2WINM

C3 convertase (c3bbb) stabilized by scin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
84
structure length
84
Chain Sequence
TSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGQKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C3 BETA CHAIN
publication title Structural and functional implications of the alternative complement pathway C3 convertase stabilized by a staphylococcal inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 27
structure length 84
sequence length 84
chains with identical sequence N, P, Q
ec nomenclature
pdb deposition date 2009-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2winM00
3T48A 2QFFA 3D2FA 4EZVA 3D2EA 1DKYA 3T47A 4R5KA 4R5IA 4JWCA 4EZNA 4R5GA 4EZWA 4F01A 4EZQA 4F00A 2WINM 3T4AG 4EZXA 4HY9A 4B9QA 1DKZA 3DPOA 4EZTA 4EZUA 3DPQA 4JWIA 4JNEA 3T49A 3QNJA 4PO2A 4EZRA 2KHOA 4EZSA 5TKYA 4H6IA 3OHXM 3DPPA 1U00A 3T46A 4H6HA 4E81A 4R5LA 3C7NA 2QXLA 5E84A 4EZYA 4EZZA 4HYBA 4EZOA 4R5JA 1DKXA 3L3OM 4JWEA 4JNFA 4JN4A 4JWDA 4EZPA
chains in the Genus database with same CATH superfamily
3D2EA 4ATMA 3ER9B 3EJRA 3VKHA 3ABHA 2ZXQA 3O3OB 4IWOA 2EFLA 3QNIA 2X3XA 1I49A 2C08A 1YWMA 1DKXA 4AZCB 3UITA 3BVUA 2YL6A 2D1LA 4HY9A 4FZPA 2PMRA 2WYIA 3D4YA 4DCNC 4WPCA 2RT6A 4M0MA 1I4TA 5C5BA 3D2FA 1PS3A 1TQWA 1QWNA 3KAWA 3DX2A 3BLBA 3HAIA 3VEAA 2RAKA 3HAJA 4EZZA 1ZWWA 1HXKA 2RAJA 4JN4A 2EFKA 2F7OA 3LMFA 3DX0A 3DPOA 2Z0NA 3QE6A 2JNKA 1I4LA 4EZSA 3L3PA 4NQIA 3C7NA 5C5BB 3CAZA 3T48A 4AZCA 1SU8A 4EZWA 4EZNA 3O3NB 4AZHA 3GI7A 4JL9A 3OK8A 2YIBA 3CV5A 3DDGA 5E84A 3RV0A 4R5JA 3Q0KA 1JQKA 1W9MA 3Q84A 3T47A 4JWCA 3T4AG 5KBPA 1X04A 3DPQA 4JWIA 3D50A 2KHOA 2N3KA 3D4ZA 3PLTA 2EWFA 1TQVA 3QWEA 4EZYA 3D51A 3I01A 2F7RA 2X3VA 1HTYA 4UDYX 3FD9A 3BUIA 3D52A 3ER8C 1UPXA 4E81A 4BNEA 3I2WA 4AKVA 4AZBA 4EZPA 2Z8YA 1E1DA 4EZTA 3SYVA 4IM3A 2Q12A 3DPPA 2EX3B 2F7QA 4D8JA 3F7WA 4IWQA 3BVTA 4EZVA 2OO2A 4AZ7A 3O3MB 2GAFD 2GF4A 4JLCA 4EZXA 1R33A 2YI8A 2F1BA 1DKZA 2JNSA 4JNEA 3T49A 3QNJA 4IW0A 3HAHA 1OAOA 4AZ6A 2LXYA 1HWWA 1QWUA 3B53X 4R5IA 2F7PA 4HR1B 4EZQA 4FM3A 4I1QA 3BUBA 3B52X 2X3WA 3BVXA 3EJUA 2Q13A 3CZNA 4DYLA 3OHXM 1U00A 2F18A 3LLLA 2YL5A 2QXLA 1TQUA 3DYTA 3KDRA 1LQ7A 5FLEX 1DKYA 1E2UA 4F01A 1GNTA 3RPMA 2WINM 4EZUA 2OW6A 1SU7A 1WDZA 2GA9D 