2WJAA

Crystal structure of the tyrosine phosphatase wzb from escherichia coli k30 in complex with phosphate.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
152
structure length
146
Chain Sequence
PRGSHMAKLMFDSILVICTGNICRSPIGERLLRRLLPSKKINSAGVGALVDHAADESAIRVNGLCLKGHRGTKFTSALARQYDLLLVMEYSHLEQISRIAPEARGKTMLFGHWKEIPDPYRMSDEAFDSVYQLLEQASKRWAEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ACID PHOSPHATASE WZB
publication title Crystal Structures of Wzb of Escherichia Coli and Cpsb of Streptococcus Pneumoniae, Representatives of Two Families of Tyrosine Phosphatases that Regulate Capsule Assembly.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 48
structure length 146
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wjaA00
4MR9B 5C5CA 1C0EA 4KNYA 1T34A 2QVGA 3QLUA 3JVIA 3B2NA 1JFSA 1YK1A 4KREA 1MAVA 1F4VA 2NUBA 2HQOA 2FN9A 2Q5CA 4G0QA 4W5RA 4NCBA 4W5NA 4KQ9A 2FLKA 1MVOA 3RVKA 3SG0A 4UHKA 2IDMA 1YTUA 3Q15C 4EYOA 2ID7A 4Y9TA 5CNIA 4YS6A 4D6YA 4EVSA 1AB6A 4KFCA 2IKSA 3O21A 1E6MA 3P9YA 4E7OA 3ROFA 1ISSA 4TMYA 1JYEA 1RZRA 4H3KB 4L85A 3C3WA 2JK1A 4Z4EA 3TX6A 3O2SB 1RXIA 2CHFA 5KQGA 2L18A 2FXIA 2WB4A 3VNBA 2B1JA 3LKVA 4RK4A 3CTPA 2PAFA 1Z2DA 3RVLA 2IPAB 3IP7A 4MR7A 5JNTA 1U0SY 3S99A 3SM9A 2PUFA 2I6FA 1R8JA 1EAYA 5I4CA 4GNRA 4EYGA 3HZHA 4G0MA 1E2BA 1GCAA 2LP4Y 1VLZA 3FFXA 5B3JC 2DRIA 3O2JA 7ABPA 2QV0A 2O20A 3HCWA 4PE5B 3CU5A 3G1WA 3TD9A 2QR3A 1U2PA 1NXSA 1GUBA 2QVCA 4RXMA 1VRVA 3A10A 2GBPA 1ZY2A 2E4VA 4XFKA 5TQ2A 4KRFA 3F6PA 4IRXA 4G0XA 3C97A 4YO7A 4NCAA 1DCFA 4EVRA 3L6UA 1BA2A 1XHFA 4MQEA 4MLDA 2FQXA 4EUKA 3JY6A 1FQWA 1ZGGA 2FEKA 1JX6A 3GBVA 3DGEC 5BR1A 4KVFA 1NXWA 1DRKA 1NXVA 4ZJPA 1M5UA 2MSKA 5KC8A 2IPMA 4H60A 2E4WA 4WUTA 4G97A 2F8SA 1Z26A 3HEBA 3O1HB 1RNLA 2XDYA 4MRMA 3KSMA 4W5OA 3JS5A 3MIZA 4PYRA 4JAVC 4RK0A 4KZKA 1GCGA 3Q7RA 3O1JC 3FFTA 1J56A 4XAQA 8ABPA 1EFAA 4ML3A 2WJAA 3H5TA 3CG4A 2B4AA 1QP7A 1AB5A 3N0RA 3IP9A 2FW0A 2NZVG 3EDCA 4D74A 4E7PA 4MQFA 1TM2A 1K66A 3BRSA 6ABPA 5B3JA 4G86A 3N75A 3MQ4A 3JTEA 2FMKA 4RK5A 3HXMA 2PUEA 5PNTA 1S8NA 3MYYA 2R47A 1ZITA 3Q7SA 1M2EA 3MMNA 2ID9A 2NT3A 4IGAA 4MR7B 3OLZA 4RY8A 2NZUG 3OO0A 3BRQA 3OLYA 3ILYA 3OMXA 5FWYB 4KPYA 3UKJA 1D4ZA 2FQYA 3OLWA 5EWJA 4KK4A 5TQ2B 5HSGA 3KHTA 1U8TA 5TQ0B 5T3YA 4Z4GA 1LJUA 1L5ZA 3QLTA 3EODA 2PUGA 4MQEB 3HO1A 1Z13A 2N9UA 2H3HA 4XXHA 2E4UA 5BQ3A 3H5LA 4LE0A 4OG2A 2BGGA 2HSGA 3EQZA 5ED4A 1ZH4A 1Z12A 1NATA 5D2CA 1ZN2A 3LMKA 4W5QA 3QLVC 4O1HA 5CNJA 1IIBA 1BAPA 2OENG 3DBIA 3F6CA 4MRMB 4RKRA 3T6KA 5C5EA 1CEYA 1DG9A 3KG2A 3LUHA 1EWTA 5JNUA 4YLEA 1C4WA 1PEYA 3RQIA 4RWEA 3SAJA 2FEPA 1ISRA 1EHCA 3BILA 1JF8A 1QO0A 1KMIY 1SXHA 1YK0A 2IPLA 2WY2D 5HKOA 3HVRA 3F7NA 1BDHA 4KMRA 2ZAYA 3LKBA 2LPMA 3N8IA 1NY5A 4MQFB 3D8UA 4WT7A 