2WIUB

Mercury-modified bacterial persistence regulator hipba
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
71
Chain Sequence
KIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDNLEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Kinase Regulation Mechanism Found in Hipba: A Bacterial Persistence Switch.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transcription
molecule keywords PROTEIN HIPA
total genus 21
structure length 71
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2wiuB00
1ZZ9A 2EF8A 3CECA 2LYJA 4NDWA 2O4AA 2XI8A 4OB4A 2H8RA 3BS3A 1RZRD 4Z5DA 1E3OC 4Y42A 4PU8A 3JXCL 1NEQA 2MQKA 2LYRA 3G7DA 2R1JL 2LCVA 1R63A 3KJXA 1WH8A 1JWLA 2JCGA 4MCTA 1WH6A 3JXBC 3OQNA 2IU7A 4I6RA 3UFDA 1CJGA 3PXPA 1HF0A 1PRAA 2ICTA 2IVBA 2LYPA 4X4FA 1OCTC 1ZZCA 4X4DA 4IWRA 2GRLA 2AWIA 4FN3A 2A6CA 1UXDA 3S8QA 2L49A 1ADRA 2R63A 2XCJA 3L1PA 3CROL 2PUCA 3VK0A 1PRVA 1LCDA 1BDHA 2PUAA 2XSDC 4F8DA 3BDNA 1RPEL 2AXZA 1JFTA 4J1XA 2EBYA 1ZZ6A 1O4XA 1RZSA 1QP4A 4O8BA 2GRMA 3SCFA 2LYLA 2IUOA 1JH9A 1NERA 1OSLA 1DWKA 4YG7B 4PU3C 3DNVB 4IA8A 2PUDA 2EWTA 3OP9A 1ZPQA 4Z5HA 4YG4A 4X4EA 1GT0C 4X4HA 1IC8A 1EFAA 3FYMA 3FMYA 2BNMA 4JCYA 1QP0A 2LYKA 4X4CA 2HSGA 1S7EA 2KEJA 1LCCA 3D1NI 2KEIA 3SCHA 2AUWA 3LFPA 1ZAYA 3KXAA 2HINA 3CLCA 2IVQA 4YBAA 4X4GA 1L1MA 2MEZA 4MCXA 1RZRA 2KPJA 3B7HA 4FBIA 1Y7YA 4IVZA 2ICPA 4Z58A 3QQ6A 1ZZ7A 1DW9A 4X4IA 1PERL 1UXCA 1X2LA 2WIUB 4GHJA 2AXUA 2B5AA 2BNNA 2AXVA 1ZS4A 3HZIB 2OR1L 2BNOA 3G5GA 1XWRA 1JFSA 3GN5A 3H5TA 3QYXA 3KZ3A 3QF3A 3QWGA 3R1FA 4I6TA 2O38A 1VPWA 4I8TA 1LMB3 2PUEA 1ZZBA 3ZKCA 4Z59A 4GQMA 1ZUGA 1QP7A 1POUA 2BJCA 2D5VA 2XJ3A 1UTXA 2WUSR 4PU4C 2O49A 4I6UA 1B0NA 3MLFA 4Z5CA 3OQMA 1QPZA 2GZUA 3TRBA 1QQBA 2KZ8A 2L8NA 2PUGA 4YG1A 1LLIA 1R69A 2PIJA 2KEKA 3ZHMA 1WETA 3O9XA 2IVGA 5K98B 2IV1A 2JVLA 3EUSA 4X4BA 1QQAA 2LYSA 2LYQA 2CROA 1X57A 3U3WA 5A7LA 1PRUA 4JQDA 1Y9QA 1AU7A 3OMTA 3OQOA 1BDIA 3BD1A 1ZZ8A 2CSFA 4JCXA 3SCGA 3GBFA 2PPXA 1ZVVA 1SQ8A 2PUFA 1CQTA 3JXDL 3LISA 3IVPA 2FJRA 2XIUA 2OFYA 4YARA 1YSEA 3GN5B 3F6WA 2PUBA 2PE5A 1WIZA 3FYAA 1PNRA 1RIOA 3RZZA 3F52A 4PU7A 2AW6A 3ZHIA 1LQCA 4J1WA 3F51A
