2WJAA

Crystal structure of the tyrosine phosphatase wzb from escherichia coli k30 in complex with phosphate.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
152
structure length
146
Chain Sequence
PRGSHMAKLMFDSILVICTGNICRSPIGERLLRRLLPSKKINSAGVGALVDHAADESAIRVNGLCLKGHRGTKFTSALARQYDLLLVMEYSHLEQISRIAPEARGKTMLFGHWKEIPDPYRMSDEAFDSVYQLLEQASKRWAEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Wzb of Escherichia Coli and Cpsb of Streptococcus Pneumoniae, Representatives of Two Families of Tyrosine Phosphatases that Regulate Capsule Assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords PUTATIVE ACID PHOSPHATASE WZB
total genus 48
structure length 146
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wjaA00
1AB6A 1YTUA 3A10A 4RV5A 2PKXA 1C0EA 2CHFA 4UHKA 4D6XA 1BA2A 2KYRA 1YS6A 2IKSA 5FBHA 4W5TA 4ML3A 4N76A 2ZWMA 4PICA 4RY9A 3KYJB 4ZJPA 5TQ2B 2XDYA 1HEYA 2FEKA 3LFTA 1Z12A 2FVYA 3N75A 3O1JC 2IDMA 4FB4A 1XWWA 1Z2EA 3JTEA 3BRQA 3CRNA 3IP5A 4IMJB 3RQIA 6ABPA 1RPJA 1DBWA 4RK6A 5BRJA 4LX8A 4B09A 2WJAA 4QICA 2QZJA 4XLTA 1IIBA 2PJUA 2QV0A 3QK7A 3T95A 1JFTA 4KVFA 2R47A 4NICA 3IP9A 3HXMA 4XASA 4ETMA 4W5NA 1H9CA 3FGZA 1LBHA 3QEMA 2LP4Y 2RDMA 4N0PA 4G0XA 3O1HB 4Q6WA 1OXBB 2PUEA 3H1FA 4O1IA 2YHAA 2IPAB 3I5AA 4YR7A 4TMYA 3F73A 3LUAA 4RK0A 3CTPA 2MSWA 1ZN2A 2MSKA 5IULC 3C3MA 3GYBA 2IPNA 2GWRA 2PAFA 5PNTA 3JVDA 1YMVA 2CHEA 3FMVA 3TX6A 4W5QA 2WRZA 2NUBA 3SY8A 4Q7EA 1YK1A 2RJOA 4KMRA 3H5WA 1LJLA 4IGAA 1MB3A 3MM4A 4NCBA 1PHRA 2GI4A 1DZ3A 5EWLA 3C6QA 2LPMA 4OLAA 4ETIA 1YIOA 4OLBA 2F8SA 1U8TA 4JB0A 3QLUA 4O5AA 4RK7A 4RY0A 1PNTA 1T34A 4KNYA 3CS3A 3GRCA 2GKGA 2E4YA 3Q7TA 2MYNA 5JS2A 4F12A 1VPWA 4LDZA 2AYZA 3O2QB 2JBAB 3CNBA 3NHMA 2FEWB 4MYRA 3OLYA 2CD7A 3QLTA 1NXTA 4E7PA 1Z2DA 2O20A 1E6KA 5ABPA 2WB4A 4QYWA 3RVJA 5B3JC 1QP7A 1QO0D 4XAQA 3QX9A 5DGCA 3D02A 1ABEA 3EGCA 4RXMA 3IPCA 2PUCA 2HQBA 5FWYB 2GBPA 3VNAA 1CHNA 5TQ0B 1E6MA 3GL9A 4OBBA 1U2QA 4MR7B 3NBMA 5FWXB 4JB2A 1SXGA 3RVOA 1QQBA 3KHTA 3TMYA 5JNRA 2TMYA 4Z9BA 3CKMA 1URPA 1GCAA 3KLOA 3RVQA 3OLVA 3T8YA 2QSJA 4DN6A 4P98A 4CBVA 1ZAYA 3Q9SA 3OQMA 3OM0A 4JASB 2P4UA 4YLEA 2FMFA 1A2OA 2NT3A 4MAAA 2FN9A 5JNVA 2FMIA 3LUDA 3H5TA 4DQDA 3FFWA 5CHYA 3RVSA 2A9RA 2MYUA 1RZRA 3F7NA 4KV7A 4YRZA 5I4CA 3HV2A 3TD9A 3HSYA 4MPTA 4KFCA 1EFAA 4TLMB 3DGEC 3K9CA 2HJ9A 3SM9A 1KRXA 3M9XA 1NXVA 4L4UA 4XFKA 3FFXA 1QP4A 3MYYA 3L6UA 1GUDA 3H75A 4LE2A 4EVSA 3BBLA 2L18A 2VUIB 3T6KA 4Z4EA 2HSGA 2JVJA 2QVCA 3KLNA 4MR7A 5FWXA 3LTEA 3QEMB 5TPZD 4RXUA 2JB9A 7ABPA 4ZPJA 1MVOA 2QU7A 1DJMA 4EVQA 1EAYA 4RK4A 4RKQA 5DTEA 3F6CA 3RVLA 4KREA 3O21A 1Z13A 3DGFC 1ZGZA 4GNRA 3I09A 4Y9TA 2HQOA 4YS6A 2PLNA 5TPZA 3MF4A 3OMWA 4E7OA 3OMXA 4D74A 3Q7RA 4HNRA 4P1ZA 4TN5A 2B1JA 3O1IC 4EYGA 3HVRA 2MSLA 4MS3A 1ABFA 1W9HA 5IEBA 2M98A 4RKRA 1PUXA 4RSMA 3IDOA 3FDFA 3KG2A 5CNJA 2FQXA 2FW0A 1I3CA 4G0PA 4RU1A 4ZYLA 5JNSA 4MQFA 1LJUA 1BDJA 5DCLA 2NZVG 3ILYA 1WETA 4JA2A 5EWMB 1MB0A 5HM6A 2VUHB 2LUOA 1Z17A 1E6LA 2ID9A 2WMYA 4PE5B 5HQJA 3O74A 1RXIA 2IPLA 2NZUG 4MS3B 2FLKA 4N0QA 3OQNA 2A9PA 3IP6A 2I6FA 3EULA 5IUJC 2QVGA 4IILA 2BGGA 3LUJA 1LBIA 4LRQA 2QW1A 4WWHA 2PUBA 1NXOA 2JBAA 5IEJA 3N53A 1EWVA 2JCGA 3KTOA 5HKOA 5IC5A 3Q41A 3N0WA 1NXWA 4EVRA 1EWKA 4KRFA 1USGA 3IP7A 1ZY2A 2AYXA 5C5EA 4MRMB 4G0YA 2IPMA 1L5ZA 4G0MA 4F3TA 8ABPA 1MIHA 5D2CA 2E4UA 2JRLA 1JFSA 1JH9A 4Z0NA 3C3WA 1GCGA 4HYEA 2IOYA 2F8TA 3HM9A 2ZAYA 3HCWA 1D5WA 3IPAA 1C4WA 1JFVA 3O2JA 1JF8A 3BREA 4GPAA 4YCSA 5JNWA 2JVKA 4MRMA 1DCKA 3EAFA 5JS1A 2A9OA 3H1GA 1RNLA 4QPJC 1JL3A 5BQ3A 3C97A 3VNBA 3ILHA 4ZMSA 1BDIA 3JY6A 4JOQA 1Y1LA 4MS1A 5FBKA 1QQAA 4N03A 2QR3A 3JPWA 4LE1A 5JNTA 4RK5A 3KYIB 3SNKA 2H0AA 2R4QA 3EJWA 3OQOA 5EWJA 3NNSA 1PEYA 2FQYA 4RZSA 3SQNA 3OO1A 1DCMA 1NXPA 5KQLA 3CG0A 5KC9A 1M2FA 3F6PA 2H3HA 1BAPA 1ISRA 1QO0A 4DADA 1U04A 1M2EA 2PUFA 5C5CA 3NHZA 4S05A 2HQRA 3OLZA 4MS1B 1TLFA 2ID7A 3T38A 5T7BA 4ETNA 4RK1A 4S04A 1NXXA 4OATA 1USIA 5HSGA 4MGEA 4Z4CA 1ZESA 3RVMA 1P8AA 1SRRA 3M6MD 3G85A 4Z9AA 1ZH2A 3EQZA 4MR9B 1JLKA 1K68A 3M9WA 4WUTA 1DG9A 1Z15A 4FE7A 2WJWA 3D8UA 1ZGGA 3B2NA 4NV3A 2N9UA 1EHCA 2GX6A 3NNDA 4EYQA 2OENG 1FQWA 1M5TA 3QLVC 3TO5A 5CNIA 3LKBA 2RJNA 3H6GA 5IUNC 1UDRA 3RVPA 3URMA 4EYOA 3ROTA 2E4VA 3SAJA 4EUKA 5CNMA 1NTRA 1W25A 1KMIY 4N41A 2E4ZA 1DBQA 1Z25A 4UHJA 5E3JA 2L19A 3A0RB 3DBIA 3OLXA 3KCNA 2FLWA 3LUFA 3QLUC 3HZHA 4LDAA 6CHYA 4N47A 1RZRD 4MQEB 5DKFA 4EY3A 2QXYA 3LOPA 3Q7SA 3FFTA 4D6YA 5JNUA 4MR8B 4EGSA 3OLWA 3CHYA 1JDPA 1D4ZA 4RXTA 5DLEA 3RVNA 4H60A 5IX8A 5KWSA 3HJFA 2R25B 1KGSA 1SXHA 2OQRA 5CNKA 5TE9A 3L49A 4W5RA 2JK1A 2W42A 1JYFA 3ROFA 3HS3A 2A9QA 4G0ZA 1DC8A 2FTKE 2PL9A 4FE4A 4KZKA 5IUKC 4MQEA 1FSPA 3LUKA 3RVRA 3DLHA 2FEPA 2M1ZA 4KPYA 5GQSA 3CU5A 3A3KA 4EYKA 2PL1A 3Q15C 1CYEA 3HUTA 4YP9A 1SXIA 1L5YA 1DRJA 4Q6BA 2FSPA 4Z4GA 2FKAA 1D1PA 3H5OA 2Q5CA 3HDVA 3QEKA 5TPWA 4ZMRA 1P2FA 5BRAA 5KQPA 1JX6A 1OXKB 3LKVA 1Z18A 3HEBA 3GWGA 5ED4A 4Z4FA 3RH0A 2FMHA 3E3MA 2X7XA 1LK0A 1USKA 3O2SB 3GV0A 4Z4HA 3QLVA 1GUBA 4NCAA 1ZHHA 3W9SA 3H1EA 5TPWB 4PEVA 3GBPA 1TVMA 3CZ5A 4F11A 1ZDMA 5BR1A 4KQ9A 1APBA 5EWMA 2PUGA 1RXEA 1QPZA 