5IX8A 3KTOA 3ILHA 1PNRA 2A9OA 1JDPA 1YMUA 3SNKA 2JVJA 5IUKC 2WRZA 3KCNA 3MA0A 4JASB 1JDNA 3NHMA 3BBLA 2A9QA 4RXUA 4DQDA 4EYQA 2LIVA 3GA5A 4Z9AA 2X7XA 5CNMA 2MSWA 2WMYA 4WXEA 2ZWMA 1D1PA 1FFSA 1CHNA 1QKKA 1SRRA 4P98A 3CZ5A 4Z9BA 1Z18A 3RH0A 3DZDA 1W25A 2FTKE 3CFYA 4F12A 1WETA 1CYEA 1I3CA 5EWJB 1LK0A 4JB2A 1JFVA 3QLVA 4TLLB 1D2AA 2GKGA 3FDFA 4Q6WA 1GLGA 1QP4A 3KLNA 3MM4A 4YR7A 1UDRA 2E4YA 4RY0A 2HJ9A 4FE7A 4G0ZA 3RVQA 3HUTA 4HYEA 1KRWA 5KQMA 4EVQA 4XARA 4KK3A 5EWLA 3GL9A 2KYRA 2MYTA 3QEKA 4Z0NA 1ZHHA 4F8JA 3LUAA 4DN6A 5FWYA 1JWLA 3OO1A 1JFTA 2JBAA 3GV0A 6CHYA 4FB4A 2IYNA 1YVUA 5ABPA 1YMVA 3HM9A 1P6QA 4TN5A 5DGCA 2FEWB 3QX9A 5TE9A 5TQ0A 5TPZD 4MPTA 5IUNC 2IOYA 3O1IC 2L2QA 1JH9A 3KJXA 3D02A 2JVKA 1JHZA 3C3MA 3QK7A 2WJWA 5DLEA 5KI6A 1U04A 4JA2A 1GUDA 4QICA 4ZYLA 2V0NA 1JLKA 2A9RA 3LTEA 3E61A 1USIA 4KV7A 2L19A 5JNWA 4S05A 3OLXA 3A3KA 3KLOA 2QZJA 2VYCA 5FBHA 2J48A 3RVMA 3MF4A 1D5WA 4Q6BA 4KQCA 2QW1A 4O1IA 3ROTA 4PICA 3QEMA 3NNDA 4MLCA 4MS3B 2A9PA 1DCKA 1DC8A 2JRLA 3NHZA 4QYMA 2PUDA 1OXBB 4LE2A 2CHEA 3H5VA 4IILA 4NQRA 4L4UA 5JNSA 4MAAA 2MYNA 3G85A 5DTEA 3HDGA 3HJFA 3CKMA 1PNTA 4OLAA 4NICA 4N47A 3H5OA 5FBKA 3N6VA 5GOTA 4ETNA 5EWLB 1D1QA 4N0PA 4ETIA 3A0RB 3C3KA 1P6UA 1ZDMA 4WZZA 1A2OA 4Z4HA 4Q7EA 2FMFA 1RPJA 4F11A 2GX6A 4XASA 4ZMRA 1QQBA 2JBAB 5IC5A 3T38A 4OBBA 4S04A 4IF4A 4TLMB 4HNSA 1DC7A 3UK0A 4OATA 2PL9A 4RK6A 3IP6A 1NXXA 1TJYA 3I45A 3KS9A 3LUJA 1Y1LA 1VPWA 3JPWA 2M98A 3CG0A 4YP9A 4MGEA 3HK2A 3O74A 3NNNA 4RSMA 1M2FA 3QLUC 2NT4A 2E4ZA 2FMHA 1EWVA 3GBPA 1ZAYA 1TLFA 1URPA 1FFGA 1XWWA 2QSJA 3HSYA 1ZH2A 3GYBA 3HDVA 1KRXA 3DLHA 1K68A 3C6QA 1DJMA 5IUJC 2MYUA 2CD7A 2YHAA 3CZCA 4N0QA 4WWHA 5JNRA 1NXOA 1KGSA 2HQRA 4XLTA 3GRCA 2VUIB 5KQLA 3IPAA 1Z17A 1MB3A 2HPHA 5CHYA 3LUFA 3NNSA 1DCMA 2TMYA 3SQNA 2H0AA 3QEMB 4OLBA 3H5IA 2JB9A 1YIOA 4RKQA 3LOPA 5JS2A 2PUBA 1OXKB 5DCLA 4N03A 3OQMA 3Q7TA 3KYIB 4GPAA 3Q9SA 2M1ZA 2QU7A 2R4QA 3IP5A 3H6HA 1JBEA 2OQRA 1QP0A 2FSPA 1EWKA 4YRZA 1RZRD 5EWMA 3QELA 3T95A 4JP1A 4RXTA 5F64A 2PUAA 1PUXA 4MS3A 3URMA 3FGZA 3IPCA 4ETMA 1SXIA 1Z25A 1LBHA 5IEBA 5IULC 1E6KA 4P1ZA 1H9CA 2MYPA 2PJUA 2P4UA 4IMIB 3K9CA 4QYWA 1YS7A 3EAFA 5KWSA 3GWGA 2AYZA 3OQNA 3M6MD 2JVIA 3R0JA 1MIHA 5JNVA 4OTZA 3NBMA 4RU1A 5BRJA 1Z16A 3L49A 4YGXB 3W9SA 3KKEA 5BRAA 1TVMA 5IBQA 4NV3A 3E3MA 4ZMSA 3M9XA 2HQBA 4HNRA 2PUCA 4EY3A 1HEYA 3HV2A 3TMYA 4YV7A 1ZGZA 4M88A 2RDMA 3F73A 1MB0A 4MR8A 3EULA 2FKAA 4Z4FA 4RZSA 4DADA 1BVHA 4UHJA 1NTRA 1SXGA 2VUHB 1DBWA 4LE1A 4YCSA 3EJWA 3RVJA 4JOQA 3H1GA 1JYFA 1ABEA 4H3HB 2FVYA 1ZESA 1F51E 4MS1A 3OM0A 1W9HA 3HUUA 1DP4A 3EQ2A 1LBIA 2FQWA 3RVPA 1QPZA 4W5TA 3CS3A 3T8YA 5FWXA 1FFWA 2AYXA 2P9HA 2R48A 3H6GA 4ZPJA 2W42A 1DBPA 1DZ3A 1NXPA 1PHRA 5EWMB 3QELB 5TQJA 4PZ0A 1E6LA 2RJNA 4RK1A 