chains in the Genus database with same CATH superfamily
3CECA 4NDWA 2H8RA 2PXFA 1NEQA 2XXAA 1HQ1A 4DE8A 3SR4A 4MCTA 3UFDA 2ICTA 2IVBA 4X4FA 4WVLA 4X4DA 2GRLA 4FN3A 1UXDA 2XCJA 3L1PA 1PRVA 2AXZA 4J1XA 2EBYA 1QP4A 2ODRD 3ME5A 4EKGA 4PU3C 4YG7B 2PUDA 2XXQA 4X4HA 4DE9A 3NROA 1S7EA 1MFQC 3TEPA 1QZXA 3LFPA 3SCHA 3KXAA 1L1MA 2HFZA 3B7HA 4EK9A 2WIUB 2AXUA 3HZIB 2MXDA 5DT2A 4I6TA 3QF3A 3R1FA 2O38A 4Z59A 2PXQA 3M9LA 2D5VA 2WUSR 4PU4C 3A9XA 2O49A 1B0NA 3MLFA 4Z5CA 1QPZA 2KZ8A 2PIJA 3LQXA 3UWPA 2KEKA 3GZDA 1WETA 5DSXA 2IVGA 2PXTA 3A9ZA 5K98B 2IV1A 5A7LA 1PRUA 3VWSA 2PXDA 1Y9QA 1ZZ8A 2CSFA 4JCXA 3GBFA 1ZVVA 2PUFA 4ER7A 5JUWA 4ER0A 2PE5A 1PNRA 3FYAA 3F52A 3BDNA 3ZHIA 3F51A 2EF8A 3BS3A 1E3OC 4Y42A 4PU8A 2MQKA 3G7DA 4EZIA 2LLVA 2PXBA 3KJXA 1JWLA 3JXBC 4EKIA 4I6RA 2HCSA 2LYPA 1OCTC 1ZZCA 4IWRA 2AWIA 2L49A 2XSDC 1JFTA 1ZZ6A 1RZSA 4O8BA 3SCFA 2LYLA 4HRAA 1NERA 1OSLA 4IA8A 1ZPQA 4YG4A 1NW3A 4JCYA 1QP0A 1LCCA 3OWQA 3OKZA 1ZAYA 3CLCA 2MEZA 4Q2JA 1RZRA 2KPJA 2ICPA 1ZZ7A 4X4IA 3A9YA 2AXVA 2J7WA 3QFIA 3G5GA 3GN5A 3H5TA 3KZ3A 2PUEA 4GQMA 2BJCA 2XJ3A 5GAHi 4I6UA 2GZUA 3TRBA 1DULA 1LLIA 4X4BA 2JVLA 3EUSA 1QQAA 2LYSA 1X57A 4JQDA 3KL4A 3SCGA 4ER6A 2PPXA 2L1PA 1CQTA 3LISA 3SX0A 2XIUA 4YARA 2M4HA 4PU7A 3TFLA 2PXUA 1ZZ9A 2LYJA 2XI8A 2YBDA 2LLWA 3QOWA 3JXCL 2R1JL 2LYRA 2HCNA 2LCVA 1R63A 1WH8A 2JCGA 1WH6A 3OQNA 2IU7A 1CJGA 3PXPA 5DTRA 1PRAA 2A6CA 2PXKA 1ADRA 2R63A 2PXVA 3VK0A 1LCDA 3G0TA 4F8DA 1U2ZA 1O4XA 3DM5A 2GRMA 3DNVB 2EWTA 3OP9A 4ER5A 1GT0C 2BNMA 2LYKA 2KEJA 2HINA 2IVQA 4FBIA 5DTMA 4Z58A 3QQ6A 1DW9A 1PERL 1UXCA 4GHJA 2B5AA 2BNNA 1ZS4A 2OR1L 1XWRA 3QYXA 3QWGA 1VPWA 1LMB3 1ZZBA 3ZKCA 1ZUGA 2J7UA 3OQMA 2PUGA 4YG1A 1R69A 2LYQA 2CROA 3U3WA 5DRYA 1AU7A 3OMTA 3BD1A 2V3CC 5DRTA 3JXDL 3GZCA 2FJRA 3IVPA 3MEJA 2PXLA 3GN5B 3F6WA 2PUBA 1WIZA 2AW6A 1LQCA 4J1WA 2FFHA 2O4AA 4OB4A 3PE5A 4OBMA 1RZRD 4Z5DA 4EQZA 1HF0A 1QB2A 3S8QA 3CROL 2PUCA 1BDHA 2PUAA 1RPEL 2JQEA 2IUOA 1JH9A 1DWKA 5DTQA 4Z5HA 4X4EA 1IC8A 1EFAA 3FYMA 4X4CA 4ER3A 2HSGA 3D1NI 3NXHA 2KEIA 2AUWA 3R09A 4YBAA 4X4GA 4MCXA 1Y7YA 4IVZA 2XXPA 1X2LA 3QOXA 3TELA 2BNOA 1JFSA 3GUUA 4I8TA 1QP7A 1POUA 1UTXA 3GZDC 2VEOA 1QQBA 2L8NA 2PXEA 3ZHMA 3O9XA 3NZLA 3OQOA 1BDIA 2LNMA 1SQ8A 3ZPXA 3NDBB 2OFYA 1YSEA 2PXPA 1RIOA 3RZZA 5GAGi 3FMYA