4Z99A 2FMKA 4WXMA 2FN8A 4KK4A 4XARA 1ZH4A 2E4WA 3N8IA 4RWEA 1U2PA 5TQJA 5TQ2A 4G0OA 3QX8A 3OM1A 1YVUA 1P6QA 1R8JA 3O75A 1ZITA 1Z16A 1QMPA 1D2AA 1AB5A 4LZLA 3EODA 3CFYA 1SD5A 2RGYA 1JWLA 4H3KB 1DC7A 4H3HB 3N0RA 1YMUA 3HDGA 5GOTA 2J48A 4LE0A 1F4VA 1VKRA 2DRIA 4OG2A 1QP0A 2LIVA 4YGXB 2PMCA 2VK2A 1JHZA 5KQMA 4RDCA 2IYNA 3HUUA 4HNSA 3BILA 4MLDA 2YHBA 3KSMA 3LMKA 1KRWA 2WWVD 4Z4IA 1FFWA 1QKKA 3BRSA 3KKEA 3N0XA 3H5VA 5T3YA 1QNLA 4F8JA 1K66A 4W5OA 4MLCA 2CWDA 9ABPA 3CZCA 1FFSA 4IRXA 2L17A 1TM2A 2P9HA 3NNNA 4HNQA 1D1QA 3R0JA 4YWHA 4G86A 3JPYA 3H5LA 1A04A 2MYTA 3I42A 3LUHA 5FWYA 4TLLB 4WT7A 1GLGA 2HPHA 4OTZA 1S8NA 2L2QA 3TB6A 3K4HA 4G97A 2NT4A 1JYEA 1DBPA 1NXSA 2FQWA 5EWJB 5KC8A 1U0SY 4MS4A 5EWLB 4F06A 1DP4A 4RY8A 3QELB 3LUGA 4NQRA 3MQ4A 1B00A 3H5IA 3KJXA 3EQ2A 4JAVC 5IBQA 3HO1A 3MIZA 3UKJA 1TJYA 3A0UA 3N6VA 2FXIA 4PZ0A 1ZVVA 1EWTA 2E4XA 4MR8A 1DRKA 3UUGA 3UK0A 1F51E 4YV7A 1CEYA 5F64A 1J56A 4WZZA 2R48A 4PYRA 1E2BA 3QELA 1NATA 5B3JA 4MR9A 4MS4B 1JDNA 1FFGA 3JVIA 4IF4A 3S99A 4KQCA 1PEAA 2WY2D 4IMIB 1VLZA 2PUAA 2VYCA 4YO7A 2PE5A 3RVKA 3HK2A 2V0NA 1XHFA 3DLBA 3G1WA 3MA0A 4QYMA 3GT7A 5TQ0A 3I45A 1XHEA 1YS7A 4KK3A 5KI6A 1JBEA 1VRVA 1A0OA 1DCFA 1MAVA 4M88A 4XXHA 1ISSA 1Z26A 3LUCA 3E61A 2JVIA 3EDCA 3GA5A 3H6HA 3KS9A 4G0QA 4MQFB 3C3KA 1TMYA 4O1HA 4RS3A 3MMNA 3SG0A 5KQGA 1P6UA 3P9YA 3GBVA 3OO0A 1NY5A 4JP1A 4WXEA 2PUDA 1M5UA 1BVHA 1YK0A 3CG4A 3DZDA 1PNRA 1BDHA 2LBPA 3CLKA 2MYPA 2B4AA 3JS5A 4L85A
chains in the Genus database with same CATH superfamily
1RXYA 1YCGA 1ZLYA 2JI8A 3A10A 4O8ZA 2PKXA 4U8GA 1KJIA 4ARCA 4K3VA 2HK7A 1QYIA 1H4SA 2IKSA 2YRXA 1XA3A 5TB5A 2QVLA 1XAGA 5JATA 1E2UA 4C7KA 1QV7A 5BR7A 2YWGA 4BHTA 2FVYA 3V80A 5KTSA 3VR3D 2G82A 1KOLA 1K2VN 5A06A 4AJPA 1UOEA 5TSDA 1CUXA 1AK2A 1E2MA 3R8XA 3WB1A 2GO1A 4KZPA 4PSCA 1RLOA 3AILA 4H6VA 3ZD6A 2VOJA 1LPMA 1Y63A 2WFAA 3QSGA 4Z1MA 3ZZ0A 4AZVA 4MUEA 1FYEA 2B5OA 2R8BA 3COSA 1XZMA 3C5CA 3H2JA 4KKVA 1B2LA 3FB4A 3NCTA 1RRVA 4KFRA 2NUTA 3WK4A 4D45A 2CCGA 1S2MA 2F43B 1CY0A 1BEUB 3O8OA 1DDOA 3R9XB 2OEPA 1ULAA 5DNDA 4RC9A 1MUUA 4RHXA 5IS2A 1XJ5A 4DIMA 3F9CA 5EZQA 2MSWA 4PQGA 3WGIA 4FYPA 5IBCA 3OE7A 4HK4A 5FPYA 1HXHA 4CODB 4O4IA 4XQCA 4BGVA 1M2HA 2PZAA 3UH0A 3FETA 1O77A 1GTMA 2RGEA 3NDRA 3WWOA 2LXNA 1VSQA 2IHUA 1GQFA 5JY6A 2VNIA 5F1KA 3LD9A 5ICFA 1JQJC 3SGLA 2OBLA 2PZMA 2DQZA 4BDTA 4GHWA 4YCCA 5BVGB 4MDEA 2P7HA 4RKWA 2DXIA 4ARSA 3NDBB 3U44B 2X0IA 4FFRA 3IPLA 5FLXA 1ZM7A 4CF4A 3HYCA 4M83A 3AIIA 2MHCA 2QAGA 4RIEA 4S0XA 4JEMA 2Q4EA 3RFVA 4M87A 3QF4B 4MMZB 4H31A 3KB2A 4LXYA 1UINA 2IGBA 4JLNA 5EFOA 2DJ5A 3I9OA 5J4VA 1PGJA 4BX2A 1EAMA 1KDOA 4BIIA 2Z5VA 4IUDS 2QX8A 5HX7A 2I6TA 1PN3A 3FUCA 4W9NC 4PGMA 1YKGA 1C7JA 1WSBA 2YIJA 3WIOA 1Q6ZA 4ZZ0A 1Z2DA 2JJ1D 4MIEA 3N39C 1E6KA 2OOSA 4ZU1X 3RTCA 3ZDEA 5DT2A 5ERXA 3VC1A 4JLBA 4AQDA 4RX1A 5I6DA 3EVTA 2AUNA 2ZRHA 2DQSA 4YT5A 2A84A 4R2MA 3DBRB 5JADA 2PMWB 4OBBA 2CUNA 1GILA 4X20A 3LLUA 3QVSA 3ZZUA 3DOIA 1KEEB 4D4JA 521PA 3ETCA 5AHOA 2GM9A 2OZLA 1JDUA 4PGFA 3L0PA 1AHPA 3ZG6A 2B2CA 2WVGA 2QT1A 1C1DA 1NP3A 1Z22A 2VUSA 3D7MA 3E9ZA 4J2OA 3RO7A 3Q5GA 1OREA 3UT0A 2ZE6A 1AQ6A 1NONA 3OPQA 4F3RA 1GHTA 4BZPA 4FINA 1BYUA 4OJYA 6NULA 1LC3A 4ILEA 5FFMA 2CVPA 3DV0B 3Q9SA 1WZ2A 3M5PA 1IHXA 4NZNA 5KVCA 3EXFB 2FMFA 5FBQB 4ZEWA 3K9BA 3WGQA 2Q3FA 4F9FA 3V33A 4HYQA 4FW8A 4F5EA 4ALKA 5BSFA 4HEJA 3RWBA 5F7OA 3KT3A 1X14A 3DZBA 2WHRA 3TX2A 3V1NA 2WFLB 4JQZA 1ZGBA 5JNLA 3U13A 3IOYA 5I4CA 4RAQA 3CLUC 1RRKA 2TMKA 1BMTA 3E03A 4FGUA 4TTSA 1WA5A 2I2BA 4Y9SA 2X0FA 4MGZR 4NNPA 3UWKA 4A36A 1S96A 2AOXA 1IEWA 1CXZA 2YXEA 1A5ZA 1W96A 2A0XA 1Y3FE 3LC7O 5EMNA 2GXUA 4JA0A 2QN7A 1X3SA 3KT6A 4JNCA 3TSCA 5JQGF 3BXPA 3I1YA 1Z5GA 2JCXA 1GG5A 2H2DA 2VC2B 2CZQA 4J0DA 1FF9A 4EB6A 3BBLA 5G1NA 1TU4A 1AUXA 2JJ2D 1SO8A 4WESA 1KDYA 4Z7QB 1LFAA 1QB7A 5EGNA 3U7FB 3WY9A 1UR5A 2PV7A 3RW9A 5LJIA 1W4ZA 4KVGA 4ND2A 4YCAA 4BEWA 5J47A 2V3WA 3ETHA 3ECAA 4RMHA 3WWCA 2RBEA 5FH9A 1BEZA 1MVOA 3PF9A 3AM3A 4IDAA 5BNFA 4Q9AA 4UOZA 4ZJUA 2OA0A 3EG9A 4JJ6A 1DCTA 2QTCA 3BFVA 3W3AA 4X00A 2IEDA 1R0LA 2WHQA 4JGBA 3ZDRA 3R9IA 4A6EA 2WZCA 4DLXA 3FPHA 1ILEA 4H1UA 4Y9TA 2HDNB 2ZITA 3JQ9C 1WUKS 1XTIA 4JITA 2VCEA 3AR5A 4PXYA 3UAWA 4QRHA 4XR9A 2PGJA 2W2PA 3G82C 3M2PA 1QO9A 4G1UC 1WCIB 4PYKA 1UPBA 2QMUA 3H1TA 4Y30A 2GCPA 4RNDB 3UMFA 5SYNA 3ZY2A 4CEJB 3PHJA 1X1EA 4FOLA 3WLPA 3OAAD 2M98A 1NL3A 1EDDA 4H1VA 2HN9A 1M2KA 1S9DA 3KPUA 5SZHB 3FDFA 3JAWA 2R00C 3B36A 3U4IA 2XA9A 4OIMA 2G9ZA 2ZIWB 1LPOA 2W6PA 2WA2A 4DXHA 1T9HA 4RELA 3JD4A 5G02A 1YB6A 1AT1A 4DQXA 3CVYA 1O96A 1UM8A 3MMXA 4BNGA 2DYKA 3X2EA 1UJ6A 2GPYA 1BXGA 4A8JA 1PEDA 5GJCA 4DSUA 1IM5A 3E6AA 3QY9A 5FWDA 1V1MB 3ESQA 3MJCA 5HVNA 4X92A 3ZWCA 1UBSB 2XRFA 3KWLA 4UCFA 3NBZC 1FTWA 3U61B 3M2TA 3HLTA 5JFTA 2WMYA 4II3A 1CJKC 1EX7A 2NZWA 2H2WA 3HMQA 4AMGA 3SZOA 4QU9A 2PD4A 3MLBA 1JSCA 1UXOA 1RRPA 2CLCX 3N8GA 5CX4A 3IPRA 5DBIA 3HRIA 4YRDA 1KY2A 3E3LA 4RWZA 2FEXA 5CFRA 5DM2A 4JHXA 1UK6A 4C4SA 4I4CA 2ZOSA 2JGLA 1GZSA 1OHHA 2GDZA 3A1EA 1UJ5A 2GAIA 2WM2A 3I76A 2CVZA 3S29A 1MJGM 3KFLA 3DZ8A 4C1NA 3B9QA 3F8SA 2DUUA 2CFOA 2P2NA 5FCDA 3SBDA 1VCOA 