2WGSA

Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor.
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
475
structure length
463
Chain Sequence
KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Inhibition of Mycobacterium Tuberculosis Glutamine Synthetase by Novel ATP-Competitive Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords GLUTAMINE SYNTHETASE 1
total genus 150
structure length 463
sequence length 475
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2009-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2wgsA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 2wgsA02
1F1HA 3M10A 4BG4A 3JPZA 4GW2A 1G0WA 1CRKA 4LNFA 2CRKA 2WGSA 3FKYA 3JU6A 4BAXA 3DREA 4GVYA 4RF8A 4RF7A 5J9AA 1F52A 2D3AA 2D3CA 1HTQA 4GVZA 4BHLA 2LGSA 1P50A 2WHIA 4LNOA 4HPPA 2QC8A 4ACFA 3NG0A 3JQ3A 3L2EA 4GW0A 2D3BA 4LNIA 1RL9A 4Z9MA 5J99A 2J1QA 4RF6A 1VRPA 3DRBA 1HTOA 4S17A 2UU7A 4S0RA 1M15A 4LNNA 4RF9A 1P52A 4XYCA 2BVCA 3ZXRA 1BG0A 1SD0A 1FPYA 4LNKA 3JU5A 4BG4B 1U6RA 2OJWA 4AM1A 1QH4A 2GLSA 1I0EA 3ZXVA 3B6RA 3L2EB 1LGRA 3L2DA 1QK1A 4Q2RA
chains in the Genus database with same CATH superfamily
4YTPB 2LRWA 1J7AA 4DDGD 3FKYA 5AEKB 2OHFA 3U52E 4MJSA 1KH0A 2G9HD 2KXJA 1BMLC 3A1QB 1TIFA 1E10A 1GG3A 1C3TA 3RNGC 4GLSC 3FILA 2N9PC 1FNUA 2EELA 3PS6A 2MSED 1RLFA 4K7WA 1YJIA 5C3JB 2KWCA 3DQVA 4E3CA 4BKGA 2L0FA 3VH4B 3PLUA 4ICVA 2BB5A 4P1BC 2ZNVC 2IBIB 3QARA 1MFWA 2KJRA 4EFOA 2DZJA 3VHTC 1T5XD 1JALA 2N9EB 4MEMA 2WXGA 3W1SC 3H8HA 1T6BX 2KC1A 1E8ZA 3Q8CA 2Z0DB 2NTTA 3IT6B 2KN5A 5CTRC 4FULA 2LVQA 5I4DA 3NJTA 3FC4A 4KDLB 2HJ1A 1YIWA 2QC8A 2LGDA 3N20C 4A8XC 3R66C 2YEPB 3PRMB 1YN4A 4OZCA 3T3NA 2FUG1 2BS2B 3Q8EA 1QT9A 4NJ6A 1CJEA 1YJJA 1ZKHA 1F52A 1V2YA 2IY1B 1V86A 1NBFC 2XK5B 4RFBA 4FN2A 2J0MA 3AE4B 3IG5A 3VUYA 4HLEA 4JWUC 2E6XA 2N7JA 2K0PA 1V8CA 1WJUA 3Q3JA 1K50A 1DOIA 2WX0A 4GDKB 2LJ5A 1VD2A 1WM2A 4LJPB 1UNSA 3O13A 4HPPA 4HPMB 4HWIB 5EE0A 3ZNHB 3HK0A 3L08A 2LD9A 1WSPA 3PHXB 5EDSA 4M0WB 4G50A 3AM9A 1ZXIA 2K6QA 2GLSA 1K8RB 3HRDD 4KSLC 1HEZE 2WXOA 4BKTA 1TKEA 2JU6X 1ZW7A 2CHWA 1AN8A 3NHEB 3NZSA 1HZ6A 4REZA 4AP4C 2KLGA 4XWTA 4AJWA 2HE7A 3P4QB 2O6VB 2N1VA 3AMZA 3AU4A 4BG4A 3B08A 4LK0M 2PE6B 3KYCD 3ZRFA 2BYTA 4HROA 1K52A 4WAAA 3TEZA 1VA6A 1T0RC 2R2OA 3GOEA 1OEYJ 1E7UA 1EF1A 2MJ3A 4NAMA 3ZKJC 1DGJA 4BZAA 1PFDA 2CHZA 1WGGA 3DVGX 4LNOA 3BY4B 3P1MA 1UF0A 2AQ3B 3RD2A 4C7ZA 1I7HA 1F0ZA 2L0TA 4QAYA 3VR8B 2D11A 5D94A 2LUMA 2VRRB 5EE1A 4YXDB 1SGHA 3GP7A 4GW2A 3NZUA 1IBXA 2B3AA 1R4MI 2C7HA 2M0AA 3QQ8B 1L7YA 3ABVB 2KFJA 4W9CA 1UUPA 5L83A 2KQ4X 5J99A 2Y5PA 2M0XA 3WAPA 1I4HA 2WYQA 2A5UA 1GB1A 1X1MA 5AZHA 2GMIC 1C76A 2IGGA 3PRPB 3UIPB 3QC8B 2REXA 4KGTA 3BK1A 1TBEA 2ZVNA 2DZIA 1B1ZA 2MJEA 3LN6A 2MLBA 1L0YB 3I63C 2J4XA 4F1SA 5C2TB 5H92C 5JXVA 1Q5WB 1M15A 3AB5A 1J19A 2Y5CA 4XC2A 2H89B 3EFCA 4KVGB 3ZNID 4W9DA 3H7PA 3JU5A 2KZRA 1UELA 1XXGA 3U7DA 1EWYC 1D5ZC 1PYWD 2ONQA 5J9AA 1H4RA 2M8SA 2FCQA 4C00A 3I5JC 4OZBA 1CQVA 1HTOA 1VJKA 4IWQA 4PYUA 4E74A 3IAS1 3TMPB 5AUKA 2RR9A 1GC7A 3ZVVA 4JE3B 2BWES 3GZNB 2R61A 1OEYA 3R2TA 5BYQA 2JZ3B 4NAWB 1QOGA 3ALBA 3B9JA 1C4PA 4J3OD 4JPSA 4BKSD 2RPVA 3DVGY 2PIAA 4LNIA 4RGMA 3PPAA 3AE3B 3WANA 2JT4B 5BO4B 3RPFC 1FXTB 2WX1A 4MDKE 4R3DA 4YSYB 3ZDTA 2IO1B 4OZAA 4C4VB 1N5WA 1D4BA 1KOTA 4LLGM 5HFYA 5J17A 1LQBA 4CO7A 4TUUA 2EMTA 1T0QC 1DOYA 3LVVA 4EZKA 2DLBA 4WWMA 3VTUA 2SEBD 4DHZE 2G4DB 2C9WB 1JWAD 4LTUA 1L4ZB 3H7PB 3IFWB 1R4NB 2MP2A 1WH3A 1YJ1A 4A3PA 4CYEA 3GZNI 5KHQA 4DHJD 1K53A 4TV3A 3APCA 3EA6A 2JYTA 3J9CA 2L00B 4DHJB 3X0WA 2MJDA 1JWBD 4GSWA 2BTEA 3LXFA 3V05A 3EFUA 4XDCA 4US8A 1IYFA 2W54A 2C7MB 2MW5A 2ZPYA 4HXDA 3JPZA 4USAA 4J6IA 1WRIA 2CJOA 2IO0B 4L1BA 1NYQA 3IG8A 4BHLA 3I3TB 3P2BA 3DWMA 2V3NA 3VR9B 4S0RA 2WS3B 1SF0A 2PEAA 2WU5B 4AM1A 4EE2A 1RFAA 5D2MB 1XLQA 4ZRQA 1WJ4A 2KK8A 5IAAC 1JRPA 4P16A 2GBNA 1UGMA 2O2VA 3E9SA 2DBYA 1R4NI 4K7UA 1D6EC 4FADA 4II2B 4MSQB 3ETRA 3DBRI 1C78A 1TT4A 4ANVA 1UBQA 5GMVA 2MBQA 2KAJA 3ZXVA 4JWSC 2CU3A 