chains in the Genus database with same CATH topology
1ZZ9A 2EF8A 3CECA 2LYJA 4NDWA 2O4AA 2XI8A 4OB4A 2H8RA 3BS3A 1RZRD 4Z5DA 1E3OC 4Y42A 4PU8A 3JXCL 1NEQA 2MQKA 2LYRA 3G7DA 2R1JL 2LCVA 1R63A 3KJXA 1WH8A 1JWLA 2JCGA 4MCTA 1WH6A 3JXBC 3OQNA 2IU7A 4I6RA 3UFDA 1CJGA 3PXPA 1HF0A 1PRAA 2ICTA 2IVBA 2LYPA 4X4FA 1OCTC 1ZZCA 4X4DA 4IWRA 2GRLA 2AWIA 4FN3A 2A6CA 1UXDA 3S8QA 2L49A 1ADRA 2R63A 2XCJA 3L1PA 3CROL 2PUCA 3VK0A 1PRVA 1LCDA 1BDHA 2PUAA 2XSDC 4F8DA 3BDNA 1RPEL 2AXZA 1JFTA 4J1XA 2EBYA 1ZZ6A 1O4XA 1RZSA 1QP4A 4O8BA 2GRMA 3SCFA 2LYLA 2IUOA 1JH9A 1NERA 1OSLA 1DWKA 4YG7B 4PU3C 3DNVB 4IA8A 2PUDA 2EWTA 3OP9A 1ZPQA 4Z5HA 4YG4A 4X4EA 1GT0C 4X4HA 1IC8A 1EFAA 3FYMA 3FMYA 2BNMA 4JCYA 1QP0A 2LYKA 4X4CA 2HSGA 1S7EA 2KEJA 1LCCA 3D1NI 2KEIA 3SCHA 2AUWA 3LFPA 1ZAYA 3KXAA 2HINA 3CLCA 2IVQA 4YBAA 4X4GA 1L1MA 2MEZA 4MCXA 1RZRA 2KPJA 3B7HA 4FBIA 1Y7YA 4IVZA 2ICPA 4Z58A 3QQ6A 1ZZ7A 1DW9A 4X4IA 1PERL 1UXCA 1X2LA 2WIUB 4GHJA 2AXUA 2B5AA 2BNNA 2AXVA 1ZS4A 3HZIB 2OR1L 2BNOA 3G5GA 1XWRA 1JFSA 3GN5A 3H5TA 3QYXA 3KZ3A 3QF3A 3QWGA 3R1FA 4I6TA 2O38A 1VPWA 4I8TA 1LMB3 2PUEA 1ZZBA 3ZKCA 4Z59A 4GQMA 1ZUGA 1QP7A 1POUA 2BJCA 2D5VA 2XJ3A 1UTXA 2WUSR 4PU4C 2O49A 4I6UA 1B0NA 3MLFA 4Z5CA 3OQMA 1QPZA 2GZUA 3TRBA 1QQBA 2KZ8A 2L8NA 2PUGA 4YG1A 1LLIA 1R69A 2PIJA 2KEKA 3ZHMA 1WETA 3O9XA 2IVGA 5K98B 2IV1A 2JVLA 3EUSA 4X4BA 1QQAA 2LYSA 2LYQA 2CROA 1X57A 3U3WA 5A7LA 1PRUA 4JQDA 1Y9QA 1AU7A 3OMTA 3OQOA 1BDIA 3BD1A 1ZZ8A 2CSFA 4JCXA 3SCGA 3GBFA 2PPXA 1ZVVA 1SQ8A 2PUFA 1CQTA 3JXDL 3LISA 3IVPA 2FJRA 2XIUA 2OFYA 4YARA 1YSEA 3GN5B 3F6WA 2PUBA 2PE5A 1WIZA 3FYAA 1PNRA 1RIOA 3RZZA 3F52A 4PU7A 2AW6A 3ZHIA 1LQCA 4J1WA 3F51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZ9 A;  2EF8 A;  3CEC A;  2LYJ A;  4NDW A;  2O4A A;  