2G4D B;  3QA8 A;  4GMV A;  3LVW A;  2JRI B;  2LWP A;  1N63 A;  2KXJ A;  2ZPN A;  4K7S A;  3MC8 A;  1GB1 A;  1HZ5 A;  1JWB D;  1R4M B;  4C4V A;  2D33 A;  3VH3 B;  2PJH A;  3CSF A;  2LMC A;  4HPM B;  3V05 A;  3AEG B;  1TBE A;  2ZVN A;  1L0V B;  4OHJ A;  1KTK A;  1RWS A;  2KWV B;  3LYY A;  2INN E;  4OVU A;  1BT0 A;  3MHZ A;  4LTU A;  3O65 B;  2JPH A;  2O6V D;  3IG3 A;  3ML8 A;  4W9H A;  2BQQ A;  4US8 A;  3PVL A;  3APF A;  4W9I A;  1WM2 A;  3I57 A;  3U30 A;  2BS2 B;  4AOF A;  1Z5S B;  4ZYS A;  3A9J B;  1L0X B;  1LXD A;  2RSU A;  1E0Z A;  1SIF A;  4FJY A;  2IO2 B;  4YSZ B;  3V6E B;  1I7H A;  2FCN A;  1V4G A;  2C7M B;  3CIR B;  4TMA B;  1Y56 A;  3WAO A;  3JVZ X;  4TKN A;  1DOI A;  2EMT A;  5C3J B;  1ZKH A;  2LVP A;  2V4L A;  1RM6 C;  1PYW D;  3P63 A;  3VDZ A;  2KN5 A;  4FBJ B;  3TL5 A;  2KLG A;  4CQN A;  3VR8 B;  3QHT A;  2GRI A;  1V49 A;  3Q6B A;  3TEW A;  3ZIM A;  1V1P A;  1OGW A;  5G5G A;  3W1S A;  1LO5 D;  4RCO A;  4FJV B;  2UYZ B;  4TUU A;  4Q2R A;  4HDO A;  3U2S C;  4IKG A;  4EEW A;  4XC2 A;  4KDI C;  3DDC B;  4OVV A;  4GN1 A;  4ZHO A;  3VTU A;  5AZF A;  4YTP B;  2GWD A;  5IAA C;  2O2V B;  3R2T A;  4MGK E;  2D11 A;  3AEC B;  4A6Q A;  2LI5 A;  1N5X A;  1UWX A;  2NCN A;  1WJ6 A;  1KLU D;  2G3Q B;  1QOB A;  1TKE A;  3PS6 A;  4ZOH C;  4ZHP A;  2REX A;  2XBB C;  3PPA A;  4YSY B;  5HHD G;  4URK A;  3VH4 B;  1OFF A;  3H9D A;  3B0A A;  2WYQ A;  2G45 B;  3L16 A;  4N6E B;  2QC8 A;  2KNB A;  1X1M A;  3ECI A;  2JUO A;  3APD A;  3CF6 E;  5J18 A;  3KVF B;  4FXC A;  4YL8 A;  3AEB B;  3S2A A;  4ICV A;  2IBI B;  2AX5 A;  4B0M A;  3ZNG C;  4BG4 B;  2GBR A;  1KJT A;  1WXV A;  4GVY A;  4TV3 A;  2W54 A;  2OJW A;  2K8H A;  1WGG A;  1YX6 B;  2DWQ A;  2MQJ A;  1E8W A;  4DWF A;  1V5O A;  3AE2 B;  3LN6 A;  1NYR A;  2MJD A;  1WGY A;  3ZO5 B;  3IT4 B;  2MA9 B;  3MJ5 A;  1ZDV A;  4KGS A;  4GLS C;  2IZV B;  4EOY A;  1LFD A;  4DHJ D;  3NVV A;  4XZ4 A;  4JWS C;  5FR3 A;  3IAS 1;  5HFY A;  3TBL D;  3E56 A;  1PUT A;  4EE2 A;  2OJR A;  3W5U B;  3GE3 C;  1E7P B;  2I1J A;  4XYC A;  4OVZ A;  4RGT A;  2L52 A;  2JXT A;  3R7R A;  1T0S C;  2LD9 A;  1SSN A;  1YN4 A;  2MRP A;  4HDQ A;  4P1B C;  3NZS A;  3AMZ A;  5G5H A;  2KQ7 A;  4P6V F;  1I35 A;  2JWZ A;  3A1Q B;  1L6U A;  2KJH B;  3HHM A;  2CHZ A;  4BKG A;  4RMA A;  5DPW A;  4GIV A;  5GMV A;  2PTL A;  1QLB B;  1GNU A;  1AN8 A;  4P1C C;  5L83 A;  2N7D A;  1QKZ A;  3Q3J A;  3UQB A;  1P98 A;  4K1R B;  2FE8 A;  3DBL I;  1TGZ B;  1R8G A;  1VCB A;  2CJN A;  2AQ2 B;  4C56 C;  4AJW A;  5FR6 A;  1WE6 A;  1FMA D;  1C4A A;  4HK2 A;  2LVQ A;  4WJQ A;  2FUH B;  3Q8A A;  4M01 A;  1UZX B;  4ARI A;  2PEA A;  2Y5P A;  4A55 A;  1WYG A;  3VR9 B;  3AB5 A;  3I63 C;  1TS4 A;  4W9G A;  5AZH A;  2KOX