1LXDA 1WXSA 4FJZA 2NCNA 1R4MB 3ZLZA 4UDUC 3SHQA 1OGWA 1MG8A 1JMLA 5G2NA 4BFRA 2JZPA 1XQQA 1V49A 2JSVX 3DBLI 2K8CA 1QOAA 3P4PB 1UBIA 3P4RB 4BBNF 4ZOHC 1S3SG 1E7VA 1AARA 1SJED 4YSXB 4K3BA 1YOVB 1UD7A 2QMTA 3IT4B 5EE3A 1XD3B 3HM3A 3CMMB 1VRPA 4NPNA 4IDIA 3AE1B 2KHWB 2INPE 1I42A 2BYEA 2L1AA 1U6RA 1CK1A 3UQBA 2M1MA 1XLOA 1SIFA 3RN9C 3Q8FA 3W5UB 5JH5C 3JQ3A 3B1LX 1SE2A 3BVMA 4EKUA 2LMCA 4LDTD 4ANWA 5IN7A 3LN7A 5G5HA 3T3OA 1NI2A 1WX7A 4IM3A 2V3PA 3ECIA 3EECA 2V0GA 3ZIMA 3QCAA 2BB6A 3DHGC 2J52A 4RM8A 3TBLD 2RMMA 2WXMA 2OEDA 3RYTA 3C19A 1XCTL 1FXAA 1F2RI 4XYCA 3X23A 2PW9A 4M02A 4MGYE 2KC2A 1G6JA 2KTRB 2N9XA 1WIAA 1KF6B 1SE4A 4ZHOA 1TS2A 1TKYA 3A4RA 3HM6X 5CHVC 4G11A 1R7SA 4M01A 4KX6B 2H88B 2OJRA 1BXTA 2KO3A 2PVGC 2B76B 4YWGG 4RGNA 4RF0A 2L05A 3DVNU 3Q3FA 4HKZE 3N9YC 1L0VB 3N3KB 4BOSC 4DWFA 3B6RA 3L2EB 1D5MC 4ARCA 2HJ8A 1E7PB 1QILA 1E8WA 1NVID 4GW0A 3MC9A 4X57B 2FCNA 3RNFC 3K9OB 2LXCA 3JSVB 4BKSA 3LJ3A 3ZJVA 3WCQA 1TJEA 2KMAA 4WJNA 4LNKA 2D3GA 2LEKA 1C9FA 1WZ0A 1M4VA 1TY0A 2C7NB 5E6PA 2WLBA 3R3MA 5AZGA 4GGQA 4DQOC 4WJPA 2VZKB 4M8NA 2ZJDA 4HCNB 4TKNA 4S17A 3AE8B 2L76A 1IP9A 2BWFA 4JLCA 2KNBA 1XCQL 3H6NA 2G1EA 4ASWC 2KMMA 1S1QB 1GUAB 5BYSA 3VTVA 3RNCC 5BMGA 4XE0A 2MRPA 4TMAB 3VH3B 4FJYA 5KHOA 3RULA 1BG0A 4PS8A 1V6EA 4W9FA 1XF5L 4JQWC 1G0WA 2PJHA 4RMAA 2MQJA 2PKOA 1BT0A 5CHFA 2KANA 4RM9A 2WDQB 3ZDMC 3ZUNA 1GJZA 3APFA 1L6VA 2Z59B 2EKEC 1V81A 4GB9A 2HDEA 4D2KA 1F2RC 4K7SA 2HTME 5HKHA 3PO0A 3B0AA 2I2YA 2BKRB 1EU3A 3IBEA 3W9CB 3TEXA 4OVVA 1JWSD 2Y5BB 2IO3B 2KDFB 2AEHA 3RZFA 1AYFA 4OHJA 3ZTCA 3TEYA 2BYVE 3QA8A 4YSZB 3ZO5B 3Q3NC 1UZXB 1NEKB 1IBXB 2JQRB 2KFKB 2DYOA 4LNNA 1VZ6A 4GXBA 3VDZA 3KLSX 4ZRJA 4DXAB 1WF9A 2WXLA 4MGKE 3N1XC 4I6LB 1T0YA 3QIJA 1WR1A 4FHKA 3L4PA 1YX6B 3U2SC 4GU2A 4B95A 2KTRA 3DPDA 3IHPC 2I1JA 2KX3A 1NI3A 1WGRA 3L17A 3PGEA 2YVCA 2INCC 5FKAC 2BVCA 2KT7A 1C79A 4MH0E 3Q2AC 4W9HA 3MP9A 4K1RB 2GBRA 3M10A 1PGBA 3VXWA 4WIPA 1WYGA 2KTFA 2JPHA 4FXCA 4HCPB 4MGIE 1WYWB 1EO6A 1FO4A 1FRDA 2BQQA 1CZPA 3HUIA 2QSDA 3A33B 4PS7A 3DCGA 4MM3B 3GB1A 2LZ6A 4AWJA 1MPEA 3VVWB 1UWXA 1IPGA 1TZOA 1SE9A 5JHAA 1GC6A 5FK9C 2MWSB 1C1YB 2UYZB 4JGHB 4AS1A 1ZPSA 4ZRKA 3DHHC 1HTQA 1N63A 2NTSA 2AWTA 2FCSA 1PGAA 2I38A 4MACA 2KD0A 1A5RA 3CSTA 4WWOA 3IAM1 4P7IA 4JX1C 2R2QA 4RGTA 4Q2RA 2J0JA 2LVPA 1WXMA 1V1PB 2PE9A 4US9A 1ZDVA 3JU6A 3KVFB 4LDTB 3MTNB 2LGSA 5MPOA 2NR2A 1WGYA 2KDMA 3CWIA 3HHMA 3MC8A 4KKJA 3VUXA 3NVYA 3PREA 1P1AA 1QQRA 1WXAA 5DPWA 5FR6A 1T0SC 1EU4A 1STEA 3A9JB 1LGRA 4HJKA 2W9NA 4RGOS 4GOCA 3UIOB 4XZ4A 4BAXA 5G55A 3C8YA 3V61A 3QJZA 4A3OA 3DWGC 1MJDA 3VFKA 2AQ2B 2JYEA 4FBJB 5AZFA 4W9GA 2ZCBA 2K8BA 5HHDG 3PRZA 3WAMA 1PDXA 3Q6BA 1NDDA 3AULA 2O2VB 3ZJUA 1QLBB 1VDVA 2AX5A 2A4ZA 3ZRCA 3NS1A 5IA7A 1ZOYB 3K9PB 4FHJA 3GE8C 4GVZA 1HA5A 3TSSA 1WJNA 2RDHA 3UQAA 3AEBB 2XNAC 4CQNA 3L16A 4NQKE 2BS4B 3JSVA 1L6UA 4ZHPA 3KUDB 3N30A 2XN9C 2OOBB 3OAWA 2QHOA 3IG3A 3RI7C 1FPYA 3M63B 2WU2B 2LI5A 1YN3A 4IG7B 5GXGB 3KW5B 1EF5A 4EUTA 1E6EB 2O6VA 2KDEB 1SSNA 2WXQA 1WRDB 3BWUD 1VR9A 4NY0A 1WFYA 2SAKA 4LJOB 2KVZA 3L0WB 3B2GA 5JHBA 1TGZB 1J0GA 4MJSB 2K22A 2DAJA 2FAZA 1TKGA 4TQ0A 1I4QA 2K39A 4A20A 4KGSA 3E56A 3SEBA 1JRUA 2Z8LA 3NOBA 2IJ0A 2AQ1B 1L4DB 2UU7A 3BINA 4HRSA 2G4SA 4GIVA 1YN5A 2M4NA 1YD8U 2CJNA 3MHSD 1L5PA 1YMHE 2INDC 2KDBA 5DPRA 1N6ZA 3L2DA 2K1FA 5D6JB 4EOYA 3KWVA 3WAOA 4EZLA 1ZDXA 3KH0A 1TY2A 3HVDA 5L95C 1JCKB 2BPSA 4EZJA 4IUMB 3ZJTA 3AEAB 3RFZB 2KJ6A 3BK2A 3LVWA 1FCLA 3WALA 4B6WA 3MHZA 2WP9B 3AE2B 2YLMA 2MEKA 2LXAA 3P42A 3PTFC 1V5OA 1KLVA 2VZKD 4GDLB 2D33A 4AUQC 2FCMA 3S2AA 3KUZA 1BUIC 4DHZB 3OJ3A 1U4AA 2L52A 1UGJA 1F1HA 2DHZA 1P98A 2LASA 4GDKA 2QDFA 4A90A 2J7QB 4ICUA 2J0KA 3AH7A 3EUB2 3M95A 2FIDA 2NPTB 3AE6B 4K81A 2KWUB 3AV8A 3V6EB 2Y3AA 2MBHA 2ZNVB 3NVZA 3UINB 1ZE3D 2WDTB 2N7DA 2WDVB 5HG2A 3P4SB 5BMHA 1CRKA 2BW2A 3A1QA 2BBCA 3A9JA 3D32A 2K25A 1P3QU 1ACCA 3RT3B 1TZ1A 4HDQA 1L2NA 1IGCA 1RYJA 3OJ4B 3UGBB 5C1ZA 1EWCA 2YEPF 2JF5A 5LNK1 4JL9A 3Q8AA 3PZ7A 3TJPA 3V60A 2LFIA 