2XI8 A;  4OB4 A;  2H8R A;  3BS3 A;  1RZR D;  4Z5D A;  1E3O C;  4Y42 A;  4PU8 A;  3JXC L;  1NEQ A;  2MQK A;  2LYR A;  3G7D A;  2R1J L;  2LCV A;  1R63 A;  3KJX A;  1WH8 A;  1JWL A;  2JCG A;  4MCT A;  1WH6 A;  3JXB C;  3OQN A;  2IU7 A;  4I6R A;  3UFD A;  1CJG A;  3PXP A;  1HF0 A;  1PRA A;  2ICT A;  2IVB A;  2LYP A;  4X4F A;  1OCT C;  1ZZC A;  4X4D A;  4IWR A;  2GRL A;  2AWI A;  4FN3 A;  2A6C A;  1UXD A;  3S8Q A;  2L49 A;  1ADR A;  2R63 A;  2XCJ A;  3L1P A;  3CRO L;  2PUC A;  3VK0 A;  1PRV A;  1LCD A;  1BDH A;  2PUA A;  2XSD C;  4F8D A;  3BDN A;  1RPE L;  2AXZ A;  1JFT A;  4J1X A;  2EBY A;  1ZZ6 A;  1O4X A;  1RZS A;  1QP4 A;  4O8B A;  2GRM A;  3SCF A;  2LYL A;  2IUO A;  1JH9 A;  1NER A;  1OSL A;  1DWK A;  4YG7 B;  4PU3 C;  3DNV B;  4IA8 A;  2PUD A;  2EWT A;  3OP9 A;  1ZPQ A;  4Z5H A;  4YG4 A;  4X4E A;  1GT0 C;  4X4H A;  1IC8 A;  1EFA A;  3FYM A;  3FMY A;  2BNM A;  4JCY A;  1QP0 A;  2LYK A;  4X4C A;  2HSG A;  1S7E A;  2KEJ A;  1LCC A;  3D1N I;  2KEI A;  3SCH A;  2AUW A;  3LFP A;  1ZAY A;  3KXA A;  2HIN A;  3CLC A;  2IVQ A;  4YBA A;  4X4G A;  1L1M A;  2MEZ A;  4MCX A;  1RZR A;  2KPJ A;  3B7H A;  4FBI A;  1Y7Y A;  4IVZ A;  2ICP A;  4Z58 A;  3QQ6 A;  1ZZ7 A;  1DW9 A;  4X4I A;  1PER L;  1UXC A;  1X2L A;  2WIU B;  4GHJ A;  2AXU A;  2B5A A;  2BNN A;  2AXV A;  1ZS4 A;  3HZI B;  2OR1 L;  2BNO A;  3G5G A;  1XWR A;  1JFS A;  3GN5 A;  3H5T A;  3QYX A;  3KZ3 A;  3QF3 A;  3QWG A;  3R1F A;  4I6T A;  2O38 A;  1VPW A;  4I8T A;  1LMB 3;  2PUE A;  1ZZB A;  3ZKC A;  4Z59 A;  4GQM A;  1ZUG A;  1QP7 A;  1POU A;  2BJC A;  2D5V A;  2XJ3 A;  1UTX A;  2WUS R;  4PU4 C;  2O49 A;  4I6U A;  1B0N A;  3MLF A;  4Z5C A;  3OQM A;  1QPZ A;  2GZU A;  3TRB A;  1QQB A;  2KZ8 A;  2L8N A;  2PUG A;  4YG1 A;  1LLI A;  1R69 A;  2PIJ A;  2KEK A;  3ZHM A;  1WET A;  3O9X A;  2IVG A;  5K98 B;  2IV1 A;  2JVL A;  3EUS A;  4X4B A;  1QQA A;  2LYS A;  2LYQ A;  2CRO A;  1X57 A;  3U3W A;  5A7L A;  1PRU A;  4JQD A;  1Y9Q A;  1AU7 A;  3OMT A;  3OQO A;  1BDI A;  3BD1 A;  1ZZ8 A;  2CSF A;  4JCX A;  3SCG A;  3GBF A;  2PPX A;  1ZVV A;  1SQ8 A;  2PUF A;  1CQT A;  3JXD L;  3LIS A;  3IVP A;  2FJR A;  2XIU A;  2OFY A;  4YAR A;  1YSE A;  3GN5 B;  3F6W A;  2PUB A;  2PE5 A;  1WIZ A;  3FYA A;  1PNR A;  1RIO A;  3RZZ A;  3F52 A;  4PU7 A;  2AW6 A;  3ZHI A;  1LQC A;  4J1W A;  3F51 A; 