A;  4KV2 A;  1S3S G;  1BXT A;  3BVM A;  2W82 A;  2A4Z A;  5LLI A;  1V6E A;  1PDX A;  4TSS A;  3D32 A;  2V4I B;  1HTO A;  2ZCC A;  3L2D A;  1WMH B;  3L08 A;  3L2E B;  4IM0 A;  2ZCB A;  2LXC A;  4LJP B;  4KGT A;  4MGZ E;  4WQM A;  3EEC A;  3VUY A;  2UU7 A;  1VD2 A;  4PK1 A;  3WAN A;  2DNF A;  4HJG E;  1WFY A;  1SD0 A;  1ISN A;  2GBJ A;  1QOG A;  4LNN A;  4E3C A;  1VR9 A;  3N3K B;  4I6N B;  1EU4 A;  3A4S C;  1C3T A;  2BKF A;  1C79 A;  2PMV A;  4M0W B;  4DHZ B;  4EKU A;  2JRH A;  4MEL A;  4D2K A;  1R4M I;  3FIL A;  4C80 A;  3ML9 A;  2DAJ A;  3QC8 B;  4JQW C;  5DCN A;  1XQQ A;  2I2Y A;  3AEF B;  2N1W A;  2HJ1 A;  2K1F A;  1P3Q U;  3DRB A;  1JRU A;  1P50 A;  1EWC A;  3JU5 A;  3RNA C;  2ZW0 A;  1XXG A;  5E6J A;  1UBQ A;  1J0G A;  3T9L A;  2WS3 B;  2GB1 A;  2M1M A;  1YOV B;  5JHA A;  4N58 A;  4IUM B;  2PIA A;  4WJN A;  1FIQ A;  2MWS B;  3L17 A;  3AV8 A;  2KC2 A;  2OED A;  1EO6 A;  4PS3 A;  3OJ4 B;  3IBE A;  1F2R I;  3KW5 B;  3BIN A;  4OW0 A;  3VUW A;  3NG0 A;  3ZXR A;  4RF1 A;  2NVU I;  3QAR A;  4RH6 A;  1JWU D;  4NJ7 A;  1HA5 A;  1NEK B;  4WJO A;  2BTE A;  1WGD A;  2CHW A;  3H7P A;  1BUI C;  3N1Z C;  3SFD B;  5T8I A;  1XEE A;  4HRO A;  1SEB D;  4YT0 B;  2H88 B;  4KDL B;  5BMH A;  4JLC A;  1NBF C;  4WIP A;  2WQY B;  3ALB A;  2V0G A;  3TJP A;  4GU2 A;  1WZ0 A;  4I6L B;  2BW2 A;  1MHH E;  1FD6 A;  1F0Z A;  2W9N A;  2DZJ A;  1QQR A;  5G2N A;  3URY A;  4AS1 A;  3Q8F A;  4KKJ A;  1EF1 A;  2JSV X;  1J7C A;  4G0N B;  1AWD A;  1EU3 A;  1E7U A;  2LGD A;  2BF8 B;  3UGB B;  3AE5 B;  3VUX A;  2JWU A;  3QK0 A;  1J8C A;  2WXG A;  1TZ1 A;  3EC8 A;  4AWJ A;  2HE7 A;  1JML A;  5D2M B;  3RI7 C;  1EUV B;  2GMI C;  3JU6 A;  3SFE B;  5AUI A;  4CO7 A;  3L54 A;  4MGY E;  1GB4 A;  2ONQ A;  2KMM A;  4B9K A;  1ESF A;  4XDC A;  3H6N A;  1UGJ A;  1UGM A;  4NAW A;  5LXH A;  4WQO B;  1DOX A;  1TKY A;  3TIX A;  1FO4 A;  4WAF A;  1UF0 A;  2J0K A;  3HRD D;  4MT5 A; 
#chains in the Genus database with same CATH homology
 4S0R A;  3ZXV A;  4GVZ A;  1HTQ A;  4GW2 A;  3JU6 A;  1QK1 A;  2WHI A;  1SD0 A;  2D3C A;  2J1Q A;  4RF6 A;  4XYC A;  2D3A A;  2WGS A;  1F52 A;  1I0E A;  4LNN A;  5J99 A;  4S17 A;  4Z9M A;  4RF9 A;  1HTO A;  3FKY A;  4LNF A;  4ACF A;  3DRB A;  3L2D A;  3JPZ A;  3L2E B;  4Q2R A;  5J9A A;  2BVC A;  1CRK A;  2LGS A;  1P50 A;  1F1H A;  1M15 A;  1VRP A;  3JU5 A;  4HPP A;  2CRK A;  4RF7 A;  1P52 A;  3L2E A;  4BG4 B;  3DRE A;  4AM1 A;  1BG0 A;  2D3B A;  4GW0 A;  4LNI A;  4GVY A;  1G0W A;  3B6R A;  2GLS A;  4BAX A;  2QC8 A;  1RL9 A;  4RF8 A;  4BG4 A;  3NG0 A;  3ZXR A;  1QH4 A;  4BHL A;  2OJW A;  4LNO A;  1LGR A;  2UU7 A;  4LNK A;  1FPY A;  1U6R A;  3M10 A;  3JQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...