2WJ9A

Ardb
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
138
Chain Sequence
b'TSSACAPETGLQQLVATIVPDEQRISFWPQHFGLIPQWVTLEPRVFGWMDRLCCIWNLYTLNNGGAFMAPEETWVLFNAMNGNRAEMSPEAAGIAACLMTYSHHACRTECYAMTVHYYRLRDYALQHPECSAIMRIID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERGENIC-REGION PROTEIN
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Escherichia coli cft073
molecule tags Hydrolase inhibitor
total genus 47
structure length 138
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03230 Antirestrict Antirestriction protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.120 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2wj9A00
2WJ9A 2KMGA
chains in the Genus database with same CATH superfamily
5EFQB 4JX6A 1OL2B 4BCMD 3QWLA 3TW6A 3K7AM 1IREB 3QZ5B 4HNUA 3DL1A 5L2WB 2QDYB 2WMBB 2DMEA 3G33B 2CCHB 4F6UB 2ZCFB 2WHBB 4AKHA 2C5NB 1H4LD 3DOGB 2W96A 1JOWA 2ZPBB 5ICPB 1GUXB 3X20B 1AD6A 2WMAB 2CZ7B 4MFDA 3MY1B 1W98B 3WVEB 4BCND 3A8GB 3RGFB 4CRLB 1URCB 4YOOA 4Y72B 4BCMB 1O9KB 4CXAB 3TNIB 3QZ9B 4HNTA 4ROCA 1OKVB 4RODA 3X26B 4BBRM 3H4CA 3F5XB 5DQVA 4BXXX 1UGQB 4G6LB 4BCOB 1H24B 2WXVB 3BLHB 1UNLD 3B57A 4BCQD 3HBLA 1OIYB 4OB0B 1GUXA 2BKZB 2BS4A 4BCPB 4JX5A 3PO3S 2WJ9A 1H27B 5HBJB 3X25B 4BCNB 4ZGDB 2QF7A 5HNBB 3TNWB 2BPMB 2LW4A 3BHUB 1O9KA 4ZGJB 4OB1B 2B9RA 2W9FA 1V29B 4KRCB 4BY1X 3O0GD 5IHYA 1VINA 1KXUA 1VOLA 4II5B 2D0QB 2W2HA 4ELJA 5ACBA 1UNGD 1OL1B 3KHIA 2G9XB 4EOIB 2JGZB 4HL4A 4BCQB 2BS3A 3BHTB 3EOCB 1UGRB 1ENWA 2C5OB 4ZGEB 4HLQA 1H1QB 2ZZDB 2CJMB 2PK9B 3GTMS 3A8HB 3X28B 4CFXB 1D3UB 1AHJB 4OB2B 4F7JB 4BCJB 5IF1B 2UZDB 5IDNB 3MI9B 4KRDB 3TN8B 2QDJA 4CFWB 5BNJB 5HBEB 3DTOA 5HQ0B 4F7SB 2X1NB 1H1PB 2C6TB 4F7NB 1VYWB 5IDPB 2W9ZA 5I5ZB 3QYHB 2DXCB 4EOJB 1FVVB 3BHVB 2CCIB 1P5EB 2CZ6B 2QGSA 4FM4B 3VYHB 4CFUD 4EOLB 4CFNB 4AKIA 1UNHD 4CFMB 2IW9B 2KMGA 1H1RB 2WIHB 1UGSB 4UN0A 3QYGB 4F6SB 1H28B 2PJQA 4HNVA 3X24B 1JKWA 1GY3B 2DPPB 1H26B 2CYZB 1F5QB 4Z6YA 4AKGA 2G77A 3WVDB 1ZP2A 3MY5B 4ELLA 4BCIB 4EOMB 1TD6A 5HVYB 4CFUB 2IN3A 1BU2A 4AI6A 