2WIUB

Mercury-modified bacterial persistence regulator hipba
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
71
Chain Sequence
KIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDNLEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Kinase Regulation Mechanism Found in Hipba: A Bacterial Persistence Switch.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transcription
molecule keywords PROTEIN HIPA
total genus 21
structure length 71
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2wiuB00
1B0NA 1UXDA 2XCJA 3KJXA 3S8QA 1PNRA 2PUBA 2AW6A 4FBIA 2LYKA 2MQKA 3B7HA 1X57A 1LMB3 1ADRA 2BNOA 1CJGA 3OP9A 4X4BA 1R63A 3G5GA 4Z5HA 2OFYA 3D1NI 2LYJA 1ZS4A 3KZ3A 4X4FA 1ZZ9A 2CSFA 4X4EA 2XI8A 2ICPA 2LCVA 2KEJA 4X4DA 2R63A 4J1XA 1BDHA 1X2LA 2IVBA 4IVZA 3UFDA 1SQ8A 4Z5DA 1PRAA 1WETA 1VPWA 1NEQA 3F52A 3BDNA 1RZRA 4PU3C 1ZUGA 2B5AA 3L1PA 1IC8A 4J1WA 2BJCA 3CLCA 3ZKCA 2XIUA 3U3WA 4O8BA 4IA8A 1QP4A 3VK0A 2KEIA 1LLIA 1HF0A 4X4IA 4Z5CA 1EFAA 2GRLA 1NERA 4PU7A 3SCHA 3EUSA 3SCFA 2IV1A 2AWIA 2ICTA 2R1JL 3CROL 3PXPA 3BD1A 2XJ3A 4MCXA 2FJRA 4YG4A 1QPZA 3JXBC 3KXAA 1RIOA 4I8TA 1QQBA 2OR1L 3G7DA 2PUAA 4I6RA 3F51A 3LISA 1ZZBA 2EWTA 2GRMA 2AUWA 1XWRA 1JFSA 1DW9A 2JVLA 1RPEL 5K98B 3MLFA 2PE5A 4YG1A 2AXZA 2PIJA 4X4HA 1QP7A 4FN3A 1Y7YA 2L8NA 3JXCL 3O9XA 3QYXA 4MCTA 1BDIA 2PPXA 3F6WA 3R1FA 3H5TA 2EF8A 2WIUB 3DNVB 1AU7A 4JCYA 3GN5B 4JCXA 4PU4C 1PRUA 2IVQA 1PERL 1R69A 2HSGA 1DWKA 2LYRA 1WH6A 2PUEA 2BNMA 4GQMA 2KEKA 2IUOA 4Z58A 1POUA 1Y9QA 1WH8A 1ZPQA 1ZZ7A 4Z59A 2A6CA 1QQAA 2PUDA 2HINA 3OQNA 4Y42A 4OB4A 2O4AA 3QQ6A 4IWRA 1ZZ8A 3TRBA 1UXCA 3FYAA 1L1MA 5A7LA 2BNNA 3GBFA 4YARA 2O38A 2PUGA 3BS3A 3GN5A 3ZHMA 3OQOA 1QP0A 2EBYA 3FYMA 1UTXA 4NDWA 1OCTC 2MEZA 2O49A 1O4XA 2AXUA 2LYPA 2LYLA 4F8DA 4X4GA 1RZSA 1OSLA 1YSEA 1ZVVA 3LFPA 4GHJA 1PRVA 2AXVA 2CROA 4I6UA 2JCGA 3JXDL 1ZZ6A 3QWGA 1WIZA 2IU7A 4PU8A 2GZUA 3QF3A 1RZRD 1ZZCA 4YBAA 1JFTA 1ZAYA 2H8RA 1LCCA 3HZIB 3SCGA 1E3OC 2XSDC 2IVGA 2L49A 2LYSA 3IVPA 4I6TA 2PUCA 1S7EA 2D5VA 1GT0C 2WUSR 3OQMA 4YG7B 1LCDA 2KZ8A 1CQTA 3FMYA 2PUFA 4X4CA 3ZHIA 3RZZA 1JH9A 2LYQA 3CECA 3OMTA 1JWLA 1LQCA 2KPJA 4JQDA