4KZ0A 2W82A 3BYTB 3RNBC 4DXGA 3V62A 1RAXA 3AN1A 4GMVA 1XO3A 3RUIB 2ZZPB 2KVRA 1AW7A 2WQYB 4M00A 4HDOA 5T8IA 2ZCCA 1QKZA 1ROEA 4B9KA 4CHKA 1L0XB 3H1UA 4PK1A 1SE3A 1WXQA 3PHWB 4KIKB 4KIKA 3ZYYX 4P1CC 3W2DA 4BG4B 2K8HA 2VH2A 2MH7A 1N5XA 1LFDA 4W9JA 4GVYA 4RF8A 4XGAB 2WXJA 2IPKD 1J7CA 2NVUI 2ZW0A 1QOBA 1FNWA 3SFDB 1SJHD 2Q5WD 4ZYNA 3AU5A 2DZMA 1Q10A 3AE7B 2MP2B 4HEA1 4WQMA 3A9KB 2NBVB 2CR5A 4C4VA 3NUHB 2IDYA 1FRRA 3JVZX 2ZPNA 1H8CA 5EE9A 5LXIB 1IUEA 4IM0A 1J7BA 4BOZB 3TIXA 2KFKA 2XBBC 2NBWB 1UWMA 2V4LA 4YT0B 1SXTA 2QILA 1ZXHA 1F9JA 2ASQA 2ZW1A 4II3B 1WE7A 4TQ1A 1P7FA 2N9KA 4HKQA 2WXFA 4LCDE 3QAQA 2GBKA 3R8BA 1FFUA 2BKFA 4KKIA 3O65B 1I4GA 3QHTA 2LUEA 3QX1A 5CX3A 1N61A 3GE3C 1ET6A 2IYDB 2JRHA 2KQSA 4N6EB 2AL6A 1RRBA 2JXXA 2LGYA 3ZQ4A 3BYYB 2ON8A 1ENFA 2L32A 2GB1A 1VZ8A 4MGZE 3A9KA 5D3DA 1YQBA 2AL3A 2FE8A 2LHEA 2X38A 1OQRA 2GWCA 1R8GA 1GPXA 4KZCA 2WNMA 2FNJB 2WXNA 3C0RB 4W9IA 3TL5A 1HQRD 3WIMA 3SR6A 2KQ7A 1C77A 5BYRA 4HJGE 3BIID 3IXSA 3ONSA 3DBRB 1NENB 1RL9A 3FILB 3L10B 3W1YA 3VAWA 4ZDVA 4ANXA 1YX5B 2BT6A 1GOZA 2JVCA 1E5WA 2JZZA 4IWOA 1V5TA 1QK1A 2N0SB 4OW0A 3PSEB 1JROA 1JWUD 2D3AA 5TSSA 5DPSA 3BVGA 1V4GA 2BYFA 2QCZA 4N58A 3KUCB 1B9RA 2BS3B 4URKA 2PVOD 1SB3C 2MBOA 1JW9D 1TT5B 2C5LC 2WXIA 4K3CA 3MFGA 3NZ3A 1HXYD 3EGRA 3DBLB 1CMXB 3SU8X 1QH4A 1SIJA 3PT2B 4WAFA 1P0RA 1YQ4B 4ANUA 3AE9B 3DREA 3VUWA 2D5GA 1SBBB 1LO5D 2DYBA 1GAQB 1P9DU 4L23A 2Z0EB 2ICIA 3NRZA 1SD0A 1A70A 3PV1A 4G3XB 5E6NA 3PLVA 1OTRB 3ZGZA 2GI9A 4LNFA 1FEHA 2LWPA 2QEJC 1Z2MA 2WXPA 4C7YA 3NZTA 1PUTA 4RF1A 2L83A 3V6CB 2KYWA 1MVKA 4BVUC 1P52A 1WMHB 3V3XA 2JX5A 2RPQA 1QF6A 2ZVOA 3CF6E 3VTWA 4BBNC 1WJ6A 1GNUA 2LGXA 3NY5A 3NVWA 3HIZA 2FBWB 2NPTA 4MSMB 1MHXA 2N4FA 4GN1A 2WWZA 4N9F4 2CKHB 2J1QA 3DRBA 1FCCC 5E6JA 2MCNB 4IC7B 1VCBA 3B2FA 2KX0A 1SEBD 2L3ZA 3DVNV 3RNEC 1FNVA 3GS2A 1WMHA 2K5PA 5HI1A 1YQ3B 4P6VF 3AI5A 3DOWA 2WGSA 2PMVA 2QIEB 5JZEB 3VQIA 3L54A 2MA9B 3L13A 2C60A 4WJQA 4L2YA 2JWZA 4I6NB 2HTHA 2IO2B 2E3TA 2PTLA 2ACZB 4XWWA 1ET9A 4NZLB 4XDDA 2PPHA 2LVOA 3DBSA 1QOFA 2IZVB 4WURA 1XLPA 1M94A 4N59A 4IW0A 2M19A 2CS4A 3VRBB 4EEWA 3TUOA 1E8YA 2D10A 3M3JA 5DCNA 2D07B 3NVVA 4AOFA 1XEEA 2EKIA 1E90A 2I1KA 4TSSA 1DOXA 1KTKA 4XX5A 3QWZB 1D3ZA 1DYQA 4G0NB 4OVUA 4DK5A 4Q2JA 2XEWA 4WWPA 2D3CA 1AWDA 1KM7A 5LLIA 5BMIA 2O6VD 4H2AA 3EHVA 1WY8A 4DBGA 3Q8BA 2LGIA 3AEGB 5IO9A 4MM3A 4RCOA 3N1YC 1OQYA 2DYMA 3AEFB 1WX9A 4A55A 2V4IB 4IKGA 3AXCA 3TEWA 4MH8A 4KSKC 1V9JA 2KJHB 3OLMD 2GRIA 2M17A 1TYGB 3AEDB 2KWDA 4AQ7A 3H9DA 3I9V1 4WQOB 5H8YE 5D7GA 2KLCA 2JRIB 3SDLC 2FIFA 1ZUD2 1V1OA 2J42A 1E8XA 3A4SC 3NS8A 3PZ8A 1WXVA 3RNAC 3LDZE 1V80A 5DPTA 3U4EG 2JUOA 5J2RA 2KOXA 2X8XX 3ML9A 2N7EA 1I35A 1FM0D 1FIQA 4B0MA 2WXHA 3JYUA 4E71A 1FFVA 4MELA 1WZ3A 2CHXA 2EMSA 3R2IA 3RCZA 3RMKC 2GOWA 2IGHA 4KV2A 1NYRA 2TSSA 1HZ5A 2N9LA 3U30A 2BGFA 1Y56A 5TR5A 4YTNB 3W1SA 3OWEB 4C80A 2V3SA 1JWMD 4HK2A 1WGHA 1MI0A 3DBHB 4W9EA 5IP4D 1KRHA 1OQQA 4A6QA 2ZEQA 2DENB 1YNTE 1K51A 1Z5SB 1WX8A 4WJOA 2RSUA 4F7ZA 3URYA 1TTNA 2MX2A 1ISNA 4NQLB 1P50A 4ACFA 2RDGA 5D3IB 2V1YA 3R7RA 4Z9MA 4YL8A 3LYYA 1V1PA 3DDCB 2J53A 2D2QA 3MJ5A 3ML8A 1KLGD 1N60A 2NBUA 1VRAB 4A9AA 2JXTA 2V9HA 1GB4A 1E0ZA 4B0EA 2DNFA 1F77A 4ARIA 2RDBC 3NG0A 4IWPA 4NNJB 3I57A 4RF6A 2W3RA 1ZP0B 2LRUA 4WH4A 2QJLA 3LB8C 1E9MA 4DDID 2LJIA 4FJVB 3U7ZA 3CIRB 3AECB 2GBJA 1WWTA 3ENEA 2PLPA 2MBBB 1LM8B 4ITKA 1XLNA 4PYZA 2GWDA 3R7QA 4F8CB 4IOIE 2RGFA 3P63A 1RWSA 3TCAA 5IKCM 1PGXA 1I0EA 1TS4A 3M62B 2K6DB 2G3QB 1WGDA 4NJCA 1IGDA 3W5VB 3KYDD 1XT9B 2UWQA 1FMAD 2MHJA 2IGDA 2KN4A 4NJ7A 1QZEA 2JWUA 2W55A 2NS5A 2CU1A 5CHWA 2DAFA 4AJYB 2KKCA 2K9XA 4W9KA 4RH6A 1FD6A 4KGRA 5J18A 1RFKA 2JY6A 4O1NA 5LXHA 2G45B 4C56C 3ZNZB 2MBEA 2INNE 3PVLA 2M56B 3H7SA 1EM7A 1D5XC 4MT5A 1OFFA 1Q1OA 4JIOU 2RD0A 3L2EA 4M8MA 3HVZA 3Q69A 3IVFA 4OVZA 3QK0A 1WGKA 2HD5B 3AE5B 3UI3A 5AUIA 1C4CA 3VRAB 3T8MA 3Q3MC 1EUVB 2W3SA 4I6PA 4WWNA 4NAWA 1TS3A 3T9LA 3KQ4A 1Q0WB 1JQ4A 5E6OA 1I4PA 3JW0X 3Q14C 5C23A 4M0WA 2CRKA 2LHDA 