3WRYA 2G77B 3LQYA 4RMNA 3W6ZA 4AX8A 3MTDA 3GARA 2Z4RA 5DXFA 4GI2A 3GP3A 1NQTA 4BATA 3N58A 3VR5A 3M82A 3ZGZA 2V8BA 4FCVA 1Q1BA 2B4QA 4AKTA 2NXWA 2VHWA 4IY1A 1ZM4A 4QC2A 2R1VB 1EHYA 1DT5A 5BWBA 5L3VA 4MRMA 1DCKA 2LIPA 3OQBA 1RNLA 4HGYA 4WCFC 3IAUA 2MSDB 2I80A 1ML3A 3VNBA 4G5OA 1HE5A 3PK0A 1XMXA 3N74A 5DBEX 5FI0B 2F1RA 2V55B 5IH7A 2P5TB 3BCSA 5ENDA 1ST2A 3VNRA 1BXRA 3TGPA 2FWNA 1B74A 3GUZA 3H86A 1T36A 1P7VA 1ZBQA 2PTHA 4GPBA 5HP4A 1NOIA 1G291 3AI7A 1Y3DE 1K6MA 2CDBA 2H3HA 1ISRA 1JPJA 2B6NA 1N2OA 3B1ZA 3WQQA 2I1VB 3L7KA 3FIUA 5ECYA 2CNBA 1UMCA 3L8FA 5HDQA 5EN4A 2AFHB 2Q8NA 1T5TA 2IEYA 1RXWA 1TAHA 1BX0A 2YXPX 5HSGA 1ZM3A 2C2YA 3K35A 1WABA 1GAQA 2H8GA 4UUBA 1PBTA 5HE9A 4AS3A 3PUJA 3R3UA 4L07A 1QYDA 3GJSA 1A7UA 2VF5X 1KI7A 4ZI7B 4KMMA 1WE2A 4PGHA 2C3MA 5CYGA 2BY4A 2VKTA 2HU2A 5B1IA 1W7AA 3ZJYA 2XLBA 5E38A 3B2NA 1OPXA 4FZRA 3O47A 3UO8B 1QZUA 1O6GA 3BWYA 2EGGA 3C3JA 2VYVD 4M8KA 3WLFA 2EGHA 3BF8A 2YC4C 3KVOA 4MQ6A 1R15A 4MW6A 4X8HA 4U0KA 2ONJA 2Y1GA 4HDRA 5A9TA 1NP7A 3MS4A 2EARA 2VHXA 3N07A 5CEFA 1E0JA 1YR1A 4NH0A 2E4ZA 5EZYF 3PPXA 4BNLA 3BIJA 3FNEA 3HYSA 4LRTB 4A7PA 1QE5A 3NUZA 3OLXA 2WWWA 4LDAA 2Z2XA 3ZD8A 1F8FA 4G6ZA 3HZHA 4E1VA 9ATCA 1U7HA 3V4LA 3WBBA 1DT3A 5KU7A 5A6SA 1GG9A 3FFTA 4TL8A 3WYNA 1JMKC 4BZXA 5A4KA 1T1IA 4PO3X 4EJFA 1W47A 2WPDD 1DLIA 4U2BA 5FI3A 5J3JA 1N5OX 2OQRA 2XIQA 5TE9A 1E3MA 1I1QB 3PVZA 2D5AA 3PQ8A 1NVFA 1I5OA 2O6LA 3DZKA 1AQUA 4PLTA 2BEUB 4QNRA 3HYTA 4IZOA 3U5ZB 4HNAA 1A9OA 3PE3A 4NJEB 3GA0A 1KS9A 1DELA 4IIDA 3RCBA 3VNQA 5CAEA 3ERCA 4R8VA 2ARKA 1KJJA 2AQIA 2RGNC 1N3YA 3FSGD 4QUDA 5EJ4A 1CYDA 1Z5PA 4GOJA 2EKZA 3QOWA 4Y9RA 4C2BA 1ZM2A 3HUTA 4LVNA 4M8NE 2W6ID 4XB2A 4YP9A 5DN6D 3SQXA 1CUGA 2X4IA 3T5TA 1K98A 3EXG2 3LFUA 3QVKA 3PHCA 4DGSA 3E23A 4AP5A 1NI5A 3EUAA 2ATIA 1VA5A 3LKVA 1P2UA 1B6RA 1FJ2A 1VOTA 2FUCA 4G01B 1T3GA 1UXGA 3DAPA 2QXUA 4C0XA 2FZEA 2CHUA 2VQDA 4IDEA 1XZPA 3E8SA 4UE3S 3WAGA 2Y05A 2VJLA 4NEQA 1H8ED 5K3CA 1QVRA 5KOYA 4L4XA 2I62A 4I9FA 4MV6A 3TEJA 3A6KA 4EHHA 3P2OA 4KQ9A 1HDRA 1SKQA 4KWEA 1CDEA 4P4SA 4UTOA 5TMEA 3WQRA 4CETA 3CONA 3RKUA 2NXNA 3AY0A 4QQKA 5HOQA 1DBSA 3TFQA 2D1TA 3E2PA 2EKQA 5JC1A 2X8BA 4CCYA 4PSUA 5AD1A 3W06A 3SQOA 3QMWA 5TIIA 2PCJA 1BHO1 1FXWF 2GN8A 3DLTA 3QX8A 1WMSA 3E7WA 1CE8A 4RORA 1E9FA 2XBLA 4GVLA 3SBEA 3NT4A 2AJLI 5CDSA 3MWDA 3TM5A 1YL6A 2PH7A 2Q27A 2W37A 1JRLA 2FETA 4DLTA 4C7OB 2BKUA 2AGVA 2WK1A 3BGSA 2XE7A 1P31A 2G0AA 3BXGA 3N0RA 1TVKA 4EELA 2N47A 5ADVA 2VRNA 3DMHA 4MVJH 4R1UA 3GH3A 4OL0A 1G8AA 4ZC8A 4ENSA 3HYRA 5KQMA 3IPYA 3NHAA 1EVIA 1JJIA 1ECFA 1LQUA 1SNYA 1XDDA 2JIPA 4FK8A 4ZT6A 4C04A 2Q0QA 4YQEA 3MCUA 5LYJA 2HBQA 2DR3A 5B53A 1IVNA 2EQ5A 1FFBA 1U3GA 1SU4A 2RMKA 2JIMA 3N0XA 3R3XA 4R1PA 2KJQA 1ENPA 4P58A 1K66A 3B3FA 4EY6A 2P2GA 3IEKA 2ODTX 3HJBA 3F7TA 4FUTA 3S70A 1ESNA 2ZIAA 5IKPA 3R5XA 5JMOA 1P3JA 1COZA 3ONWA 1DNPA 1W5EA 1U1GA 3H5LA 1BD3A 1FVOA 4N7JA 5FNVF 4D43A 2ORIA 5JJLA 4IEFB 2IFTA 1RYZA 1JG2A 1LY1A 2Q28A 1AUOA 1QDLB 1KYIA 3CVOA 4Q47A 5A9SB 2WNSA 1GZ3A 3LVQE 1G55A 1W35A 5KU1A 2NVBA 2BD0A 1JNXX 1Q57A 1ZSYA 2NT4A 2B82A 3KDSE 4IHJB 3A27A 2GSWA 3INGA 5EWLB 3AP3A 2AL7A 5EFZA 2CL7X 4FM9A 4ENUA 3EIEA 2G9RA 2YMPA 1G3UA 5CUQA 2DHEA 4I9HA 3G9ZA 1XXHB 1ZI8A 2WJIA 4P5DA 3A0UA 2NIPA 5LLSA 1J0CA 2PMKA 2ZIXA 3NVAA 1EFTA 4KXLA 2R8PA 3OM9A 4UNSA 1RPNA 4MP8A 4TM8A 3EXIA 1F51E 1ORRA 1ZX1A 2UVPA 4RPCA 4A10A 4G0WA 1L1QA 5AICA 2ZFUA 1E99A 1YACA 1HL3A 2VZLA 1L5GB 4MS4B 3E05A 5L3SA 4UZSA 3A28A 3PXCX 4J1QA 3S99A 5FIUA 3ETDA 4C01A 4CKEA 1FRNA 2IKQA 1E3WB 3BIXA 4RACA 1SCDA 4JIMA 1EDEA 2X14A 4IHKA 2BFAA 3FROA 4E1BA 4LJSA 1XHFA 3LP5A 4HO1X 1JWLA 3R44A 1XRJA 2H1HA 2ZBGA 1PJ8A 1WB9A 2GVDC 4P4UA 5DT9A 3WLOA 4Y0NA 3MGGA 4MV0A 1VRVA 4MUAA 5JUWA 1EIZA 3BH7A 3EGXB 1FS5A 2AEJA 1R6UA 1W6UA 5G3YA 4WZAB 3KHKA 1E1QD 1N7IA 4Q12A 4OLFA 2A1UA 1FTNA 1NDHA 3AR9A 1Z0AA 3BWDD 3OFVA 4RESA 1XU9A 1NUTA 1U8XX 5SY9A 1HKHA 1K2WA 2R8RA 3KJZA 1DAKA 4IH9A 3HKDB 4V1CI 3QG5A 5HA5A 2VJAA 3U62A 1NQOA 4HFNA 1EFPA 1M54A 2JI9A 3FF1A 2PMFA 4UCWA 5D7BA 5DX1A 4UULA 1T8WA 2HHAA 5E9AA 3W7AA 4C4PA 2MYPA 1ONOA 1BKYA 4DABA 4BVBA 1P18A 1BN6A 3DKPA 1VDZA 4W5JA 2HCRA 2I1LA 2PGIA 4DWVA 3IUPA 3UCEA 4LWPA 4MCJA 3IAS1 3ROMA 1DRUA 3PWSA 1BGVA 4HRAA 1SB9A 4RHUA 2XHZA 2O5RA 2ZWMA 1NC3A 4GG1A 3VU9A 3M6FA 1TJNA 5TQ2B 3I1IA 3TZ6A 1GVHA 1NI3A 1O94D 2B8JA 2CJWB 1Y4ZA 3DQPA 3OKCA 3OX3A 3P1JA 4PIPA 2NU9B 1YZKA 3BRQA 4IMJB 1ECPA 3EDOA 3ZXYA 2A78A 4DY6A 3U7IA 1G8KA 4PLGA 4AAYA 2QZJA 2W2VA 4ADSG 4ASUD 4AT1A 4WCFB 2GD1O 1JFTA 4HQKA 1IY9A 4MULA 1EFRD 3K15A 5HBRA 2FX2A 3H84A 4B6FA 3OIGA 5L40A 1J49A 2R6DA 3IOBA 1BC5A 3K31A 3PT9A 4IIJB 3H97A 4G0XA 5JDIC 3OG9A 4LQ4A 1OH7A 4LJRA 1GPH1 1S4QA 1JHVA 2EFHB 4FFMA 4S1TA 3FSGA 4C20A 2D1SA 2EP5A 4R3NA 3L1UA 4R8MA 1A4XA 3TNDA 2O6HA 4A2CA 3HN6A 1MO2A 4X1IB 1SZPA 3DYBA 3R9KA 2ODBA 2Z58A 4IM7A 4J0QA 4WNAA 1HDOA 1VP3A 1SHUX 2C9BA 3HDHA 2ZIGA 1KJYA 3PHHA 2WOJA 1DFIA 4AK9A 4B3BA 3JX9A 4YCBA 3EVFA 1R0RE 2ZTHA 1RWVA 1UPFA 3I4FA 2WRZA 4TLBA 1R5JA 4X0EA 4LRWA 3LT5A 1QVZA 1B8OA 1YQTA 1MB3A 4PTLA 3N05A 4ZO8A 2WZDA 5JV5A 5FTMA 3KQNA 5KYWA 4A9AA 1K86A 3DHNA 3AFOA 1E5XA 