2WIHB

Structure of cdk2-cyclin a with pha-848125
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
257
structure length
257
Chain Sequence
b'PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Identification of N,1,4,4-Tetramethyl-8-{[4-(4-Methylpiperazin-1-Yl)Phenyl]Amino}-4,5-Dihydro-1H-Pyrazolo[4,3-H]Quinazoline-3-Carboxamide (Pha-848125), a Potent, Orally Available Cyclin Dependent Kinase Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wihB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wihB02
4CFNB 2R7GA 4BCQD 4BCOB 1H28B 2WEVB 3H4CA 4OR5B 3BHUB 2BPMB 1F5QB 2W96A 3BLQB 5ICPB 5HQ0B 2F2CA 4CFMB 5CEIB 2X1NB 1GH6B 3QHWB 3O0GD 4F6SB 4CXAB 1AD6A 3DDQB 5IDPB 4KRCB 2W9FA 4IMYB 3TNIB 4EOLB 4F7JB 4BCIB 1JSUB 4CRLB 2C4GB 4BCQB 2B9RA 1H27B 2PK2A 1W98B 2UZBB 4BCMD 1O9KB 5EFQB 2JGZB 4CFUD 4NSTB 1H1SB 3EJ1B 1OL2B 2W99A 3LQ5B 4EC8B 1H1RB 5CYIB 3QHRB 1GUXA 3TNHB 4BCND 2WMAB 5IDNB 4F70B 1VYWB 4YOOA 1P5EB 3EOCB 4EOPB 2WMBB 3RGFB 4EOKB 2PMIB 1KXUA 1OL1B 2UZEB 1D3UB 4EOQB 4BCMB 3M03A 1VOLA 4YC3B 2I40B 1H24B 4CFWB 4BCNB 2EUFA 3MIAB 1JKWA 4OGRB 3G33B 5HVYB 2CJMB 2WXVB 4F7NB 5ACBA 3BHVB 5HBEB 3BLRB 4F7LB 4EOSB 3BLHB 1E9HB 4ROEA 4ELLA 2G9XB 2C5NB 1JOWA 4F7SB 4BCJB 1FINB 5IF1B 2I53A 2WFYB 5HNBB 1JSTB 4Y72B 4BCFB 4CFVB 4II5B 2W9ZA 2C6TB 3EIDB 4F6WB 4F6UB 1UNLD 1VINA 1N4MA 1URCB 2CCHB 2UUEB 1OKVB 1UNGD 3MY1B 4CFUB 5LMKB 2IW6B 2V22B 4EOIB 5HBHB 2WPAB 4FX3B 5L2WB 1O9KA 2WIHB 3DDPB 4EONB 4BCHB 1PKDB 1GY3B 3TNWB 3DOGB 1G3NC 4UN0A 2W2HA 4G6LB 2IVXA 2UZDB 1H25B 1FVVB 1H26B 2IW9B 3POMA 1QMZB 1GUXB 2BKZB 1H4LD 1OGUB 1OKWB 3MI9B 4YOSA 1H1PB 2PK9B 1UNHD 4I3ZB 1OIUB 3MY5B 5FGKB 3K7AM 4EOJB 2UZLB 2WHBB 1BU2A 1XO2A 4ELJA 4YOZA 2CCIB 2C5XB 5LQFB 4EOOB 3F5XB 1AISB 1OI9B 1TFBA 3BHTB 5HBJB 2IW8B 1OIYB 4TTHA 4CFXB 1C9BA 4ROCA 5I5ZB 4BCGB 4EORB 4RODA 1H1QB 2C5OB 2QDJA 4BCKB 5BNJB 4KRDB 4EOMB 2C5VB 2PHGA 2WIPB 4BCPB 1ZP2A 3TN8B 4EC9B
chains in the Genus database with same CATH superfamily