1KLUD 3Q3OC 4ZYSA 2KDIA 1WI0A 2N1WA 2WHIA 3DBHI 1V97A 2KACA 3KWLA 3N32A 1RM6C 2L8JA 4RF9A 1VZ7A 1P7EA 4GDLA 5FR3A 4KDIC 3EC8A 1PQSA 4HVBA 2L7RA 2BF8B 3BZDB 2GBMA 1UH6A 4FLHA 2DWQA 4PS3A 1MHHE 4DXFA 3ZNGC 2KWVB 3ZXRA 5G5GA 4RNAA 4FA6A 3N1ZC 3RZWC 1C4AA 3WA0A 1WR6E 3ZTDA 1T3QA 1ESFA 1I4XA 1HE8A 2AYOB 2IY0B 3DHIC 2KMCA 2NMQA 4RF7A 2K3UA 1WM3A 3BVZA 1ZGUB 3AEEB 1MG4A 2D3BA 1N62A 3OG5A 3U8ZA 2WXKA 1J8CA 3FAHA 1WE6A 2FUHB 3SD5A 5IOIA 1VLBA 2OJWA 2VH1A 4HPLB 1KJTA 4W9LA 3SFEB 4ZRIA 4PT5A 2DZKA 4ZRPA 2WXRA 1I4RA 1KFYB 1FXIA 4IM2A 4YTMB 1TS5A 3CSFA 3PZDA 3UF8A 3MJWA 2WDRB 3APDA 2DX5B 2XK5A 3MC0B 2D32A 3ZW3A 1Y8RC
chains in the Genus database with same CATH topology
1F1HA 3M10A 4BG4A 3JPZA 4GW2A 1G0WA 1CRKA 4LNFA 2CRKA 2WGSA 3FKYA 3JU6A 4BAXA 3DREA 4GVYA 4RF8A 4RF7A 5J9AA 1F52A 2D3AA 2D3CA 1HTQA 4GVZA 4BHLA 2LGSA 1P50A 2WHIA 4LNOA 4HPPA 2QC8A 4ACFA 3NG0A 3JQ3A 3L2EA 4GW0A 2D3BA 4LNIA 1RL9A 4Z9MA 5J99A 2J1QA 4RF6A 1VRPA 3DRBA 1HTOA 4S17A 2UU7A 4S0RA 1M15A 4LNNA 4RF9A 1P52A 4XYCA 2BVCA 3ZXRA 1BG0A 1SD0A 1FPYA 4LNKA 3JU5A 4BG4B 1U6RA 2OJWA 4AM1A 1QH4A 2GLSA 1I0EA 3ZXVA 3B6RA 3L2EB 1LGRA 3L2DA 1QK1A 4Q2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F1H A;  3M10 A;  4BG4 A;  3JPZ A;  4GW2 A;  1G0W A;  1CRK A;  4LNF A;  2CRK A;  2WGS A;  3FKY A;  3JU6 A;  4BAX A;  3DRE A;  4GVY A;  4RF8 A;  4RF7 A;  5J9A A;  1F52 A;  2D3A A;  2D3C A;  1HTQ A;  4GVZ A;  4BHL A;  2LGS A;  1P50 A;  2WHI A;  4LNO A;  4HPP A;  2QC8 A;  4ACF A;  3NG0 A;  3JQ3 A;  3L2E A;  4GW0 A;  2D3B A;  4LNI A;  1RL9 A;  4Z9M A;  5J99 A;  2J1Q A;  4RF6 A;  1VRP A;  3DRB A;  1HTO A;  4S17 A;  2UU7 A;  4S0R A;  1M15 A;  4LNN A;  4RF9 A;  1P52 A;  4XYC A;  2BVC A;  3ZXR A;  1BG0 A;  1SD0 A;  1FPY A;  4LNK A;  3JU5 A;  4BG4 B;  1U6R A;  2OJW A;  4AM1 A;  1QH4 A;  2GLS A;  1I0E A;  3ZXV A;  3B6R A;  3L2E B;  1LGR A;  3L2D A;  1QK1 A;  4Q2R A; 
#chains in the Genus database with same CATH topology
 4YTP B;  2LRW A;  1J7A A;  4DDG D;  3FKY A;  5AEK B;  2OHF A;  3U52 E;  4MJS A;  1KH0 A;  2G9H D;  2KXJ A;  1BML C;  3A1Q B;  1TIF A;  1E10 A;  1GG3 A;  1C3T A;  3RNG C;  4GLS C;  3FIL A;  2N9P C;  1FNU A;  2EEL A;  3PS6 A;  2MSE D;  1RLF A;  4K7W A;  1YJI A;  5C3J B;  2KWC A;  3DQV A;  4E3C A;  4BKG A;  2L0F A;  3VH4 B;  3PLU A;  4ICV A;  2BB5 A;  4P1B C;  2ZNV C;  2IBI B;  3QAR A;  1MFW A;  2KJR A;  4EFO A;  2DZJ A;  3VHT C;  1T5X D;  1JAL A;  2N9E B;  4MEM A;  2WXG A;  3W1S C;  3H8H A;  1T6B X;  2KC1 A;  1E8Z A;  3Q8C A;  2Z0D B;  2NTT A;  3IT6 B;  2KN5 A;  5CTR C;  4FUL A;  2LVQ A;  5I4D A;  3NJT A;  3FC4 A;  4KDL B;  2HJ1 A;  1YIW A;  2QC8 A;  2LGD A;  3N20 C;  4A8X C;  3R66 C;  2YEP B;  3PRM B;  1YN4 A;  4OZC A;  3T3N A;  2FUG 1;  2BS2 B;  3Q8E A;  1QT9 A;  4NJ6 A;  1CJE A;  1YJJ A;  1ZKH A;  1F52 A;  1V2Y A;  2IY1 B;  1V86 A;  1NBF C;  2XK5 B;  4RFB A;  4FN2 A;  2J0M A;  3AE4 B;  3IG5 A;  3VUY A;  4HLE A;  4JWU C;  2E6X A;  2N7J A;  2K0P A;  1V8C A;  1WJU A;  3Q3J A;  1K50 A;  1DOI A;  2WX0 A;  4GDK B;  2LJ5 A;  1VD2 A;  1WM2 A;  4LJP B;  1UNS A;  3O13 A;  4HPP A;  4HPM B;  4HWI B;  5EE0 A;  3ZNH B;  3HK0 A;  3L08 A;  2LD9 A;  1WSP A;  3PHX B;  5EDS A;  4M0W B;  4G50 A;  3AM9 A;  1ZXI A;  2K6Q A;  2GLS A;  1K8R B;  3HRD D;  4KSL C;  1HEZ E;  2WXO A;  4BKT A;  1TKE A;  2JU6 X;  1ZW7 A;  2CHW A;  1AN8 A;  3NHE B;  3NZS A;  1HZ6 A;  4REZ A;  4AP4 C;  2KLG A;  4XWT A;  4AJW A;  2HE7 A;  3P4Q B;  2O6V B;  2N1V A;  3AMZ A;  3AU4 A;  4BG4 A;  3B08 A;  4LK0 M;  2PE6 B;  3KYC D;  3ZRF A;  2BYT A;  4HRO A;  1K52 A;  4WAA A;  3TEZ A;  1VA6 A;  1T0R C;  2R2O A;  3GOE A;  1OEY J;  1E7U A;  1EF1 A;  2MJ3 A;  4NAM A;  3ZKJ C;  1DGJ A;  4BZA A;  1PFD A;  2CHZ A;  1WGG A;  3DVG X;  4LNO A;  3BY4 B;  3P1M A;  1UF0 A;  2AQ3 B;  3RD2 A;  4C7Z A;  1I7H A;  1F0Z A;  2L0T A;  4QAY A;  3VR8 B;  2D11 A;  5D94 A;  2LUM A;  2VRR B;  5EE1 A;  4YXD B;  1SGH A;  3GP7 A;  4GW2 A;  3NZU A;  1IBX A;  2B3A