3RVOA 2PE5A 3CNBA 3K4HA 4B09A 1USKA 1NXTA 2R25B 4PEVA 4RY9A 5TPWA 3LUDA 4JB0A 3JPYA 5KC9A 1LJLA 2CWDA 2PL1A 3EGCA 3LFTA 5E3JA 5TPZA 3N0WA 5IEJA 1A04A 2IPNA 2MSLA 4WXMA 3O75A 1L5YA 3OMWA 4LDZA 1APBA 3KYJB 1P8AA 2GWRA 3H5WA 3I5AA 3UUGA 4MS4A 2LBPA 5KQPA 2JCGA 3H75A 1B00A 2GI4A 3M9WA 3VNAA 2YHBA 4LRQA 3CHYA 3H1FA 4RV5A 2QXYA 3TB6A 2RGYA 2FN8A 1ZVVA 5DKFA 4D6XA 1BDJA 1A0OA 2WWVD 4EYKA 2RJOA 4MR9A 3N0XA 4G0YA 1Z15A 4F06A 3FMVA 4N76A 4IMJB 5HM6A 1YS6A 3HS3A 3IDOA 5HQJA 3RVRA 4MR8B 5JS1A 4G0PA 3Q41A 2FLWA 2PMCA 3LUKA 3SY8A 4Z4IA 1SD5A 1QNLA 2L17A 3OM1A 2PKXA 2F8TA 4QPJC 1QQAA 4G0OA 4MS1B 3LUCA 4RDCA 2VK2A 3A0UA 3RVNA 3LUGA 3FFWA 1Z2EA 3CRNA 4LDAA 2E4XA 4HNQA 5FWXB 4F3TA 1FSPA 4Z99A 1JL3A 3I42A 1QO0D 3H1EA 1USGA 1XHEA 1P2FA 1ABFA 5TPWB 3GT7A 5T7BA 4Z4CA 4CBVA 1QMPA 2FMIA 3RVSA 3CLKA 4O5AA 3OQOA 3TO5A 1DRJA 3JVDA 4FE4A 1BDIA 4LZLA 3OLVA 4RS3A 3BREA 4MYRA 3O2QB 3DGFC 1DBQA 4N41A 1VKRA 9ABPA 3QX8A 2PLNA 4MS4B 2LUOA 4RK7A 5CNKA 3N53A 3I09A 1TMYA 4LX8A 1U2QA 4YWHA 3DLBA 1M5TA 1PEAA 5GQSA 1RXEA 4EGSA
chains in the Genus database with same CATH superfamily
4AAYA 3VOSA 2ANBA 1C0EA 1GOTA 3EXG1 5HDBB 2NSDA 2IXFA 2BM0A 3OSUA 2WIDA 4HDMB 4F6RA 2UZ3A 4UMDA 1JXOA 2VNSA 4NCBA 2ZBFA 2O54A 3TOVA 3QM1A 3EYAA 2IXBA 4V0NA 1UOOA 5DWDA 4NPHA 1HDIA 2XYRA 4FI3F 1Y8RA 4XQGA 1KL7A 4Y9TA 1W2GA 1GUAA 5AUNB 2VN8A 2J9FA 4XFJA 2JI9A 3PC7A 5ELLA 2HBQA 4EITA 1YJ8A 1J07A 3GEGA 3O21A 3AKYA 7YASA 3WDKA 2H9YA 4UBIA 1EXDA 4WZAB 5ESXA 2JK1A 1DJLA 1VJ5A 1KEEA 4M38A 5JI3E 1A95A 3GJ4A 3O8QB 5LDDC 2QNIA 2CHFA 2AOWA 2QD1A 3Q5GA 4MH0R 4CPDA 5ALUA 3VJMA 2CUZA 1EE9A 2VA8A 3C7DB 3LXRA 4PQEA 4ZCTA 3QKRB 2B4YA 2OWEA 3K9NA 3LX5A 5CXXA 4ZCLA 3K0SA 2E85A 1QZTA 2OV8A 3LKVA 1Z0FA 3PEEA 1W5BA 4OA8A 4RK4A 5ELMA 1GUZA 2OE2A 4HPWA 1AN0A 3V8QA 4C3OB 1TDJA 1ZI9A 1A4IA 2N1MA 4XDGA 5C3MA 3T7EA 5F2NA 1EAYA 2BRUC 2EU8A 5C8YB 3HZHA 2JGFA 4RFSA 3RUIA 1G59A 3I12A 1ECBA 2J4CA 1ZH6A 4J0QA 4P22A 4PG4A 4EGJA 3TD9A 1JEYA 1ZD9A 4XUDA 4NG5A 4Z8YA 2X5JO 2GBPA 3G2HA 4V3CA 4WIAA 3E3AA 3PC3A 5HQ3A 4UEJA 1W9MA 4KV9A 2HRZA 1P39A 2BSAA 3DULA 2IYRA 4C88A 1XHFA 4JI7B 4FWTA 3T7KA 1PK9A 4OH1A 4U6QA 1CZRA 3R1IA 4Y9RA 1BFDA 2ZUEA 1FXWA 5MDHA 3DFZA 4RL6A 1UM8A 3C4JA 4LYGA 4GPTA 1P2UA 1RPZA 2E4WA 4KN6A 5DNWA 1L5RA 1QH1A 5JEEA 4ND5A 1Z6TA 5D5QA 4AJHA 4Z54A 4XGIA 3GRKA 5EJEA 2FQ1A 3O38A 4MRMA 1KPIA 3BAFA 3UMSA 1S2OA 1PJLA 4HO1X 1V8PA 3I6BA 2VTBA 2F62A 2LDBA 2DQ4A 2Z2YA 2H4WA 3ZC3A 5EMHA 1WNTA 2OQVA 5CCEA 2VF2A 5FA8A 1IUOA 2QKYA 3K09C 2JGKA 3TNFA 2FPUA 1X19A 1R16A 3OX3A 4AZ0B 3I23A 1TYEB 2M1XA 3TQTA 2CB9A 4CM3A 5SY4A 4L51A 4KITB 4ZEXA 2KBFA 2CLKB 2F3UA 3C74A 1PSWA 3N75A 3PQEA 4G84A 3RRNA 2H57A 3NONA 1L4LA 1S8NA 1RHQA 3ZI4A 3Q7SA 4KODA 4KJZA 1XIVA 1DEKA 2RGDA 1X74A 2P1ZA 3PJDA 3H1TA 