2R7GA 3X28B 1H28B 2WEVB 5DQVA 5CEIB 1GH6B 4CXAB 1AD6A 4HLQA 4KRCB 4F7JB 2BS3A 3NDQA 2C4GB 2B9RA 1H27B 4NSTB 4AKHA 3LQ5B 4EC8B 5CYIB 1GUXA 4BCND 2WMAB 1VYWB 4YOOA 1P5EB 2CYZB 3RGFB 2PMIB 1KXUA 3M03A 3VYHB 4BCNB 1JKWA 5HVYB 3G33B 2CJMB 3BLRB 4F7LB 2WJ9A 4BBRM 2BS4A 2QGSA 1JSTB 2C6TB 3HHTB 1N4MA 2ZPFB 2DXCB 2WPAB 4FX3B 5L2WB 3DDPB 3DOGB 3WVDB 1V29B 4UN0A 4AKGA 4G6LB 2UZDB 2CZ1B 3HO8A 2CZ0B 4FM4B 1OKWB 3MI9B 4YOSA 1H1PB 1UNHD 4I3ZB 4HL4A 3PO3S 4OB1B 1XO2A 4BY1X 2CCIB 4EOOB 3A8MB 2ZCFB 1TFBA 3BHTB 1FKMA 4ROCA 2C5OB 2QDJA 4BCKB 4EOMB 2C5VB 2WIPB 3TN8B 4EC9B 4BCQD 2IN3A 4ZGJB 3BHUB 2BPMB 5ICPB 3BLQB 5HQ0B 4CFMB 4F6SB 3QHWB 2W9FA 3TNIB 2QF7A 2QQ8A 4BCIB 4CRLB 1ENWA 4BCQB 3TW7A 5EFQB 1H1RB 3QHRB 3X24B 5IDNB 2DD4B 3X25B 2ZPHB 3QXEB 1OL1B 2CZ7B 4Z6YA 4EOQB 1VOLA 3DJBA 3DL1A 3A8GB 2WXVB 4F7NB 5ACBA 3BHVB 5HBEB 1E9HB 2DXBB 4ELLA 2G9XB 2C5NB 4F7SB 2I53A 5HNBB 4CFVB 4F6UB 1VINA 1UNGD 2CZ6B 4EOIB 2D0QB 5HBHB 1O9KA 4BBSM 1UGRB 5DQWA 4HNTA 3QZ9B 2W2HA 2QDYB 1GUXB 1UGSB 2PK9B 3MY5B 4EOJB 3VKHA 2KR6A 2UZLB 2WHBB 1IREB 4LOCA 4YOZA 4OB3B 5LQFB 4TTHA 4OB0B 3X20B 5I5ZB 4BCGB 4EORB 3B57A 2PHGA 4BCPB 1E7PA 4CFNB 2PJQA 3H4CA 4OR5B 2W96A 2X1NB 3O0GD 5IDPB 1JSUB 3WVEB 3BG3A 2PK2A 4BCMD 5IHYA 2JGZB 4CFUD 1H1SB 1UGPB 3EJ1B 1OL2B 4OB2B 3HB9A 4BY7X 3EOCB 2WMBB 2UZEB 2ZPEB 4BCMB 2I40B 1H24B 2ZZDB 3QYHB 4AI6A 4MIMA 3BG5A 4M6VA 4OGRB 3BLHB 1JOWA 4BCJB 1FINB 5IF1B 2WFYB 3HBLA 4ZGEB 3QYEA 2CCHB 2UUEB 1OKVB 3A8HB 3MY1B 5LMKB 3X26B 4HNVA 4EONB 1GY3B 1H25B 1H26B 1QMZB 3VYGB 2BKZB 1H4LD 1OGUB 5FGKB 4JX4A 3K7AM 1QLBA 2DMEA 2G77A 2ZPIB 4ELJA 4ZGDB 2C5XB 3F5XB 1OI9B 4CFXB 1OIYB 1UGQB 2DD5B 1H1QB 5BNJB 4KRDB 3A8LB 3KHIA 4RODA 3A8OB 4BCOB 1F5QB 2F2CA 2KMGA 3DDQB 4JX6A 4IMYB 4EOLB 2BS2A 1W98B 2LW4A 2UZBB 4JX5A 1O9KB 2W99A 3HZJA 3TNHB 4BXXX 3VKGA 4F70B 5EJCA 4MFDA 4EOPB 4QSHA 4EOKB 1D3UB 4YC3B 4NC6A 2ZPGB 4CFWB 2EUFA 1AHJB 3MIAB 4MFEA 4EOSB 4ROEA 3TW6A 2ZPBB 4BCFB 4Y72B 4F6WB 4II5B 2W9ZA 3EIDB 1UNLD 1URCB 4CFUB 3QYBA 2IW6B 2V22B 2WIHB 4BCHB 1PKDB 3TNWB 4AKIA 3QWLA 3BG9A 1G3NC 1TD6A 2IVXA 1FVVB 2IW9B 3POMA 3GTMS 3QZ5B 2DPPB 2AHJB 1OIUB 1BU2A 3QYGB 1AISB 5HBJB 2IW8B 1C9BA 4HNUA 2QFZA 3DTOA 1ZP2A
chains in the Genus database with same CATH topology
