2WJAA

Crystal structure of the tyrosine phosphatase wzb from escherichia coli k30 in complex with phosphate.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
152
structure length
146
Chain Sequence
b'PRGSHMAKLMFDSILVICTGNICRSPIGERLLRRLLPSKKINSAGVGALVDHAADESAIRVNGLCLKGHRGTKFTSALARQYDLLLVMEYSHLEQISRIAPEARGKTMLFGHWKEIPDPYRMSDEAFDSVYQLLEQASKRWAEKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ACID PHOSPHATASE WZB
publication title Crystal Structures of Wzb of Escherichia Coli and Cpsb of Streptococcus Pneumoniae, Representatives of Two Families of Tyrosine Phosphatases that Regulate Capsule Assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 48
structure length 146
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wjaA00
3E3MA 6CHYA 2FQXA 2FMHA 3LUCA 4UHJA 4ZYLA 1ZN2A 1ZITA 4RY0A 3O2JA 1SXGA 3DGEC 3I5AA 1DBWA 1M2EA 1Z17A 1DZ3A 2FEKA 2MYPA 1QO0D 1MIHA 3K9CA 5TPWA 3N0XA 3H5OA 1RPJA 1BDJA 5JNRA 3NNSA 4XARA 4YP9A 1DBQA 4YO7A 2A9QA 1YTUA 4FB4A 5BR1A 4MS4A 1Z13A 2RGYA 1ZH2A 1LBHA 2V0NA 3CNBA 4DQDA 3UKJA 1D1QA 2IPMA 2QVCA 4LE2A 1Z2EA 4QYMA 5B3JC 1ZESA 3JTEA 2E4YA 4RK5A 3HJFA 5IUNC 2IPLA 4RK4A 4Z9AA 1IIBA 4JB0A 1LK0A 1PEAA 4MLDA 2IPNA 2PUGA 2B4AA 1EWKA 4F3TA 3URMA 1NXVA 1ZY2A 5IX8A 2R47A 3I45A 3M9XA 2OENG 1E2BA 5FWYA 1TM2A 4DADA 2FEWB 3FFWA 1ZGGA 4KMRA 1K66A 3P9YA 4QICA 3B2NA 1EWVA 1NXWA 4WT7A 5HQJA 1YMVA 4MQFB 4UHKA 5D2CA 1L5YA 3HVRA 2L17A 3HO1A 1ISRA 2CHEA 3A0RB 3RVNA 1U2QA 5DTEA 1CHNA 4XXHA 3H5TA 1U2PA 1DJMA 2QV0A 2YHBA 2A9RA 3OMXA 1KRWA 2WRZA 4G0YA 4Y9TA 2JBAA 2JRLA 2PKXA 2GI4A 3H1GA 4Z4HA 1MB3A 3OM0A 1JF8A 2WJAA 1JDNA 5KQPA 1FFWA 4PZ0A 3RH0A 4Z99A 3L6UA 5DCLA 5HSGA 4YS6A 4HNRA 1QP0A 2VUIB 1MB0A 3CU5A 1D5WA 4EYKA 1P6QA 4N0QA 1NTRA 1GCGA 3LKBA 2WY2D 1RZRD 1SD5A 4MQFA 3N0RA 7ABPA 3H5WA 4YWHA 5HM6A 4RXUA 5TQ2A 2PUFA 3MIZA 3N0WA 3UK0A 4TLLB 3SY8A 1KMIY 4G0OA 1T34A 3OQNA 5CNMA 3SNKA 4MS1B 1XHFA 4EYOA 4N47A 1NXTA 4LDAA 2LUOA 3RVLA 3HDVA 4RSMA 3D02A 3NHZA 3QEMB 3QX8A 2LIVA 5DKFA 1MAVA 3KSMA 5IUKC 2PE5A 3GRCA 4EYGA 3IP7A 3RVMA 2CD7A 4N03A 1M5UA 4Z4FA 1FFGA 1QO0A 1JWLA 3DBIA 1D2AA 5IBQA 2PMCA 1C4WA 4EVQA 3KLNA 5EWJA 2ID9A 4RZSA 4ETMA 2L19A 2FLWA 2E4ZA 2FMFA 3W9SA 2VYCA 5KC9A 4L85A 4MQEB 4MS3A 3RVQA 1BVHA 4Z4EA 2FQYA 3QELB 2JB9A 4PE5B 2CHFA 4H3HB 4OG2A 3S99A 1FSPA 4O1IA 1EAYA 2MSLA 3QLUC 4S05A 3CFYA 3GT7A 2JVJA 4OBBA 2R48A 2LP4Y 4W5RA 1PUXA 2VK2A 1BDHA 1Z15A 4E7OA 2R4QA 5GOTA 3QLVA 5TPWB 3OQOA 2MSWA 4JOQA 2A9PA 3HCWA 1SXHA 1E6MA 3O2SB 3O75A 5GQSA 4MS4B 5EWLB 5IEBA 1YK0A 1W25A 3QELA 4RU1A 3HEBA 4QPJC 1PNTA 2WWVD 2FMKA 5TE9A 1NXPA 2P4UA 2RJNA 3ROFA 1U8TA 2GBPA 3IP6A 3JS5A 3C3MA 4OLAA 3SQNA 3VNAA 2JVIA 3QEKA 4MPTA 1JBEA 1JYFA 1TJYA 3DZDA 4NCAA 5FBHA 4KQ9A 3EULA 1JL3A 2GKGA 5T3YA 1M2FA 2PUBA 4B09A 3EQ2A 3IPCA 5FWYB 2N9UA 3KJXA 3OO0A 4IILA 3CLKA 3F6CA 3QX9A 1A2OA 4MGEA 2L2QA 4G0PA 4Z9BA 5I4CA 1SRRA 1RZRA 3MMNA 4OTZA 1DCFA 3OLYA 5DLEA 3SAJA 8ABPA 5IEJA 2HQOA 5JNTA 4KNYA 5EWLA 5IC5A 4XASA 2PAFA 2R25B 4G86A 5BRAA 4WXEA 2PL1A 5T7BA 4IGAA 4P1ZA 4RKQA 2JBAB 4N76A 2QR3A 3KLOA 3R0JA 1D1PA 1S8NA 2J48A 4NQRA 3TO5A 5KWSA 3O21A 5KC8A 3OM1A 3NNNA 3T95A 3CZCA 2AYXA 1LBIA 2B1JA 2IOYA 4MLCA 1KGSA 3C3KA 4RXTA 3H5IA 1FQWA 3SG0A 2PUEA 2FLKA 4Z4IA 4OATA 4TN5A 4XLTA 1A0OA 2IYNA 3RVRA 4KREA 1JHZA 2ID7A 5JNWA 3G85A 2QVGA 5TQ2B 2HSGA 3HUUA 3F7NA 1P2FA 4G0MA 1NY5A 4IRXA 2RDMA 3FFXA 5KI6A 3CHYA 3T8YA 1QKKA 4EVSA 3A10A 4WZZA 3FDFA 1DC8A 2E4UA 3OMWA 3QLTA 1EHCA 1EWTA 4GNRA 3GYBA 4OLBA 1AB5A 3F6PA 1VRVA 3MQ4A 3RQIA 5KQGA 3DLBA 2FSPA 3N53A 4RK0A 3RVJA 2KYRA 5IUJC 1K68A 2NZUG 2ZAYA 4EYQA 3CKMA 4G0ZA 4EY3A 2W42A 1F51E 5EWJB 4LE0A 2PL9A 1UDRA 5EWMA 1USGA 3CRNA 1JX6A 2JK1A 2M1ZA 2NT3A 5FWXB 4RS3A 4MS3B 1URPA 1APBA 4FE7A 5KQLA 4RK6A 3O2QB 5HKOA 5JNVA 3C97A 2LPMA 3HS3A 4G0QA 5B3JA 3KYJB 2F8TA 2I6FA 4ZPJA 1ABFA 5BRJA 4KFCA 1QQBA 3GL9A 1DC7A 3MYYA 2H0AA 3N6VA 2E4WA 5E3JA 1RXIA 2H3HA 5TQ0B 1PNRA 4KV7A 1YS6A 1JDPA 1B00A 3HM9A 3N75A 4O1HA 5PNTA 4W5TA 1TLFA 3TD9A 2NT4A 3DLHA 3EQZA 4RWEA 5FWXA 1PHRA 5CNKA 2VUHB 3H75A 4LX8A 5F64A 4DN6A 1ZH4A 3KG2A 3OQMA 3EODA 3JY6A 5JNUA 3UUGA 4LZLA 1Z25A 3KS9A 3RVOA 3E61A 1DCMA 3CZ5A 4PEVA 1C0EA 2FN8A 3Q41A 3GV0A 3CTPA 5CHYA 5TQ0A 1J56A 4D6XA 4ZJPA 4KRFA 1QP4A 3GWGA 3MF4A 1NXSA 1TMYA 1DCKA 3LUAA 3N8IA 3C3WA 3KTOA 3Q7RA 1A04A 3Q9SA 4RXMA 3T6KA 2FN9A 4NCBA 1NXOA 3T38A 2M98A 2ZWMA 4YV7A 1ABEA 3IDOA 4MRMB 3RVKA 3H6HA 3LFTA 4JA2A 3JVDA 3RVPA 3LOPA 1U04A 1FFSA 3EJWA 3TMYA 3BREA 1ISSA 4ML3A 3IPAA 1Z12A 2X7XA 1JFSA 2PUAA 4G97A 3LUDA 3LUKA 1ZDMA 4W5OA 3LUGA 2FEPA 4NV3A 3F73A 1P8AA 2RJOA 3LMKA 3ROTA 2PUDA 3KCNA 2FTKE 4NICA 2P9HA 1YIOA 4RDCA 1QNLA 1USIA 3H1FA 3BRSA 2MYUA 4FE4A 4H60A 4KK4A 5ED4A 2BGGA 2FQWA 2IPAB 3FMVA 1LJLA 4WXMA 4MRMA 1USKA 4RY9A 1HEYA 2JCGA 3HK2A 1JFVA 3HDGA 1I3CA 2QZJA 3LUJA 4RKRA 1BAPA 2FW0A 1DG9A 2DRIA 3BBLA 3IP5A 1Z2DA 3JPYA 1GUDA 4MR9B 1RNLA 3LTEA 4LE1A 5TPZD 1OXKB 3GBPA 3RVSA 4RY8A 1RXEA 4EGSA 4YRZA 3EGCA 5C5CA 4D74A 1DBPA 3H1EA 3DGFC 5ABPA 4MR8B 4P98A 1XHEA 3EDCA 1ZGZA 3KKEA 3QLUA 4YGXB 3TX6A 3BRQA 3OLVA 3L49A 4JAVC 1VLZA 3LUHA 2F8SA 1YS7A 2AYZA 1VKRA 