2YKTA 3QA8A 1MJGA 4AZGA 1OA1A 3T46A 2YL9A 4NSWA 2YI9A 3OWGA 5TKYA 2FYVA 4H6HA 2QKWA 3LVTA 2OW7A 3G9GA 3RV1A 3DDFA 4JWEA 2O0I1 4JNFA 3BUQA 4AVMA 3EJSA 2YL8A 2ND1A 1GNLA 2PY6A 4HR1A 1TQSA 4H8SA 4IWPA 3EJTA 1URUA 3ACOA 3I39X 4IM2A 3M3WA 4KIKB 1R5EA 4H6IA 3EJQA 2YIAA 3CKDA 1SUFA 2ELBA 4EZOA 4G6QA 2Z0VA 4AZIA 3BVWA 1QX1A 2WYHA 2OBLA 4R5GA 1X03A 1R34A 1OA0A 2ND0A 2ALWA 2YIVX 4UDXX 3DX4A 3ERCC 3BVVA 1O7DB 3VEBA 4FZSA 2OBMA 3A98A 3CVRA 1Y2OA 2X5CA 1I4DA 4R5LA 3SOGA 1GN9A 4NPHA 2FICA 3DX3A 4JWDA 2QFFA 4R5KA 2YLLA 1O7DC 3ZEDA 3KAVA 3DX1A 5FIGA 4PO2A 3CZSA 2Z0OA 4WPEA 1ZYLA 2YLAA 1SU6A 2D4CA 3I04A 4AZ5A 3L3OM 4E3CA 2MI7A 3B51X 1TQTA 4F00A 4B9QA 2LM0A 3BUPA 1E9VA 4EZRA 4KIKA 2V0OA 2F1AA 3EJPA 2RAIA 4FZOA 3BUDA 2OZNB 4HYBA 4IM0A 2NCZA
chains in the Genus database with same CATH topology
2ND1A 3T48A 4EZVA 3D2EA 1SU8A 4EZWA 2PY6A 3O3MB 4EZNA 2GAFD 3ER9B 4HR1A 4JLCA 3O3NB 4EZXA 2YI8A 3VKHA 1DKZA 4IWPA 2JNSA 4JNEA 3I39X 4IM2A 3T49A 3QNJA 4IW0A 4KIKB 3GI7A 4JL9A 3O3OB 4H6IA 4IWOA 2YIBA 2YIAA 1SUFA 5E84A 1OAOA 3RV0A 4EZOA 4G6QA 4R5JA 1DKXA 1JQKA 1W9MA 3B53X 3UITA 3T47A 4R5IA 4JWCA 4HR1B 2OBLA 4R5GA 4EZQA 4FM3A 3T4AG 1OA0A 2ND0A 4HY9A 3B52X 2YIVX 3DPQA 4JWIA 4UDXX 3ERCC 3VEBA 2KHOA 2N3KA 3OHXM 2OBMA 2RT6A 3A98A 1U00A 4M0MA 2EWFA 2X5CA 4R5LA 2QXLA 4EZYA 1GN9A 4NPHA 3KDRA 3I01A 4JWDA 2QFFA 3D2FA 4UDYX 5FLEX 1DKYA 1E2UA 4R5KA 4F01A 1GNTA 2WINM 3ZEDA 3FD9A 3KAVA 4EZUA 5FIGA 3KAWA 4PO2A 1SU7A 2GA9D 3QA8A 3ER8C 3VEAA 1ZYLA 1UPXA 4E81A 1SU6A 3I04A 4EZZA 1MJGA 3L3OM 4JN4A 1OA1A 3T46A 4EZPA 4E3CA 3B51X 4F00A 3LMFA 2Z8YA 1E1DA 4B9QA 3DPOA 2LM0A 4EZTA 2YI9A 3OWGA 1E9VA 4EZRA 4EZSA 5TKYA 4IM3A 4KIKA 3DPPA 4H6HA 2EX3B 4D8JA 3C7NA 4HYBA 4IM0A 3F7WA 3RV1A 4IWQA 4JWEA 2NCZA 4JNFA 1GNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T48 A;  2QFF A;  3D2F A;  4EZV A;  3D2E A;  1DKY A;  3T47 A;  4R5K A;  4R5I A;  4JWC A;  4EZN A;  4R5G A;  4EZW A;  4F01 A;  4EZQ A;  4F00 A;  2WIN M;  3T4A G;  4EZX A;  4HY9 A;  4B9Q A;  1DKZ A;  3DPO A;  4EZT A;  4EZU A;  3DPQ A;  4JWI A;  4JNE A;  3T49 A;  3QNJ A;  4PO2 A;  4EZR A;  2KHO A;  4EZS A;  5TKY A;  4H6I A;  3OHX M;  3DPP A;  1U00 A;  3T46 A;  4H6H A;  4E81 A;  4R5L A;  3C7N A;  2QXL A;  5E84 A;  4EZY A;  4EZZ A;  4HYB A;  4EZO A;  4R5J A;  1DKX A;  3L3O M;  4JWE A;  4JNF A;  4JN4 A;  4JWD A;  4EZP A; 