4CFNB 2R7GA 4BCQD 4BCOB 1H28B 2WEVB 3H4CA 4OR5B 3BHUB 2BPMB 1F5QB 2W96A 3BLQB 5ICPB 5HQ0B 2F2CA 4CFMB 5CEIB 2X1NB 1GH6B 3QHWB 3O0GD 4F6SB 4CXAB 1AD6A 3DDQB 5IDPB 4KRCB 2W9FA 4IMYB 3TNIB 4EOLB 4F7JB 4BCIB 1JSUB 4CRLB 2C4GB 4BCQB 2B9RA 1H27B 2PK2A 1W98B 2UZBB 4BCMD 1O9KB 5EFQB 2JGZB 4CFUD 4NSTB 1H1SB 3EJ1B 1OL2B 2W99A 3LQ5B 4EC8B 1H1RB 5CYIB 3QHRB 1GUXA 3TNHB 4BCND 2WMAB 5IDNB 4F70B 1VYWB 4YOOA 1P5EB 3EOCB 4EOPB 2WMBB 3RGFB 4EOKB 2PMIB 1KXUA 1OL1B 2UZEB 1D3UB 4EOQB 4BCMB 3M03A 1VOLA 4YC3B 2I40B 1H24B 4CFWB 4BCNB 2EUFA 3MIAB 1JKWA 4OGRB 3G33B 5HVYB 2CJMB 2WXVB 4F7NB 5ACBA 3BHVB 5HBEB 3BLRB 4F7LB 4EOSB 3BLHB 1E9HB 4ROEA 4ELLA 2G9XB 2C5NB 1JOWA 4F7SB 4BCJB 1FINB 5IF1B 2I53A 2WFYB 5HNBB 1JSTB 4Y72B 4BCFB 4CFVB 4II5B 2W9ZA 2C6TB 3EIDB 4F6WB 4F6UB 1UNLD 1VINA 1N4MA 1URCB 2CCHB 2UUEB 1OKVB 1UNGD 3MY1B 4CFUB 5LMKB 2IW6B 2V22B 4EOIB 5HBHB 2WPAB 4FX3B 5L2WB 1O9KA 2WIHB 3DDPB 4EONB 4BCHB 1PKDB 1GY3B 3TNWB 3DOGB 1G3NC 4UN0A 2W2HA 4G6LB 2IVXA 2UZDB 1H25B 1FVVB 1H26B 2IW9B 3POMA 1QMZB 1GUXB 2BKZB 1H4LD 1OGUB 1OKWB 3MI9B 4YOSA 1H1PB 2PK9B 1UNHD 4I3ZB 1OIUB 3MY5B 5FGKB 3K7AM 4EOJB 2UZLB 2WHBB 1BU2A 1XO2A 4ELJA 4YOZA 2CCIB 2C5XB 5LQFB 4EOOB 3F5XB 1AISB 1OI9B 1TFBA 3BHTB 5HBJB 2IW8B 1OIYB 4TTHA 4CFXB 1C9BA 4ROCA 5I5ZB 4BCGB 4EORB 4RODA 1H1QB 2C5OB 2QDJA 4BCKB 5BNJB 4KRDB 4EOMB 2C5VB 2PHGA 2WIPB 4BCPB 1ZP2A 3TN8B 4EC9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CFN B;  2R7G A;  4BCQ D;  4BCO B;  1H28 B;  2WEV B;  3H4C A;  4OR5 B;  3BHU B;  2BPM B;  1F5Q B;  2W96 A;  3BLQ B;  5ICP B;  5HQ0 B;  2F2C A;  4CFM B;  5CEI B;  2X1N B;  1GH6 B;  3QHW B;  3O0G D;  4F6S B;  4CXA B;  1AD6 A;  3DDQ B;  5IDP B;  4KRC B;  2W9F A;  4IMY B;  3TNI B;  4EOL B;  4F7J B;  4BCI B;  1JSU B;  4CRL B;  2C4G B;  4BCQ B;  2B9R A;  1H27 B;  2PK2 A;  1W98 B;  2UZB B;  4BCM D;  1O9K B;  5EFQ B;  2JGZ B;  4CFU D;  4NST B;  1H1S B;  3EJ1 B;  1OL2 B;  2W99 A;  3LQ5 B;  4EC8 B;  1H1R B;  5CYI B;  3QHR B;  1GUX A;  3TNH B;  4BCN D;  2WMA B;  5IDN B;  4F70 B;  1VYW B;  4YOO A;  1P5E B;  3EOC B;  4EOP B;  2WMB B;  3RGF B;  4EOK B;  2PMI B;  1KXU A;  1OL1 B;  2UZE B;  1D3U B;  4EOQ B;  4BCM B;  3M03 A;  1VOL A;  4YC3 B;  2I40 B;  1H24 B;  4CFW B;  4BCN B;  2EUF A;  3MIA B;  1JKW A;  4OGR B;  3G33 B;  5HVY B;  2CJM B;  2WXV B;  4F7N B;  5ACB A;  3BHV B;  5HBE B;  3BLR B;  4F7L B;  4EOS B;  3BLH B;  1E9H