A;  1R4M I;  2C7H A;  2M0A A;  3QQ8 B;  1L7Y A;  3ABV B;  2KFJ A;  4W9C A;  1UUP A;  5L83 A;  2KQ4 X;  5J99 A;  2Y5P A;  2M0X A;  3WAP A;  1I4H A;  2WYQ A;  2A5U A;  1GB1 A;  1X1M A;  5AZH A;  2GMI C;  1C76 A;  2IGG A;  3PRP B;  3UIP B;  3QC8 B;  2REX A;  4KGT A;  3BK1 A;  1TBE A;  2ZVN A;  2DZI A;  1B1Z A;  2MJE A;  3LN6 A;  2MLB A;  1L0Y B;  3I63 C;  2J4X A;  4F1S A;  5C2T B;  5H92 C;  5JXV A;  1Q5W B;  1M15 A;  3AB5 A;  1J19 A;  2Y5C A;  4XC2 A;  2H89 B;  3EFC A;  4KVG B;  3ZNI D;  4W9D A;  3H7P A;  3JU5 A;  2KZR A;  1UEL A;  1XXG A;  3U7D A;  1EWY C;  1D5Z C;  1PYW D;  2ONQ A;  5J9A A;  1H4R A;  2M8S A;  2FCQ A;  4C00 A;  3I5J C;  4OZB A;  1CQV A;  1HTO A;  1VJK A;  4IWQ A;  4PYU A;  4E74 A;  3IAS 1;  3TMP B;  5AUK A;  2RR9 A;  1GC7 A;  3ZVV A;  4JE3 B;  2BWE S;  3GZN B;  2R61 A;  1OEY A;  3R2T A;  5BYQ A;  2JZ3 B;  4NAW B;  1QOG A;  3ALB A;  3B9J A;  1C4P A;  4J3O D;  4JPS A;  4BKS D;  2RPV A;  3DVG Y;  2PIA A;  4LNI A;  4RGM A;  3PPA A;  3AE3 B;  3WAN A;  2JT4 B;  5BO4 B;  3RPF C;  1FXT B;  2WX1 A;  4MDK E;  4R3D A;  4YSY B;  3ZDT A;  2IO1 B;  4OZA A;  4C4V B;  1N5W A;  1D4B A;  1KOT A;  4LLG M;  5HFY A;  5J17 A;  1LQB A;  4CO7 A;  4TUU A;  2EMT A;  1T0Q C;  1DOY A;  3LVV A;  4EZK A;  2DLB A;  4WWM A;  3VTU A;  2SEB D;  4DHZ E;  2G4D B;  2C9W B;  1JWA D;  4LTU A;  1L4Z B;  3H7P B;  3IFW B;  1R4N B;  2MP2 A;  1WH3 A;  1YJ1 A;  4A3P A;  4CYE A;  3GZN I;  5KHQ A;  4DHJ D;  1K53 A;  4TV3 A;  3APC A;  3EA6 A;  2JYT A;  3J9C A;  2L00 B;  4DHJ B;  3X0W A;  2MJD A;  1JWB D;  4GSW A;  2BTE A;  3LXF A;  3V05 A;  3EFU A;  4XDC A;  4US8 A;  1IYF A;  2W54 A;  2C7M B;  2MW5 A;  2ZPY A;  4HXD A;  3JPZ A;  4USA A;  4J6I A;  1WRI A;  2CJO A;  2IO0 B;  4L1B A;  1NYQ A;  3IG8 A;  4BHL A;  3I3T B;  3P2B A;  3DWM A;  2V3N A;  3VR9 B;  4S0R A;  2WS3 B;  1SF0 A;  2PEA A;  2WU5 B;  4AM1 A;  4EE2 A;  1RFA A;  5D2M B;  1XLQ A;  4ZRQ A;  1WJ4 A;  2KK8 A;  5IAA C;  1JRP A;  4P16 A;  2GBN A;  1UGM A;  2O2V A;  3E9S A;  2DBY A;  1R4N I;  4K7U A;  1D6E C;  4FAD A;  4II2 B;  4MSQ B;  3ETR A;  3DBR I;  1C78 A;  1TT4 A;  4ANV A;  1UBQ A;  5GMV A;  2MBQ A;  2KAJ A;  3ZXV A;  4JWS C;  2CU3 A;  1LXD A;  1WXS A;  4FJZ A;  2NCN A;  1R4M B;  3ZLZ A;  4UDU C;  3SHQ A;  1OGW A;  1MG8 A;  1JML A;  5G2N A;  4BFR A;  2JZP A;  1XQQ A;  1V49 A;  2JSV X;  3DBL I;  2K8C A;  1QOA A;  3P4P B;  1UBI A;  3P4R B;  4BBN F;  4ZOH C;  1S3S G;  1E7V A;  1AAR A;  1SJE D;  4YSX B;  4K3B A;  1YOV B;  1UD7 A;  2QMT A;  3IT4 B;  5EE3 A;  1XD3 B;  3HM3 A;  3CMM B;  1VRP A;  4NPN A;  4IDI A;  3AE1 B;  2KHW B;  2INP E;  1I42 A;  2BYE A;  2L1A A;  1U6R A;  1CK1 A;  3UQB A;  2M1M A;  1XLO A;  1SIF A;  3RN9 C;  3Q8F A;  3W5U B;  5JH5 C;  3JQ3 A;  3B1L X;  1SE2 A;  3BVM A;  4EKU A;  2LMC A;  4LDT D;  4ANW A;  5IN7 A;  3LN7 A;  5G5H A;  3T3O A;  1NI2 A;  1WX7 A;  4IM3 A;  2V3P A;  3ECI A;  3EEC A;  2V0G A;  3ZIM A;  3QCA A;  2BB6 A;  3DHG C;  2J52 A;  4RM8 A;  3TBL D;  2RMM A;  2WXM A;  2OED A;  3RYT A;  3C19 A;  1XCT L;  1FXA A;  1F2R I;  4XYC A;  3X23 A;  2PW9 A;  4M02 A;  4MGY E;  2KC2 A;  1G6J A;  2KTR B;  2N9X A;  1WIA A;  1KF6 B;  1SE4 A;  4ZHO A;  1TS2 A;  1TKY A;  3A4R A;  3HM6 X;  5CHV C;  4G11 A;  1R7S A;  4M01 A;  4KX6 B;  2H88 B;  2OJR A;  1BXT A;  2KO3 A;  2PVG C;  2B76 B;  4YWG G;  4RGN A;  4RF0 A;  2L05 A;  3DVN U;  3Q3F A;  4HKZ E;  3N9Y C;  1L0V B;  3N3K B;  4BOS C;  4DWF A;  3B6R A;  3L2E B;  1D5M C;  4ARC A;  2HJ8 A;  1E7P B;  1QIL A;  1E8W A;  1NVI D;  4GW0 A;  3MC9 A;  4X57 B;  2FCN A;  3RNF C;  3K9O B;  2LXC A;  3JSV B;  4BKS A;  3LJ3 A;  3ZJV A;  3WCQ A;  1TJE A;  2KMA A;  4WJN A;  4LNK A;  2D3G A;  2LEK A;  1C9F A;  1WZ0 A;  1M4V A;  1TY0 A;  2C7N B;  5E6P A;  2WLB A;  3R3M A;  5AZG A;  4GGQ A;  4DQO C;  4WJP A;  2VZK B;  4M8N A;  2ZJD A;  4HCN B;  4TKN A;  4S17 A;  3AE8 B;  2L76 A;  1IP9 A;  2BWF A;  4JLC A;  2KNB A;  1XCQ L;  3H6N A;  2G1E A;  4ASW C;  2KMM