chains in the Genus database with same CATH superfamily
2XCJA 1PNRA 4DE9A 2AW6A 1X57A 1ADRA 2BNOA 1ZS4A 4Z5HA 2PXVA 2IVBA 3UFDA 1PRAA 3BDNA 2B5AA 3CLCA 2XIUA 4O8BA 4IA8A 1QP4A 3VK0A 2KEIA 2LLVA 4EKGA 1HF0A 3A9XA 3SCHA 2AWIA 2R1JL 3A9ZA 4HRAA 4YG4A 3ZPXA 3A9YA 4I6RA 1JFSA 1DW9A 2HFZA 3MLFA 3TELA 3TFLA 4FN3A 3F6WA 2WIUB 4PU4C 3NROA 3UWPA 2BNMA 5DTQA 2IUOA 1Y9QA 1QQAA 2HINA 1QB2A 4IWRA 2L1PA 4WVLA 2PUGA 3GBFA 3BS3A 3QOWA 3FYMA 1OCTC 1O4XA 2MXDA 1ZVVA 2AXVA 4I6UA 2JCGA 1ZZ6A 1RZRD 4PU8A 1E3OC 3G0TA 3SX0A 2L49A 2PUCA 2D5VA 1GT0C 2WUSR 3OQMA 2LYQA 3OMTA 1UXDA 3S8QA 4FBIA 1LMB3 2PXKA 4X4BA 2LYJA 2CSFA 2HCNA 2JQEA 1SQ8A 1VPWA 3ME5A 3F52A 4PU3C 2BJCA 5DRYA 3U3WA 4ER0A 2J7WA 4Z5CA 1EFAA 4PU7A 3EUSA 3SCFA 3PXPA 4MCXA 2FJRA 3JXBC 3LQXA 1QQBA 2OR1L 3VWSA 3R09A 2PIJA 4EKIA 3GZCA 2L8NA 4ER5A 4MCTA 1BDIA 2PPXA 2ODRD 3H5TA 3PE5A 1WH6A 5DT2A 4GQMA 3QFIA 1WH8A 1ZPQA 4Z59A 2PXFA 2A6CA 3SR4A 4OB4A 2O4AA 1ZZ8A 3TRBA 4YARA 2BNNA 5DRTA 3ZHMA 2EBYA 3OKZA 2LYPA 3LFPA 1U2ZA 1PRVA 2XXAA 3QWGA 1JFTA 2LLWA 1LCCA 2PXLA 4EK9A 2IVGA 2V3CC 2PXTA 1CQTA 3FMYA 4X4CA 4ER7A 1JH9A 1LQCA 1B0NA 3KJXA 2LYKA 2FFHA 2MQKA 3B7HA 3GZDA 4Q2JA 1CJGA 1R63A 3M9LA 1ZZ9A 2XI8A 4X4DA 4J1XA 1BDHA 1X2LA 4Z5DA 1ZUGA 3L1PA 4J1WA 3ZKCA 2VEOA 1LLIA 4X4IA 4DE8A 2GRLA 2PXQA 3CROL 3BD1A 2XJ3A 1QPZA 1RIOA 3KXAA 3G7DA 2GRMA 2AUWA 1XWRA 2JVLA 5K98B 2PE5A 4X4HA 1Y7YA 3JXCL 3O9XA 3QYXA 3R1FA 2M4HA 1AU7A 2EF8A 4JCYA 3GN5B 1R69A 2HSGA 2LYRA 3NXHA 4Z58A 1POUA 2PUDA 3OQNA 4Y42A 1UXCA 2J7UA 3MEJA 1L1MA 5A7LA 2O38A 3GN5A 2HCSA 2O49A 2LYLA 4F8DA 4X4GA 1RZSA 1YSEA 3JXDL 2CROA 3DM5A 1WIZA 2IU7A 2H8RA 1ZZCA 4YBAA 3QOXA 2LYSA 2YBDA 3IVPA 4ER6A 4YG7B 2LNMA 2PUFA 3ZHIA 3RZZA 2XXQA 3CECA 2XXPA 3GUUA 2KPJA 4JQDA 2PUBA 1QZXA 3KL4A 3OWQA 3OP9A 3G5GA 3D1NI 2OFYA 3KZ3A 4X4FA 4X4EA 2KEJA 2ICPA 2LCVA 2R63A 4IVZA 5GAGi 1WETA 1NEQA 1RZRA 2PXBA 1IC8A 2PXDA 1NERA 5GAHi 2IV1A 2ICTA 4EQZA 2PXUA 4I8TA 2PUAA 3F51A 3LISA 1ZZBA 2EWTA 3NDBB 1RPEL 3GZDC 4ER3A 4YG1A 2AXZA 3NZLA 1QP7A 2PXPA 4OBMA 3DNVB 4JCXA 1PRUA 2IVQA 1PERL 1DWKA 2PUEA 2KEKA 1ZZ7A 5DTRA 1NW3A 5JUWA 2PXEA 3QQ6A 3FYAA 5DTMA 3OQOA 1QP0A 4NDWA 1UTXA 2MEZA 2AXUA 1OSLA 4GHJA 1MFQC 1ZAYA 2GZUA 3QF3A 1DULA 4EZIA 5DSXA 3HZIB 3SCGA 2XSDC 1HQ1A 4I6TA 1S7EA 1LCDA 2KZ8A 3TEPA 1JWLA