4LXHA 4MR7B 4TLDA 4MIYA 5DT2A 5FR2A 2A1UA 1N3BA 4E6PA 4DSZA 7REQB 5DMXA 1AZWA 5CJ2A 3TM5A 4NYJR 1TKRA 1Y63A 3NHWA 3ILYA 2GYYA 2YS6A 4IL5A 1KQNA 3VPGA 4O4IA 5EQFA 4PSUA 2ZYWX 3EZYA 3ETDA 1VHQA 3DBHA 4UDOA 1JR6A 1O95C 4WDRA 3PWSA 1RQNA 2WF8A 4HEJA 2ZQ5A 1CD5A 1L5ZA 1MZVA 1QVVA 5IJ0B 2B1QA 2PUGA 1L5FA 4G9GA 1GADO 1MABB 4J3FA 3BB3A 3MINA 4DCUA 1P31A 4OG2A 2IH4A 1Z29A 3D54D 4PCLA 4QOFA 1MQSA 5KNDD 1C9EA 2WMDA 1ZH4A 2VFAA 5L6MB 4N1AA 4CKEA 1GQSA 3C3PA 1JIKA 2GM3A 4RHCA 4WKOA 4B6OA 2I3DA 2V9PA 1CJUC 1K6IA 2ZIZA 2EP7A 1ZNQO 1QGUB 5JO0A 3BORA 4PSAA 2VP9A 4U6NA 4JEMA 4FW8A 1JLSA 5LR6A 3WWDA 1FS4A 2G25A 3BN3A 4I4TA 4LFBB 1BXGB 1A1SA 4D4JA 4RWEA 3FB4A 3DF9A 3IMCA 4U7TB 5FUWA 1SBZA 3BD7A 2OYCA 3VR5D 4GXNA 3WYNA 4U7GA 3HVRA 2AZXA 4PRKA 4EYSA 2VJCA 2X23A 4LNHA 4KACA 1XYVA 1BDHA 1PHPA 1ZCBA 2OLEA 4EO4A 2EJUA 1FP7A 2AC4A 5EJ9A 2WWXA 3KT8A 4L76A 4ROSA 5LL6P 4EGFA 4MB2A 2CYAA 1D2HA 3FI0A 4EA8A 3PQ3A 4HRYA 3B52X 3KZOA 5IBPA 1FY2A 1RHKA 1UM9B 1JDNA 3PNOA 1YB6A 1N7IA 4RZUA 5J5CA 2WSBA 4FQ7A 1HUQA 3HVKA 4QQFA 2RAVA 3GZTB 1CUHA 4XR4A 3UBMA 1SXPA 4PC6A 4LHVA 5K2MA 4EA9A 1RAGA 3GRYA 3H2BA 3LA8A 1DC5A 3KYDA 4UCXA 3KE8A 3UGJA 3TCNA 4CV2A 3AGQA 3R5XA 2D7DA 1XAHA 2VP0A 3COVA 3L7JA 3KJIA 1UZUA 3HYNA 3QIAA 1P1FA 4TLLB 1D2AA 2GRUA 1A2KC 4CV3A 5CM8B 5BNTA 1ULHA 3MTBA 4A0FA 3D1LA 1H1LA 1TRKA 2Z1MA 3Q8LA 4Q9JA 3FVTA 3JQ7A 2SKCA 1BE8A 1ZONA 2D06A 2NU9A 2V7UA 3JZIA 4MAMA 4PZDA 4WCFC 5HGJA 4DCNA 4KR2A 3IALA 4OQZA 1PT5A 1QS0A 2CLCX 1IQ0A 2OO5A 3KU1A 4ZVLA 3WTBA 3AFOA 1VIDA 2ADFA 1YMVA 3AERA 2NZYA 3GGJA 2C3UA 4UZSA 4E13A 3KKKA 1UQTA 1OV6A 3EXFA 2FSVC 4NE7A 3SQXA 4MV7A 5F3RA 1T3TA 3CX8A 2NTNA 3LKZA 4PW0A 3C3MA 4BMDA 1EUCB 3BWDD 1H8EA 2O2SA 4GI7A 2WJWA 4E09A 1CU1A 1G66A 1UC5B 2VP5A 1GUDA 4QICA 5IAOA 3VISA 4RWZA 2Q2NA 1NC1A 1WPQA 2FW1A 2P2YA 3BTSA 1J23A 1KEZA 2O2XA 3E1KA 4L2IA 3OPVA 4D3FA 3KDSE 4LWZA 2L19A 3ZLVA 4K9DA 2X0EA 4F8YA 2QRVB 2VATA 2X2FA 1S96A 3CXRA 3G2QA 3LP8A 1V5IA 3KSAC 3DFUA 2IOFA 3DWEX 1U8YA 2Q6OA 2ZJ0A 4N3BA 4DMCA 2QW1A 3I9MA 2IS4A 4E4RA 4URVR 3L4BC 3QEMA 4S35A 1LZLA 1CP3A 1GZ6A 1QH9A 1KI7A 4N9QA 4D9HA 1D7OA 2IDKA 1IIRA 2HM7A 2YQ5A 3RSQA 2V8BA 3EC1A 3INRA 3GDGA 2V6FA 4KVGA 3LVFO 2C2XA 1CQPA 2UZ1B 3DXFA 5DVZA 2AEMA 1G4AE 1SR8A 1LQTA 3FHCB 3QV1A 3IRVA 3V32A 4NFSA 4YAKA 2D0IA 3E8SA 5EIOA 5ADUS 1W4ZA 4HMQA 2XHZA 3V7NA 1N2OA 3GMDA 3WC4A 1R00A 4YAUA 1KJQA 2VS1A 5FBKA 4BMVA 2ZUFA 5GOTA 4IFIA 4YJHB 5H9WA 1U8UA 1OYOA 1XVTA 1TT5B 2HPVA 2ZITA 3FMIA 3M8KA 4I2VA 4E88A 3FY4A 4LZAA 3B6ZA 3VR0A 4BNVA 2RGEA 4YUWA 1IM8A 4BNKA 1KVTA 3G2OA 4JBWA 4RZXA 1K8XB 2QIOA 4GZLA 3GJTA 4TLMB 5ALNA 4AZVA 1GUFA 3BRWD 4NNOA 5KKNB 2GXUA 1GYRA 3UK0A 3IMFA 3IP6A 3S1AB 1YZVA 1PYOA 2E7ZA 1QTNA 1Y1LA 2C78A 3LUBA 3THYB 3HK2A 4UAUA 4LECA 2BL4A 3A1SA 4GEKA 