1Z26A 1Y1LA 4HNSA 2GX6A 1JYEA 1E6KA 2NUBA 3ILYA 4Q6WA 5EWMB 1YK1A 4G0XA 2FKAA 4MR9A 5TQJA 4F06A 1ZVVA 4Z4GA 5CNJA 2NZVG 1XWWA 3I09A 3HV2A 4PYRA 5JS1A 3Q15C 1E6LA 2GWRA 5CNIA 2PJUA 1ZAYA 1CEYA 5KQMA 2LBPA 4XAQA 2MYNA 4M88A 3TB6A 3GA5A 4MR8A 3GBVA 4EVRA 3O1IC 4MR7B 4D6YA 1DRJA 1LJUA 2FMIA 2HJ9A 2O20A 2QU7A 5C5EA 4LDZA 3O1JC 3SM9A 1P6UA 4Q7EA 4YLEA 5FBKA 3H6GA 3D8UA 3NNDA 1ZHHA 3OLXA 4IF4A 1SXIA 4KVFA 4WWHA 3OLWA 3VNBA 1Z16A 4Z0NA 1GLGA 4S04A 2A9OA 2IDMA 1R8JA 4HYEA 4TLMB 4XFKA 1CYEA 4KZKA 4ETIA 3Q7SA 1MVOA 5DGCA 3LKVA 1JH9A 1GUBA 3O1HB 4YR7A 2WMYA 1H9CA 3MA0A 4F11A 3A0UA 3QLVC 4IMJB 4N41A 3H5LA 4H3KB 4MR7A 1OXBB 4JASB 2L18A 2QW1A 3Q7TA 1EFAA 2IKSA 3OO1A 2FXIA 1TVMA 3MM4A 3M9WA 2Q5CA 3NBMA 1PEYA 2HPHA 3BILA 3K4HA 4PICA 4ETNA 1GCAA 3I42A 4O5AA 1WETA 3HSYA 4F12A 4N0PA 4JP1A 2HQBA 4KPYA 3OLZA 2QXYA 4IMIB 4KK3A 4RK7A 1VPWA 1U0SY 3H5VA 3FGZA 4RK1A 4WUTA 3ILHA 5JNSA 1JLKA 1NXXA 1QQAA 2FVYA 1DRKA 2E4VA 2MSKA 4W5NA 5TPZA 4ZMSA 4Q6BA 4JB2A 3NHMA 4CBVA 3CG4A 2MYTA 2PUCA 4GPAA 1BDIA 3KYIB 1QP7A 3HUTA 4F8JA 1KRXA 3C6QA 3HXMA 3LUFA 2JVKA 3G1WA 5JS2A 4YCSA 1YVUA 2WJWA 4MS1A 2WB4A 3A3KA 1F4VA 3JPWA 1W9HA 1L5ZA 3CS3A 4MYRA 5BQ3A 4ZMRA 1BA2A 3QEMA 2PLNA 4QYWA 1Z18A 2HQRA 1QPZA 5IULC 3EAFA 1AB6A 1D4ZA 3KHTA 4L4UA 2CWDA 1M5TA 4E7PA 4EUKA 4Z4CA 1NATA 3QK7A 4RV5A 9ABPA 1JFTA 4KQCA 4MAAA 4HNQA 4W5QA 3O74A 2TMYA 6ABPA 3CG0A 3HZHA 3M6MD 3IP9A 4MQEA 1DP4A 3JVIA 1QMPA 2E4XA 2YHAA 2XDYA 3FFTA 4TMYA 2OQRA 1YMUA 2QSJA 4LRQA
chains in the Genus database with same CATH superfamily
1M8KA 3EUEA 3IB3A 1WPRA 2BD0A 5K6RA 4EG7A 4DV0B 2H2HA 1KEVA 1ULHA 3L4BA 3PA8A 4CMIB 3I5MA 3ADBA 3UW3A 4C3OB 4ZOBA 3K72B 4O63O 4B47A 1HT1E 2C5SA 3M9LA 4RTOA 2J5XA 1CUSA 2FEKA 1EDZA 5DH9A 1MIHA 4DPMA 4G9BA 3ZDAA 2PBLA 2WUGA 1IJKA 1BDJA 1IUPA 2HBYA 2JFVA 2ZJ8A 3A37A 3LOUA 2ZVDA 4KRYA 3X44A 2A9QA 1GYPA 2XCSB 3DV2A 2QJRA 2KBEA 3QWBA 2QRVB 2RGYA 1QGOA 3L79A 1LBHA 3I9V6 3UKJA 2AOTB 5A3QA 3FCOA 2JIZD 3EASA 4BMNA 2RFLA 1Q0SA 3V1YA 3HVRA 3KXKA 4HN4B 1SHUX 2HDNB 4EL5A 2Z5FA 4DSUA 4WZAA 1OXSC 2B4AA 2X2PA 4CPDA 5EJ2A 3RHTA 5HJEA 1Y6FA 1SNYA 1HUQA 2NU6A 2J6IA 3HKDA 2OXIA 2O3SA 4QICA 3B2NA 2ZSKA 1KP9A 4CKBA 3V8EA 1MF7A 3WK7A 5GADl 5KNBD 1ZGBA 5KYVA 3SX2A 5L6MB 4M7PA 2OB1A 2P6OA 4MRNA 2D06A 2L17A 4JIMA 4ALIA 1UC4B 4KAJA 1DQPA 2O1SA 2UZAA 5LJIA 2Z30A 4L78A 3OEED 4TT3A 3FPFA 3WNBA 1JKFA 3L1IA 5C7YA 2O8DB 1WOMA 3AERA 2EIXA 1V0JA 1QFXA 4FSDA 1XXHB 5JCOA 5EVJA 1QIJA 3ZVLA 3U4MA 2HZBA 1AS2A 4FYJA 1RXCA 1GRVA 5C1BA 5BWOA 1L5RA 4CJXA 1JQDA 1X7XA 3RH0A 3IE1A 3FGNA 3OUUA 1WUJS 5CLLA 5EP3A 1SD1A 4FUTA 4C04A 1L6RA 1E61A 1KF0A 2IYYA 3O91A 4TLBA 2FPIB 1LBQA 2VRBA 1RZRD 4UBIA 3NG1A 3RWBA 3SPXA 5G1NA 4DMMA 3MUFA 5F12A 4TL9A 2IBTA 2BZGA 1XIVA 2F43B 3ORSA 4JDPA 5H5JA 1CR2A 4O1MA 2Z1NA 4C3VA 2IE8A 2DULA 2E49A 1KMIY 1S3GA 5F73A 2P35A 3TTUA 2Z56A 3H2ZA 1U0EA 3DZIA 3SIPA 2WMOB 2VYND 5GV7A 1Y6QA 1NUTA 5A9TA 2PXAA 4PR3A 3T34A 2R86A 3SYTA 2BF7A 1QV9A 3OCVA 1MTZA 2G9VA 1DAHA 2O23A 2PWBA 2QRPA 4EJ6A 4E5SA 3P2IA 2AFIA 5KU1A 1K1EA 4W7HA 1EJ6A 3GAZA 3PNOA 1AN9A 3VJKA 3B3GA 4NZYA 3ZGNA 2PE5A 3MILA 1I2BA 3CV3A 1Z6QA 1JBQA 3K0AA 3T3EA 4E5NA 5LIPA 2HT1A 3VHRA 3R7NA 4LHXA 1WHTA 1DL5A 3VPAA 2PWPA 5JLAA 4K6OA 2H1VA 1ECLA 1NVVR 1IZ9A 2ORVA 4NU8X 5LUAA 1DPGA 3KZ1E 3ESBA 1JPUA 1P73A 2JJ8A 3ZCPA 1FSZA 1O8BA 2DMRA 3QVWA 4MV1A 2FVXA 3SHOA 4ZHQB 4L0DA 1CNEA 2YXLA 3DW1X 1UM9A 4EFKA 3FVRA 5LD2C 1F2UA 5JVDA 4XQ9A 2OHJA 3LDFA 1RJWA 4ZTZB 5T8KA 4WCVA 4UEWA 4Q9IA 1X86B 1P9RA 4ZDWA 1Z7YA 1JAIA 2DQ4A 2ODQA 3HU5A 3QHAA 2YIDA 4J76A 5C5IA 5FL7A 2MSLA 2XTJA 4YJGA 4ITRC 4Q7MB 1V5FA 1VZ3A 2AW3A 2O54A 5KAPA 3JVEA 1X2EA 2QT0A 4OBXA 4PANA 3QLVA 4DPKA 3MINA 1WZUA 2YHUA 1KAOA 3NEPX 3IPRA 2XUAA 5JZMA 1C7JA 3C6XA 3P0HA 1NP6A 4EJ2A 1YA8A 1G7RA 1L4YA 2DQYA 3I5UA 4M8SA 5ALDA 1K2WA 5GQSA 1KO4A 2PCJA 3BWEA 5GONA 1FB5A 4OCZA 4QOFA 3QELA 2BISA 5EEHA 2SHKA 3ZWAA 3PQ7A 4PRYA 4A36A 4Q3NA 3ZX5A 5D86A 4I4LA 1GRRA 2EJVA 1UKBA 3MCVA 1MEJA 2ID4A 5BWNA 3ASYA 5K0BA 1MIOA 2ZI5A 3PRJA 5BPFA 5EMHA 3RRYA 5EIFA 2QTFA 3IQWA 5CBPA 1U9JA 4A1OA 1A8QA 1Z9BA 1V3UA 2Z8YA 1W29A 1K27A 1NZJA 1VIYA 4Q4JB 3TW8A 4IIVA 1ZN8A 2AEEA 2HT6A 2I5PO 3VYVA 1J21A 2VPPA 1QC5A 3O94A 3H2IA 2Q1TA 2REBA 1HDZA 3OE5A 1M8PA 1UDBA 4TGLA 1VP9A 5T3UA 4RLFA 4UTOA 2R25B 2FY8A 3HXLA 2VJYA 3GN2A 5ESXA 1TFUA 1TQ2A 1XTSA 3B53X 4GQIA 4M1YA 1UXKA 3DMNA 3WLQA 2NMVA 1F8FA 5A04A 2FE4A 4WN9B 3AI2A 4F5WA 5K7SA 3ZE6A 3O21A 1TC1A 4X1KB 3GUZA 4YHHB 1D2GA 1N0UA 3G8AA 5EHNA 2JLZA 3T95A 4MKZA 4K87A 1SOMA 3RYFA 2VG8A 1Y6ZA 2VLIA 2DSTA 3ETCA 4Y2QA 1D6MA 5DX0A 4BRWA 1EVYA 3CZPA 3KLBA 5JIBA 2V6FA 4Z4IA 4KGXA 3HP1A 3SQMA 3P0EA 4D8VA 2CKDA 1GVNB 4FNGA 2OGZA 4I8DA 1EQUA 2QVGA 3WP1B 2FQ1A 3LFUA 4TV8F 5F1OA 3MRVA 4G0MA 3RFFA 2VJMB 3VR2D 5L3QA 2I2DA 4RJKA 3R3VA 3Q3CA 1KL7A 1DHTA 1N1DA 1RMYA 5FRDA 1Q1AA 3QBEA 1ODCA 3IBFA 3L4KA 3GGOA 1YTLA 3HQ4O 2ZSJA 5DZSA 5DW0A 5KTYA 1Z6XA 2FSVC 1SC6A 3EWNA 3G1UA 3Q9UA 4UUAA 3PUKA 1SKYE 2Y67A 1FBNA 2DJ5A 2EZ4A 4ZOQI 4KYUA 4YPVA 1W581 3AYZB 2IQ5A 4NAUA 2QRKA 1FUIA 2WFLB 4N0DA 1XTBA 3BK1A 1TOAA 4RK0A 3D4BA 2QE6A 2QXUA 3RYHB 1X42A 4XVCA 5COQA 