4DMUB 5LXTA 7ADHA 1ZNZA 5K99A 2JZCA 2GYYA 2HU7A 4RK7A 3PENA 1PS0A 2UUPA 3LCCA 5D5QA 3HWX1 4OFWA 3E9RA 3OLCX 5L6LB 2QE6A 2W48A 2X1HA 3C6ZA 4Z7OB 3Q7TA 4LDZA 1H0KA 1OXUA 2AYZA 2QTMA 4GT1A 5LP6C 1ULHA 3ZGLA 1DEOA 2XZDA 4JJ8A 4XSGA 2Y1EA 5CLQA 1B6SA 1PQPA 3FTDA 5CBPA 2ALJA 3N2YA 5FKJA 1H2ZA 1DPGA 3I9V1 1Z33A 1CQXA 2V7BA 1EX6A 4MJLA 2H08A 3RVJA 4TVSA 4IOKA 3ES9A 5JFGA 3PCRB 2Q6TA 5E7MA 1N6IA 3OJLA 4G24A 1MZVA 1VG8A 1TW3A 3IVRA 4PBTA 5TQ0B 4FDUA 4DILA 4NZOA 5SZIA 5DYWA 1M10A 2PUJA 2HRRA 1QFMA 3I23A 3NHKA 2O2XA 3NEJA 4YALA 3RSCA 3L8YA 4ZYYA 2Y8EA 4Z54A 5C80A 4LF6B 2QP3A 1UWKA 3TMYA 4OXXA 4WSOA 5GONF 4KB5A 2WF6A 1UOOA 3M33A 2YWJA 3ZJVA 3QPDA 1NVGA 3OJCA 4ZVSA 3T54A 3GDGA 3UJCA 2GAAA 4WBNB 4WDRA 1ZAYA 5DK4A 1PJ3A 5AVRA 2JS7A 3JWGA 1TCBA 4LDRA 4MK4A 2NU7B 1YZ3A 3MILA 4U02A 4NK4A 2CLEB 4U7GA 4CL0A 4FHEA 2QENA 3AF2A 1DO2A 3LU1A 4GOMD 3SOZA 3FKJA 3M83A 3HXLA 4DEXA 1H5NA 2EJBA 4PAMA 4RY2A 2B5VA 2G8NA 3JWIA 1XT6A 4GX2A 3RVSA 4I55F 3KTDA 1E1LA 3V8EA 5IYZB 1BE1A 3ZIAA 2VWPA 4KV7A 4Y18A 4WKCA 5I9NA 1AO0A 1A5TA 3BAFA 2QROA 4FLEA 3A36A 3BMQB 1G5RA 4CW7A 4LJ4A 4CLRA 4QOIA 1NBMD 1KY5A 1NJ6A 1Y4SA 2WTMA 2ZREA 3JATB 3LE8A 2WYOA 3EAGA 4TLMB 4NP6A 4JEIA 4ZREA 2P7IA 4IZHA 3Q3GE 4M9QA 4HDQB 3TMAA 2FWIA 3FPAA 1NJFA 2MMCA 5BWOA 1GUDA 3H75A 3RGGA 3VR6H 2P69A 1DIAA 2BBWA 4IEEA 4TL6A 1EK1A 4TSFA 2VEDA 1H85A 4HEA6 1BWSA 3IULA 5FWXA 2JFFA 3QEMB 4ZI3A 3OTQA 5IKOA 1QIIA 5L4SA 4IF6A 4QD3A 1EDBA 2PRZA 1DJMA 4CQLB 3L84A 2NO6A 3TN7A 4ZO4A 1D6JA 2FFHA 3DM9B 4WERA 5DTEA 3LDUA 4QFDA 4QUEA 2PZLA 4FSDA 3ON5A 3SJCA 1RBYA 3X1YA 5FOSA 3VDRA 2HUNA 3DCIA 2PLNA 5EESA 2FZ5A 1Z5OA 4LCBA 3RYCB 1EG7A 2JJYA 2X42A 4P1ZA 2DFTA 2XUGA 1J70A 4AY5A 3NYWA 3NBUA 4GGOA 5TR9A 1TQ6A 2MSLA 3LQ4A 2W11A 1CRZA 1FZQA 3ABSB 4NOJA 4H16A 3G7UA 4A6DA 4B4KA 4N65A 2J0SA 1U7ZA 3ZV4A 4Z51A 4HMOA 4I5FA 4MB0A 1A97A 4DDHA 5C51B 1M72A 1FP7A 1XTJA 5C81A 5ADWA 2BJHA 1V96A 4BX9A 3GJ0A 1RHRA 1MQ9A 1V3QE 1YUBA 1Q3TA 4M0LA 3OQPA 2RBGA 4ZCQA 5IJ0B 4LFBB 3GPIA 3L7YA 1L5OA 4NG5A 4XVUA 1C8BA 4CHGA 5J58A 2V03A 4MJ3A 4HFMA 1PBNA 2ECQA 4CYMA 1QHSA 3FMOB 4H08A 5JSYA 2K7FA 2QI9C 4YJ2A 3TW0A 4IILA 8LDHA 3D6FA 4DG8A 3LPAA 2J4FA 4L9AA 1TI7A 4KWHA 4LZZA 3KZMA 4IUYA 2JBAA 3FSJX 4IIBA 1P1RA 5ALQA 3KXIA 3I6QA 4JQCA 1GQ2A 2AFHA 2NO5A 2IV2X 5DLEA 3EMKA 2EATA 3OPXA 3DMYA 4RA9B 1N0HA 2QTBA 3BH0A 3NHYA 3UHOA 2Y92A 2FKNA 3AJEA 1B14A 2JIOA 3E8XA 3B7PA 4LNUB 2GZ2A 2B25A 3UMRA 4LZWA 1ZH0A 1QH9A 1UMDA 2RB4A 3MT0A 3T35A 2V45A 4GW3A 3VC2A 2ZBPA 1TADA 3UK2A 1RHKA 5I47A 4HF7A 1GCGA 3FNGA 3HEAA 4HJRA 4J1TC 4DV4B 5DIZA 1KO5A 1FE8A 1UADA 5EIBD 1K7YA 4UTRA 3VHLB 3LC2O 5JXIA 2Q0XA 4DBZA 3R6DA 2R1ZA 3B20A 3HP7A 3IERA 3RYFB 3U7RA 4LHYA 8OHMA 3ZS8A 4QPJC 2C8JA 4X6UA 3OTGA 3T61A 3VDXA 2I5PO 1N1MA 3EY9A 4RVOA 2HEIA 2JLUA 2HRCA 2GLXA 2Z56A 3AETB 5FYQA 2EKDA 1R50A 3QE0A 4JP5A 4C22A 4AY6A 1WKBA 1FNCA 3OOHA 4BS9A 4CMIB 4ZI7A 4QULA 3STVA 1OB2A 4ZWNA 3ZW7A 1H9AA 1PAUA 3BERA 5HIIA 1GKIA 1NIPA 4DSTA 2QW0X 1X8JA 1YD7A 3EG5A 3SEAA 2R8XA 2AMLA 1FQJA 2HF2A 4HS9A 2FP4A 2HCJB 5IAEA 3RG2A 4URVR 1HK7A 3KLMX 1I32A 1Y6ZA 4B3FX 4HH4A 4F8EA 3WNVA 2C5AA 5DSTA 3N2EA 2PKEA 4MROA 4F2HA 2QTVA 1DG3A 1Z8FA 3PUKA 1OI2A 5H83A 4KR9A 1J00A 4M7RA 4YMVA 4Z4CA 5C46F 5IU6A 1KU6A 3FLMA 1O6CA 4LJYA 1XZFA 3BMNA 4Z8XA 1P0PA 3R23A 3KU4A 1JJBA 1G9SA 1M67A 3CF0A 3CUEF 2H51A 1DAEA 3LHSA 1E98A 2BPOA 4Q19A 1S9HA 2GA9A 2VTBB 1XQVA 3SJAA 1H1TA 5U4XA 2Q1WA 1R27A 1YC2A 3ZLUA 5IKMA 3ZI7A 1BKDR 2HO5A 2O3TA 1KJZA 3MTGA 4JT8A 3DVRX 1GUFA 2REOA 5BYAA 1AHNA 2R6CA 4QM7A 4GRIA 3URMA 1KHTA 3AG5A 2JCBA 4I9NA 4ZCLA 3RROA 1UUFA 3GFFA 4XM2A 3LSTA 2CJPA 4GR4A 2I2DA 5ALLA 3GYGA 4Z9XA 2OYRA 5IYZF 1I3KA 4QXQA 1YNSA 5LC1A 2L19A 3E7DA 1UANA 3C3YA 3VBEA 5FAXA 1TAQA 2DPLA 4P54A 3OOYA 1SEPA 4E33A 1ADJA 4UM5A 1UFVA 3EUEA 1NP6A 5IJ9B 4D6YA 3PDIA 1ETHA 5JE8A 3W2EA 3GT0A 1IUOA 2C5SA 1LZKA 2BMDA 1YB4A 4WDQA 1G5FA 5DNUA 1E3SA 1QG0A 3SJUA 4Z0PA 4ZT5A 4AY4A 5LYYA 3WNBA 2D54A 2ZANA 2MMGA 3BWBA 2OV8A 2ZVQX 4ZVVA 1MW9X 2PZEA 1E62A 1R0ZA 1E3WA 1TYEB 1TT5A 2Q2OA 3HCOA 3JQAD 2W2QA 2XJ4A 2A9KA 2AIRA 3GVHA 1ZMOA 1E5TA 3HPQA 4UDYX 2WA1A 5JZVA 1ABBA 3AUUA 4MV3A 3BHJA 3WGZA 1A9QA 3H7IA 4NCKA 1I3OA 3K32A 1M3SA 2PO7A 4KI0A 3T7RA 2FN3A 5JCPA 3SFVA 1IK4A 1FRFS 1KH2A 1P2SA 2IYWA 3CM0A 3LY8A 5JYBA 1P4GA 1Q14A 4E1AA 4FGZA 2Q5CA 3TG2A 4NYMQ 5IAJA 4CKWB 1P7PA 3NC4A 2K6GA 3EK2A 4IDQA 5CLIA 4EHLA 5LQUA 1GOTA 3CX6A 4RF2A 4J91A 1TA4A 2RG7A 1RXVA 3E9DA 3MBKA 3THYA 5DLQC 2IDKA 2VPXA 2J3QA 3E3MA 2RH4A 3GMDA 3Q8WA 4DMHA 5IAOA 1N77A 4GVPA 2NSYA 4OHRA 4DG5A 4FX2A 4C7MA 4UUPA 4L5BA 2C5LA 4IDNA 4LY3A 1T2EA 2NXJA 2Q6KA 1ZHHA 2X9VA 2ZPUA 2IV3A 2FJUA 3MTQA 3UQZA 3G68A 1Q1GA 3LT2A 4B85A 4F11A 1U28A 2OYSA 2QM0A 3PJFA 1CFJA 4FGLA 1ZIDA 2H4WA 3F96A 1M75A 1PJ4A 1ESEA 2DHRA 4FKMA 3ADCA 1ZH4A 1P33A 3H8VA 5K2MA 4YLYA 1RQGA 5F73A 1E2JA 2X8JA 2JZNA 3HL0A 3S27A 3USCS 2RFLA 4B44A 4U2DA 2PRIA 2YW9A 4YIKA 1AKTA 1YVUA 2Y1FA 4BZQA 2O07A 4UFNA 3RAEC 1M5RA 1FYVA 4ZTUB 2BCGY 4XGNA 2PA3A 3WS7A 1JT2A 4I0WB 1N7HA 1BCSA 3PUHA 3A4IA 3KXLA 1QHYA 4N8SA 5C8ZA 3D3QA 4RADA 1C3VA 1S2OA 4Q16A 4ATNA 2A1IA 2WZQA 4HUTA 1KYXA 