A;  1S1Q B;  1GUA B;  5BYS A;  3VTV A;  3RNC C;  5BMG A;  4XE0 A;  2MRP A;  4TMA B;  3VH3 B;  4FJY A;  5KHO A;  3RUL A;  1BG0 A;  4PS8 A;  1V6E A;  4W9F A;  1XF5 L;  4JQW C;  1G0W A;  2PJH A;  4RMA A;  2MQJ A;  2PKO A;  1BT0 A;  5CHF A;  2KAN A;  4RM9 A;  2WDQ B;  3ZDM C;  3ZUN A;  1GJZ A;  3APF A;  1L6V A;  2Z59 B;  2EKE C;  1V81 A;  4GB9 A;  2HDE A;  4D2K A;  1F2R C;  4K7S A;  2HTM E;  5HKH A;  3PO0 A;  3B0A A;  2I2Y A;  2BKR B;  1EU3 A;  3IBE A;  3W9C B;  3TEX A;  4OVV A;  1JWS D;  2Y5B B;  2IO3 B;  2KDF B;  2AEH A;  3RZF A;  1AYF A;  4OHJ A;  3ZTC A;  3TEY A;  2BYV E;  3QA8 A;  4YSZ B;  3ZO5 B;  3Q3N C;  1UZX B;  1NEK B;  1IBX B;  2JQR B;  2KFK B;  2DYO A;  4LNN A;  1VZ6 A;  4GXB A;  3VDZ A;  3KLS X;  4ZRJ A;  4DXA B;  1WF9 A;  2WXL A;  4MGK E;  3N1X C;  4I6L B;  1T0Y A;  3QIJ A;  1WR1 A;  4FHK A;  3L4P A;  1YX6 B;  3U2S C;  4GU2 A;  4B95 A;  2KTR A;  3DPD A;  3IHP C;  2I1J A;  2KX3 A;  1NI3 A;  1WGR A;  3L17 A;  3PGE A;  2YVC A;  2INC C;  5FKA C;  2BVC A;  2KT7 A;  1C79 A;  4MH0 E;  3Q2A C;  4W9H A;  3MP9 A;  4K1R B;  2GBR A;  3M10 A;  1PGB A;  3VXW A;  4WIP A;  1WYG A;  2KTF A;  2JPH A;  4FXC A;  4HCP B;  4MGI E;  1WYW B;  1EO6 A;  1FO4 A;  1FRD A;  2BQQ A;  1CZP A;  3HUI A;  2QSD A;  3A33 B;  4PS7 A;  3DCG A;  4MM3 B;  3GB1 A;  2LZ6 A;  4AWJ A;  1MPE A;  3VVW B;  1UWX A;  1IPG A;  1TZO A;  1SE9 A;  5JHA A;  1GC6 A;  5FK9 C;  2MWS B;  1C1Y B;  2UYZ B;  4JGH B;  4AS1 A;  1ZPS A;  4ZRK A;  3DHH C;  1HTQ A;  1N63 A;  2NTS A;  2AWT A;  2FCS A;  1PGA A;  2I38 A;  4MAC A;  2KD0 A;  1A5R A;  3CST A;  4WWO A;  3IAM 1;  4P7I A;  4JX1 C;  2R2Q A;  4RGT A;  4Q2R A;  2J0J A;  2LVP A;  1WXM A;  1V1P B;  2PE9 A;  4US9 A;  1ZDV A;  3JU6 A;  3KVF B;  4LDT B;  3MTN B;  2LGS A;  5MPO A;  2NR2 A;  1WGY A;  2KDM A;  3CWI A;  3HHM A;  3MC8 A;  4KKJ A;  3VUX A;  3NVY A;  3PRE A;  1P1A A;  1QQR A;  1WXA A;  5DPW A;  5FR6 A;  1T0S C;  1EU4 A;  1STE A;  3A9J B;  1LGR A;  4HJK A;  2W9N A;  4RGO S;  4GOC A;  3UIO B;  4XZ4 A;  4BAX A;  5G55 A;  3C8Y A;  3V61 A;  3QJZ A;  4A3O A;  3DWG C;  1MJD A;  3VFK A;  2AQ2 B;  2JYE A;  4FBJ B;  5AZF A;  4W9G A;  2ZCB A;  2K8B A;  5HHD G;  3PRZ A;  3WAM A;  1PDX A;  3Q6B A;  1NDD A;  3AUL A;  2O2V B;  3ZJU A;  1QLB B;  1VDV A;  2AX5 A;  2A4Z A;  3ZRC A;  3NS1 A;  5IA7 A;  1ZOY B;  3K9P B;  4FHJ A;  3GE8 C;  4GVZ A;  1HA5 A;  3TSS A;  1WJN A;  2RDH A;  3UQA A;  3AEB B;  2XNA C;  4CQN A;  3L16 A;  4NQK E;  2BS4 B;  3JSV A;  1L6U A;  4ZHP A;  3KUD B;  3N30 A;  2XN9 C;  2OOB B;  3OAW A;  2QHO A;  3IG3 A;  3RI7 C;  1FPY A;  3M63 B;  2WU2 B;  2LI5 A;  1YN3 A;  4IG7 B;  5GXG B;  3KW5 B;  1EF5 A;  4EUT A;  1E6E B;  2O6V A;  2KDE B;  1SSN A;  2WXQ A;  1WRD B;  3BWU D;  1VR9 A;  4NY0 A;  1WFY A;  2SAK A;  4LJO B;  2KVZ A;  3L0W B;  3B2G A;  5JHB A;  1TGZ B;  1J0G A;  4MJS B;  2K22 A;  2DAJ A;  2FAZ A;  1TKG A;  4TQ0 A;  1I4Q A;  2K39 A;  4A20 A;  4KGS A;  3E56 A;  3SEB A;  1JRU A;  2Z8L A;  3NOB A;  2IJ0 A;  2AQ1 B;  1L4D B;  2UU7 A;  3BIN A;  4HRS A;  2G4S A;  4GIV A;  1YN5 A;  2M4N A;  1YD8 U;  2CJN A;  3MHS D;  1L5P A;  1YMH E;  2IND C;  2KDB A;  5DPR A;  1N6Z A;  3L2D A;  2K1F A;  5D6J B;  4EOY A;  3KWV A;  3WAO A;  4EZL A;  1ZDX A;  3KH0 A;  1TY2 A;  3HVD A;  5L95 C;  1JCK B;  2BPS A;  4EZJ A;  4IUM B;  3ZJT A;  3AEA B;  3RFZ B;  2KJ6 A;  3BK2 A;  3LVW A;  1FCL A;  3WAL A;  4B6W A;  3MHZ A;  2WP9 B;  3AE2 B;  2YLM A;  2MEK A;  2LXA A;  3P42 A;  3PTF C;  1V5O A;  1KLV A;  2VZK D;  4GDL B;  2D33 A;  4AUQ C;  2FCM A;  3S2A A;  3KUZ A;  1BUI C;  4DHZ B;  3OJ3 A;  1U4A A;  2L52 A;  1UGJ A;  1F1H A;  2DHZ A;  1P98 A;  2LAS A;  4GDK A;  2QDF A;  4A90 A;  2J7Q B;  4ICU A;  2J0K A;  3AH7 A;  3EUB 2;  3M95 A;  2FID A;  2NPT B;  3AE6 B;  4K81 A;  2KWU B;  3AV8 A;  3V6E B;  2Y3A A;  2MBH A;  2ZNV B;  3NVZ A;  3UIN B;  1ZE3 D;  2WDT B;  2N7D A;  2WDV B;  5HG2 A;  3P4S B;  5BMH A;  1CRK A;  2BW2 A;  3A1Q A;  2BBC A;  3A9J