B;  4ROE A;  4ELL A;  2G9X B;  2C5N B;  1JOW A;  4F7S B;  4BCJ B;  1FIN B;  5IF1 B;  2I53 A;  2WFY B;  5HNB B;  1JST B;  4Y72 B;  4BCF B;  4CFV B;  4II5 B;  2W9Z A;  2C6T B;  3EID B;  4F6W B;  4F6U B;  1UNL D;  1VIN A;  1N4M A;  1URC B;  2CCH B;  2UUE B;  1OKV B;  1UNG D;  3MY1 B;  4CFU B;  5LMK B;  2IW6 B;  2V22 B;  4EOI B;  5HBH B;  2WPA B;  4FX3 B;  5L2W B;  1O9K A;  2WIH B;  3DDP B;  4EON B;  4BCH B;  1PKD B;  1GY3 B;  3TNW B;  3DOG B;  1G3N C;  4UN0 A;  2W2H A;  4G6L B;  2IVX A;  2UZD B;  1H25 B;  1FVV B;  1H26 B;  2IW9 B;  3POM A;  1QMZ B;  1GUX B;  2BKZ B;  1H4L D;  1OGU B;  1OKW B;  3MI9 B;  4YOS A;  1H1P B;  2PK9 B;  1UNH D;  4I3Z B;  1OIU B;  3MY5 B;  5FGK B;  3K7A M;  4EOJ B;  2UZL B;  2WHB B;  1BU2 A;  1XO2 A;  4ELJ A;  4YOZ A;  2CCI B;  2C5X B;  5LQF B;  4EOO B;  3F5X B;  1AIS B;  1OI9 B;  1TFB A;  3BHT B;  5HBJ B;  2IW8 B;  1OIY B;  4TTH A;  4CFX B;  1C9B A;  4ROC A;  5I5Z B;  4BCG B;  4EOR B;  4ROD A;  1H1Q B;  2C5O B;  2QDJ A;  4BCK B;  5BNJ B;  4KRD B;  4EOM B;  2C5V B;  2PHG A;  2WIP B;  4BCP B;  1ZP2 A;  3TN8 B;  4EC9 B; 
#chains in the Genus database with same CATH topology
 2R7G A;  3X28 B;  1H28 B;  2WEV B;  5DQV A;  5CEI B;  1GH6 B;  4CXA B;  1AD6 A;  4HLQ A;  4KRC B;  4F7J B;  2BS3 A;  3NDQ A;  2C4G B;  2B9R A;  1H27 B;  4NST B;  4AKH A;  3LQ5 B;  4EC8 B;  5CYI B;  1GUX A;  4BCN D;  2WMA B;  1VYW B;  4YOO A;  1P5E B;  2CYZ B;  3RGF B;  2PMI B;  1KXU A;  3M03 A;  3VYH B;  4BCN B;  1JKW A;  5HVY B;  3G33 B;  2CJM B;  3BLR B;  4F7L B;  2WJ9 A;  4BBR M;  2BS4 A;  2QGS A;  1JST B;  2C6T B;  3HHT B;  1N4M A;  2ZPF B;  2DXC B;  2WPA B;  4FX3 B;  5L2W B;  3DDP B;  3DOG B;  3WVD B;  1V29 B;  4UN0 A;  4AKG A;  4G6L B;  2UZD B;  2CZ1 B;  3HO8 A;  2CZ0 B;  4FM4 B;  1OKW B;  3MI9 B;  4YOS A;  1H1P B;  1UNH D;  4I3Z B;  4HL4 A;  3PO3 S;  4OB1 B;  1XO2 A;  4BY1 X;  2CCI B;  4EOO B;  3A8M B;  2ZCF B;  1TFB A;  3BHT B;  1FKM A;  4ROC A;  2C5O B;  2QDJ A;  4BCK B;  4EOM B;  2C5V B;  2WIP B;  3TN8 B;  4EC9 B;  4BCQ D;  2IN3 A;  4ZGJ B;  3BHU B;  2BPM B;  5ICP B;  3BLQ B;  5HQ0 B;  4CFM B;  4F6S B;  3QHW B;  2W9F A;  3TNI B;  2QF7 A;  2QQ8 A;  4BCI B;  4CRL B;  1ENW