4IH4A 1ZFNA 2R97A 1RLIA 1L4BA 1C7FA 3B9PA 4FBMA 4FCTA 4LSZA 4BEBA 1SHKA 4QE3A 3DE0X 1ID1A 3IEXA 4OKIA 5EZ5A 2PSSA 3LP8A 3TQHA 2Q1SA 2Q6VA 1FXWA 5HR5A 3OETA 4FMDF 4C08A 2X1MA 4L8FA 2PR7A 3S2UA 3GO4A 1BE0A 3DAYA 4YT8A 3BRSA 1M2OB 3QVTA 5T3YA 2Q4DA 3RS4A 2FSHA 5D01A 3GGOA 3QFFA 1K3TA 5IVDA 1YIAA 2UZAA 2W6QA 3C2QA 5AFSA 1GKLA 3CW8X 4F21A 1SHJA 1O5OA 3IE2A 4YWHA 4NBLA 3R3ZA 5T5QA 1WDLA 4QAQA 1QIGA 4L16A 3CEJA 3ZLTA 1OA1A 2BBSA 2K5UA 3G2IA 2BTQB 1B7GO 3JALB 3FMPB 2EP8A 3JYNA 3QVUA 2DT5A 1LDGA 3TRKA 4RIFA 3U44A 2PSJA 3G8YA 1WOMA 5IKXA 3ORQA 4UDOA 2WJZB 4C06A 3OKAA 1DINA 3I9JA 2GBCA 4QDZA 1WUTA 4MHTA 5G4KA 3GELA 1X7ZA 4JY7A 4UEWA 5CCXA 1C3JA 3VDMA 3FAKA 3FPLA 3CIOA 4PPFA 1XEXA 3GROA 3E5MA 5KAPA 4UJ5A 4R83A 5CEEA 4GPIB 4GPZA 3OJFA 3S68A 4GKVA 4JH0A 3THSA 3UUWA 1J8VA 1V8ZA 4NFLA 1ZCAA 1XL0A 4KL8S 5DM60 2MTBA 4G56A 4GAEA 4C9BA 3A1TA 3HU2A 4TSFD 3IHTA 3NWEA 1X7ZB 3PUXA 3HNRA 1V8DA 3L7DA 3RT1A 1RJWA 5KDLA 4CQLA 1L5QA 1DAFA 2I6UA 2PKQP 5EJ2A 2VJDA 5IWCA 4FC6A 3L0OA 1TVCA 3AHEA 4XVQA 4KQ6A 1UOPA 1PGOA 1CJVC 1GDTA 3BD6A 4JYAB 3QF7A 4CKBB 1WPGA 3LPMA 2QPLA 1JBEA 3CNLA 4B6SA 3P27A 2G07A 3MGKA 4J1TA 3RUIA 1ECJA 3TKAA 3O8CA 3H5NA 3P9PA 3P7MA 3GLIE 1C2YA 1SR8A 1TXGA 2JJQA 4H15A 4MP3A 5LP6F 3FFAA 4AF6A 4KACA 3VISA 1NBME 4POAA 1N2XA 1DEKA 4WVFA 4LFAB 1NURA 2GYUA 1YGPA 4I5GA 3VH2A 5CA0F 4YV1A 1N5JA 1M83A 2JGRA 1JFFB 1BVHA 2VVTA 3DEKA 3LQFA 2WM8A 2G28A 2C4NA 2NU7A 1C8LA 1QYVA 1B0ZA 3AGQA 3CLKA 2D13A 3KWJA 3G9UA 2ZYSA 4IFTA 4OD0A 2B61A 3ZW8A 2F62A 2LWIA 3LKZA 2XCOA 1WJGA 1C0EA 1QO7A 2QWXA 4M1MA 4R7TA 1BIFA 3GA7A 1SHZA 1MFZA 3B1KA 3I2IA 4FIDA 2WTAA 2ZRNA 1U63A 4BX3A 1L5NA 2B3DA 2FRVA 1U7PA 2HMUA 4U2EA 1OVMA 4KH1A 5H68A 2CV0A 1IONA 2D5CA 3H0CA 1OH6A 4PC6A 4PCVA 4FB4A 1T0HB 5AW2A 4MVJI 3V2IA 3K05A 5IDQA 2GFIA 3QVGB 5FBWB 4GO1A 1M6WA 3MZ0A 1K4KA 1TVKB 4PGAA 4UMFA 4ZI2A 1VJ1A 3OJXA 4WZAE 1TO2E 3DBLB 3IGFA 1ZXBA 1PWXA 4RCYA 4M9ZA 2PX4A 3SVZA 4HXFB 4YJ2B 4EHBA 5FUMA 3BSWA 3F7OA 3KEQA 2H92A 2YIVX 2JI4A 3H2ZA 2IX3A 1WY5A 1XDSA 1C9KA 2IPAB 2QE7A 4GU5A 1N2BA 4N7BA 5JROA 3I5AA 5BQ5A 1V4NA 3Q3EA 1VLLA 1KVTA 1UL1X 1FSSA 4MTCA 3G2PA 1M8PA 1OWLA 1I7SB 3CTPA 5AM0A 1WM1A 4UM9B 3I6YA 3PFBA 3MT7A 1KSHA 2HT1A 5CT8A 1T1EA 2C5FA 1NLZA 4OBEA 3ICWA 3SQMA 4XCVA 2A5GA 1RTTA 2GXAA 2ECKA 4W5QA 1ZG3A 3CRRA 2PO5A 3LCJA 4OUKX 4WBSA 4WMLA 2P4QA 5AHKA 1XKLA 4PSDA 4LDPA 4US0R 3M6AA 4XKJA 1DIBA 3RF7A 1Z88A 2QUJA 4TRMA 3A6DA 3Q2IA 4FOPA 4KFTA 4ETIA 4XVCA 3ND6A 1VLJA 4Q4CA 1U4OA 3GR6A 2OCIA 3MTJA 2C2BA 4KR3A 1YS1X 4GMGA 3KQOA 5THQA 4C2AA 5C8VA 3KQUA 1PR6A 3CEPB 4JZKA 1Q1AA 1X1BA 4GDFA 3PX7A 1CLEA 4RZQA 1KR5A 4KQFA 3H11A 5LKRA 2YN4A 1B1AA 3G49A 1VL0A 3SHTA 3VX4A 1AXEA 1W19A 3PHIA 3EIQA 1NUUA 4KXUA 5A05A 4WZBB 3W2IA 2YJ5A 1E7RA 3DOJA 1BO6A 1EQ2A 4HBGA 4RF5A 4YVFA 2IEZA 3FHLA 3PRKE 4U8HA 3RBVA 4G5HA 4UXIA 2VO1A 2VPTA 3FR8A 4EQ6B 2GN1A 2B0JA 2O2GA 1TRKA 3OF2A 2XSZA 2QL5A 4RXMA 2PUCA 5G1PA 3K92A 3L9WA 3GL9A 3UJNA 1XLWA 4NU8X 4HHEA 3NBMA 3CZ9A 5H02A 3T94A 1P0QA 3K53A 3OIWA 3PXUA 4Q9IA 4OI1A 1UBHS 4ZVQA 1EWRA 1SXGA 4GWKA 3PV0A 2EFJA 4HDSA 1GGKA 3U1TA 2GPTA 4N0DA 4OQ4A 2X86A 1MBZA 4DUPA 2P0EA 1PL6A 1LBSA 4AXXA 4A0QA 1R1DA 3QE4A 4CG2A 5FDFA 4OAQA 2WSIA 8ADHA 5ITSA 3FJ1A 4LAFA 3S5UA 2R7LA 2YKGA 1HYEA 3EGEA 4AJEA 1E58A 1MRZA 2ZJZA 3IQEA 3SYRA 3H16A 4DN6A 1KDPA 2DM6A 3ET4A 4AWBA 4BGIA 5A0FA 1SCQA 2V97A 1THMA 3D3WA 5JPCA 3ENKA 3EQ7A 4JBWA 2NT3A 4TLEA 5ERGB 3N2KB 4DXAA 2HA4A 1P74A 3H4TA 4O63O 3FFWA 3D31A 4CEIA 3JZAA 2VYND 2XUJA 3FPFA 3ZXSA 2ONZA 3BGWA 3NIFB 4G25A 3F2VA 4RL6A 5CHYA 2MYUA 3RJ9A 2ZJ5A 1PT7A 3P97A 4MQ4A 4CIYA 2Z30A 4GRDA 4A1OA 4D8XA 3TSOA 3I2KA 3IJPA 4XJSA 2ACWA 4ROSA 3OURA 5I7VA 2IZ6A 1EUZA 4Q3CA 4M21A 1QWSA 3CWQA 4F46A 4UNRA 2AVDA 2G4LA 2XODA 4RIIA 5IJXA 4D8VA 3NTQA 1R16A 1YJBA 4QKQA 2IU4A 3M5WA 1T4DA 4HMPA 3DT8A 1KRHA 4GSYA 1AXGA 4PFSA 3PI7A 2M6KA 4ZI7F 4W6QA 1VBFA 5FR1A 4P8RA 4ESVA 1G6HA 2QUIA 4RXUA 4YAIA 7ABPA 5KMGB 4TXHA 3EIXA 4BAGA 2WYIA 3SZLA 2PBFA 1KFCB 4M86A 2GF9A 4X61A 3D4NA 6Q21A 2JLZA 3P2MA 4LCEA 4D42A 3SKYA 2BMAA 2NUPA 4G8DA 1VIYA 3P4XA 1KAOA 1OI4A 2HDWA 4G0NA 4B7AA 2C0CA 3S8MA 4YRRA 1JPVA 4O0LA 4LHWA 4TN5A 1J21A 2JKYA 3VYSB 3Q6MA 1W8DA 3E0XA 4KJXA 2FPIA 4Y8VA 1M66A 4M6WB 4RTSA 2DU8A 3O38A 1M1XB 4X1YB 3ORRA 3GAZA 4ONEA 2R60A 1E4EB 2YJZA 1QHHB 4NKRA 3UWPA 4C03A 4G0PA 5JDCA 2G71A 5AKZA 1XDUA 5H70A 3T34A 1XPRA 4OLJA 4JIGA 4TTIA 2QLLA 1HC7A 4E51A 2D8AA 5JVDF 3BGOS 4CGYA 3KO8A 2XI4A 1ADFA 1IY0A 4B6EA 5HQ3A 4JA2A 2FY8A 4CUKA 1IM2A 1X70A 3CCBA 1MRNA 2ISCA 2FZLA 3F4BA 3F74A 2LUOA 4D7AA 4CXMA 1GPUA 2G4VA 4IDHA 4TWZA 1DC4A 3EW7A 4RD3A 1O9GA 3SJ7A 4GYYA 3DKIA 1MT3A 3WYEA 3QVJA 4N0QA 3SQWA 1XVVA 4ZU6X 3BK2A 1U1IA 2D2VA 2QVGA 3IURA 4K88A 1SG0A 4QXMA 5J2UF 5JYEA 1QK3A 1VL1A 2OMKA 4OP2A 1J8QA 4GMKA 4DQ0A 3WA7A 1QSGA 3AI2A 4URUR 2FDCA 2XNJA 2OAGA 2YOGA 4MYDA 4EA8A 1ORIA 5CVJA 4BNYA 4F5DA 3QKRB 2PKYX 3ESAA 2QL6A 4R1QA 3PGLA 4X3CA 4QYXA 3VU8A 3WNCA 3IOMA 3ZI4A 4MRMB 2HQSA 4KGVA 1CJTC 3FPGA 2BRUA 1MIHA 2SECE 2YL2A 1GTJ1 1U0HC 2HREA 4RANA 2H1RA 2Z8ZA 3GGCA 3TI7A 4FT2A 3X1JA 3I83A 1E32A 2C54A 3FI9A 2OHOA 4JVOA 4QYSA 