2E4ZA 2I87A 4JI6B 4BVHA 5JVDB 3K0CC 4GKAA 5EXEA 4A73A 3I4LA 3OQ1A 4BX0A 1XJWA 1SCKA 2CUNA 2HD4A 2PCJA 3C7TA 3FNQA 2ZU0C 4N0QA 1CY7A 4OO3A 5I5GA 4UNSA 1KSGA 3A4TA 1DFGA 1YE8A 3VKGA 2Y1XA 1S8FA 2G1JA 3EK2A 4WESB 3CUKA 1UIRA 3F96A 2HF9A 4CGYA 1DCMA 1ZPDA 1V5FA 2D2FA 3OZEA 4K26A 5G3YA 4UHFA 3DZGA 3H8WA 3SQNA 1R0BA 2R9VA 4US0R 2ZWPA 1UT6A 3CA8A 2HZBA 1ZJ4A 5DCLA 3AL3A 2VQDA 4GPAA 1E1NA 2CD9A 2NVBA 3NATA 3NBYC 4RFVA 5EZYF 2QU7A 3AX6A 2C59A 2RIRA 1VI5A 2XZTA 4K40A 3ZK9A 3OFKA 1L7VC 4MW2A 2BFWA 2F43B 4R1OA 2ODEA 4MV1A 1IUNA 2WAYA 2PXXA 4YJDA 1NM5A 1NMQA 3RUHA 3VOBA 3ZHZA 2MSDB 3FGZA 4LOIA 2QGFA 4LY9A 4OHXA 3U7RA 3WNQA 3VA7A 2YZ7A 4HLNA 3S8MA 2IYTA 1GPMA 4MQ6A 1S02A 3LA6A 1DXYA 4FHDA 4C7VA 2P4UA 4FN4A 3K9CA 2GSWA 3RSOA 3SMVA 1C2YA 4Y3UA 4RTNA 4OJYA 2WMNB 2EZTA 4IDHA 4L5CA 2QE7D 4I1OA 5KNLA 2FZLA 4HGZA 3PIRA 3WIOA 4C4PA 1P1IA 2C8VA 4BLUA 5IVPA 1AOXA 2XGJA 5JS7A 1OVGA 1WKBA 3QBTA 1DFIA 1JIUA 4MGZR 4NE9A 4X65B 1MU0A 3KKOA 4GOMD 4QG3A 3TQRA 3D5QA 3T3EA 4ZCPA 2JDIA 1NVUQ 4D4GA 4NV3A 1BE0A 1G5HA 4U8HA 3ORFA 5HKKD 1VL6A 3REGA 3FNBA 3VDQA 2RGXA 5C7YA 2V6JA 5GJCA 1U8CB 2AOVA 2RH9B 3NXKA 3F3MA 3HKBB 1BX1A 4GR4A 3T3GA 1UWVA 1KKLA 2BM1A 4UREA 3IE1A 1BHQ1 1E5TA 4EG1A 5BMVB 2IS1A 2CKMA 2EF0A 3EJWA 4BFVA 1KZHA 2C84A 3HB1A 2FFHA 3A1DA 3PFGA 4A82A 2YMQA 3H1GA 4MKRA 1EP9A 2VJOA 2J45A 4MWDA 3SE7A 3RAEC 1A5SB 4QNRA 1C5KA 1QIEA 2Z2IA 3CYFA 3E1GA 4AW9A 4C06A 5FBLB 2FV8A 2YN2A 1WIWA 3G3EA 1XVUA 3I39X 2CJWA 1RPTA 1QPZA 2WA2A 2VYND 3DR5A 3JAKA 1FFWA 4NV0A 1LBSA 1S2NA 1W0CA 2B30A 4K2AA 2W42A 4JB3A 4ZC8A 3SU8A 4B80A 4YMIA 1CUZA 4GLFA 5EEHA 4FNGA 1JDSA 2PH3A 4H7IA 3UOGA 3N2KB 1EUDA 2NPOA 1KDVA 2B83A 4F2PA 3OBBA 5FI1B 4PQFA 3U1VA 1TVEA 1W5TA 3PCTA 4D57A 2GZAA 1GKKA 3ADCA 1QYWA 4F2DA 5KOHB 5ITWA 2QDKA 4RSHA 5BV2P 2HGSA 4M9RA 4IWNA 3WRYA 5KOYA 5AW9A 1JV2B 1JVNA 1SQSA 1L7RA 2HDHA 2HX1A 1F7UA 4DC1A 3UAGA 4D43A 4TRMA 2FW7A 1Z9BA 1R0KA 4BQIA 2AW3A 2XYPA 2O2JA 5CG2A 3PQ6A 5C7LO 3AP3A 5KSZA 4WOBA 4QM7A 3TB6A 1HF3A 3QE9Y 1G0NA 4BC1A 5TV2A 1OXMA 5BPFA 1ZVVA 4MX8A 2H65A 2PD6A 2Y05A 3I52A 3K9BA 2E87A 3R7LA 4BMPB 3D8NA 2H4HA 3HV0A 2PGOA 3HACA 5F78A 4F06A 3TPZA 2D62A 4B2PA 5HM6A 4LKOA 2GQ0A 3HS3A 5C7OO 1CJKC 3CB2A 3DEAA 3EGIA 4H16A 4K86A 3DMTA 2AFIB 1V9CA 4G0PA 3Q41A 5EE3A 1PQUA 1CR0A 5K8JB 1WP4A 3A2LA 3VPHA 2RCNA 3BKWA 1Q19A 2A9KA 3KDAA 1TQHA 2ODQA 4MS1B 4M1SA 3TVTA 1WULS 3G13A 1W36D 1PJRA 1Z63A 5JNLA 1WSAA 2Y67A 2Q0XA 2PRJA 4QE3A 1IN1A 2QMEA 2I2DA 3DE4X 4WZAE 3Q8KA 1WXIA 1Y3HA 1NKSA 2HRDA 4LXXA 5FUYA 3I1FA 1XQYA 2AJCA 3KOOA 4K7JA 5UKDA 4V39A 3WK8A 1YD7A 1KE1A 2BHLA 3ZQKA 1FYXA 1Y8ZA 4F5DA 3PHLA 4BFLA 1XHEA 3PUXA 3ZHQA 4CRWB 1P2FA 5AT1A 3OF2A 3EPJA 3ASZA 5TPWB 4N82A 1I7PA 4CE6A 4GBED 5C80A 1ZD8A 4J43A 3X44A 1VHLA 4UDYX 2J5BA 3E22A 