#chains in the Genus database with same CATH topology
 3D2E A;  4ATM A;  3ER9 B;  3EJR A;  3VKH A;  3ABH A;  2ZXQ A;  3O3O B;  4IWO A;  2EFL A;  3QNI A;  2X3X A;  1I49 A;  2C08 A;  1YWM A;  1DKX A;  4AZC B;  3UIT A;  3BVU A;  2YL6 A;  2D1L A;  4HY9 A;  4FZP A;  2PMR A;  2WYI A;  3D4Y A;  4DCN C;  4WPC A;  2RT6 A;  4M0M A;  1I4T A;  5C5B A;  3D2F A;  1PS3 A;  1TQW A;  1QWN A;  3KAW A;  3DX2 A;  3BLB A;  3HAI A;  3VEA A;  2RAK A;  3HAJ A;  4EZZ A;  1ZWW A;  1HXK A;  2RAJ A;  4JN4 A;  2EFK A;  2F7O A;  3LMF A;  3DX0 A;  3DPO A;  2Z0N A;  3QE6 A;  2JNK A;  1I4L A;  4EZS A;  3L3P A;  4NQI A;  3C7N A;  5C5B B;  3CAZ A;  3T48 A;  4AZC A;  1SU8 A;  4EZW A;  4EZN A;  3O3N B;  4AZH A;  3GI7 A;  4JL9 A;  3OK8 A;  2YIB A;  3CV5 A;  3DDG A;  5E84 A;  3RV0 A;  4R5J A;  3Q0K A;  1JQK A;  1W9M A;  3Q84 A;  3T47 A;  4JWC A;  3T4A G;  5KBP A;  1X04 A;  3DPQ A;  4JWI A;  3D50 A;  2KHO A;  2N3K A;  3D4Z A;  3PLT A;  2EWF A;  1TQV A;  3QWE A;  4EZY A;  3D51 A;  3I01 A;  2F7R A;  2X3V A;  1HTY A;  4UDY X;  3FD9 A;  3BUI A;  3D52 A;  3ER8 C;  1UPX A;  4E81 A;  4BNE A;  3I2W A;  4AKV A;  4AZB A;  4EZP A;  2Z8Y A;  1E1D A;  4EZT A;  3SYV A;  4IM3 A;  2Q12 A;  3DPP A;  2EX3 B;  2F7Q A;  4D8J A;  3F7W A;  4IWQ A;  3BVT A;  4EZV A;  2OO2 A;  4AZ7 A;  3O3M B;  2GAF D;  2GF4 A;  4JLC A;  4EZX A;  1R33 A;  2YI8 A;  2F1B A;  1DKZ A;  2JNS A;  4JNE A;  3T49 A;  3QNJ A;  4IW0 A;  3HAH A;  1OAO A;  4AZ6 A;  2LXY A;  1HWW A;  1QWU A;  3B53 X;  4R5I A;  2F7P A;  4HR1 B;  4EZQ A;  4FM3 A;  4I1Q A;  3BUB A;  3B52 X;  2X3W A;  3BVX A;  3EJU A;  2Q13 A;  3CZN A;  4DYL A;  3OHX M;  1U00 A;  2F18 A;  3LLL A;  2YL5 A;  2QXL A;  1TQU A;  3DYT A;  3KDR A;  1LQ7 A;  5FLE X;  1DKY A;  1E2U A;  4F01 A;  1GNT A;  3RPM A;  2WIN M;  4EZU A;  2OW6 A;  1SU7 A;  1WDZ A;  2GA9 D;  2YKT A;  3QA8 A;  1MJG A;  4AZG A;  1OA1 A;  3T46 A;  2YL9 A;  4NSW A;  2YI9 A;  3OWG A;  5TKY A;  2FYV A;  4H6H A;  2QKW A;  3LVT A;  2OW7 A;  3G9G A;  3RV1 A;  3DDF A;  4JWE A;  2O0I 1;  4JNF A;  3BUQ A;  4AVM A;  3EJS A;  2YL8 A;  2ND1 A;  1GNL A;  2PY6 A;  4HR1 A;  1TQS A;  4H8S A;  4IWP A;  3EJT A;  1URU A;  3ACO A;  3I39 X;  4IM2 A;  3M3W A;  4KIK B;  