#chains in the Genus database with same CATH topology
 3CEC A;  4NDW A;  2H8R A;  2PXF A;  1NEQ A;  2XXA A;  1HQ1 A;  4DE8 A;  3SR4 A;  4MCT A;  3UFD A;  2ICT A;  2IVB A;  4X4F A;  4WVL A;  4X4D A;  2GRL A;  4FN3 A;  1UXD A;  2XCJ A;  3L1P A;  1PRV A;  2AXZ A;  4J1X A;  2EBY A;  1QP4 A;  2ODR D;  3ME5 A;  4EKG A;  4PU3 C;  4YG7 B;  2PUD A;  2XXQ A;  4X4H A;  4DE9 A;  3NRO A;  1S7E A;  1MFQ C;  3TEP A;  1QZX A;  3LFP A;  3SCH A;  3KXA A;  1L1M A;  2HFZ A;  3B7H A;  4EK9 A;  2WIU B;  2AXU A;  3HZI B;  2MXD A;  5DT2 A;  4I6T A;  3QF3 A;  3R1F A;  2O38 A;  4Z59 A;  2PXQ A;  3M9L A;  2D5V A;  2WUS R;  4PU4 C;  3A9X A;  2O49 A;  1B0N A;  3MLF A;  4Z5C A;  1QPZ A;  2KZ8 A;  2PIJ A;  3LQX A;  3UWP A;  2KEK A;  3GZD A;  1WET A;  5DSX A;  2IVG A;  2PXT A;  3A9Z A;  5K98 B;  2IV1 A;  5A7L A;  1PRU A;  3VWS A;  2PXD A;  1Y9Q A;  1ZZ8 A;  2CSF A;  4JCX A;  3GBF A;  1ZVV A;  2PUF A;  4ER7 A;  5JUW A;  4ER0 A;  2PE5 A;  1PNR A;  3FYA A;  3F52 A;  3BDN A;  3ZHI A;  3F51 A;  2EF8 A;  3BS3 A;  1E3O C;  4Y42 A;  4PU8 A;  2MQK A;  3G7D A;  4EZI A;  2LLV A;  2PXB A;  3KJX A;  1JWL A;  3JXB C;  4EKI A;  4I6R A;  2HCS A;  2LYP A;  1OCT C;  1ZZC A;  4IWR A;  2AWI A;  2L49 A;  2XSD C;  1JFT A;  1ZZ6 A;  1RZS A;  4O8B A;  3SCF A;  2LYL A;  4HRA A;  1NER A;  1OSL A;  4IA8 A;  1ZPQ A;  4YG4 A;  1NW3 A;  4JCY A;  1QP0 A;  1LCC A;  3OWQ A;  3OKZ A;  1ZAY A;  3CLC A;  2MEZ A;  4Q2J A;  1RZR A;  2KPJ A;  2ICP A;  1ZZ7 A;  4X4I A;  3A9Y A;  2AXV A;  2J7W A;  3QFI A;  3G5G A;  3GN5 A;  3H5T A;  3KZ3 A;  2PUE A;  4GQM A;  2BJC A;  2XJ3 A;  5GAH i;  4I6U A;  2GZU A;  3TRB A;  1DUL A;  1LLI A;  4X4B A;  2JVL A;  3EUS A;  1QQA A;  2LYS A;  1X57 A;  4JQD A;  3KL4 A;  3SCG A;  4ER6 A;  2PPX A;  2L1P A;  1CQT