1DX9A 4CM7A 4ER3A 2C0PA 1Q21A 1H0SA 2FUEA 3P5BA 3LT4A 2CL5A 3UXMA 1OA0A 1R6UA 4E5DA 4JHXA 4TWRA 2YYAA 3HN2A 1RKUA 3O4IA 4BIMA 1SEVA 3C3BA 2K7FA 5EQDA 5KKAA 1GEGA 5AOCA 4K0KB 3I4FA 1EAMA 1F17A 1GNSA 2DQSA 3BD8A 4IX1A 3RAPR 2EKZA 2H51A 5K0ZA 1LF0A 4PC1A 3GR6A 4D5EA 1U7UA 1C3VA 1FVHA 3UATA 2WNSA 3D2BA 4PBSA 5LA6A 1DBRA 2DAPA 3RWOA 1AN9A 4PIVA 4W5WA 3S70A 2WV7A 3SI7A 2XUFA 1GTRA 2XITA 3PYLA 1U7WA 1PS9A 4R7TA 1U0TA 1O0BA 1TCCA 2PUJA 2Q5LA 4DLUA 1KMCA 1H2HA 1XYGA 1GQRA 1YR3A 4QHTA 4W5NA 2EDAA 4IS2A 5K0EA 4NG4A 1QGDA 2X0IA 3KSDO 4R40A 2EL7A 3P9CA 1Y9EA 4XWYA 4PO8A 3K31A 1W73A 1VP9A 1E58A 2OV4A 2ENWA 2VJQA 3D0RA 1N5RA 3E0XA 3INNA 8OHMA 1FDOA 4Y9UA 4I1IA 1SK9A 3WGMA 2DBVO 2PXAA 3HJRA 3DEFA 1SURA 2NSHA 1JHVA 3EQ7A 3IPLA 4G5RA 5E4JA 3DZBA 5H70A 1VPLA 4DEVA 4QAJA 5I8WA 1RXIA 1CRPA 4EUHA 1GRRA 2QLTA 4OD0A 5AJZA 2PKWA 2AE2A 5REQB 4BXOB 2AGVA 4NWIA 5FPSA 2G1KA 3DTTA 1GVNB 3RWBA 2ZYDA 1CY2A 5F7OA 4P93A 1RHUA 5EC8A 1VZ3A 3MUOA 4W82A 4AY5A 1SZCA 2XT9A 4ZIRB 5LYJB 1K08A 1Z6PA 1A71A 1YDWA 1QIFA 5HVNA 2J3HA 4EYGA 1EXVA 4KYIB 1QG4A 1WQ1R 1FX1A 3KWMA 4XD2A 5I7UA 3LK7A 1YL6A 3QHPA 1HZJA 4NS1A 4QKQA 4MI1A 4R1SA 3OURA 2ODBA 2NUPA 1YZKA 5AWFC 4KRFA 1ZY2A 3IR6A 3WE7A 5J58A 3WMWA 5LJLA 4G0XA 3E05A 2WQZA 4DBZA 4EVRA 4YP1A 2O5EA 3TQQA 1EI9A 4FGUA 1Q0RA 1ZX1A 5ALDA 4C0JA 4ZOLB 4D4IA 2FW8A 1ORWA 4PZAA 4B5KA 5ALXA 2HY7A 3H4MA 1KIAA 2GEUA 4KO1S 1NW8A 2MTBA 1GFZA 2NQTA 3D5TA 3RC2A 3RABA 3LTNC 2AWOA 1DC4A 3AFMA 3PNVA 5J1SB 2ECQA 1M74A 3HYCA 3NHSA 1B1CA 1VSVA 1AKRA 3TDNA 3ET5A 1UBJS 4KI7A 1U0NA 1MA0A 1O8BA 1SVIA 1Z28A 2OHFA 2OCBA 3FIJA 1ZM4A 3MAGA 4RK0A 2H1WA 3TZCA 1J0DA 3N07A 1NF2A 2W2QA 3ZHUA 5B36A 1EFAA 4ZO7A 2W6IA 2F3PA 1SKAA 1ZQ9A 4R8VA 2ZRJA 1T13A 1YT5A 5CLIA 1P5JA 2Q62A 2VJNA 4IH1A 5DWQA 5EMKA 4RYDA 3RHZA 4BQSA 4D74A 4ENSA 4ER7A 2QJRA 1Z22A 5FWDA 5KS2A 3OEYA 4B31A 1E8NA 1C7RA 3QVKA 2GZSA 1P75A 1W34A 1I7SB 1YRBA 2NX2A 5AUOB 1OF1A 1RWNA 3QFRA 3SP1A 3DM9B 2GA9A 2ICAA 4OJMX 1IK4A 1VSTA 4Y2GA 5K4GA 3FAZA 3IRUA 4Y2HA 2VYVA 2WDZA 2F2TA 4H7PA 1LLQA 1OLUA 1OAOC 3IBCA 4I1UA 4Y1RB 1B23P 3C15C 2I9PA 4X1KB 4OMDA 5K01A 5DHUA 1EXWA 1EJ6A 3B9BA 1KDOA 4C5AA 1O94D 3CXUA 3LC0A 5K0GA 3AW8A 2FQYA 3QQ5A 1EUZA 4YRLA 1B41A 3FUXA 2VC2B 3DMPA 4U2BA 5AM1A 5AXBA 2G72A 3BMNA 4FYPA 3RAGA 3GGOA 1TKAA 4UEQA 4D8VA 4BIIA 1TVCA 2CZQA 1DHTA 1LJUA 1A9TA 2W58A 2IOQA 3BCUA 4UBJA 4WNAB 3D31A 4F5ZA 4OFXA 3O8LA 3AV0B 3F74A 3I3OA 3SKVA 4DIUA 3ETCA 3N7UA 1Z12A 4JLMA 1C1XA 4W1RA 4WDQA 5ALRA 2A8YA 2XVMA 2W2XA 3FUUA 3BAZA 1IY9A 3OPMA 4C30A 3T41A 4DOMA 1VG1A 4LWQA 4X7MA 4UNIA 1ZN9A 1O7JA 1IIBA 1RRKA 2JKYA 4BBPA 3PNSA 3X3HA 3LUHA 2VXYA 2YDYA 1M8KA 3SHOA 1DRUA 3TLYA 5E1MA 4O8CA 1BHO1 5JLJA 1ZINA 3DMNA 4C4OA 2Q07A 2A4KA 2Q8QA 4M2LA 4MKFA 4XUCA 4X64B 1C9MA 3D3WB 4TMVA 