4EHAA 1VMAA 3IUJA 3LF1A 1U80A 1GR1A 3R40A 1RVV1 4BKOA 1P9OA 3C7CB 4BWGA 5KNCH 4B3HA 1GM5A 3KQTA 4DT1A 4O4HB 4EY7A 2JA2A 1O58A 1IVSA 2GLUA 2DCUA 4J7XA 4OMFG 2OSBA 2HLNA 3E5HA 5DHQA 2AMVA 1UKCA 4I19A 1RXSA 3IBCA 3G8CA 1E3IA 5C7IO 2DLNA 2VKQA 1Z7EA 4UPDA 4KEAA 3ACBA 3UH1A 4EFKA 1FX1A 1YR6A 3SNKA 2GBGA 1PVVA 2X9QA 4UTZA 4YRJA 2EZTA 5AO9A 1ZNQO 1YB5A 3MOGA 5EE3A 5BN5A 1OV4A 3ME5A 5L3QB 3WWPA 2Y9PB 1BN7A 1XA4A 2OL4A 2KS6A 2QUKA 1EGVB 3GJXC 3PHGA 4FYHA 2JCSA 4D9BA 3A6ZA 3FH0A 3JD0A 4LMAA 4W1SA 1A9RA 3OEHA 4AJ4A 3SC4A 2W2KB 1L1RA 1U04A 4C3OB 2PUFA 5C5CA 3BFJA 3SKXA 3OLZA 4PTYA 2O8DB 1TLFA 1NI4B 3WYDA 1A77A 5EUCA 3QENA 1J07A 1JHDA 4UMEA 4OATA 2AC2A 5K0GA 2DECA 1WHTA 1IOWA 1JHPA 2ZJOA 4XA8A 5AOCA 2OP1A 1CR1A 3A2KA 2YRWA 1DXOA 4H77A 3IV7A 2G8LA 2BE7A 4Z9AA 3JD2A 1BXKA 3ZDZB 1SQ6A 3IV9A 4S1PA 3L93A 2A4MA 4RKYA 4RVUA 1MZPA 2ZBQA 1QG6A 8ATCA 2DLCX 1GSIA 2AR9A 1YJ8A 3LNCA 3DOCA 1TEHA 4JUAA 4YJDA 4ZD6A 4Q03A 3C0KA 5CNIA 2NTEA 2VF7A 3TIGA 3FCEA 2I4TA 3OFKA 2R8OA 3RVDA 3W8FA 1E59A 3VOSA 4DMKA 3ROTA 2E4VA 4JP8A 1RYHA 5J43A 2XH8A 5DX8A 1IRIA 1XMJA 2CW5A 4KQ2A 3FRJA 2ZRAA 4P4GA 3R2JA 1IZ9A 3LVRE 1Z06A 3GFRA 4NJMA 3KKQA 4BVGA 5CVEA 3LLCA 1RYDA 2C9MA 2I2WA 4JR1A 4OYHA 5J4YA 3QEAZ 1U3FA 4CT4B 4DCUA 1LPNA 2Q8PA 4KXQA 1KFEB 4AP9A 3FLAA 5DKFA 3MVEA 1O03A 1FNDA 1CIVA 1ZK1A 4JBYA 1Z8DA 4EGSA 4F72A 4F9TA 4R4JA 5JYCA 3TOVA 1KZYC 2EIHA 1GKKA 1U99A 1Z6QA 5ENVA 3NBAA 3HH8A 4RSRA 3AXTA 1LB1B 1UDWA 3OMLA 2WFZA 3NBQA 3THRA 2RHJA 1ADYA 4UU0A 1JYFA 4Q9LA 1ISMA 3JQDA 3JD1A 5JSUA 1EVQA 3SKVA 2Q29A 4U7TB 2RHHA 4QFMA 1EQUA 3LUKA 4UD2A 1Y6FA 4JZYA 3NP9A 4KR2A 2CFTA 1E2KA 1KK1A 1XTBA 4LY9A 4X8MA 3HV0A 3SYNA 1PDOA 4MTLA 1XQ6A 3MD9A 3EGDA 1EGAA 4MVJG 2ZM5A 3NBKA 4M9UA 5DGXA 1P5JA 3LT1A 1L5YA 3AW8A 3MTAA 2R8ZA 1DRJA 3N2GB 4HLCA 3II6X 4X1KB 3ZE8A 3EAQA 1YJAA 3UA4A 5TPWA 2J59A 2J5KA 3NKFA 3VO1A 5CAEB 1CY2A 3BTVA 3G59A 1E69A 5HF9A 4C0WA 4I55B 1PFWA 3AIOA 5ED4A 2X1LA 2BYTA 1W88B 2V7QA 3DOFA 1HEUA 2X7XA 3KPYA 1USKA 1R6XA 2P9QA 4U39A 3H5AA 4CHTA 4WKGA 3O91A 2HRDA 3DL7A 2BMJA 1GUBA 2OO5A 4Z3KA 2H4YA 1WVMA 5G4LA 4PEVA 5K8TA 2A1TS 4OJQA 3U09A 1IUPA 3ZDQA 1RXEA 1NASA 1KERA 1WVGA 5IXSA 3TGLA 3RS3A 2CJYA 3FJYA 3Q7QA 1YFZA 3LQ2A 5F3RA 3G0DA 5FPSA 1QAQA 1K5PA 3RLIA 4Q00A 5TQJA 3OCCA 1KHHA 3VKVA 2JD2A 3SS9X 4ZHQB 4QASA 1W93A 5TT0A 1CUAA 1JKMA 5C9ZA 3N2LA 2YYAA 3X3HA 1K3FA 1N0WA 1FDVA 4A5OA 3C7TA 1TZBA 1USUA 4BVKA 2FDRA 5EIBC 1OI7A 2ZRPA 3X43A 1CQIB 3F98A 4YUYA 2J48A 1TM3E 5L45A 3ITNA 1GU1A 2J0QA 1TOAA 3OZAA 5ALOA 2E37A 4MQBA 1E9RA 5BQFA 1V71A 2Z95A 5BVHA 2GEDA 1XNHA 1JILA 1K75A 1R74A 1R37A 1TUGA 2C5BA 2VZ8A 3MWEB 4CKCB 1NW7A 4KNWA 1W4CA 5KYYA 2FH5B 2VHQA 3LMKA 4XWYA 4ABTA 2B9EA 3IXQA 2DPYA 4PYMA 5G3ZA 5HIJA 3RJ5A 3DV9A 3AU8A 1YQXA 1GYRA 1AA6A 1FP4A 4W5OA 3ZV5A 1RFLA 4R0MA 2Y1CA 5KOIA 1FUIA 5I7AA 4DHEA 1T13A 3EOZA 5CFPA 5A5FA 5HMMA 1PF7E 5HTOA 3ZWMA 1RT9A 5LZ8A 4XD7D 4C5AA 2XXAB 3EZ9A 4KODA 3UMMA 4M7WA 4CDMA 1VJTA 2AJTA 4XVHA 1X6VA 5AQ1A 1NNEA 2HPHA 2CK3D 4BLRA 2ZU0C 1ORVA 2Q62A 3TB6A 1S8OA 5DFAA 1Z47A 3PYXA 4P9NA 2WJ3A 4DEYA 4DOMA 5KC8A 3PEUA 4WV3A 3P9XA 5LU9A 3U48A 4FOTA 5H7XA 3V55A 3A6EA 4L7VA 5K0LA 3H5IA 5K4GA 3ZHBA 2QUZA 5A1JA 2IZ7A 2H8KA 5AM5A 2Z6VA 3COVA 2ROQA 3OIVA 2R8YA 3PGKA 1L0BA 5DXJA 4ZHSA 1HE8B 1K6EA 2W4QA 4YQZA 5IJ9A 4WLOA 1U7UA 1VBNA 1G3MA 2O23A 4ZOLB 1NPTO 2AG5A 2CFCA 4HPWA 2KLBA 3OM8A 3UY4A 2XNDA 3AEYA 3TLGB 4PYRA 1E2LA 5B3JA 1W75A 5AJVB 3LA8A 1HOXA 4KIWA 2RAFA 3HKCB 3C41J 4KTTE 5J5CA 2HO4A 5AI0A 4XOUA 3DW3X 4ZOLA 3WWZA 2VJNA 1NJ1A 5AW0A 1XQ9A 2CDNA 4NOLA 5U1PA 1M7BA 3BRWD 3DCYA 4E14A 3HR8A 3FOZA 1DQNA 2EKBA 4OQPA 1XHEA 2ZS9A 1VKNA 3LZDA 4FGWA 3CW9A 1I51A 3B2QA 3D8RA 2XWJI 1Z26A 3O4GA 4ENWA 3K6RA 4HV4A 2BELA 5KVQA 1TMYA 1YL7A 2IHNA 3SG0A 2FCRA 4GMDA 2QBYB 4EI7A 3LGSA 2QTVB 1NY5A 1V1MA 4L76A 4NDZA 1U0BB 3HFRA 4FR0A 3LDAA 5HFNA 5FA5A 1W88A 2NZXA 1PVDA 2D2XA 2DE0X 2AZMA 4LJ6A 3RJMA 1HYHA 2WWFA 1JEEA 3JS5A 4PQEA 1JV2B 3N8KA 5EP4A 5I3CA 1YR7A 1RFGE 4YT2A 1P4SA 1GRVA 4P80A 4UHKA 1NMSA 1BA2A 1RWBA 4G8BA 4XDYA 4B31A 1E1NA 4UU1A 1QGDA 2X76A 4PAGA 3TCNA 3TLAA 1TIKA 4E08A 2F3PA 3DAFA 4XGQA 3WHLA 4Q3OA 3U4MA 3L7AA 3OJWA 4P83A 1LF0A 1Z12A 2BFFA 2CB9A 2HJHA 1R4AA 1W2WB 2WLTA 3HB1A 3NASA 3OIDA 3PBKA 4A8TA 4KO8A 2RAVA 4MYHA 2AF4C 3B3JA 3IP5A 4L50A 1WULS 1XEWX 3MK31 3K70D 2ZP1A 2PJUA 3M6IA 5BYBA 5KYNA 3T5AA 2C5EA 3NONA 5FOXA 3ABRB 1T5DX 3KVRA 4NAUA 3T1YB 2BSXA 3IHKA 3OZRA 1ISIA 4L8GA 4OXNA 2XMZA 5KNBD 2RDMA 2WUWE 3IUEA 1GPKA 2QJFA 3DOOA 3QXGA 5J59A 3UHFA 4MVJA 4DTCA 4O1IA 2YHAA 3CH6A 3K73O 1XTRA 2HSDA 1NHWA 1NPYA 2P4EA 2AHRA 4OMDA 2ODPA 4NYJR 1W581 1PL0A 2C7PA 3TW8B 5ALTA 5KTMA 1JP7A 1PGQA 2GN0A 1K7XB 2N0SA 4QOFA 5EOVA 4ARAA 3AVYA 4PBRA 2IPNA 3T15A 1QFZA 3B70A 1G21A 3QF4A 1DOZA 1N6OA 5C0OE 5PNTA 3AH8A 3AHDA 1DGQA 1YMVA 4ND5A 1SUDA 3PR3A 3I6MA 1IOZA 1I0IA 1IZ0A 4GE3A 3PUYA 3V42A 3VR0A 1JN0A 3X44A 3H5WA 3QUQA 5DBGA 1Y5NA 1SC1A 1GWNA 4DLBA 4LHXA 1G5QA 2CY0A 1K89A 1U3DA 4DYVA 5DM0A 4BXOB 2XMPA 3C6QA 2ONCA 4JLMA 1F1JA 3OOEA 1CX9B 3UN1A 1KC3A 3AEZA 1XZIA 3F3SA 2JIZD 3WSVA 4IFBA 4P7JA 1F8UA 1Z0SA 2PJRA 2B4KA 3I9V6 4BGEA 