chains in the Genus database with same CATH topology
1B0NA 1UXDA 2XCJA 3KJXA 3S8QA 1PNRA 2PUBA 2AW6A 4FBIA 2LYKA 2MQKA 3B7HA 1X57A 1LMB3 1ADRA 2BNOA 1CJGA 3OP9A 4X4BA 1R63A 3G5GA 4Z5HA 2OFYA 3D1NI 2LYJA 1ZS4A 3KZ3A 4X4FA 1ZZ9A 2CSFA 4X4EA 2XI8A 2ICPA 2LCVA 2KEJA 4X4DA 2R63A 4J1XA 1BDHA 1X2LA 2IVBA 4IVZA 3UFDA 1SQ8A 4Z5DA 1PRAA 1WETA 1VPWA 1NEQA 3F52A 3BDNA 1RZRA 4PU3C 1ZUGA 2B5AA 3L1PA 1IC8A 4J1WA 2BJCA 3CLCA 3ZKCA 2XIUA 3U3WA 4O8BA 4IA8A 1QP4A 3VK0A 2KEIA 1LLIA 1HF0A 4X4IA 4Z5CA 1EFAA 2GRLA 1NERA 4PU7A 3SCHA 3EUSA 3SCFA 2IV1A 2AWIA 2ICTA 2R1JL 3CROL 3PXPA 3BD1A 2XJ3A 4MCXA 2FJRA 4YG4A 1QPZA 3JXBC 3KXAA 1RIOA 4I8TA 1QQBA 2OR1L 3G7DA 2PUAA 4I6RA 3F51A 3LISA 1ZZBA 2EWTA 2GRMA 2AUWA 1XWRA 1JFSA 1DW9A 2JVLA 1RPEL 5K98B 3MLFA 2PE5A 4YG1A 2AXZA 2PIJA 4X4HA 1QP7A 4FN3A 1Y7YA 2L8NA 3JXCL 3O9XA 3QYXA 4MCTA 1BDIA 2PPXA 3F6WA 3R1FA 3H5TA 2EF8A 2WIUB 3DNVB 1AU7A 4JCYA 3GN5B 4JCXA 4PU4C 1PRUA 2IVQA 1PERL 1R69A 2HSGA 1DWKA 2LYRA 1WH6A 2PUEA 2BNMA 4GQMA 2KEKA 2IUOA 4Z58A 1POUA 1Y9QA 1WH8A 1ZPQA 1ZZ7A 4Z59A 2A6CA 1QQAA 2PUDA 2HINA 3OQNA 4Y42A 4OB4A 2O4AA 3QQ6A 4IWRA 1ZZ8A 3TRBA 1UXCA 3FYAA 1L1MA 5A7LA 2BNNA 3GBFA 4YARA 2O38A 2PUGA 3BS3A 3GN5A 3ZHMA 3OQOA 1QP0A 2EBYA 3FYMA 1UTXA 4NDWA 1OCTC 2MEZA 2O49A 1O4XA 2AXUA 2LYPA 2LYLA 4F8DA 4X4GA 1RZSA 1OSLA 1YSEA 1ZVVA 3LFPA 4GHJA 1PRVA 2AXVA 2CROA 4I6UA 2JCGA 3JXDL 1ZZ6A 3QWGA 1WIZA 2IU7A 4PU8A 2GZUA 3QF3A 1RZRD 1ZZCA 4YBAA 1JFTA 1ZAYA 2H8RA 1LCCA 3HZIB 3SCGA 1E3OC 2XSDC 2IVGA 2L49A 2LYSA 3IVPA 4I6TA 2PUCA 1S7EA 2D5VA 1GT0C 2WUSR 3OQMA 4YG7B 1LCDA 2KZ8A 1CQTA 3FMYA 2PUFA 4X4CA 3ZHIA 3RZZA 1JH9A 2LYQA 3CECA 3OMTA 1JWLA 1LQCA 2KPJA 4JQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B0N A;  1UXD A;  2XCJ A;  3KJX A;  3S8Q A;  1PNR A;  