2WIIC

Complement c3b in complex with factor h domains 1-4
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
245
structure length
245
Chain Sequence
CNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNIIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C3 BETA CHAIN
publication title Structure of complement fragment C3b-factor H and implications for host protection by complement regulators.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2009-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2wiiC04
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2wiiC02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2wiiC01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2wiiC03
4ZH1D 2JGWA 1OJYA 1SRZA 2CG6A 4F4OC 5HYUB 1HFIA 1QGBA 1OK2A 1PPQA 1VVDA 2W80A 1FBRA 5FO8C 1CKLA 3O8EB 1Q3XA 2XQWC 3EJHA 4DJZA 1E8BA 2RLPA 4PZ5A 4K12A 3TVJA 2CKUA 4ONTD 2XRBA 2B5ID 2JRAA 1MD7A 1GKGA 1H2PP 3OEDC 4KKDA 3CALA 1UOTP 3ZD2A 3ERBA 2W81A 4LOTA 1C1ZA 2MCZA 1QO6A 4JHSA 1H04P 4B2RA 1OK9A 2CG7A 4CSYA 5JPMG 4AYDA 5HYPA 2BZMA 5HZPB 4AYEA 3OXUD 1U5MA 4AYMA 3MQLA 1HFHA 2YBYA 3R62A 3RJ3D 3SW0X 3M7PA 3IU3I 4LOSA 3IX0A 2XWJI 2KMSA 2EC3A 2RKZA 1SS2A 3ZD1A 1ZJKA 2QY0A 3ZRZA 1H2QP 2RLQA 1E88A 1OJVA 1GKNA 1O9AA 3NFPI 1HCCA 1NWVA 2V8EA 4A5WB 4IGDA 1G4FA 1TPNA 3OP8A 3GXEA 2RKYA 2XWBF 2O39C 4AYIA 5HYTB 2EHFA 2XRDA 1E5GA 2IZ3A 1TPMA 1OK3A 2IZ4A 1TPGA 3KXVA 3L89M 2ERJA 1GPZA 2G7IA 3GOVA 1Z92B 2YRAA 1GHQB 1QUBA 1OK1A 4WJG2 2MCYA 2WIIC 1ELVA 1H03P 3KZJA 2UWNA 4YNXA 1G4GA 2RL0A 4MUCA 1MD8A 2A55A 3INBC 1VVCA 1OJWA 1LY2A 4J38B 2JGXA 2KRIA 4C16A 5I0QB 4FXGG 3T5OA 4B2SA 2LOJA
chains in the Genus database with same CATH superfamily
4ZH1D 2JGWA 1OJYA 1SRZA 2CG6A 4F4OC 5HYUB 1HFIA 1QGBA 1OK2A 1PPQA 1VVDA 2W80A 1FBRA 2I2LA 5FO8C 1CKLA 3O8EB 1Q3XA 2XQWC 3ZLDA 3EJHA 4DJZA 1E8BA 2RLPA 4PZ5A 4K12A 3TVJA 2CKUA 4ONTD 2XRBA 2B5ID 2JRAA 1MD7A 3WSYA 1GKGA 1H2PP 3OEDC 4KKDA 3CALA 3WSXA 4BWCA 1UOTP 3ZD2A 3ERBA 2W81A 4LOTA 1C1ZA 2MCZA 1QO6A 4JHSA 4MSLA 1H04P 4B2RA 1OK9A 2CG7A 4CSYA 5JPMG 4AYDA 