A;  4BCQ B;  3TW7 A;  5EFQ B;  1H1R B;  3QHR B;  3X24 B;  5IDN B;  2DD4 B;  3X25 B;  2ZPH B;  3QXE B;  1OL1 B;  2CZ7 B;  4Z6Y A;  4EOQ B;  1VOL A;  3DJB A;  3DL1 A;  3A8G B;  2WXV B;  4F7N B;  5ACB A;  3BHV B;  5HBE B;  1E9H B;  2DXB B;  4ELL A;  2G9X B;  2C5N B;  4F7S B;  2I53 A;  5HNB B;  4CFV B;  4F6U B;  1VIN A;  1UNG D;  2CZ6 B;  4EOI B;  2D0Q B;  5HBH B;  1O9K A;  4BBS M;  1UGR B;  5DQW A;  4HNT A;  3QZ9 B;  2W2H A;  2QDY B;  1GUX B;  1UGS B;  2PK9 B;  3MY5 B;  4EOJ B;  3VKH A;  2KR6 A;  2UZL B;  2WHB B;  1IRE B;  4LOC A;  4YOZ A;  4OB3 B;  5LQF B;  4TTH A;  4OB0 B;  3X20 B;  5I5Z B;  4BCG B;  4EOR B;  3B57 A;  2PHG A;  4BCP B;  1E7P A;  4CFN B;  2PJQ A;  3H4C A;  4OR5 B;  2W96 A;  2X1N B;  3O0G D;  5IDP B;  1JSU B;  3WVE B;  3BG3 A;  2PK2 A;  4BCM D;  5IHY A;  2JGZ B;  4CFU D;  1H1S B;  1UGP B;  3EJ1 B;  1OL2 B;  4OB2 B;  3HB9 A;  4BY7 X;  3EOC B;  2WMB B;  2UZE B;  2ZPE B;  4BCM B;  2I40 B;  1H24 B;  2ZZD B;  3QYH B;  4AI6 A;  4MIM A;  3BG5 A;  4M6V A;  4OGR B;  3BLH B;  1JOW A;  4BCJ B;  1FIN B;  5IF1 B;  2WFY B;  3HBL A;  4ZGE B;  3QYE A;  2CCH B;  2UUE B;  1OKV B;  3A8H B;  3MY1 B;  5LMK B;  3X26 B;  4HNV A;  4EON B;  1GY3 B;  1H25 B;  1H26 B;  1QMZ B;  3VYG B;  2BKZ B;  1H4L D;  1OGU B;  5FGK B;  4JX4 A;  3K7A M;  1QLB A;  2DME A;  2G77 A;  2ZPI B;  4ELJ A;  4ZGD B;  2C5X B;  3F5X B;  1OI9 B;  4CFX B;  1OIY B;  1UGQ B;  2DD5 B;  1H1Q B;  5BNJ B;  4KRD B;  3A8L B;  3KHI A;  4ROD A;  3A8O B;  4BCO B;  1F5Q B;  2F2C A;  2KMG A;  3DDQ B;  4JX6 A;  4IMY B;  4EOL B;  2BS2 A;  1W98 B;  2LW4 A;  2UZB B;  4JX5 A;  1O9K B;  2W99 A;  3HZJ A;  3TNH B;  4BXX X;  3VKG A;  4F70 B;  5EJC A;  4MFD A;  4EOP B;  4QSH A;  4EOK B;  1D3U B;  4YC3 B;  4NC6 A;  2ZPG B;  4CFW B;  2EUF A;  1AHJ B;  3MIA B;  4MFE A;  4EOS B;  4ROE A;  3TW6 A;  2ZPB B;  4BCF B;  4Y72 B;  4F6W B;  4II5 B;  2W9Z A;  3EID B;  1UNL D;  1URC B;  4CFU B;  3QYB A;  2IW6 B;  2V22 B;  2WIH B;  4BCH B;  1PKD B;  3TNW B;  4AKI A;  3QWL A;  3BG9 A;  1G3N C;  1TD6 A;  2IVX A;  1FVV B;  2IW9 B;  3POM A;  3GTM S;  3QZ5 B;  2DPP B;  2AHJ B;  1OIU B;  1BU2 A;  3QYG B;  1AIS B;  5HBJ B;  2IW8 B;  1C9B A;  4HNU A;  2QFZ A;  3DTO A;  1ZP2 A; 