2PUB A;  2AW6 A;  4FBI A;  2LYK A;  2MQK A;  3B7H A;  1X57 A;  1LMB 3;  1ADR A;  2BNO A;  1CJG A;  3OP9 A;  4X4B A;  1R63 A;  3G5G A;  4Z5H A;  2OFY A;  3D1N I;  2LYJ A;  1ZS4 A;  3KZ3 A;  4X4F A;  1ZZ9 A;  2CSF A;  4X4E A;  2XI8 A;  2ICP A;  2LCV A;  2KEJ A;  4X4D A;  2R63 A;  4J1X A;  1BDH A;  1X2L A;  2IVB A;  4IVZ A;  3UFD A;  1SQ8 A;  4Z5D A;  1PRA A;  1WET A;  1VPW A;  1NEQ A;  3F52 A;  3BDN A;  1RZR A;  4PU3 C;  1ZUG A;  2B5A A;  3L1P A;  1IC8 A;  4J1W A;  2BJC A;  3CLC A;  3ZKC A;  2XIU A;  3U3W A;  4O8B A;  4IA8 A;  1QP4 A;  3VK0 A;  2KEI A;  1LLI A;  1HF0 A;  4X4I A;  4Z5C A;  1EFA A;  2GRL A;  1NER A;  4PU7 A;  3SCH A;  3EUS A;  3SCF A;  2IV1 A;  2AWI A;  2ICT A;  2R1J L;  3CRO L;  3PXP A;  3BD1 A;  2XJ3 A;  4MCX A;  2FJR A;  4YG4 A;  1QPZ A;  3JXB C;  3KXA A;  1RIO A;  4I8T A;  1QQB A;  2OR1 L;  3G7D A;  2PUA A;  4I6R A;  3F51 A;  3LIS A;  1ZZB A;  2EWT A;  2GRM A;  2AUW A;  1XWR A;  1JFS A;  1DW9 A;  2JVL A;  1RPE L;  5K98 B;  3MLF A;  2PE5 A;  4YG1 A;  2AXZ A;  2PIJ A;  4X4H A;  1QP7 A;  4FN3 A;  1Y7Y A;  2L8N A;  3JXC L;  3O9X A;  3QYX A;  4MCT A;  1BDI A;  2PPX A;  3F6W A;  3R1F A;  3H5T A;  2EF8 A;  2WIU B;  3DNV B;  1AU7 A;  4JCY A;  3GN5 B;  4JCX A;  4PU4 C;  1PRU A;  2IVQ A;  1PER L;  1R69 A;  2HSG A;  1DWK A;  2LYR A;  1WH6 A;  2PUE A;  2BNM A;  4GQM A;  2KEK A;  2IUO A;  4Z58 A;  1POU A;  1Y9Q A;  1WH8 A;  1ZPQ A;  1ZZ7 A;  4Z59 A;  2A6C A;  1QQA A;  2PUD A;  2HIN A;  3OQN A;  4Y42 A;  4OB4 A;  2O4A A;  3QQ6 A;  4IWR A;  1ZZ8 A;  3TRB A;  1UXC A;  3FYA A;  1L1M A;  5A7L A;  2BNN A;  3GBF A;  4YAR A;  2O38 A;  2PUG A;  3BS3 A;  3GN5 A;  3ZHM A;  3OQO A;  1QP0 A;  2EBY A;  3FYM A;  1UTX A;  4NDW A;  1OCT C;  2MEZ A;  2O49 A;  1O4X A;  2AXU A;  2LYP A;  2LYL A;  4F8D A;  4X4G A;  1RZS A;  1OSL A;  1YSE A;  1ZVV A;  3LFP A;  4GHJ A;  1PRV A;  2AXV A;  2CRO A;  4I6U A;  2JCG A;  3JXD L;  1ZZ6 A;  3QWG A;  1WIZ A;  2IU7 A;  4PU8 A;  2GZU A;  3QF3 A;  1RZR D;  1ZZC A;  4YBA A;  1JFT A;  1ZAY A;  2H8R A;  1LCC A;  3HZI B;  3SCG A;  1E3O C;  2XSD C;  2IVG A;  2L49 A;  2LYS A;  3IVP A;  4I6T A;  2PUC A;  1S7E A;  2D5V A;  1GT0 C;  2WUS R;  3OQM A;  4YG7 B;  1LCD A;  2KZ8 A;  1CQT A;  3FMY A;  2PUF A;  4X4C A;  3ZHI A;  3RZZ A;  1JH9 A;  2LYQ A;  3CEC A;  3OMT A;  1JWL A;  1LQC A;  2KPJ A;  4JQD A; 