1XQ9A 4HS9A 4CKWB 1O4WA 3IUMA 1F4PA 3TQTA 4FCVA 5EIBC 3P4XA 4XDYA 4HDSA 3THYA 2WF5A 5ESRA 1NMXA 4X6YA 1WNFA 1AO0A 1YNSA 1U80A 3QJGA 3KTDA 1C1XB 1NJGA 1S7GA 1E5VA 2QZ4A 2JZCA 4LJLA 5KQLA 1E79A 1NQWA 4RK6A 1JFFB 4YJ2B 4ZVVA 1XZBA 4R98A 4EP1A 2IC5A 3HUFA 1FDOA 3V1TC 1JSCA 1XZFA 2ZUUA 3E9EA 2VJKA 3KYJB 4CKEA 2BDEA 1Y9AA 1CD5A 1QORA 2WIDA 3DT9A 4HDNA 2A67A 1YULA 1V8ZA 2MR5A 3FB4A 3OVMA 2IU4A 4AO6A 2Z8XA 4PFJA 4LK3A 4RQBA 3UWPA 4DIMA 5HUHA 1UOPA 3GW8A 2G88A 1RJ9A 3Q5DA 3MAGA 1O2DA 4IS3A 1MPXA 1RTTA 4DARA 5ADHA 3RS4A 1YF3A 3E9YA 1P29A 1UFRA 5J5CA 5A3JA 2YJ6A 2UZ3A 3E05A 2ZT8A 3TSZA 3FE2A 3TZ6A 3DAPA 1YBVA 2OEPA 5CNKA 2VAWA 1PJ2A 4Q9HA 1GZ5A 5SY9A 3QE3A 4YRFA 2E4AA 4Q03A 1XYGA 5EIAA 2ZE7A 5P21A 2YDXA 4ECAA 4H3SA 4AZTA 1U2SA 1P1IA 5GOZA 4LNAA 5K8JB 2CLIB 3RODA 4NIMA 5HIAA 2XWSA 2GBFA 5K4HA 4M9RA 4A8JA 1XLVA 4U9UA 1KI7A 2RIRA 1T1JA 4J3JA 4DBZA 4DLXA 2R6DA 4JU9A 5HIJA 4AZ3B 2B25A 2WVHA 3F7OA 4K9KA 3SD7A 4RXMA 4F1WA 5BVHA 5JH7B 1E9FA 4CM9A 721PA 2GTHA 4KIWA 2M98A 3G2HA 4OOFA 4B9AA 2ATXA 3KB8A 1XVAA 1RJEA 4GYJA 4RIGA 3JVDA 3LWZA 2QLJA 1KI6B 1IBRA 2ESRA 3TG8A 1M10A 1QUEA 4UZEA 1Y4ZA 2RGWA 1U3CA 1SVOA 3UMRA 3LXMA 2ODWA 1W85A 1PE0A 3A1SA 3HCAA 4U3JB 4RZXA 2UUOA 4QWMA 5H4HA 3RS7A 4F46A 4JSYA 1MO4A 3GFTA 3UAVA 1JDSA 3AO0B 3EA4A 3GGDA 4FLEA 5L9AA 1RIFA 3DP9A 2FTKE 4MUNA 1YIOA 2QT1A 3F1LA 2F3QA 3NAGA 1Q21A 1VJCA 4KVAA 4A0FA 4DWWA 4EG5A 5CEEA 1MV8A 4H60A 1FUYB 4KMMA 4PLTA 1UKZA 3GPLA 1ZOPA 3HVJA 3AT1A 4RY9A 3CPSA 1CBUA 1HEYA 1QF7A 4QUEA 1GQYA 4DLAA 4PHFA 1TYCA 1GRCA 1OLXA 2FR1A 3PGXA 1A5BB 3Q87B 4UM5A 1SBYA 4YIKA 1ETHA 5JXGA 1GG5A 5JBQA 3JAMA 2MHCA 3J80A 2AV6A 1UAAA 4D42A 4KQJA 4ASUA 1T4MA 2Y93A 2XQJA 1Q0PA 4LI3X 1G41A 2CLHB 4RTSA 1PUJA 1EVQA 2H9AA 3GDHA 5TPZD 4C7BA 1V6CA 1HYBA 1K8XB 3QENA 4D98A 4M9ZA 3H1EA 2BVNA 1QXSA 1WCXA 4D25A 2I3DA 2R2AA 3ZTYA 1INLA 3BIFA 3E3LA 3PQEA 1WJGA 1X7HA 3BRQA 3KK0A 1PTJC 3UOGA 4AZVA 4JS0A 1OX4A 1X15A 4BFZA 3MB5A 3CH6A 4M37A 2A33A 1EFVB 3PKIA 2I99A 2ZIXA 4HNSA 4IJ6A 3HUDA 5CK4A 4QELA 5BYAA 1L5VA 4C4ZA 3AESA 2VH1A 2EZ9A 3EIEA 1MTOA 3DV9A 4PZLA 4TUYB 1CVRA 3R0IA 2RC6A 3OX1A 4Q47A 2WINI 2X2FA 2NZVG 4LK2A 1IVNA 1JZTA 1UBUS 1I7LA 1PJRA 2HLPA 2XB4A 3HV2A 3LRPA 4BUZA 5AVRA 5J2TB 3M6AA 4GKKB 5CB4F 1VE6A 1D8AA 4BGUA 3KM0A 1PZFA 4YQEA 2Y9MB 1TJ5A 3KSDO 4DPLA 3ORYA 2A9JA 2DPXA 1G21A 4KVGA 1Q92A 1N75A 1UJNA 1V45E 2P5YA 3OESA 3IILA 5JD3A 4RTNA 2IHZA 1G1MA 3FYHA 2GZAA 1UDCA 1QM5A 2RI1A 3W5VA 4Z0NA 3NCHA 2A9OA 1JHXA 4YAFA 1W2HA 3ZZTA 1FS6A 3RSQA 4COKA 3HR7A 3TKYA 1B4DA 1DRWA 1MG0A 1WTAA 4ND8B 4Y2TA 4X90A 5DGCA 4J0QA 2VNKA 4EX7A 3O1HB 3B20A 1P0IA 2O2GA 1UDWA 2L42A 3KQMA 4MV0A 1JHRA 1RE0A 3B36A 4MVJA 1X0VA 3A0UA 3UIEA 5U9CA 4PTLA 1YI0A 2AZ4A 2FLVA 4JLAA 4OSEA 2HMVA 5HVNA 1K0FA 3AHEA 5AYVA 2RE8A 3JZIA 5JAQA 3LQ1A 3I6YA 4JSTA 3TOXA 3BG5A 1DKLA 2PL5A 1CE8A 1W8DA 1YKGA 4B6EA 3L8DA 2RGUA 4Q00A 1NI4B 4UEJA 4X8HA 2Q5CA 1JSXA 5JQGF 1ZFNA 4QKQA 2AOXA 1J90A 2O05A 1XDZA 2OHFA 3ZWYA 4L4XA 1VXOA 2ACEA 4BP3A 4MKRA 2ZS7A 3STXA 2FN4A 3C4VA 4KX5A 4LS3A 4IH9A 2OTCA 3AK4A 3IO3A 4KC0A 3E27A 4KK3A 4DNOA 4F4IA 1YFKA 2NIPA 1NX9A 2RGNA 1SEVA 3RHFA 4BZPA 3H87A 4NLLA 2TMGA 1L7NA 1DRKA 1SQSA 4B3BA 2FSHA 1TW2A 1V37A 1A27A 4ME6A 4AS3A 3WZ2A 3GDWA 2X13A 3NHMA 3K6SA 3HM2A 5B7NA 3E03A 3EG9B 1NMEA 5TVKA 3U80A 3QSGA 4IPTA 1S3SA 4EUSA 1XAIA 1RKVA 1P60A 3C5WP 3EVDA 3DBVO 3HUTA 1P9OA 3GCWA 2C7VA 2E1RA 4TT3D 1BO6A 4K7JA 1RC8A 4L2IB 2EG9A 4NQZA 4GH5A 2BI7A 2GK6A 5FEMA 2QP3A 2NO7A 1JILA 3L1KA 4OJMX 1NUSA 2FMXA 4WMLA 1J25A 1F8YA 3QYPA 3PHJA 1LQ2A 4XCXA 4LY9A 3JQFC 3V2UA 2VF8A 4G4SP 5JZSA 2PLNA 1ZKDA 4QYWA 1BYIA 2NSDA 4H59A 2P8SA 4GF5A 1BHO1 5CCEA 2FW8A 3R9KA 4JHXA 3VXKA 1CRQA 1E0SA 3D3JA 3Q6NA 1T1IA 1M5TA 4UUOA 4CDNA 4YPFA 3RUHA 4M76B 1A82A 1RVDA 1RWWA 2XE6A 4RV5A 5J63A 3QI2A 4IHQA 1FP2A 4GGOA 1ST2A 3D0OA 4N5HX 2W43A 3PRHA 2GM4A 4CLRA 1YRBA 3G0IA 4XSHA 2FSUA 5D3ZA 2J3HA 2WPNA 3R6LA 4ITVA 4HH3C 4OP3A 3X1KA 1XR3A 1WBDA 5C1OA 2RHHA 4UE6A 3S2IA 2C4UA 3GN1A 3WGNA 5A9RA 2YFYA 2DUNA 3L0YA 6CHYA 4FILA 3F98A 2H4FA 3HJNA 2P27A 3LJKA 3LSYA 1ZM7A 4P31A 2OLJA 3FPKA 4QJ5A 3N59A 1UT5A 1MPTA 2JI7A 3NC4A 2FR8A 1UMDA 4LV8B 1YCDA 1YDWA 2H1HA 4D4HA 4X44A 4QT4A 2HSJA 2ZBEA 2ZXEA 3UGKA 4F0JA 4ZI7A 3H9EO 2M1XA 3ZHZA 1KEEA 4GXQA 2H8GA 2VNAA 3T7KA 4YCMA 2WIFA 1JLHA 4KU4A 1J20A 3B12A 1W59A 2VEOA 3ADPA 3IQFA 3CW9A 4LPSA 4A8HA 1F0KA 4KV9A 4GM4A 4WLVA 5LKAA 4LE2A 3I2FA 4JD5A 1E4OA 4YTEA 5EUQB 1N6OA 3VPCA 2WTBA 4H1WA 3FCEA 4U7GA 4E5YA 4IX1A 3OZRA 5ESWA 3BD9A 2ZM6B 1FW6A 4C08A 1QFJA 1TF7A 1MO3A 3UJCA 1RHUA 1YJBA 2CFTA 4NY1A 5F76A 5LR6A 5EXTA 1K2VN 4D02A 4X95A 1LTQA 3DNMA 1YKFA 2FGKA 3RU7A 4R71A 4TKVA 1CUDA 5F5NA 5JYDA 5KHOC 1L5YA 3E5HA 1O89A 2HIAA 2ZUSA 3FYTA 1DAEA 3A0RB 2PQ2A 4N1AA 4B6RA 2PS3A 1BZYA 2ZSDA 3ZWCA 3R74A 3RK0A 4YRNA 1T2AA 2C95A 2ZDQA 4MNTA 1J8FA 3X1JA 1LVHA 4XPIA 2JDIA 4H6XA 2BIFA 4KXVA 4XTRA 2BSXA 4HN2A 4PRZA 1JF8A 3M3HA 1CZRA 2YWHA 3ANYB 2BRUA 2JAUA 2JHAA 2Q4RA 4NAHA 3RUPA 1F4LA 3E58A 5DCLA 5KVVA 3AVVA 1AUOA 4IHJF 1GPUA 4NE2A 3ZE0B 5EJ7A 1YKSA 3CZ9A 4NATA 3C3XA 2DWPA 4CM7A 3NI2A 3Q5EA 1N2EA 1KFKB 4N0QA 3WMWA 5FBVB 