A;  3LIS A;  3SX0 A;  2XIU A;  4YAR A;  2M4H A;  4PU7 A;  3TFL A;  2PXU A;  1ZZ9 A;  2LYJ A;  2XI8 A;  2YBD A;  2LLW A;  3QOW A;  3JXC L;  2R1J L;  2LYR A;  2HCN A;  2LCV A;  1R63 A;  1WH8 A;  2JCG A;  1WH6 A;  3OQN A;  2IU7 A;  1CJG A;  3PXP A;  5DTR A;  1PRA A;  2A6C A;  2PXK A;  1ADR A;  2R63 A;  2PXV A;  3VK0 A;  1LCD A;  3G0T A;  4F8D A;  1U2Z A;  1O4X A;  3DM5 A;  2GRM A;  3DNV B;  2EWT A;  3OP9 A;  4ER5 A;  1GT0 C;  2BNM A;  2LYK A;  2KEJ A;  2HIN A;  2IVQ A;  4FBI A;  5DTM A;  4Z58 A;  3QQ6 A;  1DW9 A;  1PER L;  1UXC A;  4GHJ A;  2B5A A;  2BNN A;  1ZS4 A;  2OR1 L;  1XWR A;  3QYX A;  3QWG A;  1VPW A;  1LMB 3;  1ZZB A;  3ZKC A;  1ZUG A;  2J7U A;  3OQM A;  2PUG A;  4YG1 A;  1R69 A;  2LYQ A;  2CRO A;  3U3W A;  5DRY A;  1AU7 A;  3OMT A;  3BD1 A;  2V3C C;  5DRT A;  3JXD L;  3GZC A;  2FJR A;  3IVP A;  3MEJ A;  2PXL A;  3GN5 B;  3F6W A;  2PUB A;  1WIZ A;  2AW6 A;  1LQC A;  4J1W A;  2FFH A;  2O4A A;  4OB4 A;  3PE5 A;  4OBM A;  1RZR D;  4Z5D A;  4EQZ A;  1HF0 A;  1QB2 A;  3S8Q A;  3CRO L;  2PUC A;  1BDH A;  2PUA A;  1RPE L;  2JQE A;  2IUO A;  1JH9 A;  1DWK A;  5DTQ A;  4Z5H A;  4X4E A;  1IC8 A;  1EFA A;  3FYM A;  4X4C A;  4ER3 A;  2HSG A;  3D1N I;  3NXH A;  2KEI A;  2AUW A;  3R09 A;  4YBA A;  4X4G A;  4MCX A;  1Y7Y A;  4IVZ A;  2XXP A;  1X2L A;  3QOX A;  3TEL A;  2BNO A;  1JFS A;  3GUU A;  4I8T A;  1QP7 A;  1POU A;  1UTX A;  3GZD C;  2VEO A;  1QQB A;  2L8N A;  2PXE A;  3ZHM A;  3O9X A;  3NZL A;  3OQO A;  1BDI A;  2LNM A;  1SQ8 A;  3ZPX A;  3NDB B;  2OFY A;  1YSE A;  2PXP A;  1RIO A;  3RZZ A;  5GAG i;  3FMY A; 
#chains in the Genus database with same CATH homology
 1ZZ9 A;  2EF8 A;  3CEC A;  2LYJ A;  4NDW A;  2O4A A;  2XI8 A;  4OB4 A;  2H8R A;  3BS3 A;  1RZR D;  4Z5D A;  1E3O C;  4Y42 A;  4PU8 A;  3JXC L;  1NEQ A;  2MQK A;  2LYR A;  3G7D A;  2R1J L;  2LCV A;  1R63 A;  3KJX A;  1WH8 A;  1JWL A;  2JCG A;  4MCT A;  1WH6 A;  3JXB C;  3OQN A;  2IU7 A;  4I6R A;  3UFD A;  1CJG A;  3PXP A;  1HF0 A;  1PRA A;  2ICT A;  2IVB A;  2LYP A;  4X4F A;  1OCT