5HYPA 2BZMA 5HZPB 5DN5A 4AYEA 3OXUD 1U5MA 4AYMA 3MQLA 1HFHA 2YBYA 3R62A 3RJ3D 3SW0X 3M7PA 3IU3I 4LOSA 3IX0A 2XWJI 2KMSA 2EC3A 3NJAA 2RKZA 1SS2A 3CI0J 3ZD1A 1ZJKA 2QY0A 3ZRZA 1H2QP 2RLQA 1E88A 1OJVA 1GKNA 1O9AA 3NFPI 1HCCA 1RLHA 1NWVA 2V8EA 2X2ZA 4A5WB 4IGDA 1G4FA 4YIZA 1TPNA 3OP8A 3GXEA 2RKYA 2XWBF 2Y8SA 3F6KA 2O39C 3VWOA 2ZYCA 4N7EA 4AYIA 5HYTB 2EHFA 2XRDA 1E5GA 2IZ3A 1TPMA 4PO7A 1OK3A 2IZ4A 1TPGA 3KXVA 3L89M 2ERJA 1GPZA 2G7IA 3GOVA 1Z92B 2YRAA 1GHQB 1QUBA 1OK1A 4WJG2 4APLA 2Y8RA 2MCYA 2WIIC 1ELVA 1H03P 3KZJA 2UWNA 2Y8TA 3FGRA 4YNXA 1G4GA 2RL0A 4MUCA 1MD8A 2A55A 3INBC 5DN4A 1VVCA 3ZLEA 1OJWA 1LY2A 4J38B 2JGXA 2KRIA 4C16A 5I0QB 3K3TA 4FXGG 3T5OA 3FGTA 4B2SA 2LOJA
chains in the Genus database with same CATH topology
4ZH1D 2JGWA 1OJYA 1SRZA 2CG6A 4F4OC 5HYUB 1HFIA 1QGBA 1OK2A 1PPQA 1VVDA 2W80A 1FBRA 5FO8C 1CKLA 3O8EB 1Q3XA 2XQWC 3EJHA 4DJZA 1E8BA 2RLPA 4PZ5A 4K12A 3TVJA 2CKUA 4ONTD 2XRBA 2B5ID 2JRAA 1MD7A 1GKGA 1H2PP 3OEDC 4KKDA 3CALA 1UOTP 3ZD2A 3ERBA 2W81A 4LOTA 1C1ZA 2MCZA 1QO6A 4JHSA 1H04P 4B2RA 1OK9A 2CG7A 4CSYA 5JPMG 4AYDA 5HYPA 2BZMA 5HZPB 4AYEA 3OXUD 1U5MA 4AYMA 3MQLA 1HFHA 2YBYA 3R62A 3RJ3D 3SW0X 3M7PA 3IU3I 4LOSA 3IX0A 2XWJI 2KMSA 2EC3A 2RKZA 1SS2A 3ZD1A 1ZJKA 2QY0A 3ZRZA 1H2QP 2RLQA 1E88A 1OJVA 1GKNA 1O9AA 3NFPI 1HCCA 1NWVA 2V8EA 4A5WB 4IGDA 1G4FA 1TPNA 3OP8A 3GXEA 2RKYA 2XWBF 2O39C 4AYIA 5HYTB 2EHFA 2XRDA 1E5GA 2IZ3A 1TPMA 1OK3A 2IZ4A 1TPGA 3KXVA 3L89M 2ERJA 1GPZA 2G7IA 3GOVA 1Z92B 2YRAA 1GHQB 1QUBA 1OK1A 4WJG2 2MCYA 2WIIC 1ELVA 1H03P 3KZJA 2UWNA 4YNXA 1G4GA 2RL0A 4MUCA 1MD8A 2A55A 3INBC 1VVCA 1OJWA 1LY2A 4J38B 2JGXA 2KRIA 4C16A 5I0QB 4FXGG 3T5OA 4B2SA 2LOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZH1 D;  2JGW A;  1OJY A;  1SRZ A;  2CG6 A;  4F4O C;  5HYU B;  1HFI A;  1QGB A;  1OK2 A;  1PPQ A;  1VVD A;  2W80 A;  1FBR A;  5FO8 C;  1CKL A;  3O8E B;  1Q3X A;  2XQW C;  3EJH A;  4DJZ A;  1E8B A;  2RLP A;  4PZ5 A;  4K12 A;  3TVJ A;  2CKU A;  4ONT D;  2XRB A;  2B5I D;  2JRA A;  1MD7 A;  1GKG A;  1H2P P;  3OED C;  4KKD A;  3CAL A;  1UOT P;  