3FOEC 5C0OE 4RNCA 1P45A 3LQKA 3BB3A 3DBLB 4LBWA 1T9BA 2QTCA 4G5XA 1ORHA 4PQFA 1XEXB 1K7XB 4DMRA 1OBOA 3GHHA 2XADA 4IJUA 4LBVA 1QHNA 3REQA 5KOHB 4BWFB 4JC8A 1Z4QA 1VIAA 3KQOA 4PHGA 2BBSA 1YRWA 4K6MA 4YJ3A 3VR4A 4O2BF 4LBYA 2GB4A 2VTEA 1ITZA 4MJ7A 1EBFA 1AF4A 2BGUA 3D7RA 4D4GA 3PZRA 1LPPA 4KNWA 1OSNA 4HPJB 1DWUA 3QYFA 5DKFA 3SEQA 4CIDA 1M2OB 4YRDA 1RCFA 1REQA 2FEXA 2Q6OA 1XTUA 2FQQA 4Z4FA 1BIFA 4I8XA 3H9UA 2Z1MA 3L7NA 4N01A 5AVXA 1HZZA 3MPUA 3KE8A 4D8TA 5JFOA 3LRTA 2Q2OA 1WUHS 1EZ1A 1S1MA 2XWQA 1JDZA 5DIZA 1KKLA 2YQZA 4GVXA 5BMVB 1IRXA 4DM3A 3WE7A 1AK9A 2XYPA 1OWMA 4FEEA 4PSCA 1A4XA 2FRXA 5T67A 2Q6KA 3OOJA 4GMFA 4FXOA 2TECE 3PIRA 4ZKEA 4ETIA 5E1DA 1NPTO 2B4TO 4BDTA 4W9RA 3S99A 4OG2A 5JROA 4CMKA 2GPJA 4IIDA 3MS2A 3R4CA 1LVGA 4XIYA 4ZVLA 4RTRA 3VMFA 4WAUA 2UUAB 1LCIA 3ZDRA 2CJFA 2M2IA 3MT9A 4IYRA 4W8GA 3QVXA 4OD0A 3OOHA 2VAXA 4RZHA 3HDQA 4TKUB 1TXGA 3RKRA 4ARIA 4HDMB 2W6QA 1W4CA 4HXYA 4R1UA 1DJLA 1VG1A 1NPDA 5TPWB 2JGAA 3OUTA 5CVJA 4XE5A 1MC4A 1YMQA 2Q7XA 1QHSA 3LC1O 1CJSA 3FMPB 3SJAA 3TNFA 3BL6A 5K0GA 5LLTA 1SUCA 4AMYA 5A4DA 1P0PA 1W4BA 3G0BA 3NHFA 4GE3A 3VC7A 1E79D 3UJ6A 2BJVA 2KS6A 4PAWA 5C8YB 2C29D 3GLGA 5AVVA 1CQJA 1KJ9A 3H3JA 3PGA1 4IDDA 5EL0A 3UKDA 1B2RA 4BZZA 4X6UA 2PJRA 4OLAA 1GAXA 1VGRA 3ZJ5A 1TJYA 1A9PA 4M36A 4LXTA 2DY0A 1JL3A 3EULA 4QGBA 2P2ZA 3LBIA 3ICVA 2RHCA 1I94B 1QH1A 3F6CA 2CCJA 2G07A 2ZRHA 3IVGA 1WP9A 1EUDA 4N3CA 2J7PA 3PGLA 1T9KA 1Q6YA 3I37X 3NORA 5FJIA 2JNWA 3S2SA 2HCBA 3V5NA 3DAHA 3A6KA 2HQOA 4DT1A 1WV1A 4PAGA 1EFCA 1DI0A 4UUMA 5TT1A 3B7PA 3E18A 1YRLA 3D4LA 3JQGA 2GUGA 3GOQA 1NF9A 3PFFA 3MXTA 2EQAA 5JI3E 4YRGA 1KDOA 1Y48E 2NO6A 4IUDS 1U2GA 4YAEA 3VSCA 4NS4A 3R5XA 1GTVA 1R0SA 2Q41A 1PK8A 2QN2A 1AK2A 1SVWA 2EFJA 2G83A 2YYYA 1WBJB 1WEKA 3HR4A 2Q3MA 3IDSA 2ZYRA 3WLTA 3DFZA 1I7NA 3AHJA 2O1EA 4CKCB 4PV7A 1XKTA 1Y8AA 3JRXA 1M9NA 2ZIZA 3KZXA 3LLVA 4H6VA 3SG0A 2OM2A 4K88A 3WB0A 1G9XA 5CXUA 3NWOA 5TRTA 5I7SA 3UAYA 1WW8A 1E60A 1Z0JA 3L92A 2J45A 4FDVA 1I1HA 2C5LA 3BGSA 4R1LA 4JVMA 4Y9DA 1E1NA 3MT0A 3F7NA 3MD0A 4M9QA 1V39A 5CYGA 5IF3A 1NY5A 1FFXB 3B1KA 3T0FA 1AUQA 1L7BA 2XCUA 2ZSHA 3RTCA 1WXXA 3W6ZA 4AKSA 1IM5A 4GOXA 4KWHA 4WZZA 5E6SB 5IN5A 3RTBA 2CK3A 3FPEA 2PT7A 4RDIA 4BNVA 1W5BA 4TMVA 2EJUA 4BX8A 2QVLA 4OB6A 5IP5A 4AY3A 5IVIA 3W9UA 3EFOB 5K4AA 5F2EA 4XSGA 3GEGA 3U81A 4R1NA 3X1WA 1V96A 4EFMA 2BUAA 2G28A 1U5BA 4B82A 7REQB 4L7VA 4TV9B 2DFVA 4RLSA 1POWA 2NZUG 4U6QA 2PSFA 4HTFB 4S1OA 5AI6A 5DLDA 1BJKA 4IQGA 2IP4A 2ZAYA 3ITEA 4Q12A 2V98A 3CEMA 4EY3A 4XRRA 1LJ8A 4L9WA 3VKVA 2CMHA 2R79A 2QN1A 2XCQA 3AFHA 4B32A 2V6BA 2WAYA 3FZEA 4N3BA 3S2YA 1KP3A 1ZLYA 4ASUD 4LZNA 4MS3B 5JYBA 2EJBA 1OLSA 3NAZA 1QIGA 1DBIA 2NW6A 1W5TA 1US8B 2FF7A 3GEDA 4BDSA 1LF0A 2J9RA 3DOCA 1I1NA 1K5HA 3JQAA 1E1RA 3GLIB 4KFCA 3SJZA 1QQBA 1NOIA 4QXQA 3F5MA 3MYYA 4V0NA 1YNOA 4KWEA 1SXJB 3DLAA 4RH3A 1W8IA 3HGMA 2P9BA 2ZUDA 5DTJA 5AHOA 3U31A 1PR6A 3GA7A 1WCV1 1YS6A 3G2NA 4QXAA 5FA8A 3HM9A 1VBFA 1VJ1A 3OICA 2DLNA 3KJZA 5ELLA 2CHVA 2NO4A 3T4XA 1TT5A 2XD9A 1BROA 4RWEA 2REOA 3CN9A 3PXGA 1ZD8A 2DXIA 2MR6A 1TECE 3GH1A 3ZE8A 2DHDA 2ZWIA 2C3OA 4GPBA 2FZ4A 1IZYA 3EXG1 4ZALA 3G2IA 3L7IA 2MIIA 3YASA 4RMJA 5JNUA 1B73A 1TA4A 4WA7A 3VTFA 2E5LB 1GNQA 4KQMA 1S02A 4QGGA 5A9SA 1OWLA 4PQYA 1QKIA 1WPQA 4D57A 1G55A 3ZWOA 1FLAA 1UZNA 4NABA 4WNAB 4MZDA 3LUAA 1BWSA 3PI6A 4D46A 1XTIA 1GG9A 4W9NA 2V0CA 2WHQA 2WNIA 4PYQA 1SCNE 3IV9A 4AYWA 4Q01A 1XQ1A 3DTVA 4ZEXA 2QM8A 2WJGA 3QVUA 3LFTA 3SKYA 3COZA 4JEHA 4D3SA 4ZYUA 4EGJA 4YRMA 4NJMB 4CL0A 1P44A 2P1DA 1S01A 1X1SA 3FX2A 3IQDB 5DMXA 4DMKA 4DSZA 4IH4A 4MVJD 4W1PA 2RHTA 3G5MA 4R7ZA 5ECDA 1Y33E 2XLCA 1AGXA 4AQDA 4NJOA 4RTQA 4UQPA 4J29A 4RYDA 3UOAB 5JJCA 2JEOA 3GFQA 2B78A 4PSVA 4U9IS 1Z8DA 2JFBA 5AJVB 4YT8A 4DEVA 4C4PA 3ITNA 3W2TA 1WF6A 5CH8A 2XNCA 1HLGA 3CB2A 3TZCA 4P36A 4ZCMA 1OJ7A 3PXCX 4FE4A 4LUCA 3IEPA 3IUSA 4KK4A 2B0JA 5A2QA 2FQWA 1QIIA 3OZCA 2JCGA 1IONA 4XOUA 1R9MA 4QPNA 1M2JA 3TDMA 5JPCA 1OASA 1CDOA 2B69A 3FGPA 4BB0A 1DG9A 3DVAB 5EMNA 3U4QA 1IQRA 1T5TA 5K0TA 4JNCA 1GL6A 1NDQA 2I33A 3E23A 4B3JA 2YVLA 4KPGA 2AQKA 3GBSA 1FMLA 1Z3CA 1V16B 2PH7A 3E7PA 4GWGA 4K9RA 3W7AA 4BP1A 4V39A 5KYKA 1AMOA 5LMNB 1DO0A 1JLLA 1V1MA 1VMDA 2PIAA 3JWPA 4GSKA 2A58A 2IUEA 4LF9B 1N2OA 2EU8A 5SICE 5ABPA 4ANFA 1KY4A 5K8UA 3O83A 3QOXA 1MJFA 1BFKA 1JEJA 1EG2A 4MEAA 4YROA 3UJHA 2JFZA 2JI4A 2QU8A 3NJ4A 1NU6A 1FVHA 1JPVA 4RA6A 4W8HA 1A4RA 4ZZIA 3GXOA 1JEDA 2NUBA 4UKDA 4E09A 5DSTA 3TQOA 4OQFA 2M9MA 4AX4A 1PJTA 2BFNA 1MA0A 4GPEA 1T9DA 3WIOA 3HRIA 2JLBA 2FZCA 4ZRDA 2C1XA 2ONYA 1DO8A 5ALXA 3K5IA 2GDJA 2WM8A 1WABA 3AEQB 3NIWA 4MINA 2VDKB 5LDGA 1O94C 3QUAA 3DUWA 4EPVA 3GVCA 5KQMA 3DUFA 4MUEA 1F0YA 4CHTA 3U62A 1PUIA 3I5XA 1T9GS 1IPHA 5A7FA 4MP3A 1F2DA 1FYVA 3O73A 2FMIA 1XPJA 1NN3A 1OGIA 1KYIA 4TOIA 4MVJP 1XCOA 3AKZA 4IRUB 1J2RA 1U6JA 2NQTA 2JLSA 4A6PA 3RM3A 1DX9A 4FZRA 4EJ0A 3BB1A 4ZAZA 1NNUA 3ROMA 1IVSA 4HS4A 1CRLA 1KFEB 2VHZA 3HC7A 4TXMA 4MGZR 5FOVA 4H1HA 2Z4TA 4NULA 4JBWA 2AD1A 3AGPA 5CLQA 1I7DA 4POOA 3GQBA 4B2PA 3D5QA 5KYNA 1JH9A 2AWOA 5AI0A 4KHZA 1T3TA 5KAMA 4CTOA 4AKIA 1WG8A 3A4IA 4XLLA 1H2AS 3EA0A 