4DIBA 4CTOA 5KWIA 1RKQA 3OUZA 1Q91A 1IN1A 3D6UA 2J3JA 5DCWA 4YRKA 3QHAA 2PDAA 3NVMB 1MPTA 3NATA 1XZNA 2Y1KA 1W4LA 5L3QA 2PQ0A 2WJHA 5E6UA 1NXTA 2VFAA 1OBFO 1BU8A 2AXNA 2IW3A 3UTCA 4RZXA 3ZS9A 4E4TA 2BONA 2WG0A 2Z43A 4QVGA 4QYWA 1BROA 1HF3A 3BKWA 5CA0A 1X39A 2X8WA 3AEUB 5JG7A 1EXVA 3J80A 3WKEA 3JW8A 3KX2A 3R3VA 3TEMA 4QDUA 2MDTA 4RJTA 2X9GA 3WLLA 4DIEA 3G0OA 2QD2A 3CPJB 3OECA 4KQJA 2ZYWX 1HDYA 2F3TA 4JB2A 4HL6A 4BVLA 4G5YA 1HZZC 5IDYA 4AQ7A 1IUKA 4P3NA 3SE0A 1GA1A 1FK8A 3QJYA 2I1QA 3W5IA 3ZZ1A 5C2JB 3F6EX 1TMGE 1DL5A 1EXMA 3KLOA 4J49A 1DKRA 1K6XA 4OJMX 3EVDA 3V3TA 3WADA 3WKAA 5CBKA 4CBVA 5L4NA 2GM4A 1V8BA 3D8TA 2DFKB 1XN1A 1OU0A 1NLUA 3OM0A 3E5RA 1T6NA 1Z2AA 1YA6A 1UJMA 2O2IA 3IVAA 3PC8C 4X95A 4WAUA 3N7AA 1YCDA 2Q9AA 4V39A 2Q5QA 3NTVA 1FX0B 1P81A 4NFSA 5EGSA 1L5HB 1QIHA 4WOPA 2ZB3A 3C5HA 3QA9A 4G5RA 1N78A 2Z9BA 3GMTA 3QPBA 1JKJA 1RQ2A 3FHCB 4LPSA 2CBXA 1OFUA 1C9DB 3COZA 3MWLA 4MAFA 4G1MB 5B7QA 2NZYA 3R6LA 4ZOBA 3FM9A 1DAGA 3I92A 4F3YA 3ND7A 1NVKA 3V00A 4KUEA 1V3TA 1C3OB 5BT9A 4OHYA 1SH7A 1V7QA 1GUYA 4XCXA 3MYYA 4IDFA 2WJ6A 1YVRA 3KKMA 2NU8A 2YQZA 2FSUA 4BV9A 2I2XB 4FZ3A 3UAOA 3CF6R 1UPXA 3GZJA 2V6IA 3AR4A 1X13A 1AXRA 3H5RA 5TPZD 3QPCA 4HUQB 4IDDA 4Z0HO 2IC5A 2R7KA 3MD0A 1B76A 4BECA 3R6WA 2FA9A 3LP6A 1K9SA 3T7JA 3A6JA 2D3TA 4BNKA 3KUXA 1A9ZA 4DVJA 3UMGA 1P0IA 1EWQA 2HXGA 2HQOA 4J8PA 4YS6A 5BN3A 1GLVA 4JL8A 4ZV7A 5JS7A 3UUEA 4HCJA 5EMKA 4HNRA 3KZNA 2TECE 5I9TA 1N3IA 3PDHA 4G36A 1WV1A 5IN5A 2CDAA 4FPXA 4EB0A 4GZMA 1H0RA 4QJ4A 4RKRA 5EZYB 4EHIA 2GUGA 4B7CA 1PYGA 4PZPA 2C2HA 4MEBA 4AIIA 5BV1A 2CNWA 4R2IA 4RU1A 1C29B 2IP2A 1BDJA 3FX2A 2B8TA 5C4MA 1G8HA 5DI3B 3M4ZA 5B2FA 3CUTA 1WETA 3IT3A 1MEOA 4B3XA 1LBTA 1CZKA 5LQCA 4ZDKA 3T9BA 4XTRA 2P1DA 2IYOA 3IKLA 2B1QA 5BSKA 4M4SA 5HQJA 1XCMA 3BBPA 1WWKA 2PLAA 3BJZA 1C9JA 2EW8A 4O2RA 1DQZA 5KTPA 5LBTA 2BR5A 1J8FA 2BGGA 2XTJA 2J3EA 4M0KA 5HRCA 5LA6F 4BY9E 4PHTA 5D7NA 3WNQA 1CVIA 1S6YA 2GXQA 4JYCA 1G9TA 3ASYA 4F4DA 1L6IA 1BHQ1 3W1EA 5HKOA 2Y1OA 5JCZA 4QXRA 4EVRA 1E9CA 2I91A 2ZUTA 4DSAA 2COUA 3B9RA 4H4EA 3OA2A 2GCOB 4NAVA 3C70A 4FBGA 1TFUA 3W6NA 5C5EA 4HAIA 1PJAA 2PFKA 3S3TA 3V5NA 4B35A 3RGWS 2JRLA 1NVAA 1FU7A 3BD8A 3L1JA 5JWHA 4WL0A 2B4TO 3PGVA 4RD4A 5E7IA 4AUMA 4E94A 2UVDA 4C6HA 5IF3A 1JTVA 4PNPA 5AM1A 3IPAA 4MGYR 3RHFA 2ZVPX 1C4WA 3VZPA 4DY4A 4V0LA 4I4LA 5I8WA 3GQBA 4KXMA 3D64A 2CMGA 4Y2HA 3EC7A 3ZTYA 4BLQA 5JS1A 1EB9A 3H1GA 4I50A 2OBYA 5HFAA 3BFKA 4Q24A 5K6RA 1HT3A 2Q3MA 1YZUA 2UYQA 1N1EA 4RYDA 4K0RA 1YS4A 3PU6A 1QK4A 1DAIA 5I7SA 4UUAA 5KHOC 2VP0A 2QD5A 2NVOA 3LY7A 3TJMA 1FTYA 5ALNA 5M34A 4DKXA 4RK5A 3BORA 3D2AA 4ILKA 3DTYA 3NYQA 2J9GA 3TEFA 2OCAA 2VPQA 3LXMA 3EJWA 4FZJA 4P3OA 2QOEA 4YRGA 1I2AA 5MN4A 1T9AA 1PEYA 5A62A 1FW6A 3AM4A 4NAHA 3CG0A 4B74A 4IQGA 5JZSA 2PUHA 4N6NA 2B35A 2C84A 4DEVA 1GIAA 3C74A 1AUVA 2XF8A 3AETA 3O4RA 3QXXA 1MHTA 2Z9DA 4LF5B 3PIIA 3JYQA 1X1AA 1ZRSA 4MS1B 3DXXA 1NF9A 1PR1A 5SZJA 2JD1A 4RK1A 3RUDA 4D81A 1S2DA 4QNMA 4S04A 4OP1A 2XTMA 1PT5A 2W2TA 3FOFC 4A1FA 1FLVA 4WOBA 3RVMA 3ZNQA 3V97A 4FKZA 1I94B 2ILTA 3CA8A 5LLDA 5K0NA 4HAYA 3QX3A 3G85A 1ZH2A 3NW9A 4BAZA 2XEDA 5DN9A 1W5SA 3QU5A 4IO0A 3TPFA 4C29A 2OP0A 1KOFA 3AJRA 1C1YA 1J39A 2YIMA 3TZCA 3F4LA 4OHVA 2E89A 3WP1B 3ZCVA 1UAAA 4OKSA 3DEAA 1AF4A 3LLMA 3DE6X 2IUTA 3JRNA 2KQUA 1SUPA 1EXNA 4W9NA 3OX2A 4TUYB 1PIWA 2YJ6A 4TZKA 3LX4A 5AKIA 2WU3A 5BV8A 4N41A 3ABQB 4LDNA 4EPXA 4ZOEA 1G2IA 3U0BA 4UHJA 4YEDA 1WCIA 2W0SA 3G8DA 2PSHA 3MXOA 3P2JA 4EY5A 2QRVB 1I01A 1NVMB 2Q2QA 3FPJA 4N3BA 4C4RA 5DLDA 4EHDA 1JA9A 3LZCA 2QV7A 2XCUA 4MXDA 4ZT2A 4A8HA 4CKCA 3LX8A 3RRXA 5JRDS 4W9MC 3UJAA 1Z83A 5GZ1A 3AWDA 2FSVC 4H60A 3TDKA 4EH1A 1ECCA 3PC2A 4I1RA 3W4KA 1AUPA 4F92B 1I2ZA 2J9FA 5H3LA 3VZDA 3VC3A 3CLTC 3PEYA 2BM0A 4A0HA 4D0NA 2AN4A 2YH2A 1F06A 4BE9A 4EA7A 1U1DA 4JQYA 2BFEA 1OWMA 4YGYA 2CD9A 1LDBA 3HSSA 4D80A 3ZKWA 3G0IA 2CLDX 2C1XA 2Q1TA 4ZQFA 5GQSA 3P9KA 2IVZA 4D57A 4DDKA 2VHYA 4PYIA 1G21B 3PS9A 5CIYA 4GQAA 4D56A 2WDPA 2J4CA 3KQPA 5CDFA 4AJLA 3VNSA 5EIOA 4RYLA 5EUBA 4U7DA 4F3CA 3R7DA 5KIAA 2WU8A 1R7RA 4CMKA 4BU0A 5KQPA 4OHMA 4I08A 5HS4A 1EK0A 2DR0A 3ZC3A 3CX4A 4AKHA 1C9EA 1BCRA 2BEKA 2ZXFA 4NG4A 3I2HA 2C2KA 4KNVA 3QYJA 4Z4FA 2IYPA 4NBVA 5DV9A 1NOJA 1P3DA 3EDQA 3OP1A 3GG2A 4FMCB 3EXEB 4CM5A 2JHFA 1JH8A 4ZGBA 2IP4A 1ZBDA 1L5RA 3CXUA 3M3HA 4ZVPA 1NT4A 2JLQA 1G7TA 4NS4A 4LGCA 4ZTZB 1W44A 3D1LA 4UU8A 4CF7A 3HBAA 1JQEA 4M98A 1NQUA 3GMSA 2OD7A 4CNQA 16PKA 5FYDA 1MTOA 1QV6A 4MGHA 3EF1A 2TMDA 1Y9JA 2OLKA 4MAMA 2FGJA 2AFHE 3BZWA 4XDZA 3SLRA 4YFYA 2VSYA 3P2YA 2P79A 1MGPA 1PK8A 3HDTA 3UMJA 2ZBDA 1T1RA 2Z57A 2SHKA 4OU4A 2HBZA 3TLXA 2RHBA 5AH0A 1UKVY 1P7YA 1ZOSA 2AFIB 3HLKA 2OILA 3ZJTA 1T8RA 4TMFA 1HSZA 2LCIA 4Q1BA 3ZE9A 3C4JA 1SXPA 3KE8A 4WUVA 4BQNA 3O31A 5EEGA 3BCRA 1KI9A 4FONA 1EUDB 1FSFA 4WK6A 4YCJA 4A6XA 2ZIZA 5K09A 3LC0A 1TA9A 3CPEA 1FFWA 3KOZA 5A4FS 3IKVA 3W7BA 4PYOA 1F5SA 1S2GA 4PC3A 2CWDA 9ABPA 5C8YF 5KYKA 1P1HA 3AB3A 1R4NA 3ZU4A 1G1AA 2XNSA 3L4KA 2RGAA 2YINC 2QTHA 1E2EA 2ZSEA 3RSOA 4WY2A 1NQAO 2IHTA 5DHFA 2IHJA 4MLPA 4PS1A 3NS7A 2N1BA 5GVRA 2C1ZA 4HEQA 4M60A 4Q1EA 3AESB 4UBJA 