3ZD2 A;  3ERB A;  2W81 A;  4LOT A;  1C1Z A;  2MCZ A;  1QO6 A;  4JHS A;  1H04 P;  4B2R A;  1OK9 A;  2CG7 A;  4CSY A;  5JPM G;  4AYD A;  5HYP A;  2BZM A;  5HZP B;  4AYE A;  3OXU D;  1U5M A;  4AYM A;  3MQL A;  1HFH A;  2YBY A;  3R62 A;  3RJ3 D;  3SW0 X;  3M7P A;  3IU3 I;  4LOS A;  3IX0 A;  2XWJ I;  2KMS A;  2EC3 A;  2RKZ A;  1SS2 A;  3ZD1 A;  1ZJK A;  2QY0 A;  3ZRZ A;  1H2Q P;  2RLQ A;  1E88 A;  1OJV A;  1GKN A;  1O9A A;  3NFP I;  1HCC A;  1NWV A;  2V8E A;  4A5W B;  4IGD A;  1G4F A;  1TPN A;  3OP8 A;  3GXE A;  2RKY A;  2XWB F;  2O39 C;  4AYI A;  5HYT B;  2EHF A;  2XRD A;  1E5G A;  2IZ3 A;  1TPM A;  1OK3 A;  2IZ4 A;  1TPG A;  3KXV A;  3L89 M;  2ERJ A;  1GPZ A;  2G7I A;  3GOV A;  1Z92 B;  2YRA A;  1GHQ B;  1QUB A;  1OK1 A;  4WJG 2;  2MCY A;  2WII C;  1ELV A;  1H03 P;  3KZJ A;  2UWN A;  4YNX A;  1G4G A;  2RL0 A;  4MUC A;  1MD8 A;  2A55 A;  3INB C;  1VVC A;  1OJW A;  1LY2 A;  4J38 B;  2JGX A;  2KRI A;  4C16 A;  5I0Q B;  4FXG G;  3T5O A;  4B2S A;  2LOJ A; 
#chains in the Genus database with same CATH topology
 4ZH1 D;  2JGW A;  1OJY A;  1SRZ A;  2CG6 A;  4F4O C;  5HYU B;  1HFI A;  1QGB A;  1OK2 A;  1PPQ A;  1VVD A;  2W80 A;  1FBR A;  2I2L A;  5FO8 C;  1CKL A;  3O8E B;  1Q3X A;  2XQW C;  3ZLD A;  3EJH A;  4DJZ A;  1E8B A;  2RLP A;  4PZ5 A;  4K12 A;  3TVJ A;  2CKU A;  4ONT D;  2XRB A;  2B5I D;  2JRA A;  1MD7 A;  3WSY A;  1GKG A;  1H2P P;  3OED C;  4KKD A;  3CAL A;  3WSX A;  4BWC A;  1UOT P;  3ZD2 A;  3ERB A;  2W81 A;  4LOT A;  1C1Z A;  2MCZ A;  1QO6 A;  4JHS A;  4MSL A;  1H04 P;  4B2R A;  1OK9 A;  2CG7 A;  4CSY A;  5JPM G;  4AYD A;  5HYP A;  2BZM A;  5HZP B;  5DN5 A;  4AYE A;  3OXU D;  1U5M A;  4AYM A;  3MQL A;  1HFH A;  2YBY A;  3R62 A;  3RJ3 D;  3SW0 X;  3M7P A;  3IU3 I;  4LOS A;  3IX0 A;  2XWJ I;  2KMS A;  2EC3 A;  3NJA A;  2RKZ A;  1SS2 A;  3CI0 J;  3ZD1 A;  1ZJK A;  2QY0 A;  3ZRZ A;  1H2Q P;  2RLQ A;  1E88 A;  1OJV A;  1GKN A;  1O9A A;  3NFP I;  1HCC A;  1RLH A;  1NWV A;  2V8E A;  2X2Z A;  4A5W B;  4IGD A;  1G4F A;  4YIZ A;  1TPN A;  3OP8 A;  3GXE A;  