3ZNNA 1XA4A 4C3ZA 1V2HE 1XEAA 3ZQKA 2P9EA 1A1SA 4IQ8A 4TZTA 1MQ9A 4AMGA 3RW9A 3SE7A 5C4GB 2L18A 1SUAA 2BYTA 3T5BA 3VUEA 1BD3A 1IHDA 2H00A 4NBNA 2NYRA 2OGWA 3CMCO 1CUXA 2FPSA 4E0BA 3TL6A 4B3FX 3GLHE 1N2HA 3RSSA 1L8XA 3I4LA 5TQVA 2AIRA 4NMHA 4A9AA 2HPHA 5JD6A 4P4UA 5JFGA 3ASUA 2IL1A 2R8ZA 1FU8A 2OV4A 3G5TA 4QU0A 1NVGA 2PAAA 1PTKA 1AZLA 4JP1A 5FO1A 5ALQA 2F1OA 4QPCA 5SZKB 5DM60 4BLVA 3BEDA 4IGFA 3QKTA 1J9ZA 4EB3A 1JRLA 4FMCF 3UANA 3GEIA 3TVYA 4B8YA 1NHWA 5FYDA 3R6GA 4X41A 5EZQA 1B0UA 1JHOA 3M4JA 2CC2A 3DMTA 2X1MA 3PQFA 1SQ0A 5EHQA 4AVYA 3RRNA 1JG4A 1K86A 2Y27A 1EX6A 2X8LA 4CKXA 4M0FA 4DEYA 4RO0A 4O4JB 3RRJA 3DOHA 3IJEB 2V7EA 3WLFA 1L7XA 3M5WA 1V41E 5JJIA 3C8UA 3KJGA 2BBOA 1NC1A 3B1WA 3CGWA 4I4NA 4KE9A 5DW3A 1QP7A 3ED5A 4FFBA 2DFDA 4C30A 5A02A 4K6KA 1T9HA 3GPIA 5BRNA 3IVMA 2PZ8A 1MP0A 4XEHA 1Y5RA 3MSXA 5BNTA 3EDMA 2JDID 4GDMA 4P4SA 4X93A 3WQRA 1DKOA 3ETDA 1TQHA 1P8JA 3DQZA 3EK2A 4J16A 7MHTA 1KMHA 5BSMA 3OHPA 3A1TA 3M6XA 4AX8A 5JV5A 2Q0XA 2CMFA 4I4TB 5ERXA 1Z18A 1TI7A 1DIAA 2GO7A 3K9FC 3A1EA 1H65A 2H4JA 3GZ4A 4OL0A 1EFTA 3EA5A 1U7XA 3QK7A 1VBMA 2WU0A 3MHPA 1MB2A 6YASA 4PC1A 5FDFA 1VHJA 4NBSA 4PGGA 4II7A 2IZ6A 1E2IA 2VWPA 1KE1A 2ES4A 3MCWA 3M6MD 1OFUA 4KLZA 3UCXA 1BE1A 4X94A 3ZWKA 3IERA 4BFVA 4ZOLA 3EBPA 1PJQA 3L1JA 3VR4D 2QPLA 5A5GA 3A2NA 1QFZA 3DG9A 3ZKAA 2QSJA 1C3VA 5EQDA 3RTAA 1IY9A 2X9QA 5K20A 5DF1A 1YHYA 5C18A 3IXQA 2Z8ZA 2Q8PA 1RSZA 1PT9A 4FYXA 5CIQA 4OVKA 2VHTA 4ESHA 1E5LA 1NQAO 3NKVA 2VHQA 3D1LA 4U8HA 1AK1A 4EHBA 5EQJB 1NL3A 4KDRA 3UUEA 3D0RA 3PGMA 3U0VA 3EQ6A 3UK6A 3L93A 1ADGA 1JPJA 2WV7A 2EZTA 3RSZA 3SMQA 4YP9A 4UD2A 4DG5A 1PGQA 4O4IB 1OXMA 4UCWA 2GBLA 3OJWA 2PZBA 1LLQA 2Y76A 4YFVA 5ALIA 5A4MS 5KOYA 3QPBA 2QVCA 2AJLI 4EA6A 3OQJA 1CRZA 1CQPA 2ZI6A 4ND6A 2CVPA 2Q2NA 3P9KA 1E2FA 1YVPA 2EKQA 2I22A 1U4SA 4PZAA 4WJKB 3RK1A 1RFGE 3OTOB 2HBZA 1G20E 3DONA 4M86A 3FUCA 4NC9A 3KQPA 3NAQA 1GV1A 2H16A 4XWTA 4UM9B 2CLOB 1HNWB 2UVDA 1SIWA 3LECA 4MB6A 2DWCA 1VLJA 4IFEA 4L6CA 5EFZA 5FOXA 5KYXB 4ZI3A 2BM9A 1UPTA 4E1VA 2PXCA 1QZXA 3DLCA 5L4LA 1GZ6A 1U2QA 1E4YA 4YNBA 3SNHA 3CGGA 2YHBA 3OMXA 4R1MA 3A28A 4HLCA 1PYGA 4ZQEA 5DTMA 1SBZA 2I7XA 2JHFA 5IMBA 1T6YA 5FI0B 4S1VA 1T8PA 3HCPA 3RSFA 3AUJB 2HGZA 1J7KA 2IUTA 2O3UA 2RMKA 2GD2A 4HG2A 1PV1A 4I36A 2I4LA 5L3ZA 1KBQA 3JSXA 2BM1A 5B57C 1DKNA 3HXKA 3GVHA 2Z57A 3S2GA 4MQFA 1XWIA 2J7PD 4G0WA 3JARA 1P1HA 1UOEA 1B15A 4Q3DA 2JAQA 4L16A 5D51S 3RRZA 5KNDH 1OILA 4LWPA 3PWSA 4M7RA 4AYXA 2R5FA 3PNPA 4DDHA 3BS4A 4HB4A 5CNMA 5DULA 4EG4A 2N1MA 4EPWA 3W7BA 4GOOD 3QJ5A 1P75A 4DCOA 3ESAA 2BKEA 4DUPA 1H9BA 1IQPA 1QH9A 2H1LA 2IIBA 3UV6A 3T7JA 1T3LA 1XC7A 2IFTA 3W5HA 4JC4A 5KSWB 5EGSA 1M83A 1QBKC 3O38A 5LA6B 3MB8A 3IAXA 2FJ0A 2ZAOA 4IICA 3UJ9A 5H59A 3FNHA 1GADO 4OQDA 5JHHB 2C94A 3WB2A 3HE3A 1Y89A 1FDSA 4UTRA 3WNDA 4I46A 3QEJA 1TKCA 1W1WA 3I2YX 4V3BA 3SJ7A 3BJZA 4HNHA 3MOGA 1IRIA 1I4WA 3AF3A 5TC4A 3VC3A 4ZDKA 4PIVA 2CE2X 1R9JA 1N57A 1QZUA 2CK3D 4JLMA 4ACBA 4C21A 4FR2A 4EMBA 3KHSA 2GZ3A 4NEQA 4KG7A 1T5DX 3QU5A 4X1IB 4EEZA 2CHFA 2FZVA 4AIIA 4CGZA 5IDVA 1UT8A 4KYIB 3VHLB 4KQXA 4ENSA 3QF4A 3QUBA 1K6XA 3NCTA 4P93A 3SR3A 4JR2A 2AJ8A 4XIGS 4OBBA 4EARA 4GVPA 5BNWA 3OE4A 3BMOB 2ZYGA 4XRGA 3A6HA 4ZPXA 2YOHA 5EZYA 2PVPA 5HOEA 3KVRA 3SR0A 2UVPA 2A9PA 5KTPA 3G7NA 2V3VA 4KRGA 3FPCA 3OIUA 1LA2A 4UPDA 1O6GA 1NDHA 2EP7A 2DOKA 3E9NA 1JDVA 3CJRA 3UB2A 3U48A 5CVTA 3A4YA 1Z56C 3JQAD 1E1RD 3HTXA 4C6HA 1H8HA 3SKVA 3T3PB 3JQ7A 5LYJA 5H9WA 2UYCA 3RSCA 1AGPA 3O8LA 1X8XA 3UUFA 4UXIA 2FPPB 3IELA 2XWBF 5AW4A 4MPTA 3WR5A 1KSJA 3DZDA 3S8EA 1OI7A 1YS9A 1Z6AA 3B3AA 3CX6A 3CLTD 2QHXA 3QBVA 5CLJA 2V9CA 1XZNA 3EBLA 3EQ2A 1NU8A 2ONCA 4RACA 4WFKA 3WFIA 5AW1A 3C8HA 4HWRA 4WBSA 1DE0A 3S1AA 1I2MA 2XNKA 1OZ0A 4EMTA 1C3JA 2YR0A 3INTA 1NXQA 4YMTA 1NVKA 4JB8A 4KQ1A 3VGJA 1NMQA 1O57A 1Z4MA 3KYDB 3QLJA 4KQGA 4LI0A 4CKYA 5IEJA 2X5XA 1DC5A 5JZVA 1AA6A 4RUKA 5HZMA 4B3GA 3ECAA 5IT9A 4KBYA 1V5WA 3U3DA 3K70B 2PKWA 3KVNA 1UBTS 3LAWA 2VRCA 2I2CA 4LWZA 2WF9A 4FDLA 4PINA 2O2YA 1C29B 2ZBGA 3K0FB 2FZGA 2IQIA 2R8EA 3GI1A 4R8VA 1IHPA 4IY1A 2AF4C 2QT9A 3EOBI 2Y8EA 3NX4A 4H7EA 4UNIA 3WWDA 1PFKA 2IODA 2WLTA 1U0LA 3WBKA 2ZJ7A 4HB3A 4XWKA 4MLCA 1K9VF 3V55A 5FBWB 2AKYA 4XGQA 3ZE7A 4LY3A 3FJOA 3DTVD 3O5AA 1X14A 1G64A 2WD9A 2IS1A 4MQ5A 2D1QA 2HN9A 3KUXA 3PQ2A 4YI5A 2DPHA 4J7UA 1U5CA 2RDMA 4QDUA 5SY6A 2FPUA 3TQQA 2NO1A 1WHSB 2V54A 1TVEA 4AO8A 4EHAA 1JEYB 4Z1MA 1UBRS 5BSGA 4YXFA 4OLBA 3BCRA 3ML1A 2VC2B 3B85A 3LQ2A 3WGMA 4LEIA 2OXEA 3BSSA 1DTSA 3PL1A 1YJ8A 1BX3A 1AHHA 2B1GA 2CF6A 1Z6PA 3H7IA 2D2EA 4O3FA 3G0GA 5DWDA 4A23A 2AX3A 1QH8A 4ERNA 3NFRA 4YMSA 3PXXA 1W49A 5IUJC 2W2MA 1LLFA 1P77A 1ULTA 4BKQA 1Y3HA 3I2GA 1GPLA 2B4YA 3R24A 1L0BA 4G0ZA 5EKTA 3U13A 1LY1A 2VP9A 2WJ6A 1EFHA 1PYOA 1ZAKA 4Y2YA 1UDRA 3FTPA 2X86A 3OJCA 5DT2A 5IAJA 2AMJA 4WY5A 3ZZUA 5JSZB 3MLAA 4IJ5A 3BAZA 4JJGA 1NT4A 3AEUB 5GINE 1XB2A 3SFTA 3WICA 1U1EA 2JJYA 2MMGA 2ZW9A 3OLQA 4RGBA 4Y9RA 2WTUA 2RAPA 3IVXA 4S12A 1RXUA 1Z0IA 1YASA 3DPIA 3NTLA 3U7IA 1DC7A 3ZLJA 2XTAA 4UVHA 2OXFA 3HB5X 4DNPA 3L7OA 3LX5A 2FZEA 1AQUA 1P3JA 2DYKA 3B6JA 4K86A 3RUCA 3NXSA 2HDOA 