C;  1ZZC A;  4X4D A;  4IWR A;  2GRL A;  2AWI A;  4FN3 A;  2A6C A;  1UXD A;  3S8Q A;  2L49 A;  1ADR A;  2R63 A;  2XCJ A;  3L1P A;  3CRO L;  2PUC A;  3VK0 A;  1PRV A;  1LCD A;  1BDH A;  2PUA A;  2XSD C;  4F8D A;  3BDN A;  1RPE L;  2AXZ A;  1JFT A;  4J1X A;  2EBY A;  1ZZ6 A;  1O4X A;  1RZS A;  1QP4 A;  4O8B A;  2GRM A;  3SCF A;  2LYL A;  2IUO A;  1JH9 A;  1NER A;  1OSL A;  1DWK A;  4YG7 B;  4PU3 C;  3DNV B;  4IA8 A;  2PUD A;  2EWT A;  3OP9 A;  1ZPQ A;  4Z5H A;  4YG4 A;  4X4E A;  1GT0 C;  4X4H A;  1IC8 A;  1EFA A;  3FYM A;  3FMY A;  2BNM A;  4JCY A;  1QP0 A;  2LYK A;  4X4C A;  2HSG A;  1S7E A;  2KEJ A;  1LCC A;  3D1N I;  2KEI A;  3SCH A;  2AUW A;  3LFP A;  1ZAY A;  3KXA A;  2HIN A;  3CLC A;  2IVQ A;  4YBA A;  4X4G A;  1L1M A;  2MEZ A;  4MCX A;  1RZR A;  2KPJ A;  3B7H A;  4FBI A;  1Y7Y A;  4IVZ A;  2ICP A;  4Z58 A;  3QQ6 A;  1ZZ7 A;  1DW9 A;  4X4I A;  1PER L;  1UXC A;  1X2L A;  2WIU B;  4GHJ A;  2AXU A;  2B5A A;  2BNN A;  2AXV A;  1ZS4 A;  3HZI B;  2OR1 L;  2BNO A;  3G5G A;  1XWR A;  1JFS A;  3GN5 A;  3H5T A;  3QYX A;  3KZ3 A;  3QF3 A;  3QWG A;  3R1F A;  4I6T A;  2O38 A;  1VPW A;  4I8T A;  1LMB 3;  2PUE A;  1ZZB A;  3ZKC A;  4Z59 A;  4GQM A;  1ZUG A;  1QP7 A;  1POU A;  2BJC A;  2D5V A;  2XJ3 A;  1UTX A;  2WUS R;  4PU4 C;  2O49 A;  4I6U A;  1B0N A;  3MLF A;  4Z5C A;  3OQM A;  1QPZ A;  2GZU A;  3TRB A;  1QQB A;  2KZ8 A;  2L8N A;  2PUG A;  4YG1 A;  1LLI A;  1R69 A;  2PIJ A;  2KEK A;  3ZHM A;  1WET A;  3O9X A;  2IVG A;  5K98 B;  2IV1 A;  2JVL A;  3EUS A;  4X4B A;  1QQA A;  2LYS A;  2LYQ A;  2CRO A;  1X57 A;  3U3W A;  5A7L A;  1PRU A;  4JQD A;  1Y9Q A;  1AU7 A;  3OMT A;  3OQO A;  1BDI A;  3BD1 A;  1ZZ8 A;  2CSF A;  4JCX A;  3SCG A;  3GBF A;  2PPX A;  1ZVV A;  1SQ8 A;  2PUF A;  1CQT A;  3JXD L;  3LIS A;  3IVP A;  2FJR A;  2XIU A;  2OFY A;  4YAR A;  1YSE A;  3GN5 B;  3F6W A;  2PUB A;  2PE5 A;  1WIZ A;  3FYA A;  1PNR A;  1RIO A;  3RZZ A;  3F52 A;  4PU7 A;  2AW6 A;  3ZHI A;  1LQC A;  4J1W A;  3F51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...