1OKWB 1FINB 3HHTB 2ZPEB 1JSTB 4QSHA 2QQ8A 5DQWA 4LOCA 2R7GA 3VYGB 4JX4A 4BCHB 1XO2A 2IVXA 4EOKB 2I53A 3EIDB 1G3NC 2C4GB 2C5XB 4BCGB 4EC8B 4FX3B 1H25B 5CEIB 4EOPB 1TFBA 3BLQB 1UGPB 2IW8B 4MFEA 3BG9A 4F7LB 4YOSA 3A8OB 2F2CA 4CFVB 3A8MB 3HB9A 2UZEB 4BY7X 3EJ1B 2WFYB 2ZPFB 5EJCA 1E9HB 2DD5B 3VKGA 3VKHA 2WEVB 3BG3A 4YOZA 4F6WB 1OI9B 3LQ5B 5LQFB 3DDQB 2CZ1B 2UUEB 2DD4B 1OGUB 2BS2A 5HBHB 4OGRB 1C9BA 2PK2A 1OIUB 3MIAB 3POMA 3QYEA 2V22B 3DDPB 3HZJA 4BBSM 3M03A 2CZ0B 2EUFA 3TW7A 2AHJB 4EOOB 4EORB 4OR5B 3NDQA 1FKMA 2PHGA 2DXBB 4MIMA 4BCFB 2C5VB 1QMZB 4NSTB 4BCKB 3QHRB 1E7PA 3A8LB 1QLBA 2UZLB 2ZPHB 4YC3B 1GH6B 3QXEB 2ZPGB 4EC9B 5LMKB 3HO8A 2ZPIB 3QYBA 2WIPB 3BG5A 4IMYB 5FGKB 4F70B 1N4MA 4TTHA 2WPAB 2KR6A 3DJBA 2PMIB 2W99A 4I3ZB 4NC6A 2I40B 2QFZA 4EONB 3BLRB 2IW6B 3QHWB 1PKDB 4EOQB 2UZBB 4OB3B 4M6VA 3TNHB 1JSUB 4ROEA 5CYIB 1H1SB 1AISB 4EOSB
chains in the Genus database with same CATH topology
3BG3A 4JX6A 1UGSB 3QYGB 3QWLA 3TW6A 4ZGJB 2CZ1B 4OB1B 4HNVA 3X24B 1V29B 1IREB 3QZ5B 2DD4B 2DPPB 4HNUA 2BS2A 3DL1A 2CYZB 2QDYB 2D0QB 4Z6YA 4ELJA 4AKGA 2ZCFB 3QYEA 4AKHA 2G77A 3KHIA 3WVDB 3HZJA 2ZPBB 4BBSM 4HL4A 2CZ0B 3X20B 3TW7A 2BS3A 2AHJB 1UGRB 2CZ7B 4MFDA 1FKMA 4ZGEB 2DXBB 4HLQA 4MIMA 3WVEB 3A8GB 2ZZDB 4AI6A 3HHTB 3A8HB 2ZPEB 1E7PA 3X28B 4QSHA 3A8LB 2QQ8A 1AHJB 1QLBA 4OB2B 4LOCA 2ZPHB 3QXEB 2ZPGB 3VYGB 4JX4A 3QZ9B 3HO8A 4HNTA 2QDJA 2ZPIB 3QYBA 3X26B 3BG5A 4BBRM 3H4CA 1UGQB 2KR6A 1UGPB 3QYHB 2DXCB 4MFEA 3BG9A 3HBLA 3A8OB 4OB0B 4NC6A 2BS4A 3A8MB 2CZ6B 3HB9A 4FM4B 2QFZA 4JX5A 3VYHB 2ZPFB 2WJ9A 3X25B 5EJCA 4ZGDB 4AKIA 2DD5B 4OB3B 4M6VA 3VKGA 2QF7A 3VKHA 2KMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WJ9 A;  2KMG A; 
#chains in the Genus database with same CATH topology