1W1IA 3U44B 2AN9A 3Q72A 3DZGA 1Z2PX 4LISA 4MIOA 1PCXA 3R3UA 2X58A 5IBCA 4J0CA 1QQ6A 5HMMA 1FTWA 2WIAA 1UCFA 2W6MA 2WF6A 3VPGA 3G7UA 5F51A 1TF5A 1O77A 1THZA 4P4GA 4UDNA 3H9GA 4Q1VA 5TGDA 1UEIA 3ESRA 1RCUA 1N77A 4B4VA 2O6LA 4HATA 5P8WA 4DXAA 4X1YA 1B8VA 2IUFA 1P2VA 2O2CA 3FKQA 1YBMA 4FQ8A 4M8NE 3VOAA 4AJOA 4KRFA 1YE5A 1Q7CA 3PGVA 3E6AA 1TRKA 4EQZA 1YL7A 1J1ZA 4UDOA 3K6JA 2Q0SA 2JGKA 3EARA 4JVOA 4JI3B 4V0QA 3AHGA 4A5OA 2WKPA 1WY5A 3DT6A 1U94A 1M67A 2BC9A 3DEKA 1MXHA 1SHZA 2DPGA 3H6HA 3RB8A 1VI6A 2JAWA 1POXA 4GPTA 1SWVA 2HIGA 2AE1A 5FPQA 5D84A 1NW9B 5C37A 2I62A 2J0EA 1U8AA 3BHJA 1DZIA 4V1CB 3I12A 2F3SA 3VR5A 5IH7A 4QREA 4X65B 2EFGA 5I7UA 1JFSA 1PKXA 4ISBA 1XDSA 5JXJA 3C4QA 3R77A 1X94A 3AM5A 9MHTA 1ZVQA 3LGAA 2BR3A 3TD6A 1E5TA 2JGDA 3CZAA 3MRTA 2ZXUA 2QPAA 2REQB 1XU9A 2V6IA 1U0JA 1ZKMA 3KV3O 5T64A 4DLTA 1X7YA 1RM4A 1V5IA 4URWR 1XNRB 3NUGA 3A11A 3FM9A 2J9XB 3QVVA 4IG9A 3ZBUA 2WZBA 4ZYXA 2ZAGA 2QQEA 2Q8QA 4KQ6A 4C89A 1TCCA 4E2WA 5ED4A 1K4KA 1GM5A 1NR5A 4AJEA 1J49A 1QRUA 2X41A 3HDGA 4INPA 2QZJA 3HADA 4KXUA 5K5EA 5LP6B 2Y1EA 1GTRA 5H02A 1Z0ZA 2OR3A 2P6UA 4Q3EA 3P7MA 1LRJA 1SUSA 4DA8A 5F3WB 1KXZA 3JU3A 2DX7A 1I9CA 821PA 1OBHA 1NVWQ 1T26A 3KNZA 1TUIA 3T1TA 4YRZA 5JWRA 2ZUVA 3GARA 1L3BA 5C5CA 2XCTB 1C3OB 3DDHA 4XYLA 1TK2A 1XHEA 4OL9A 1KAGA 3SZRA 5JAPA 3NHPA 4NYIQ 3OLVA 3DDZX 1X8KA 2IEZA 2CVOA 4ER7A 4LX0A 4Q7LA 1R4MA 1IG3A 3GVPA 2RKOA 3S29A 1O0CA 5EMJA 1VLMA 2LKDA 3NQ41 4I9HA 3D6AA 3I1JA 3AJDA 3PKZA 1W76A 3U49A 3WZMA 5ADUS 2V5AA 3W5DA 2NVUB 3DH0A 4EHLA 2OFFA 4CMIA 1SD2A 1XWWA 4RPKA 2GEKA 4I55B 1M75A 2WABA 4UHBA 4H0NA 4U7FA 3S2FA 1ZAYA 3RIGA 1AHIA 3UZUA 3CCCA 2IOQA 1DV1A 1EHYA 1PLLA 2NVOA 3OQIB 3ZQ4A 2C7PA 1KDTA 2JI6A 2JRCA 5FNVF 5LL6P 2QU7A 3L18A 4JR0A 3C45A 5JDIC 1V8OA 3WRVA 4JQOA 2RB5A 4I3GA 2QRVA 1XTVA 4YLEA 2EKBA 2ZDGA 2W2TA 3CKKA 3IESA 2IEYA 3Q4GA 2AOTA 4IGKA 3BN3A 1HORA 2VP6A 3VYSB 3GFSA 4NEGA 4C0WA 4D9HA 4FP9A 1E66A 1RS0A 2AKAB 3S68A 1PAUA 1U7UA 4BVBA 4EG1A 3CUEF 5CG1A 2HC9A 3FTFA 4G4IA 5ALWA 3GZNB 5BWLA 3IA2A 1IATA 1Y8QA 3CSSA 4FEGA 3WFZA 3MTQA 1XZPA 3DL4A 3TOCA 3RTDA 3FCSB 3AYXB 1KC1A 1MFZA 3OWOA 3PJRA 1XTJA 3M0EA 4ZI2A 1VKOA 3C4JA 4MYDA 4YQZA 2FZKA 1SU7A 3WWYA 4LGVA 1V25A 3Q7TA 1I7PA 1K3FA 2QORA 1CV2A 2VCEA 2IKSA 4JJIA 4CV1A 5I3ZA 4FWBA 4KXMA 2AG8A 1V7ZA 3AQ4A 4BNHA 2A35A 1FMCA 4CF5A 3PS9A 1X8JA 3KAKA 4TLEA 3E22B 5GJVC 2X76A 4GEKA 3TL2A 4A2CA 2XQVA 1MXFA 2VYFA 2ZYTX 3HB7A 3THRA 2H5EA 3TRJA 2VYQA 4BRSA 1KYWA 1ZVJA 5GGYA 4K1XA 2AFHB 1X1RA 3KOYA 1OV6A 1GZVA 1HDGO 4RHYA 4R2JA 5LXTF 1V1JA 2QM0A 2PSJA 3WYCA 1PL6A 1PQYA 4JGBA 4QGAA 1Q17A 2A94A 3ODPA 2R66A 1CF4A 3NGMA 1PJLA 3WLKX 1HRDA 3GNQA 3MWGA 3TOSA 1CYDA 1JG1A 2D1SA 2FPIA 3AM1A 2CVFA 4XQGA 3K53A 2NVBA 5E0OA 2O0KA 2HSDA 3IAS6 3L7JA 3OCWA 3VYWA 4CBVA 4CNBA 2W2NA 4YRBA 4CCSA 3KR0A 2F43A 5U4XA 1QVVA 5JFTA 4WDRA 1AY0A 4I1SA 3KYIB 1PR3A 2O3JA 4M9CA 3UMYA 2DTEA 2QVXX 2PKCA 4BAUA 2KLHA 1TZKA 2A5DA 4YN3A 2HH9A 3VDMA 3QUQA 5A0TA 2QPOA 3ZOZA 4PO3X 4HB0A 5KSZA 2D3WA 4ZTBA 2QTVA 3D3WB 3EVGA 3PPWA 1G5RA 1L5ZA 3S70A 5HRAA 3SQOA 4CFYA 4B7ZA 3MJSA 4KXXA 1BA2A 2DQSA 2X6TA 4NFLA 2WICA 2QTGA 4ZO8A 3I05A 2R2GA 2IPOA 4K6GA 3K4PA 3JZFA 2BEVB 4H3VA 3AF4A 2G4VA 4EW1A 4RFLA 5ED0A 1QKJA 2QRMA 1VYUA 4D3DA 2XAAA 1YRYE 2BTEA 3OPQA 4X5OA 2FZ5A 1V4BA 2Q27A 5EGNA 5HTKA 1KMQA 3ZUPA 1JFLA 4M1OA 1Q19A 1YH3A 4ZHQA 2LW7A 2OBXA 1SH7A 2JIDA 1Y1PA 2QKYA 4PZDA 2NZJA 4LKOA 4UTXA 1Q15A 4FOLA 3BAFA 4JLDA 1JJ7A 3C98A 3DXZA 2AX4A 2CB9A 2X3YA 1KZGB 2NZYA 3KDPA 4G4SO 4RHTA 4UHJA 1EWYA 4UAUA 5KQSA 2J5KA 3CX8A 4RVHA 5DI9A 1IZ7A 5AKIA 1O87A 1CVLA 4J90A 4WHMA 2GHTA 2I1VB 3BB4A 1Q14A 3W8RA 3Q2IA 1ZICA 3LQYA 4QOGA 5FEUA 3RYCB 5TR9A 5L7TA 3N0XA 3U7FB 1U7ZA 1WP4A 5CA0B 2GJ9A 4X92A 3RUIA 1CY0A 3EW9A 3H0EA 2R8RA 1NBME 2ZTUA 3N39C 2HHJA 4NE9A 4RA9B 3WIUA 1T2DA 4KH0A 1KEKA 1BE0A 4J0JA 1EESA 4PGAA 4L8YA 3OU2A 4Q1BA 1S96A 4AB1A 2HUPA 3C1UA 4NHEA 1QG2A 3OTIA 3TAUA 5JAHA 2QQ5A 3KSAC 3JQ9C 4TWZA 3R3HA 4M0KA 4LC0A 2EFHB 2VLBA 2O0MA 1QX3A 5B7GA 3PFHA 5EYPB 3EN0A 4DNXA 2ZRGA 2C2GA 2WJZB 1DT5A 1JJVA 4MLDA 4ERXA 2R85A 4R1OA 5GV8A 4UCFA 4D3FA 2XGGA 4E46A 5AOVA 1Y5NA 3BWXA 3Q88A 4IQ0A 4ND5A 4WZBB 4FSHA 3I45A 4E30A 2ZJYA 2H3EA 4TXLA 5EE3A 3HA3A 1SN7A 3C3YA 5FBLB 2RBKA 3CTMA 3TFWA 1P1RA 1MRSA 1P0QA 1XLWA 4WT7A 4DV1B 4GKVA 1Y1TA 3LK7A 2D74A 4Q4JA 1KEWA 1TCBA 2XCRB 1W6RA 1J70A 4GKBA 5EP4A 3HO1A 4J43A 3ZY5A 1M6WA 1BE6A 5F23A 1TK3A 1CHNA 1Z28A 5DRYA 1NI3A 2OOSA 1NUQA 3ZHVA 1L5FA 1H8HD 1OZHA 2W6JA 4Y9TA 1T35A 5GY7A 1LWOA 1JR3A 1N7IA 3LX6A 2JGLA 3OZDA 2AK2A 4X3OA 4YMHA 4LC9A 5CX1B 3HYSA 5EHGA 3CEHA 1KNQA 1E5QA 1M0TA 3RUEA 4U39A 5I48A 4DC1A 3FPJA 1QP0A 1ISFA 2G77B 4MAMA 4KDFA 1H6CA 3K15A 4S2EA 3NTXA 4RKEA 1HE3A 1YZ3A 2XXJA 3TBKA 2COKA 1PNQA 2A4MA 3OG9A 2XVXA 5DCWA 4N48A 2MT9A 2FWIA 2NVWA 2OOKA 5LMUB 1IY2A 4AQYB 4NXMB 1S2OA 3MIZA 3N0WA 4BU1A 3EVAA 1VI5A 3LUPA 3UK0A 2XXAB 1JGTA 1PTJA 1ISIA 4NECA 2NGRA 2VRCD 4RJJA 4CU5A 4MQMA 5CXQA 2DFPA 2WHEA 1J0XO 2CNWA 4PSDA 1NSTA 2GLUA 2BEUB 1RD4A 2VDJA 1GIAA 3OD5A 3IHWA 4FGZA 3RV4A 5JH7F 1RHKA 1GILA 2WFLA 3HJRA 3QX8A 2OV2A 3TQIA 3RYHA 3QLEA 3KT3A 5I7OA 