#chains in the Genus database with same CATH topology
 2XCJ A;  1PNR A;  4DE9 A;  2AW6 A;  1X57 A;  1ADR A;  2BNO A;  1ZS4 A;  4Z5H A;  2PXV A;  2IVB A;  3UFD A;  1PRA A;  3BDN A;  2B5A A;  3CLC A;  2XIU A;  4O8B A;  4IA8 A;  1QP4 A;  3VK0 A;  2KEI A;  2LLV A;  4EKG A;  1HF0 A;  3A9X A;  3SCH A;  2AWI A;  2R1J L;  3A9Z A;  4HRA A;  4YG4 A;  3ZPX A;  3A9Y A;  4I6R A;  1JFS A;  1DW9 A;  2HFZ A;  3MLF A;  3TEL A;  3TFL A;  4FN3 A;  3F6W A;  2WIU B;  4PU4 C;  3NRO A;  3UWP A;  2BNM A;  5DTQ A;  2IUO A;  1Y9Q A;  1QQA A;  2HIN A;  1QB2 A;  4IWR A;  2L1P A;  4WVL A;  2PUG A;  3GBF A;  3BS3 A;  3QOW A;  3FYM A;  1OCT C;  1O4X A;  2MXD A;  1ZVV A;  2AXV A;  4I6U A;  2JCG A;  1ZZ6 A;  1RZR D;  4PU8 A;  1E3O C;  3G0T A;  3SX0 A;  2L49 A;  2PUC A;  2D5V A;  1GT0 C;  2WUS R;  3OQM A;  2LYQ A;  3OMT A;  1UXD A;  3S8Q A;  4FBI A;  1LMB 3;  2PXK A;  4X4B A;  2LYJ A;  2CSF A;  2HCN A;  2JQE A;  1SQ8 A;  1VPW A;  3ME5 A;  3F52 A;  4PU3 C;  2BJC A;  5DRY A;  3U3W A;  4ER0 A;  2J7W A;  4Z5C A;  1EFA A;  4PU7 A;  3EUS A;  3SCF A;  3PXP A;  4MCX A;  2FJR A;  3JXB C;  3LQX A;  1QQB A;  2OR1 L;  3VWS A;  3R09 A;  2PIJ A;  4EKI A;  3GZC A;  2L8N A;  4ER5 A;  4MCT A;  1BDI A;  2PPX A;  2ODR D;  3H5T A;  3PE5 A;  1WH6 A;  5DT2 A;  4GQM A;  3QFI A;  1WH8 A;  1ZPQ A;  4Z59 A;  2PXF A;  2A6C A;  3SR4 A;  4OB4 A;  2O4A A;  1ZZ8 A;  3TRB A;  4YAR A;  2BNN A;  5DRT A;  3ZHM A;  2EBY A;  3OKZ A;  2LYP A;  3LFP A;  1U2Z A;  1PRV A;  2XXA A;  3QWG A;  1JFT A;  2LLW A;  1LCC A;  2PXL A;  4EK9 A;  2IVG A;  2V3C C;  2PXT A;  1CQT A;  3FMY A;  4X4C A;  4ER7 A;  1JH9 A;  1LQC A;  1B0N A;  3KJX A;  2LYK A;  2FFH A;  2MQK A;  3B7H A;  3GZD A;  4Q2J A;  1CJG A;  1R63 A;  3M9L A;  1ZZ9 A;  2XI8 A;  4X4D A;  4J1X