4I9NA 3B5JA 1DAHA 4RTSA 1DJNA 2NNWB 2JJQA 2ZT6A 4Z0TA 4R0MA 4NQZA 4XIGS 5HCIA 5FOQA 4JI5B 4AO6A 3ILHA 3FZQA 3M4NA 1QM5A 3HXTA 3WX0A 4WZ6A 1V71A 1SELA 3HKCB 4RA9A 1E2FA 4XYLA 4OXYA 3LCJA 2NYRA 5CU7A 3DFIA 4EUNA 3AHFA 5MFPA 5J4LA 1PF7E 2JAUA 5FIUA 2D59A 3GN2A 1OI2A 2ZSFA 1EIWA 1TMOA 3VV2A 4GAEA 3NGLA 2XOKD 3QW4B 4A03A 1CHNA 4MVJH 3U3JA 3PHCA 2EARA 5JE8A 4R1UA 2IWRA 1VBKA 3SSNA 4CIBA 2PLRA 1NR7A 1OIWA 1RLMA 1I5OA 2H4FA 1N1DA 3BJIC 1P7CA 3GUHA 4OL9A 4M21A 4B6RA 1JFVA 2XTJA 1M8GA 2Y77A 3QLVA 4D99A 1O5OA 2XBLA 4X93A 3RFVA 4PFQA 4RY0A 4YHBA 2WWFA 1OT3A 1QBGA 3B7GA 3FPKA 4G63A 3HUTA 3F5FA 5IVDA 3GCZA 3HCDA 3C5CA 4BQFA 4EPYA 1U4NA 1KO8A 2RHGB 3AZPA 3EGXA 4BNMA 1N9KA 2IA5A 3HKEA 2FMTA 1XEXA 3OHPA 3AR4A 3ITDA 1T2CA 2HT1A 3QMWA 3DUWA 4U3JB 2EXXA 2BGKA 4D9GA 2IYSA 3FB1A 3WFZA 3ZCTA 3V4RA 1DJOA 1NMYA 1DQYA 1W36B 2BCEA 2QVLA 5WRFA 3OZXA 4IF6A 2XGOA 1UWCA 3IO3A 2BMJA 1PU2A 2FWIA 2IXAA 5FBWB 2XTAA 4OHUA 5BV1A 1YCFA 1ZIOA 2V7QD 3GP3A 2OBYA 3TXXA 3KP1A 1BH2A 2D3WA 4KN5A 7MHTA 1JPNA 2E21A 3GG2A 3H1AA 1PFKA 3P0JA 4IX9A 4XWOA 3KOXA 1BOFA 2AFVA 4YONB 4ZVOA 3EIEA 1QU2A 2HHAA 4F38A 3E61A 3H1BA 4Z7NB 3D3NA 2HGZA 4TL9A 2PNFA 1EZ1A 3WICA 1U2ZA 1A5TA 4N3NA 3GQVA 1XTUA 1JLRA 3AUAA 2BTQB 3HP4A 2NYVA 4HYTA 4RO0A 1PR4A 2FF7A 2RH5A 3CF2A 3PKIA 1AHNA 1TZCA 3SXPA 1QRAA 5ITZA 5LQAA 3ROTA 5BQXA 5B1IA 4ZKEA 4P4TA 3CLRC 2FPKA 1NF8A 1O6GA 1IATA 3NHZA 2ZIXB 3PXEA 3DD5A 4LJAA 4NHOA 4RHTA 1Z8FA 2BKUA 2KWIA 4YUAA 1JH8A 4DA6A 4C78A 1E9FA 2AN5A 5ENZA 2P3QA 4ESVA 4JL5A 3PD1A 1RAHA 4NQRA 4YJ2B 3IQIX 1GXSB 2AWNA 1QVZA 1CVIA 1VYHA 3LWDA 1SBCA 3MWFA 4Q4HB 2EZ8A 1HDZA 3C85A 5AM4A 2M6KA 3ROZA 2BBTA 3L7DA 3CKMA 4M1EA 5K0CA 3ABSB 3IKJA 4FGLA 5HF9A 1OTYA 4N47A 3PQ8A 1FP6A 3QVVA 4RPIA 3I6YA 3U2QA 3LLUA 5DM60 5SYAA 2ZJYA 4KDFA 1Z4PX 5IH7A 5KTRA 1YTLA 3NHPA 5EWLB 2QBYA 3A0RB 3B48A 1A2BA 1MJGM 1P6UA 4WZBA 3M3HA 1X70A 3O7WA 1ATZA 1PSZA 2GZRA 3DHNA 1V7CA 1LLFA 1SG9A 1NJ2A 3H8JA 3W8DA 2YX1A 2J67A 1H4QA 1DIGA 1TC1A 4C7MA 1DT5A 1TUBA 2I6TA 3JYOA 3MG9A 1FTQA 2HADA 2H5EA 2SCUB 3EGDB 2LD4A 3I45A 3OEEA 4GDMA 4D25A 1CF9A 3JZMA 2GD6A 3HJUA 5H0IA 1XTZA 1ZP6A 4ALLA 1M2FA 1EFRD 1GG5A 1FFXB 1OBCA 2IQIA 5A03A 1ZKDA 2PZLA 2HQSA 1N5OX 2Z8YA 3ZX4A 4BO5A 1KEKA 2FAXA 4E07A 4WJLA 3CIFA 1Z7EA 3GEBA 1LPNA 4JA0A 4L5IA 1REQA 3NPMA 3FGNA 3L0OA 1KTIA 2GO7A 1Y5LA 2M32A 3DV0B 1YR1A 2PHZA 3IPAA 3U40A 3UPTA 4IQ0A 5I7EA 3ESZA 1VMDA 3P96A 4L8WB 3D6TB 5CHYA 3TIFA 4CMEC 2CKDA 1QTRA 4L73A 5AVYA 2GBLA 2P4SA 3H5IA 3TSOA 2I8LA 4IJMA 2IUUA 5JS2A 2R7MA 1DAPA 3STTA 3TSCA 3EQ9A 1DTWA 4EBBA 1YA8A 1GU0A 3ROKA 1J39A 2YASA 4N03A 2ZJ8A 3IODA 3VXKA 3U5ZB 4QGFA 1H5NA 1VE1A 2Z30A 2JAQA 4RANA 4Y2JA 2YIMA 1DINA 3PD0A 5CGZA 5EUMA 3SEZA 4X1YA 5JLAA 3E0QA 3EIQA 2X6RA 3KJQA 5FI0B 5TQVA 4B75A 1FDVA 