 5EFQ B;  4JX6 A;  1OL2 B;  4BCM D;  3QWL A;  3TW6 A;  3K7A M;  1IRE B;  3QZ5 B;  4HNU A;  3DL1 A;  5L2W B;  2QDY B;  2WMB B;  2DME A;  3G33 B;  2CCH B;  4F6U B;  2ZCF B;  2WHB B;  4AKH A;  2C5N B;  1H4L D;  3DOG B;  2W96 A;  1JOW A;  2ZPB B;  5ICP B;  1GUX B;  3X20 B;  1AD6 A;  2WMA B;  2CZ7 B;  4MFD A;  3MY1 B;  1W98 B;  3WVE B;  4BCN D;  3A8G B;  3RGF B;  4CRL B;  1URC B;  4YOO A;  4Y72 B;  4BCM B;  1O9K B;  4CXA B;  3TNI B;  3QZ9 B;  4HNT A;  4ROC A;  1OKV B;  4ROD A;  3X26 B;  4BBR M;  3H4C A;  3F5X B;  5DQV A;  4BXX X;  1UGQ B;  4G6L B;  4BCO B;  1H24 B;  2WXV B;  3BLH B;  1UNL D;  3B57 A;  4BCQ D;  3HBL A;  1OIY B;  4OB0 B;  1GUX A;  2BKZ B;  2BS4 A;  4BCP B;  4JX5 A;  3PO3 S;  2WJ9 A;  1H27 B;  5HBJ B;  3X25 B;  4BCN B;  4ZGD B;  2QF7 A;  5HNB B;  3TNW B;  2BPM B;  2LW4 A;  3BHU B;  1O9K A;  4ZGJ B;  4OB1 B;  2B9R A;  2W9F A;  1V29 B;  4KRC B;  4BY1 X;  3O0G D;  5IHY A;  1VIN A;  1KXU A;  1VOL A;  4II5 B;  2D0Q B;  2W2H A;  4ELJ A;  5ACB A;  1UNG D;  1OL1 B;  3KHI A;  2G9X B;  4EOI B;  2JGZ B;  4HL4 A;  4BCQ B;  2BS3 A;  3BHT B;  3EOC B;  1UGR B;  1ENW A;  2C5O B;  4ZGE B;  4HLQ A;  1H1Q B;  2ZZD B;  2CJM B;  2PK9 B;  3GTM S;  3A8H B;  3X28 B;  4CFX B;  1D3U B;  1AHJ B;  4OB2 B;  4F7J B;  4BCJ B;  5IF1 B;  2UZD B;  5IDN B;  3MI9 B;  4KRD B;  3TN8 B;  2QDJ A;  4CFW B;  5BNJ B;  5HBE B;  3DTO A;  5HQ0 B;  4F7S B;  2X1N B;  1H1P B;  2C6T B;  4F7N B;  1VYW B;  5IDP B;  2W9Z A;  5I5Z B;  3QYH B;  2DXC B;  4EOJ B;  1FVV B;  3BHV B;  2CCI B;  1P5E B;  2CZ6 B;  2QGS A;  4FM4 B;  3VYH B;  4CFU D;  4EOL B;  4CFN B;  4AKI A;  1UNH D;  4CFM B;  2IW9 B;  2KMG A;  1H1R B;  2WIH B;  1UGS B;  4UN0 A;  3QYG B;  4F6S B;  1H28 B;  2PJQ A;  4HNV A;  3X24 B;  1JKW A;  1GY3 B;  2DPP B;  1H26 B;  2CYZ B;  1F5Q B;  4Z6Y A;  4AKG A;  2G77 A;  3WVD B;  1ZP2 A;  3MY5 B;  4ELL A;  4BCI B;  4EOM B;  1TD6 A;  5HVY B;  4CFU B;  2IN3 A;  1BU2 A;  4AI6 A;  1OKW B;  1FIN B;  3HHT B;  2ZPE B;  1JST B;  4QSH A;  2QQ8 A;  5DQW A;  4LOC A;  2R7G A;  3VYG B;  4JX4 A;  4BCH B;  1XO2 A;  2IVX A;  4EOK B;  2I53 A;  3EID B;  1G3N C;  2C4G B;  2C5X B;  4BCG B;  4EC8 B;  4FX3 B;  1H25 B;  5CEI B;  4EOP B;  1TFB A;  3BLQ B;  1UGP B;  2IW8 B;  4MFE A;  3BG9 A;  4F7L B;  4YOS A;  3A8O B;  2F2C A;  4CFV B;  3A8M B;  3HB9 A;  2UZE B;  4BY7 X;  3EJ1 B;  2WFY B;  