A;  1BDH A;  1X2L A;  4Z5D A;  1ZUG A;  3L1P A;  4J1W A;  3ZKC A;  2VEO A;  1LLI A;  4X4I A;  4DE8 A;  2GRL A;  2PXQ A;  3CRO L;  3BD1 A;  2XJ3 A;  1QPZ A;  1RIO A;  3KXA A;  3G7D A;  2GRM A;  2AUW A;  1XWR A;  2JVL A;  5K98 B;  2PE5 A;  4X4H A;  1Y7Y A;  3JXC L;  3O9X A;  3QYX A;  3R1F A;  2M4H A;  1AU7 A;  2EF8 A;  4JCY A;  3GN5 B;  1R69 A;  2HSG A;  2LYR A;  3NXH A;  4Z58 A;  1POU A;  2PUD A;  3OQN A;  4Y42 A;  1UXC A;  2J7U A;  3MEJ A;  1L1M A;  5A7L A;  2O38 A;  3GN5 A;  2HCS A;  2O49 A;  2LYL A;  4F8D A;  4X4G A;  1RZS A;  1YSE A;  3JXD L;  2CRO A;  3DM5 A;  1WIZ A;  2IU7 A;  2H8R A;  1ZZC A;  4YBA A;  3QOX A;  2LYS A;  2YBD A;  3IVP A;  4ER6 A;  4YG7 B;  2LNM A;  2PUF A;  3ZHI A;  3RZZ A;  2XXQ A;  3CEC A;  2XXP A;  3GUU A;  2KPJ A;  4JQD A;  2PUB A;  1QZX A;  3KL4 A;  3OWQ A;  3OP9 A;  3G5G A;  3D1N I;  2OFY A;  3KZ3 A;  4X4F A;  4X4E A;  2KEJ A;  2ICP A;  2LCV A;  2R63 A;  4IVZ A;  5GAG i;  1WET A;  1NEQ A;  1RZR A;  2PXB A;  1IC8 A;  2PXD A;  1NER A;  5GAH i;  2IV1 A;  2ICT A;  4EQZ A;  2PXU A;  4I8T A;  2PUA A;  3F51 A;  3LIS A;  1ZZB A;  2EWT A;  3NDB B;  1RPE L;  3GZD C;  4ER3 A;  4YG1 A;  2AXZ A;  3NZL A;  1QP7 A;  2PXP A;  4OBM A;  3DNV B;  4JCX A;  1PRU A;  2IVQ A;  1PER L;  1DWK A;  2PUE A;  2KEK A;  1ZZ7 A;  5DTR A;  1NW3 A;  5JUW A;  2PXE A;  3QQ6 A;  3FYA A;  5DTM A;  3OQO A;  1QP0 A;  4NDW A;  1UTX A;  2MEZ A;  2AXU A;  1OSL A;  4GHJ A;  1MFQ C;  1ZAY A;  2GZU A;  3QF3 A;  1DUL A;  4EZI A;  5DSX A;  3HZI B;  3SCG A;  2XSD C;  1HQ1 A;  4I6T A;  1S7E A;  1LCD A;  2KZ8 A;  3TEP A;  1JWL A; 
#chains in the Genus database with same CATH homology
 1B0N A;  1UXD A;  2XCJ A;  3KJX A;  3S8Q A;  1PNR A;  2PUB A;  2AW6 A;  4FBI A;  2LYK A;  2MQK A;  3B7H A;  1X57 A;  1LMB 3;  1ADR A;  2BNO A;  1CJG A;  3OP9 A;  4X4B A;  1R63 A;  3G5G A;  4Z5H A;  2OFY A;  3D1N I;  2LYJ A;  1ZS4 A;  3KZ3 A;  4X4F A;  1ZZ9 A;  2CSF A;  4X4E A;  2XI8 A;  2ICP A;  2LCV A;  2KEJ A;  4X4D A;  2R63 A;  4J1X A;  1BDH A;  1X2L A;  2IVB A;  4IVZ A;  3UFD