A;  3D32 A;  2K25 A;  1P3Q U;  1ACC A;  3RT3 B;  1TZ1 A;  4HDQ A;  1L2N A;  1IGC A;  1RYJ A;  3OJ4 B;  3UGB B;  5C1Z A;  1EWC A;  2YEP F;  2JF5 A;  5LNK 1;  4JL9 A;  3Q8A A;  3PZ7 A;  3TJP A;  3V60 A;  2LFI A;  4KZ0 A;  2W82 A;  3BYT B;  3RNB C;  4DXG A;  3V62 A;  1RAX A;  3AN1 A;  4GMV A;  1XO3 A;  3RUI B;  2ZZP B;  2KVR A;  1AW7 A;  2WQY B;  4M00 A;  4HDO A;  5T8I A;  2ZCC A;  1QKZ A;  1ROE A;  4B9K A;  4CHK A;  1L0X B;  3H1U A;  4PK1 A;  1SE3 A;  1WXQ A;  3PHW B;  4KIK B;  4KIK A;  3ZYY X;  4P1C C;  3W2D A;  4BG4 B;  2K8H A;  2VH2 A;  2MH7 A;  1N5X A;  1LFD A;  4W9J A;  4GVY A;  4RF8 A;  4XGA B;  2WXJ A;  2IPK D;  1J7C A;  2NVU I;  2ZW0 A;  1QOB A;  1FNW A;  3SFD B;  1SJH D;  2Q5W D;  4ZYN A;  3AU5 A;  2DZM A;  1Q10 A;  3AE7 B;  2MP2 B;  4HEA 1;  4WQM A;  3A9K B;  2NBV B;  2CR5 A;  4C4V A;  3NUH B;  2IDY A;  1FRR A;  3JVZ X;  2ZPN A;  1H8C A;  5EE9 A;  5LXI B;  1IUE A;  4IM0 A;  1J7B A;  4BOZ B;  3TIX A;  2KFK A;  2XBB C;  2NBW B;  1UWM A;  2V4L A;  4YT0 B;  1SXT A;  2QIL A;  1ZXH A;  1F9J A;  2ASQ A;  2ZW1 A;  4II3 B;  1WE7 A;  4TQ1 A;  1P7F A;  2N9K A;  4HKQ A;  2WXF A;  4LCD E;  3QAQ A;  2GBK A;  3R8B A;  1FFU A;  2BKF A;  4KKI A;  3O65 B;  1I4G A;  3QHT A;  2LUE A;  3QX1 A;  5CX3 A;  1N61 A;  3GE3 C;  1ET6 A;  2IYD B;  2JRH A;  2KQS A;  4N6E B;  2AL6 A;  1RRB A;  2JXX A;  2LGY A;  3ZQ4 A;  3BYY B;  2ON8 A;  1ENF A;  2L32 A;  2GB1 A;  1VZ8 A;  4MGZ E;  3A9K A;  5D3D A;  1YQB A;  2AL3 A;  2FE8 A;  2LHE A;  2X38 A;  1OQR A;  2GWC A;  1R8G A;  1GPX A;  4KZC A;  2WNM A;  2FNJ B;  2WXN A;  3C0R B;  4W9I A;  3TL5 A;  1HQR D;  3WIM A;  3SR6 A;  2KQ7 A;  1C77 A;  5BYR A;  4HJG E;  3BII D;  3IXS A;  3ONS A;  3DBR B;  1NEN B;  1RL9 A;  3FIL B;  3L10 B;  3W1Y A;  3VAW A;  4ZDV A;  4ANX A;  1YX5 B;  2BT6 A;  1GOZ A;  2JVC A;  1E5W A;  2JZZ A;  4IWO A;  1V5T A;  1QK1 A;  2N0S B;  4OW0 A;  3PSE B;  1JRO A;  1JWU D;  2D3A A;  5TSS A;  5DPS A;  3BVG A;  1V4G A;  2BYF A;  2QCZ A;  4N58 A;  3KUC B;  1B9R A;  2BS3 B;  4URK A;  2PVO D;  1SB3 C;  2MBO A;  1JW9 D;  1TT5 B;  2C5L C;  2WXI A;  4K3C A;  3MFG A;  3NZ3 A;  1HXY D;  3EGR A;  3DBL B;  1CMX B;  3SU8 X;  1QH4 A;  1SIJ A;  3PT2 B;  4WAF A;  1P0R A;  1YQ4 B;  4ANU A;  3AE9 B;  3DRE A;  3VUW A;  2D5G A;  1SBB B;  1LO5 D;  2DYB A;  1GAQ B;  1P9D U;  4L23 A;  2Z0E B;  2ICI A;  3NRZ A;  1SD0 A;  1A70 A;  3PV1 A;  4G3X B;  5E6N A;  3PLV A;  1OTR B;  3ZGZ A;  2GI9 A;  4LNF A;  1FEH A;  2LWP A;  2QEJ C;  1Z2M A;  2WXP A;  4C7Y A;  3NZT A;  1PUT A;  4RF1 A;  2L83 A;  3V6C B;  2KYW A;  1MVK A;  4BVU C;  1P52 A;  1WMH B;  3V3X A;  2JX5 A;  2RPQ A;  1QF6 A;  2ZVO A;  3CF6 E;  3VTW A;  4BBN C;  1WJ6 A;  1GNU A;  2LGX A;  3NY5 A;  3NVW A;  3HIZ A;  2FBW B;  2NPT A;  4MSM B;  1MHX A;  2N4F A;  4GN1 A;  2WWZ A;  4N9F 4;  2CKH B;  2J1Q A;  3DRB A;  1FCC C;  5E6J A;  2MCN B;  4IC7 B;  1VCB A;  3B2F A;  2KX0 A;  1SEB D;  2L3Z A;  3DVN V;  3RNE C;  1FNV A;  3GS2 A;  1WMH A;  2K5P A;  5HI1 A;  1YQ3 B;  4P6V F;  3AI5 A;  3DOW A;  2WGS A;  2PMV A;  2QIE B;  5JZE B;  3VQI A;  3L54 A;  2MA9 B;  3L13 A;  2C60 A;  4WJQ A;  4L2Y A;  2JWZ A;  4I6N B;  2HTH A;  2IO2 B;  2E3T A;  2PTL A;  2ACZ B;  4XWW A;  1ET9 A;  4NZL B;  4XDD A;  2PPH A;  2LVO A;  3DBS A;  1QOF A;  2IZV B;  4WUR A;  1XLP A;  1M94 A;  4N59 A;  4IW0 A;  2M19 A;  2CS4 A;  3VRB B;  4EEW A;  3TUO A;  1E8Y A;  2D10 A;  3M3J A;  5DCN A;  2D07 B;  3NVV A;  4AOF A;  1XEE A;  2EKI A;  1E90 A;  2I1K A;  4TSS A;  1DOX A;  1KTK A;  4XX5 A;  3QWZ B;  1D3Z A;  1DYQ A;  4G0N B;  4OVU A;  4DK5 A;  4Q2J A;  2XEW A;  4WWP A;  2D3C A;  1AWD A;  1KM7 A;  5LLI A;  5BMI A;  2O6V D;  4H2A A;  3EHV A;  1WY8 A;  4DBG A;  3Q8B A;  2LGI A;  3AEG B;  5IO9 A;  4MM3 A;  4RCO A;  3N1Y C;  1OQY A;  2DYM A;  3AEF B;  1WX9 A;  4A55 A;  2V4I B;  4IKG A;  3AXC A;  3TEW A;  4MH8 A;  4KSK C;  1V9J A;  2KJH B;  3OLM D;  2GRI A;  2M17 A;  1TYG B;  3AED B;  2KWD A;  4AQ7 A;  3H9D