2ZPF B;  5EJC A;  1E9H B;  2DD5 B;  3VKG A;  3VKH A;  2WEV B;  3BG3 A;  4YOZ A;  4F6W B;  1OI9 B;  3LQ5 B;  5LQF B;  3DDQ B;  2CZ1 B;  2UUE B;  2DD4 B;  1OGU B;  2BS2 A;  5HBH B;  4OGR B;  1C9B A;  2PK2 A;  1OIU B;  3MIA B;  3POM A;  3QYE A;  2V22 B;  3DDP B;  3HZJ A;  4BBS M;  3M03 A;  2CZ0 B;  2EUF A;  3TW7 A;  2AHJ B;  4EOO B;  4EOR B;  4OR5 B;  3NDQ A;  1FKM A;  2PHG A;  2DXB B;  4MIM A;  4BCF B;  2C5V B;  1QMZ B;  4NST B;  4BCK B;  3QHR B;  1E7P A;  3A8L B;  1QLB A;  2UZL B;  2ZPH B;  4YC3 B;  1GH6 B;  3QXE B;  2ZPG B;  4EC9 B;  5LMK B;  3HO8 A;  2ZPI B;  3QYB A;  2WIP B;  3BG5 A;  4IMY B;  5FGK B;  4F70 B;  1N4M A;  4TTH A;  2WPA B;  2KR6 A;  3DJB A;  2PMI B;  2W99 A;  4I3Z B;  4NC6 A;  2I40 B;  2QFZ A;  4EON B;  3BLR B;  2IW6 B;  3QHW B;  1PKD B;  4EOQ B;  2UZB B;  4OB3 B;  4M6V A;  3TNH B;  1JSU B;  4ROE A;  5CYI B;  1H1S B;  1AIS B;  4EOS B; 
#chains in the Genus database with same CATH homology
 3BG3 A;  4JX6 A;  1UGS B;  3QYG B;  3QWL A;  3TW6 A;  4ZGJ B;  2CZ1 B;  4OB1 B;  4HNV A;  3X24 B;  1V29 B;  1IRE B;  3QZ5 B;  2DD4 B;  2DPP B;  4HNU A;  2BS2 A;  3DL1 A;  2CYZ B;  2QDY B;  2D0Q B;  4Z6Y A;  4ELJ A;  4AKG A;  2ZCF B;  3QYE A;  4AKH A;  2G77 A;  3KHI A;  3WVD B;  3HZJ A;  2ZPB B;  4BBS M;  4HL4 A;  2CZ0 B;  3X20 B;  3TW7 A;  2BS3 A;  2AHJ B;  1UGR B;  2CZ7 B;  4MFD A;  1FKM A;  4ZGE B;  2DXB B;  4HLQ A;  4MIM A;  3WVE B;  3A8G B;  2ZZD B;  4AI6 A;  3HHT B;  3A8H B;  2ZPE B;  1E7P A;  3X28 B;  4QSH A;  3A8L B;  2QQ8 A;  1AHJ B;  1QLB A;  4OB2 B;  4LOC A;  2ZPH B;  3QXE B;  2ZPG B;  3VYG B;  4JX4 A;  3QZ9 B;  3HO8 A;  4HNT A;  2QDJ A;  2ZPI B;  3QYB A;  3X26 B;  3BG5 A;  4BBR M;  3H4C A;  1UGQ B;  2KR6 A;  1UGP B;  3QYH B;  2DXC B;  4MFE A;  3BG9 A;  3HBL A;  3A8O B;  4OB0 B;  4NC6 A;  2BS4 A;  3A8M B;  2CZ6 B;  3HB9 A;  4FM4 B;  2QFZ A;  4JX5 A;  3VYH B;  2ZPF B;  2WJ9 A;  3X25 B;  5EJC A;  4ZGD B;  4AKI A;  2DD5 B;  4OB3 B;  4M6V A;  3VKG A;  2QF7 A;  3VKH A;  2KMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...