1R5E A;  4H6I A;  3EJQ A;  2YIA A;  3CKD A;  1SUF A;  2ELB A;  4EZO A;  4G6Q A;  2Z0V A;  4AZI A;  3BVW A;  1QX1 A;  2WYH A;  2OBL A;  4R5G A;  1X03 A;  1R34 A;  1OA0 A;  2ND0 A;  2ALW A;  2YIV X;  4UDX X;  3DX4 A;  3ERC C;  3BVV A;  1O7D B;  3VEB A;  4FZS A;  2OBM A;  3A98 A;  3CVR A;  1Y2O A;  2X5C A;  1I4D A;  4R5L A;  3SOG A;  1GN9 A;  4NPH A;  2FIC A;  3DX3 A;  4JWD A;  2QFF A;  4R5K A;  2YLL A;  1O7D C;  3ZED A;  3KAV A;  3DX1 A;  5FIG A;  4PO2 A;  3CZS A;  2Z0O A;  4WPE A;  1ZYL A;  2YLA A;  1SU6 A;  2D4C A;  3I04 A;  4AZ5 A;  3L3O M;  4E3C A;  2MI7 A;  3B51 X;  1TQT A;  4F00 A;  4B9Q A;  2LM0 A;  3BUP A;  1E9V A;  4EZR A;  4KIK A;  2V0O A;  2F1A A;  3EJP A;  2RAI A;  4FZO A;  3BUD A;  2OZN B;  4HYB A;  4IM0 A;  2NCZ A; 
#chains in the Genus database with same CATH homology
 2ND1 A;  3T48 A;  4EZV A;  3D2E A;  1SU8 A;  4EZW A;  2PY6 A;  3O3M B;  4EZN A;  2GAF D;  3ER9 B;  4HR1 A;  4JLC A;  3O3N B;  4EZX A;  2YI8 A;  3VKH A;  1DKZ A;  4IWP A;  2JNS A;  4JNE A;  3I39 X;  4IM2 A;  3T49 A;  3QNJ A;  4IW0 A;  4KIK B;  3GI7 A;  4JL9 A;  3O3O B;  4H6I A;  4IWO A;  2YIB A;  2YIA A;  1SUF A;  5E84 A;  1OAO A;  3RV0 A;  4EZO A;  4G6Q A;  4R5J A;  1DKX A;  1JQK A;  1W9M A;  3B53 X;  3UIT A;  3T47 A;  4R5I A;  4JWC A;  4HR1 B;  2OBL A;  4R5G A;  4EZQ A;  4FM3 A;  3T4A G;  1OA0 A;  2ND0 A;  4HY9 A;  3B52 X;  2YIV X;  3DPQ A;  4JWI A;  4UDX X;  3ERC C;  3VEB A;  2KHO A;  2N3K A;  3OHX M;  2OBM A;  2RT6 A;  3A98 A;  1U00 A;  4M0M A;  2EWF A;  2X5C A;  4R5L A;  2QXL A;  4EZY A;  1GN9 A;  4NPH A;  3KDR A;  3I01 A;  4JWD A;  2QFF A;  3D2F A;  4UDY X;  5FLE X;  1DKY A;  1E2U A;  4R5K A;  4F01 A;  1GNT A;  2WIN M;  3ZED A;  3FD9 A;  3KAV A;  4EZU A;  5FIG A;  3KAW A;  4PO2 A;  1SU7 A;  2GA9 D;  3QA8 A;  3ER8 C;  3VEA A;  1ZYL A;  1UPX A;  4E81 A;  1SU6 A;  3I04 A;  4EZZ A;  1MJG A;  3L3O M;  4JN4 A;  1OA1 A;  3T46 A;  4EZP A;  4E3C A;  3B51 X;  4F00 A;  3LMF A;  2Z8Y A;  1E1D A;  4B9Q A;  3DPO A;  2LM0 A;  4EZT A;  2YI9 A;  3OWG A;  1E9V A;  4EZR A;  4EZS A;  5TKY A;  4IM3 A;  4KIK A;  3DPP A;  4H6H A;  2EX3 B;  4D8J A;  3C7N A;  4HYB A;  4IM0 A;  3F7W A;  3RV1 A;  4IWQ A;  4JWE A;  2NCZ A;  4JNF A;  1GNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...