2RKY A;  2XWB F;  2Y8S A;  3F6K A;  2O39 C;  3VWO A;  2ZYC A;  4N7E A;  4AYI A;  5HYT B;  2EHF A;  2XRD A;  1E5G A;  2IZ3 A;  1TPM A;  4PO7 A;  1OK3 A;  2IZ4 A;  1TPG A;  3KXV A;  3L89 M;  2ERJ A;  1GPZ A;  2G7I A;  3GOV A;  1Z92 B;  2YRA A;  1GHQ B;  1QUB A;  1OK1 A;  4WJG 2;  4APL A;  2Y8R A;  2MCY A;  2WII C;  1ELV A;  1H03 P;  3KZJ A;  2UWN A;  2Y8T A;  3FGR A;  4YNX A;  1G4G A;  2RL0 A;  4MUC A;  1MD8 A;  2A55 A;  3INB C;  5DN4 A;  1VVC A;  3ZLE A;  1OJW A;  1LY2 A;  4J38 B;  2JGX A;  2KRI A;  4C16 A;  5I0Q B;  3K3T A;  4FXG G;  3T5O A;  3FGT A;  4B2S A;  2LOJ A; 
#chains in the Genus database with same CATH homology
 4ZH1 D;  2JGW A;  1OJY A;  1SRZ A;  2CG6 A;  4F4O C;  5HYU B;  1HFI A;  1QGB A;  1OK2 A;  1PPQ A;  1VVD A;  2W80 A;  1FBR A;  5FO8 C;  1CKL A;  3O8E B;  1Q3X A;  2XQW C;  3EJH A;  4DJZ A;  1E8B A;  2RLP A;  4PZ5 A;  4K12 A;  3TVJ A;  2CKU A;  4ONT D;  2XRB A;  2B5I D;  2JRA A;  1MD7 A;  1GKG A;  1H2P P;  3OED C;  4KKD A;  3CAL A;  1UOT P;  3ZD2 A;  3ERB A;  2W81 A;  4LOT A;  1C1Z A;  2MCZ A;  1QO6 A;  4JHS A;  1H04 P;  4B2R A;  1OK9 A;  2CG7 A;  4CSY A;  5JPM G;  4AYD A;  5HYP A;  2BZM A;  5HZP B;  4AYE A;  3OXU D;  1U5M A;  4AYM A;  3MQL A;  1HFH A;  2YBY A;  3R62 A;  3RJ3 D;  3SW0 X;  3M7P A;  3IU3 I;  4LOS A;  3IX0 A;  2XWJ I;  2KMS A;  2EC3 A;  2RKZ A;  1SS2 A;  3ZD1 A;  1ZJK A;  2QY0 A;  3ZRZ A;  1H2Q P;  2RLQ A;  1E88 A;  1OJV A;  1GKN A;  1O9A A;  3NFP I;  1HCC A;  1NWV A;  2V8E A;  4A5W B;  4IGD A;  1G4F A;  1TPN A;  3OP8 A;  3GXE A;  2RKY A;  2XWB F;  2O39 C;  4AYI A;  5HYT B;  2EHF A;  2XRD A;  1E5G A;  2IZ3 A;  1TPM A;  1OK3 A;  2IZ4 A;  1TPG A;  3KXV A;  3L89 M;  2ERJ A;  1GPZ A;  2G7I A;  3GOV A;  1Z92 B;  2YRA A;  1GHQ B;  1QUB A;  1OK1 A;  4WJG 2;  2MCY A;  2WII C;  1ELV A;  1H03 P;  3KZJ A;  2UWN A;  4YNX A;  1G4G A;  2RL0 A;  4MUC A;  1MD8 A;  2A55 A;  3INB C;  1VVC A;  1OJW A;  1LY2 A;  4J38 B;  2JGX A;  2KRI A;  4C16 A;  5I0Q B;  4FXG G;  3T5O A;  4B2S A;  2LOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...