#chains in the Genus database with same CATH homology
 4CFN B;  2R7G A;  4BCQ D;  4BCO B;  1H28 B;  2WEV B;  3H4C A;  4OR5 B;  3BHU B;  2BPM B;  1F5Q B;  2W96 A;  3BLQ B;  5ICP B;  5HQ0 B;  2F2C A;  4CFM B;  5CEI B;  2X1N B;  1GH6 B;  3QHW B;  3O0G D;  4F6S B;  4CXA B;  1AD6 A;  3DDQ B;  5IDP B;  4KRC B;  2W9F A;  4IMY B;  3TNI B;  4EOL B;  4F7J B;  4BCI B;  1JSU B;  4CRL B;  2C4G B;  4BCQ B;  2B9R A;  1H27 B;  2PK2 A;  1W98 B;  2UZB B;  4BCM D;  1O9K B;  5EFQ B;  2JGZ B;  4CFU D;  4NST B;  1H1S B;  3EJ1 B;  1OL2 B;  2W99 A;  3LQ5 B;  4EC8 B;  1H1R B;  5CYI B;  3QHR B;  1GUX A;  3TNH B;  4BCN D;  2WMA B;  5IDN B;  4F70 B;  1VYW B;  4YOO A;  1P5E B;  3EOC B;  4EOP B;  2WMB B;  3RGF B;  4EOK B;  2PMI B;  1KXU A;  1OL1 B;  2UZE B;  1D3U B;  4EOQ B;  4BCM B;  3M03 A;  1VOL A;  4YC3 B;  2I40 B;  1H24 B;  4CFW B;  4BCN B;  2EUF A;  3MIA B;  1JKW A;  4OGR B;  3G33 B;  5HVY B;  2CJM B;  2WXV B;  4F7N B;  5ACB A;  3BHV B;  5HBE B;  3BLR B;  4F7L B;  4EOS B;  3BLH B;  1E9H B;  4ROE A;  4ELL A;  2G9X B;  2C5N B;  1JOW A;  4F7S B;  4BCJ B;  1FIN B;  5IF1 B;  2I53 A;  2WFY B;  5HNB B;  1JST B;  4Y72 B;  4BCF B;  4CFV B;  4II5 B;  2W9Z A;  2C6T B;  3EID B;  4F6W B;  4F6U B;  1UNL D;  1VIN A;  1N4M A;  1URC B;  2CCH B;  2UUE B;  1OKV B;  1UNG D;  3MY1 B;  4CFU B;  5LMK B;  2IW6 B;  2V22 B;  4EOI B;  5HBH B;  2WPA B;  4FX3 B;  5L2W B;  1O9K A;  2WIH B;  3DDP B;  4EON B;  4BCH B;  1PKD B;  1GY3 B;  3TNW B;  3DOG B;  1G3N C;  4UN0 A;  2W2H A;  4G6L B;  2IVX A;  2UZD B;  1H25 B;  1FVV B;  1H26 B;  2IW9 B;  3POM A;  1QMZ B;  1GUX B;  2BKZ B;  1H4L D;  1OGU B;  1OKW B;  3MI9 B;  4YOS A;  1H1P B;  2PK9 B;  1UNH D;  4I3Z B;  1OIU B;  3MY5 B;  5FGK B;  3K7A M;  4EOJ B;  2UZL B;  2WHB B;  1BU2 A;  1XO2 A;  4ELJ A;  4YOZ A;  2CCI B;  2C5X B;  5LQF B;  4EOO B;  3F5X B;  1AIS B;  1OI9 B;  1TFB A;  3BHT B;  5HBJ B;  2IW8 B;  1OIY B;  4TTH A;  4CFX B;  1C9B A;  4ROC A;  5I5Z B;  4BCG B;  4EOR B;  4ROD A;  1H1Q B;  2C5O B;  2QDJ A;  4BCK B;  5BNJ B;  4KRD B;  4EOM B;  2C5V B;  2PHG A;  2WIP B;  4BCP B;  1ZP2 A;  3TN8 B;  4EC9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...