3DNFA 4ZYTA 5CGZA 4N03A 2XUHA 1M2KA 3R7AA 2WJ3A 4CUKA 8AT1A 4C4RA 4BBAA 1ADYA 2IYEA 4DMLA 2PL3A 1ND5A 1VXRA 4L9RA 2FPWA 1GTJ1 3DOFA 2PYIA 2RHMA 3OFNA 4RAOA 1M34B 4O02B 4IEIA 5HJ5A 3TXAA 2QTMA 4RV4A 1EZZA 1C1XA 1BVHA 5A6VA 4Z1MD 1N0HA 2YKGA 2R97A 1JFFA 4HRXA 5L7YA 1YIDA 3PNVA 1L5WA 4YJ2A 5JEEA 1TGVA 1N6NA 4YCAA 4FN5A 2D59A 2CLEB 1LF5A 3VO9A 4E32A 2I80A 1K6MA 2EYQA 1KSGA 3VR6A 3CRRA 1R66A 1HF3A 1E2NA 4N5MA 4BUCA 4CODB 4DJDC 3MIIA 3ZU3A 1LEHA 5C52B 4NNOA 3O8BA 4NHOA 4NK4A 3FG9A 4QQNA 1H0RA 5GOTA 1DRVA 2XRMA 1C14A 1Q84A 3HXTA 3SYRA 3TLBA 4I7EA 3QTLA 1NVVQ 1AXEA 4F6RB 3QNUA 3L4EA 4FXPA 3D6JA 5DYGA 1DTEA 2GZ1A 4C5AA 1Z45A 2R6ZA 3A70A 4JBYA 3RFCA 1IC6A 1W1UA 1GZDA 2IZ5A 3IP6A 3JS5A 2YRFA 4FI3F 2CY0A 2HU8A 1I80A 1W46A 2YIVX 1XZJA 1WZNA 3QEKA 1TO2E 2D0DA 2ORIA 4XM1A 1NFFA 3HZZA 1J4AA 2OGUA 1ORWA 1NW4A 2Q6LA 2WFZA 2XNHA 3DWFA 4OK6A 4R9SA 5CT4A 4IIUA 1QK3A 3KJXA 1T0JB 3RHZA 1G63A 2HBRA 4G56A 4Y9SA 4ZAVA 2Q4TA 3WADA 4AUNA 1ZJWA 2G1JA 4TUYF 4PQGA 5CFNA 5G0VA 2VDMB 3C3AA 2W71A 3CKLA 2IZOA 1Z22A 5FAXA 1KVQA 4DBVO 2X4IA 1R6BX 5DLEA 2VHUA 3ZHQA 2ZR7A 4KNYA 1G2PA 2OO7A 1TC2A 3I1FA 3TRFA 1QB7A 5ITWA 4Q3AA 1N92A 1DOHA 4ZRNA 4P8RA 2ZSIA 3PJEA 2H2FA 3VTZA 1JFRA 3Q5GA 4ZAWA 5HDBB 2QRJA 2G5PA 2DPMA 3WL5A 3P2OA 1CZOA 3WXBA 3JZDA 5EIOA 3U09A 2BCEA 2BHTA 1P61B 2D2VA 3BSYA 2HIHA 4ZJUA 3NNNA 3KQNA 1SOVA 3VDXA 2VN8A 1DJOA 2POCA 2LDXA 3JQFA 3RS0A 1E98A 4EAAA 1HO3A 1E0KA 1NMSA 2GBCA 4AN1A 2WT8A 4QPZA 4EO9A 3WL8A 2JZOA 3ONFA 2X9LA 3OZXA 3NDJA 4FFWA 4XLTA 3BVPA 3ZNOA 4FYVA 5K0FA 2W6ZA 3QQPA 4NRDA 4EI7A 1PR4A 2BAGA 2P9JA 1VJ0A 2PWYA 2Y1XA 5EMMA 5JUWA 2OAQ1 1X13A 4X54A 3ZU4A 5BUCA 2V7PA 1P2FA 5CW1A 5CT8A 1A5AB 3FJ1A 4TT8A 3RIYA 1NG9A 5AP9A 1F8UA 1TMKA 4PTZA 4QEKA 2NX2A 4QJBA 3LZCA 2OCIA 3VR5D 3ZJVA 4MTLA 1EHCA 1E63A 2A0YA 2ZG6A 3CLRC 2BFOA 3JALA 4N5LA 4OU4A 1HNXB 1PYDA 2DZDA 1MG5A 1RADA 1RLMA 1AO3A 3A3NA 3BQ9A 3K1YA 4YUZA 3ZWPA 1JEQA 4INZA 4WFIA 3RJ5A 1DS6A 1L5QA 2A0UA 1E3IA 3B48A 3HZRA 3MCAA 4I3HA 3W8EA 4B6QA 3ABSB 1K68A 5IBRA 3TE7A 3VMMA 2ZREA 4V38A 5BT8A 1QPGA 3P2MA 3KZVA 3GR6A 4Z9FA 2J3KA 5HCIA 3IMEA 2PKEA 2ZB7A 1EFVA 3CKMA 1LNQA 3CF4A 4E12A 5EWJB 2QP9X 2VAVA 3LHIA 1CUJA 3UB4A 2FYTA 3W8FA 4BKMA 2ZM5A 4BE4A 4KXFB 5ER6A 3Q8KA 1QVAA 2F1IA 3NGLA 2IU6A 3D6FA 2VP4A 4FQ7A 3C97A 4B6FA 4M1KA 2ECKA 2QW8A 1HTWA 3G5AA 4ZCSA 4PGHA 5J2TA 1RBYA 3E5RA 4CN9A 4F2HA 3CISA 1X3SA 1KETA 1WCWA 2E4WA 3JYOA 4QGSA 1LZKA 3EQ8A 3U9TA 3MFQA 1LNZA 3LT4A 4JLJA 5G2OA 3WOVA 1VBKA 1Q91A 4OY3A 4GC9A 1AHPA 1PNRA 2WPDD 3PFBA 3FDJA 3ER8A 4F96A 1KIAA 2QJWA 3H1TA 2H51A 1ZUD1 4BPBA 3F6SA 2P2LA 1QIHA 3HL0A 2FX2A 4JKOA 4RCYA 4TKZA 4MV4A 2CYAA 5COBA 4E13A 1NR1A 5PNTA 1X1QA 3EPLA 1YQQA 2FJUA 5KPJA 2VXOA 3F0TA 2C9MA 3EQZA 4MTCA 2JJ1A 1A2QA 3QI7A 3QYJA 4LOLA 5FB3A 5K3AA 3H75A 3RNLA 3SQLA 4P22A 1KPGA 4ND8A 4LMBA 3USZA 3WHLA 4K9MA 1LDMA 3LXUX 4XIIA 1Z82A 1EVZA 1R1DA 3QV2A 1N5OX 5DM4A 2WWRA 3UUGA 2WF8A 4LZLA 4EQ6B 4DLNA 1WWKA 4L4YA 4PF1A 4YASA 1AZSC 1WVIA 5H82A 3AEYA 1PT8A 3CRZA 4C2AA 1Z36A 4K9QA 5GJWC 1J33A 1N2XA 5L4NA 1UKEA 3CNEA 3KBOA 4CETA 3MF4A 2R7KA 2WJJA 3OKPA 1BQEA 2GDZA 1C0KA 3R3JA 1UXIA 4PLHA 4YDQA 3Q9SA 4EL0A 3NBKA 3IEVA 5BOVA 4HBGA 3THXB 1N0VC 1ESNA 1KO1A 2BCGY 1C3XA 3IDOA 1U81A 4MW9A 5HDQA 1E64A 1LDBA 3WDLA 4JH0A 5BURA 3H1AA 4I4CA 3MTAA 1YGYA 1AV7A 4KI0A 3EH1A 1U3DA 1O03A 3LQRA 3P0JA 3UGTA 1TQ6A 4RY2A 1C2YA 1FU4A 2II6A 4ML3A 2J0VA 5JQGA 3LP6A 4N5IX 1NVEA 4K3UA 5DGIA 5LSAA 2I4MA 4LCEA 3QKRA 3K9NA 5K0NA 4U02A 2ZWPA 3DDSA 2JAPA 1ONBA 1E2QA 3RBVA 4LN1A 4Q82A 3N8NA 5I9MA 3G1TA 3CSDA 5MFZA 5K45A 2G1KA 1Y1QA 4AMUA 3U16A 1QNLA 4GR4A 2H7XA 4FNAA 4MSUA 1JMKC 4M38A 4F38A 4JYPA 4RULA 5CFLA 1Q22A 4F5EA 2L0XA 1GGNA 3D6UA 2WWFA 5L8VA 1AQJA 2IGBA 1Y7HA 3C5HA 4B7XA 1UMCA 5HJ2A 4LJYA 3ITDA 2AG1A 1GUDA 4KE6A 1A97A 1RNLA 1Y4AE 3MAJA 5DCUA 2H65A 1I5RA 3LCMA 4U4AA 3WBBA 1OXKB 4M21A 3AINA 3PNQA 4MUYA 3PYLA 2V3WA 5K3BA 3EPPA 1EA7A 3TR0A 1YBHA 1FNCA 2YN4A 5E0KB 1JKJB 3PE3A 1OA1A 1ZM4A 4P98A 3K6RA 4P83A 3OFJA 4NR0A 3KOUA 4CI0B 4EJSC 1TAHA 1WW3A 3WMEA 3MMXA 3R09A 4OUKX 4UAJA 4D9MA 3KDSE 3E7DA 4DA4A 1B8NA 4FK8A 5DHQA 1KJJA 2YFKA 1J0DA 1G17A 1UBFA 2HJWA 2YWGA 5EIBD 1KORA 1E2MA 1VPLA 1OFTA 1YVDA 3KFVA 4MPDA 4C78A 3MBKA 1CW2B 4UVEA 1YDHA 5BPHA 2C5EA 3JWJA 4F91B 2FKAA 4J7AA 4D7AA 3T15A 2Y9PB 4BNDB 4FMDB 2C5BA 4MWSA 4ARZA 4QTYA 3F4KA 3JQBC 3AR7A 2YH2A 4WEQA 2ZRLA 3ZY2A 4D0NA 1H42A 1PGJA 1OB5A 1T10A 4PX5A 2J1LA 2FN3A 3H0KA 3W5IA 4XVQA 4HJXA 4DAOA 3WNCA 8ATCA 2C8JA 3EC2A 4IIGA 4Y2HA 3K96A 3IAEA 3MPOA 4XWYA 1LJUA 3DAYA 3JSAA 3QNMA 1FU7A 4JQSA 4ZGBA 5C5EA 2EJCA 1KEZA 2ZQYA 1OX6A 4B8WA 2OPBA 2GPWA 3AV3A 4GP6A 3ZYZA 5B1YA 4M60A 2LNDA 1D07A 4I0WB 4AUKA 2IHTA 3CT6A 3IH5A 1USVA 4R1PA 3RNOA 1DQNA 1WR8A 4JYZA 3EY4A 2HHCA 2ET6A 5I9IA 2XRYA 1JEOA 1M6VB 4JI0B 3WLRA 4FJ1A 2H07A 2QBYB 4WKCA 4JENA 3FI9A 2HNKA 3PD0A 4ZQGA 3PUZA 3WV5A 4A3SA 1Z0AA 3OQBA 1IWBB 1OR8A 4TRMA 2I3GA 4KPFC 3ESCA 1ZYUA 4MR7A 2BMWA 3W3AA 2JD0A 1FDIA 3FBGA 1JG3A 2Y99A 3FNQA 4DCPA 1TVMA 3PHGA 3M9WA 3Q40A 5I7EA 1X1AA 2VPZA 3UCEA 4L4RA 3NJ8A 3KXIA 2CL6X 1JQ3A 4LGYA 2EBFX 2FFBA 1LQTA 4LCJA 4BGDA 1VG0B 1YRAA 