A;  3I9V 1;  4WQO B;  5H8Y E;  5D7G A;  2KLC A;  2JRI B;  3SDL C;  2FIF A;  1ZUD 2;  1V1O A;  2J42 A;  1E8X A;  3A4S C;  3NS8 A;  3PZ8 A;  1WXV A;  3RNA C;  3LDZ E;  1V80 A;  5DPT A;  3U4E G;  2JUO A;  5J2R A;  2KOX A;  2X8X X;  3ML9 A;  2N7E A;  1I35 A;  1FM0 D;  1FIQ A;  4B0M A;  2WXH A;  3JYU A;  4E71 A;  1FFV A;  4MEL A;  1WZ3 A;  2CHX A;  2EMS A;  3R2I A;  3RCZ A;  3RMK C;  2GOW A;  2IGH A;  4KV2 A;  1NYR A;  2TSS A;  1HZ5 A;  2N9L A;  3U30 A;  2BGF A;  1Y56 A;  5TR5 A;  4YTN B;  3W1S A;  3OWE B;  4C80 A;  2V3S A;  1JWM D;  4HK2 A;  1WGH A;  1MI0 A;  3DBH B;  4W9E A;  5IP4 D;  1KRH A;  1OQQ A;  4A6Q A;  2ZEQ A;  2DEN B;  1YNT E;  1K51 A;  1Z5S B;  1WX8 A;  4WJO A;  2RSU A;  4F7Z A;  3URY A;  1TTN A;  2MX2 A;  1ISN A;  4NQL B;  1P50 A;  4ACF A;  2RDG A;  5D3I B;  2V1Y A;  3R7R A;  4Z9M A;  4YL8 A;  3LYY A;  1V1P A;  3DDC B;  2J53 A;  2D2Q A;  3MJ5 A;  3ML8 A;  1KLG D;  1N60 A;  2NBU A;  1VRA B;  4A9A A;  2JXT A;  2V9H A;  1GB4 A;  1E0Z A;  4B0E A;  2DNF A;  1F77 A;  4ARI A;  2RDB C;  3NG0 A;  4IWP A;  4NNJ B;  3I57 A;  4RF6 A;  2W3R A;  1ZP0 B;  2LRU A;  4WH4 A;  2QJL A;  3LB8 C;  1E9M A;  4DDI D;  2LJI A;  4FJV B;  3U7Z A;  3CIR B;  3AEC B;  2GBJ A;  1WWT A;  3ENE A;  2PLP A;  2MBB B;  1LM8 B;  4ITK A;  1XLN A;  4PYZ A;  2GWD A;  3R7Q A;  4F8C B;  4IOI E;  2RGF A;  3P63 A;  1RWS A;  3TCA A;  5IKC M;  1PGX A;  1I0E A;  1TS4 A;  3M62 B;  2K6D B;  2G3Q B;  1WGD A;  4NJC A;  1IGD A;  3W5V B;  3KYD D;  1XT9 B;  2UWQ A;  1FMA D;  2MHJ A;  2IGD A;  2KN4 A;  4NJ7 A;  1QZE A;  2JWU A;  2W55 A;  2NS5 A;  2CU1 A;  5CHW A;  2DAF A;  4AJY B;  2KKC A;  2K9X A;  4W9K A;  4RH6 A;  1FD6 A;  4KGR A;  5J18 A;  1RFK A;  2JY6 A;  4O1N A;  5LXH A;  2G45 B;  4C56 C;  3ZNZ B;  2MBE A;  2INN E;  3PVL A;  2M56 B;  3H7S A;  1EM7 A;  1D5X C;  4MT5 A;  1OFF A;  1Q1O A;  4JIO U;  2RD0 A;  3L2E A;  4M8M A;  3HVZ A;  3Q69 A;  3IVF A;  4OVZ A;  3QK0 A;  1WGK A;  2HD5 B;  3AE5 B;  3UI3 A;  5AUI A;  1C4C A;  3VRA B;  3T8M A;  3Q3M C;  1EUV B;  2W3S A;  4I6P A;  4WWN A;  4NAW A;  1TS3 A;  3T9L A;  3KQ4 A;  1Q0W B;  1JQ4 A;  5E6O A;  1I4P A;  3JW0 X;  3Q14 C;  5C23 A;  4M0W A;  2CRK A;  2LHD A;  1KLU D;  3Q3O C;  4ZYS A;  2KDI A;  1WI0 A;  2N1W A;  2WHI A;  3DBH I;  1V97 A;  2KAC A;  3KWL A;  3N32 A;  1RM6 C;  2L8J A;  4RF9 A;  1VZ7 A;  1P7E A;  4GDL A;  5FR3 A;  4KDI C;  3EC8 A;  1PQS A;  4HVB A;  2L7R A;  2BF8 B;  3BZD B;  2GBM A;  1UH6 A;  4FLH A;  2DWQ A;  4PS3 A;  1MHH E;  4DXF A;  3ZNG C;  2KWV B;  3ZXR A;  5G5G A;  4RNA A;  4FA6 A;  3N1Z C;  3RZW C;  1C4A A;  3WA0 A;  1WR6 E;  3ZTD A;  1T3Q A;  1ESF A;  1I4X A;  1HE8 A;  2AYO B;  2IY0 B;  3DHI C;  2KMC A;  2NMQ A;  4RF7 A;  2K3U A;  1WM3 A;  3BVZ A;  1ZGU B;  3AEE B;  1MG4 A;  2D3B A;  1N62 A;  3OG5 A;  3U8Z A;  2WXK A;  1J8C A;  3FAH A;  1WE6 A;  2FUH B;  3SD5 A;  5IOI A;  1VLB A;  2OJW A;  2VH1 A;  4HPL B;  1KJT A;  4W9L A;  3SFE B;  4ZRI A;  4PT5 A;  2DZK A;  4ZRP A;  2WXR A;  1I4R A;  1KFY B;  1FXI A;  4IM2 A;  4YTM B;  1TS5 A;  3CSF A;  3PZD A;  3UF8 A;  3MJW A;  2WDR B;  3APD A;  2DX5 B;  2XK5 A;  3MC0 B;  2D32 A;  3ZW3 A;  1Y8R C; 
#chains in the Genus database with same CATH homology
 1F1H A;  3M10 A;  4BG4 A;  3JPZ A;  4GW2 A;  1G0W A;  1CRK A;  4LNF A;  2CRK A;  2WGS A;  3FKY A;  3JU6 A;  4BAX A;  3DRE A;  4GVY A;  4RF8 A;  4RF7 A;  5J9A A;  1F52 A;  2D3A A;  2D3C A;  1HTQ A;  4GVZ A;  4BHL A;  2LGS A;  1P50 A;  2WHI A;  4LNO A;  4HPP A;  2QC8 A;  4ACF A;  3NG0 A;  3JQ3 A;  3L2E A;  4GW0 A;  2D3B A;  4LNI A;  1RL9 A;  4Z9M A;  5J99 A;  2J1Q A;  4RF6 A;  1VRP A;  3DRB A;  1HTO A;  4S17 A;  2UU7 A;  4S0R A;  1M15 A;  4LNN A;  4RF9 A;  1P52 A;  4XYC A;  2BVC A;  3ZXR A;  1BG0 A;  1SD0 A;  1FPY A;  4LNK A;  3JU5 A;  4BG4 B;  1U6R A;  2OJW A;  4AM1 A;  1QH4 A;  2GLS A;  1I0E A;  3ZXV A;  3B6R A;  3L2E B;  1LGR A;  3L2D A;  1QK1 A;  4Q2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...