1OYWA 4TTRA 2A5FA 1VC2A 5IDWA 3NTLA 4GR9A 2H3EA 2G09A 1JA1A 4YMHA 3VYTB 1WNFA 5K0SA 1GQQA 1UT6A 4F1JA 1C3XA 5F5LA 5THKA 2JFOA 4EUNA 1Z0DA 4XJTA 3RYTC 3H9EO 2AOWA 1DX9A 2RI1A 2ECFA 5FULA 3GRUA 1CJCA 1Y9ZA 2PL5A 2IOHA 2XVZA 2V0CA 3NHPA 4YRTA 4ECAA 5A5GA 3M6WA 3ER9A 3QELB 1EA7A 2OUKA 3K1TA 4NR0A 2GZ1A 1SCUA 3PI6A 5DSXA 2F17A 3I64A 1CVLA 1TK2A 1V6CA 2GF0A 4ZCTA 1Z6GA 4KYIB 1N9KA 1W5BA 4FUQA 3AVUA 3CLUD 5DRYA 2Q2VA 1QYWA 4JNKA 5GGXA 3W90A 4PZ0A 1D6SA 1SJ9A 4MWOA 2XB9A 4TQGA 1JEQA 1PUJA 4YV7A 1E6WA 1JIKA 3NT5A 4F8YA 2I7DA 2QZ9A 4JL6A 5T41A 2JIBA 3EX7C 4UQLA 4WZ6A 3PSHA 1XZCA 5AMXA 1HYQA 2C3PA 4CG3A 1SIBE 1FFYA 1SKAA 3QLJA 2J9ZB 3TRHA 3QKWA 1PEAA 2PUAA 3IDQA 1T4CA 4K46A 1L9XA 3TZQA 1X8LA 2VYCA 2WWXA 3L2OB 3DEFA 4XWWA 3CJQA 4IIYA 1Y5IA 1JR3A 4BMYA 4FWIB 5F3WB 4AI6A 1L7PA 1PQWA 1EJ2A 3HUFA 5JWOA 4G4GA 4GBMA 2ZCJA 4G65A 2I4OA 1GNSA 4AIRA 3A1UA 1ZC4A 3IRUA 2HMTA 2ZWPA 3I52A 2SICE 3RRMA 3WLEA 2TRSB 4AFNA 4F5YA 2C9CA 4MPJA 1V2GA 4D3DA 5LM3A 3ZDDA 2HBYA 4MQFB 4ZCIA 1QOZA 2Q2NA 4J4BA 3H0KA 3U7EB 4A03A 2F59A 1CEQA 4RPJA 4ZV9A 3GLHB 4EZEA 1S8FA 4RETA 1WPQA 4HNHA 1DKUA 4JGGA 4EK9A 4UC0A 1VPVA 5ELLA 2EX0A 4V1CB 3ESXA 4RTPA 1AH2A 3BUSA 2X41A 3AF4A 1KEVA 3K6JA 1OU4A 3HE3A 3DDZX 1YK0A 3IAM6 3DZDA 3KE9A 3M4JA 4P7FA 4WTOA 4F9EA 1LVUA 4IXMA 5JSQA 4G4SP 2FUG6 1L4NA 3W79A 1LZLA 3DE1X 2Y0EA 5EXSA 2R1TA 2IYQA 3R8FA 3BWMA 2A5DA 3KKZA 4A2PA 4WE3A 2IA5A 1WZCA 4AKEA 5KWEA 2ZULA 2KYRA 3JQBC 4FHZA 1Q77A 2HJRA 4O4LA 2G9NA 5EZSA 2OB1A 3TOZA 3QX7A 4ZIRB 3SXJA 4KMOA 2QBYA 1UWCA 1YA8A 3GB9A 4GOOD 3VPBA 1NA5A 1WU8A 3NOQA 5JLAA 1Z5WA 4AJ2A 1HT2E 4DLRA 3ZH2A 2E48A 3OQIB 1WO8A 1GL6A 3KTAA 2LKCA 1I2BA 3N75A 1JE0A 1E3EA 3FWYA 5JD3A 4YRSA 4IJ6A 3IIJA 3RQIA 1C9NA 4JBGA 1DBWA 2CGEA 4M99A 1DADA 2R4TA 3G9XA 3OOSA 2XUKA 4IXDA 4NBRA 4RLFA 1O08A 1YCFA 2CVFA 3K5WA 5TRTA 1JR4A 2QRNA 3KB1A 2M6LA 3LOUA 1AKRA 4OHZA 2VP5A 2R85A 2ZS7A 3BZBA 1AC5A 2ACKA 1KO8A 3JXEA 1IJBA 1OIWA 4L6IA 3HGTA 1HL7A 2PX2A 3T7CA 3ENNA 4ESHA 1JQ3A 4HN4B 5AKJA 3P0JA 4IHQA 1Q7EA 1GPMA 1QUFA 2AFIE 3PE4A 4MZXA 5C1PA 1I7LA 2VSFA 4Q4HB 1UIMA 4AF8A 3PFKA 2HYIC 1TPZA 1NVDA 2VTVA 3DCJA 3PXDA 2HMYB 4U7WA 3TR6A 4QAJA 3UPTA 1P3Y1 3CV3A 2POCA 3GRPA 3LUAA 5ALVA 5AVUA 4OQYA 1G59A 4BLUA 1DZIA 2DEUA 5M3BA 4LHSA 5AJZA 4HWOA 4WA7A 1TMOA 4GXRA 2PAFA 3BPSA 1Q84A 1UZUA 4NS1A 3JVDA 4DHWA 4D02A 3FMVA 1WR8A 2WEKA 2ZUSA 5JXJA 3SYLA 5FR2A 5CFNA 3NQ41 4U63A 4N5HX 3R20A 4EG8A 5E2IA 5CH5A 5AVKA 3IKJA 3OZGA 3K1ZA 1MOPA 1CUIA 4I50B 3DKRA 2O2DA 1QP8A 2ZAMA 3BMOB 4Q1DA 4HVLA 1WDMA 4FYYA 5IBPA 1I3NA 2VHJA 2ZIXB 2ZJFA 4V2IA 5TXGA 3AUJB 3CS3A 3EASA 2B9VA 2CL6X 3FUUA 4JUCA 4MA5A 1AMNA 5KSPA 2VL7A 1KZ1A 3E70C 3JWJA 1NF3A 2ODAA 1G20B 4KE9A 3S2SA 4NENA 2INGX 2A5YB 1EP2B 3JVEA 4EITA 3K0FB 5L8VA 1QH1A 4K6HA 1JQDA 2WB4A 1ICEA 2QG6A 1CEXA 4BUJA 2NVUB 1O97C 1II8B 2WVHA 1R4MA 3IP3A 3C8DA 4Q66C 1ABEA 4TV8B 2QRQA 2FEAA 3EGCA 1K6JA 1A2KC 3SIPA 3QOFA 3DBHA 4IS2A 4MV4A 3IDZA 1VE7A 1LNZA 3H2SA 3JQEA 1E4OA 4NZPA 4UAGA 1M2GA 1IG0A 3UZUA 3BE5A 3OAAA 1IB6A 2A0WA 3A1CA 4YCMA 1FU4A 2EW2A 3ONNA 3K0FA 4Q1FA 3RUEA 5KX5A 1PWHA 4QUKA 4RD0A 1UBEA 1HNWB 3M6UA 3JQ8A 2AFVA 1FX0A 5BXYA 4CM4A 4H18A 3IKTA 3QEBZ 3I05A 2RKBA 1TEZA 4I1YA 3JQ7B 4R6WA 3P0EA 1LDNA 2FPSA 2FR0A 1H2AS 2EU8A 3PLAE 2EDCA 3CBQA 4RVCA 3U19A 2OM2A 3RIHA 4J6EA 1XELA 1Y5RA 1YBMA 3IIEA 3OTIA 3OQMA 3INTA 5LXTB 4YIHA 1GZUA 2P4UA 2VSQA 2ZKLA 1INLA 5EZYA 4EW3A 1Z4PX 4MAAA 1DXHA 3VKUA 2FMIA 1HDGO 1Y4UA 3AMVA 4C4XA 1J7KA 4TQUS 1JVNA 1QTIA 2HMVA 2GERA 3LF2A 3P9QA 5FV7A 2B4YA 2B5WA 2BCEA 1VTKA 4JLSA 3VGPA 2YDXA 2BBTA 4FQ8A 3U2QA 3E18A 4D2IA 2DPXA 4Q3BA 4ZCRA 3T4EA 5G0TA 3ILXA 4IV0A 3FJOA 1RC1A 1X0XA 3QM1A 4GBED 4JJKA 3VSDA 3WB0A 4I66A 4M2LA 2OZEA 1IUNA 3M9XA 1L7OA 4E15A 5IM4A 1OD6A 4CLHA 3QMPA 5GGYA 1VLVA 3QUAA 3O4FA 4LXQA 3KFXA 4BFYA 2OHJA 2VT7A 3AIKA 2C78A 5EVCA 2RC5A 3QUBA 2JATA 2OWDA 5AHRA 2J5XA 4IIJA 4OJKA 2KBEA 4FMBB 4HGQA 3QFTA 4GX1A 4NBWA 4QXOA 3SHOA 5AW1A 3S8YA 3I2YX 4RMJA 4UW9A 3D0RA 4MSUA 3T4XA 1WKCA 1IZ7A 2J30A 2Z04A 3BB4A 3H9BA 3EGOA 4OVKA 4RH1A 4YDHB 3O26A 4QOJA 2B0CA 1QHEA 3I09A 3CO0S 3VTKA 2PVPA 2JARA 4KBYA 4MQ5A 3HGQA 3WIDA 2JPDA 4TTVA 5ICMA 3L07A 4CTKA 4X5OA 2RHDA 4CM8B 1TD1A 2R7AA 4UKDA 3HVRA 2DMRA 3SPXA 4C4YA 1TU0A 5IEBA 7YASA 3WGGA 5E95A 3ICQB 3H42B 2QK4A 1W0CA 4HX5A 2RBKA 3DTTA 4ZZ1A 2ZUUA 1MDFA 3KV1A 2Z2ZA 3BEOA 1EE1A 2WM3A 4YV0A 3OF3A 3KETA 2XUZA 2VZ0A 1U7DA 2GJ9A 1XN4A 4ZO9A 1OBOA 1ZK3A 3O4HA 2CLIB 1M34E 1I0LA 1E9BA 4DM7A 5EJFA 5EWMB 2FF7A 4II2A 1E89A 1Y48E 1O0SA 1EI9A 1E6LA 1KPGA 1E4EA 1UBFA 3CH5A 1TKRA 4PE5B 5DWQA 3GP5A 1RXIA 3G0BA 1E9VA 2HPZA 2P3QA 1Y1RA 3T9EA 4NDAA 1RPAA 2O2SA 1J2UA 1Y9AA 4LN1A 4LRQA 2EKLA 4Q3EA 1LVGA 2EHJA 4NBNA 5E0KB 2FWMX 2R751 4LVOA 2Q4RA 4HFRA 3PLRA 2FPMA 3NHRA 2M2IA 3U80A 5FOTA 5TY0A 3FKSD 3ROQA 4RHCA 4CTJA 1PW7A 2OV6A 4CKYA 1Q1ZA 1TZJA 2RIRA 1TK3A 2FF5A 4D9IA 2W2MA 3T4PA 3MGAA 4N48A 1ZM9A 2QNRA 3FN4A 4GGMX 1G41A 2BUCA 3LBYA 5T64A 5K3OA 3G02A 4WVLA 3GT4A 3RU2A 3BQ9A 3AF3A 1H2WA 1YBHA 1ZRMA 2AXQA 4Y2RA 4KLAA 2F8TA 4XH9B 1BJRE 4REOA 2GYVA 1DTWA 1UP4A 3NHFA 1QFXA 2ZSUA 1VKZA 4IWNA 4M1TA 1M0EA 4HN2A