1ZBQA 1GR1A 4R9RA 3LZDA 1ZUNB 4P84A 2PM8A 2I0FA 3FGZA 1M1ZA 3MFYA 5DHFA 2K7ZA 2VSFA 1Q7EA 4FOTA 2CXSA 1JXMA 2WSLA 2YHSA 2E4VA 4UEQA 2X2OA 5DHPA 4XVHA 1P7ZA 1W4RA 2WU1A 1JI0A 1D3AA 2FWRA 3O8QB 1QCCA 1S7CA 4JB2A 4K03A 4XWAA 1T0BA 2DETA 5IZ4A 3CG4A 3O93A 5GJBA 5C8YF 1UF9A 3CUSA 3HDHA 2ZPTX 1XEXA 5DEOA 3ND7A 5B1HA 3TTXA 4IHJA 5BUQA 2W6JD 1B8PA 3FLAA 3N58A 1U0RA 1Q12A 2O2XA 3IA7A 4KO4S 1JR3D 1YVUA 3FWZA 3W9YA 5E6RA 2WB4A 3BERA 2QLMA 3S27A 4Z5XA 4E1AA 5EIEA 4ABTA 1V26A 4FT4A 3TIFA 1QYCA 1NKSA 5ERYA 3EC7A 2E5WA 1I2ZA 3KOXA 2ZE5A 4W1SA 1VL8A 5E8JA 3PQ6A 3SCZA 3UG6A 2EV9A 1YR9A 2OWEA 3BIXA 1XMSA 3MTIA 4OGGA 2XE4A 4EG8A 1L7PA 3CX4A 5SZHB 1A2BA 1CZNA 1DJNA 4LZWA 4BVEA 1O6CA 1X7DA 1LSSA 3EGOA 2NAPA 1T1GA 3EZFA 3KKOA 1NI5A 5CFZA 1Y9DA 2C1EA 2Q9BA 3EIOA 2Y2VA 4UBNA 3KZNA 4UOZA 5DBHX 2WUDA 2VHYA 5IM4A 3DCNA 2WA2A 4IOKA 4MPPA 2DU8A 1O5TA 1PRYA 2IYPA 2PVCA 4HDCA 2CNWD 1R6VA 2YJNA 4M87A 3D4PA 5E4TA 5IFKA 4YDHB 4UCXA 2ZIEA 3I9JA 4TX1A 1FNMA 5CFOA 4TL8A 2PMDA 4J49A 4XXHA 8ADHA 5TEWA 2YX1A 4NPCA 4EPXA 5FUBA 2D5IA 4GW3A 1H1TA 2XZLA 1TUGA 3LVQE 4WZAB 1KK0A 3Q2KA 3DVSX 2CNNA 4D9NA 4JSRA 4TKUA 4X00A 2C9DA 3H8WA 1ESDA 1CUCA 4HZUB 5ICSA 5FTJA 2BFBA 1IJFA 3CINA 1FXWF 5TPWA 2FFRA 3UTCA 3ZGYA 2ZYIA 1IDN1 3AF1A 3PGKA 2ORED 5JATA 5JC1A 4CKBB 5HP4A 3RF6A 3OFND 1SKMA 1YTUA 5BWMA 1NURA 4EHHA 4F04A 4LW8A 3U40A 1JEAA 4Z7JA 4BCBA 1EZ4A 2ODNA 4AT1A 3TDNA 2YW2A 3GRPA 4QYMA 2A5JA 3L7AA 3OETA 4JKIA 5F2OA 5B3JC 1OF1A 1ONNA 3AERB 1STOA 4RK5A 3HJFA 3BA1A 3VR6D 3X43A 4RK4A 2PZKA 2H2AA 4WXRA 4CMEC 1U28A 2RH4A 5CFMA 3AR8A 1P4RA 2NPOA 3PVZA 1MAAA 1X7XB 2YQ5A 4QJ4A 1NXVA 4PR0A 4YMLA 1C1DB 2VSOA 2R47A 1YR7A 2C7QA 2OENG 1NBEA 3RSOA 3ENNA 1EM8A 2ZCJA 5I9TA 2VT7A 4PG4A 3AIOA 4FD3A 1R50A 5T4BA 4DE5A 2ZZMA 2QSYA 1ZNYA 3IKJA 3RJZA 5G3YA 1JLSA 5CRIA 1JZQA 4GLBA 4BQQA 3GMTA 4OM8A 5DTEA 4L72A 1IE3A 4OHFA 2OP0A 3AUUA 4EA7A 1PZEA 4B3TB 4C6TB 2BKXA 1FL9A 1VB3A 2O8BB 1DINA 4WESA 4EW2A 2QB5A 4EZEA 1ENPA 5C5DA 1JR2A 1FA9A 2CXTA 4MOWA 2JKYA 1YJ5A 1I8TA 2H5JA 3U7RA 2AFIB 4BNMA 4GXRA 3O8DA 4JOSA 2ZUBA 4CUZA 1UUFA 1MB0A 3QUTA 4DZRA 4NPAA 4YUYA 4D9JA 3LKBA 3HB0A 3K0AB 2AZXA 1OAAA 4BGEA 4US0R 2BBTA 3DBRA 3EHDA 1AHNA 1WHTB 3KZKA 3SX4A 4BVAA 3I9FA 4CT4B 5DV9A 4ENQA 3D4OA 2Z5VA 4DLRA 5KJFA 5EZSA 2IDJA 4HADA 4F93B 3BFPA 3ELWA 3DC2A 2PS0A 1A9QA 4ZC1A 1A98A 2K2QB 1U0HC 3CEJA 1F2UB 1NJ6A 3FHJA 2A1TR 1NBAA 3WIVA 1UIMA 4S35A 3ZDFA 5CTJA 4E2FA 3WL6A 3FSRA 1E9DA 2QN8A 2YXDA 3B2QA 5ETJA 3HDVA 3IIJA 3V4SA 1V4NA 4E21A 3EFOA 5K05A 4OQ4A 4YJGB 1M7GA 4CLOA 3CZRA 5AW7A 4Y6QA 1CR0A 3IP7A 3TLAA 3H11B 4TV9A 3QP9A 2WE7A 3WHPA 1I7QB 1O94A 1V43A 2V1XA 4G9EA 2H9YA 2ZRIA 2GVNA 3DBIA 5HCUA 3LM8A 3MINB 1GZ4A 5B3KA 5E4YA 1UM8A 4TMZA 5CU7A 1YZNA 2QENA 3G2KA 2PKQO 3HDJA 2X0FA 3ROZA 2FMFA 4MA4A 2ZANA 1Y8ZA 3IAHA 2B7CA 4MS3A 2C2HA 3F46A 3UQZA 5GONB 2NP6A 4IDBA 4PX9A 2GCGA 2LR0A 1RYYA 3QELB 4N6OA 4A0HA 3GRFA 1V8FA 3JZMA 3GLIA 2O7NA 1G6HA 1GG8A 2PUHA 4E2ZA 4QAQA 2QK4A 4JUCA 1ZCBA 4YC7A 4XJXA 1TX4B 1MIOB 2ZJ2A 5EQTA 4QDTA 4GM1A 3GROA 1MB4A 4FS3A 5JEDA 2PV0A 1KMNA 5K2MA 4EOGA 1PR9A 5CBPB 4LOIA 1C80A 1PWEA 3R0ZA 1NMYA 2XF2A 1YS2X 4NU5A 5GM1A 2HTEA 4HX2A 4JOQA 1K8YB 2FUNB 1A2KC 3TW8B 2JLRA 1CF2O 4PFKA 2D00A 1QC5B 1GAJA 4YB8A 5J4KA 1RYHA 1EBUA 3HMQA 1KYVA 3W78A 1ABBA 2WWVD 4DVJA 2PDAA 2P4UA 2RJNA 5G4KA 1GTMA 1G3IA 2GZSA 3D7NA 5E4FA 2I1WA 2QP4A 4LF7B 4BIIA 1Z7BA 3UAOA 3KT6A 4QOEA 2A0WA 5CLIA 3FH0A 3RYFB 4A0RA 4WNAA 1K9SA 3U26A 2N9UA 2DBRA 3DR3A 2EAUA 2AF3C 3CLKA 3NH9A 4KB5A 3WK4A 2R65A 1WB4A 3OLCX 1G2IA 2P9FA 2VIIA 1R12A 5DM0A 3UA4A 2JJ1D 5DPMA 5IRCD 3LTNC 3WYAA 1XF1A 1NBHA 1D9ZA 2GQ0A 1I3LA 1VI2A 4G85A 2B92A 2VP0A 4G86A 2ORYA 4UVGA 4G67A 1X19A 3RSHA 5L3QB 1O5IA 3FUUA 4WGGA 2JBAB 3OT4A 2WD8A 2QR3A 3LWBA 5ECYA 3VHXA 1G4AE 3GJ7A 3I52A 2EG5A 3FZNA 4JT9A 3SQXA 1FRVA 3TI7A 5CA1A 3KALA 4H7JA 4E08A 4B34A 4DGQA 4RTKA 3LBAA 4Y3UA 1CX9B 4N5NA 5BYBA 1CK4A 3MWYW 1UWLA 2Q1YA 1GGJA 3Q3JB 4LV5B 2PUEA 1YB7A 3Q8XB 3B5IA 1QU3A 3U1VA 1I10A 5AWFC 3V1NA 4KREA 1IN8A 1M0WA 2K7FA 2QAGC 2R68A 1GNPA 5JPIA 4HDSB 3GCGA 3MUOA 2O7RA 3NHJA 4N9WA 4IRXA 3DVAA 1TYEB 4RKWA 3BRWA 4BECA 1T2VA 3DD1A 3T8YA 4EVSA 1MAWA 1DC8A 3OMWA 2AMLA 3PCRB 5DNCA 1EWTA 2FEMA 5CPBA 5LOVA 4E4RA 2HDWA 4FGWA 4CKEB 5CDUA 1SCAA 3HA2A 3F7MA 4QUJA 4D0GA 2IHJA 4HH0A 3EIHA 1G60A 3NTVA 4HDNB 3A2LA 4I5GA 1AZWA 2FSPA 1AKYA 1NC3A 3W6UA 4K9LA 4LJ7A 4M22A 2CEAA 1W5SA 3O4FA 3F6BX 5FHRA 3ORHA 1THTA 2AI3A 1T5SA 2C2WA 2C4HA 2WYVA 3AWDA 4G25A 1Z07A 1O96A 4V0MA 1PR1A 5IAGA 4AMBA 4GOKA 3L2OB 2ZUEA 1JA0A 3PC4A 3T5TA 3ZDCA 4LE0A 3C1TA 2ZI4A 5HM8A 3CRNA 1KR5A 4E2XA 4URVR 1QRAA 1Z2AA 2XQGA 3EEIA 1RRCA 4G8JA 2K2WA 4FE7A 1ZA2A 1UQUA 3FPHA 2VNSA 2PG3A 1I3NA 1KHTA 4KKXB 3WB1A 4DR2B 4XGIA 2XIJA 4BN5A 5EJ6A 1UQTA 1VE3A 2R8BA 1GGFA 1EGHA 1ZUHA 2R6CA 3AEQA 4KX3A 3BTVA 4LBZA 1L5HA 3RSGA 3DULA 2BV3A 2EWWA 3GZTB 1G0NA 3N6VA 3SBDA 2CSUA 4MWOA 2V55B 4UXHA 4JJZA 3ASZA 4LXHA 2R7LA 1ML3A 4C22A 2WG2A 1LUAA 1R9GA 4KV7A 2FEOA 3OM8A 3I0NA 1XVIA 1P0FA 5ALPA 421PA 4N7RA 3IXMA 5DLYA 3UM9A 5I45A 1CIPA 4MQ6A 4W5TA 1A4UA 5FO0A 4B5LA 4DWOA 3OECA 5DRTA 5NLLA 1PHPA 2VUHB