A;  1SQ8 A;  4Z5D A;  1PRA A;  1WET A;  1VPW A;  1NEQ A;  3F52 A;  3BDN A;  1RZR A;  4PU3 C;  1ZUG A;  2B5A A;  3L1P A;  1IC8 A;  4J1W A;  2BJC A;  3CLC A;  3ZKC A;  2XIU A;  3U3W A;  4O8B A;  4IA8 A;  1QP4 A;  3VK0 A;  2KEI A;  1LLI A;  1HF0 A;  4X4I A;  4Z5C A;  1EFA A;  2GRL A;  1NER A;  4PU7 A;  3SCH A;  3EUS A;  3SCF A;  2IV1 A;  2AWI A;  2ICT A;  2R1J L;  3CRO L;  3PXP A;  3BD1 A;  2XJ3 A;  4MCX A;  2FJR A;  4YG4 A;  1QPZ A;  3JXB C;  3KXA A;  1RIO A;  4I8T A;  1QQB A;  2OR1 L;  3G7D A;  2PUA A;  4I6R A;  3F51 A;  3LIS A;  1ZZB A;  2EWT A;  2GRM A;  2AUW A;  1XWR A;  1JFS A;  1DW9 A;  2JVL A;  1RPE L;  5K98 B;  3MLF A;  2PE5 A;  4YG1 A;  2AXZ A;  2PIJ A;  4X4H A;  1QP7 A;  4FN3 A;  1Y7Y A;  2L8N A;  3JXC L;  3O9X A;  3QYX A;  4MCT A;  1BDI A;  2PPX A;  3F6W A;  3R1F A;  3H5T A;  2EF8 A;  2WIU B;  3DNV B;  1AU7 A;  4JCY A;  3GN5 B;  4JCX A;  4PU4 C;  1PRU A;  2IVQ A;  1PER L;  1R69 A;  2HSG A;  1DWK A;  2LYR A;  1WH6 A;  2PUE A;  2BNM A;  4GQM A;  2KEK A;  2IUO A;  4Z58 A;  1POU A;  1Y9Q A;  1WH8 A;  1ZPQ A;  1ZZ7 A;  4Z59 A;  2A6C A;  1QQA A;  2PUD A;  2HIN A;  3OQN A;  4Y42 A;  4OB4 A;  2O4A A;  3QQ6 A;  4IWR A;  1ZZ8 A;  3TRB A;  1UXC A;  3FYA A;  1L1M A;  5A7L A;  2BNN A;  3GBF A;  4YAR A;  2O38 A;  2PUG A;  3BS3 A;  3GN5 A;  3ZHM A;  3OQO A;  1QP0 A;  2EBY A;  3FYM A;  1UTX A;  4NDW A;  1OCT C;  2MEZ A;  2O49 A;  1O4X A;  2AXU A;  2LYP A;  2LYL A;  4F8D A;  4X4G A;  1RZS A;  1OSL A;  1YSE A;  1ZVV A;  3LFP A;  4GHJ A;  1PRV A;  2AXV A;  2CRO A;  4I6U A;  2JCG A;  3JXD L;  1ZZ6 A;  3QWG A;  1WIZ A;  2IU7 A;  4PU8 A;  2GZU A;  3QF3 A;  1RZR D;  1ZZC A;  4YBA A;  1JFT A;  1ZAY A;  2H8R A;  1LCC A;  3HZI B;  3SCG A;  1E3O C;  2XSD C;  2IVG A;  2L49 A;  2LYS A;  3IVP A;  4I6T A;  2PUC A;  1S7E A;  2D5V A;  1GT0 C;  2WUS R;  3OQM A;  4YG7 B;  1LCD A;  2KZ8 A;  1CQT A;  3FMY A;  2PUF A;  4X4C A;  3ZHI A;  3RZZ A;  1JH9 A;  2LYQ A;  3CEC A;  3OMT A;  1JWL A;  1LQC A;  2KPJ A;  4JQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...