2VRBA 1ZUWA 1SQ0A 5BMVF 1X77A 1YB1A 4CI9A 3E03A 2P9CA 4TTTS 3D8TA 4RLSA 2LGJA 2HA7A 2QUJA 4PX2A 1Q22A 4OYHA 1XN4A 2H11A 4H31A 5AXAA 4D3YA 3PDWA 3HR4A 4RJJA 5A7GA 2QY6A 3GJQA 3SC4A 3U7QA 2WKSA 3VSEA 3WAGA 1YS7A 2PU5A 3K5WA 5F52A 2PNJA 4Q1AA 2DU8A 4BBAA 5K09A 4JYZA 1CK4A 2IYOA 4N5MA 1JQDA 1Z0AA 3JQAA 3HTXA 3E4DA 5LLDA 4TGLA 3VYVA 5CIWA 1R15A 1UPFA 4NABA 5FL7D 1VGQA 2Y0BA 1NTOA 1H22A 4XA8A 4MWGA 4M9ZA 5F1KA 1YJBA 3KQVA 4DNFA 5CDTA 4FP9A 5IHXA 4WX2B 4TKZA 3U3OA 2ZS7A 4G89A 1X38A 2O50A 4AM8A 1U0EA 1L5OA 2AQ8A 4BE7B 2GPAA 3QF4B 4EMUA 1P7PA 3C8UA 2XVXA 3RIEA 2AFIE 1NLFA 2JGIA 2CDAA 4UHJA 4ABYA 1DBWA 4A23A 2H2HA 5E8RA 1M6VB 3A9WA 3T1QA 4YCSA 5EIBD 2EC5A 3H17A 4QJBA 1Z88A 2A7XA 3PQ4A 2Y93A 2XQFA 3BTVA 2X8JA 2YWBA 1F51E 1W88B 2AE1A 4HB3A 4G5OA 4ND8A 4OIMA 4ALMA 3M49A 5AK5A 5JXWA 2VPZA 3IQFA 1E3TA 2VBFA 4BVBA 3DSRA 4MOWA 3Q6NA 2QQ0A 4RH3A 2EQBA 2I7DA 1S2GA 3FUWA 4ZO6A 4D0LB 3D7MA 1TYAE 4HFMA 2FEOA 1DZ3A 1K6MA 2AOTB 4JJEA 4PZ0A 4RK1A 2NUAA 3FZNA 4KWHA 1RI5A 2WPDD 1USKA 1LDYA 4PLPA 2QN3A 3UH0A 1AO0A 2H08A 3HGMA 1JDZA 1QX4A 3M2TA 2PX0A 3WK5A 3A31A 1WMDA 2J3IA 4KTTE 3VYRB 5LXTB 1UC8A 1Y8CA 4R2MA 3OETA 2MSLA 4LXYA 3TZBA 3N2EA 1XQVA 2NZ8A 3O75A 2VK8A 3QY9A 4R1QA 3N3BC 3UUFA 3U44B 2PJZA 4FKBA 4PZCA 5EUCA 1WOYA 3H5WA 4X66B 2FDRA 1VE9A 4BGUA 1WA5A 2X13A 5I7HA 1SVLA 3GQBA 2ZI9A 1QDUA 4JLUA 2XBMA 1Z5NA 2FPIA 3P19A 2N42A 3EIXA 1KI2A 2QPOA 2W4QA 4QUKA 1C8KA 1Z4NA 2ARKA 1EX7A 2JFHA 4ZAWA 1FNMA 4H0FA 4R1PA 2O0MA 2WM3A 1JKJA 2R3SA 4WUVA 1S6YA 3DXXA 2Y9PB 1GHTA 3F9RA 5DO9A 5LB2A 3T4UA 4N76A 4TVOA 3CWZA 2HRQA 1HTTA 4OAQA 4MR8B 4NLLA 3VDMA 3GLGB 5IWAB 2VEDA 2CDRA 1GGKA 3HEMA 3BKXA 4QULA 3AWDA 4RDXA 5F2EA 2IF2A 4NR0A 4P2BA 5DOVA 3SY8A 1HLPA 1WSBA 4LN1A 2XV1A 1VJGA 4D8WA 6ADHA 3AEQB 1WXDA 1YC2A 3CVWA 1X86B 4EJSA 1VOTA 2Q9UA 2DE0X 2F8TA 2XHEA 2PY6A 3C3YA 3AB7A 3GJ6A 1DKRA 4DCPA 3RG8A 2A5GA 1SG6A 5CPBA 4BMYA 5LKAA 2ZXUA 4QVKA 3GGCA 3THXB 2I9KA 2R6DA 1RIIA 1O6CA 3B13B 5L3ZA 2WD7A 2HNBA 1KVUA 2WKRA 1XKQA 3SNHA 3WLMA 3I42A 3GJRA 2X9GA 2YHSA 3MGGA 4IIHA 3KB1A 4PQYA 4R8LA 5CA0A 3V4SA 3ZU2A 3R3JA 3BICA 3EUAA 2GBFA 4H4CA 3MS4A 4MVYA 3N2GA 1V48A 2EGUA 3C5HA 2Z98A 3SBXA 4DIKA 4IDQA 3EC2A 5CDFE 4NJEA 4CN8A 5G0WA 4FE4A 1A5BB 1LI7A 1YU9A 3IKMB 3UHPA 2ZATA 3E3NA 4JIMA 4YJFA 1HTWA 3IAFA 3ML1A 5B4UA 2NAFA 3O0DA 2PR7A 1R1DA 2Z9CA 3C70A 5TSDA 4UPDA 2R8ZA 2MSNA 3IAS1 4QRIA 2OOKA 2J7PD 3NW9A 2JFGA 3PP8A 3ZWBA 4EMTA 2FPPA 4GNKA 1YS4A 4MCHA 2QVGA 5I7SA 5DJ5A 1KK2A 1NKVA 1JFLA 1QCCA 1O9GA 5JC1A 4II3A 1N2HA 3JQ8B 1GTJ1 4ZXPA 4E94A 2OBLA 4QTXA 2BUBA 3DPIA 2V74B 5A9SB 2IDMA 4GXTA 1YTUA 1G17A 1EA5A 1B2RA 5BURA 3CH7A 2IKQA 1I24A 3L7KA 4QLOA 1Z5OA 3GDFA 2W6ZA 3IXQA 5B1HA 1XK6A 1IAQA 2J5KA 4XQ0A 1G5PA 4JQYA 3MILA 2BFFA 3TX6A 5I7WA 3L01A 1JEJA 4RHEA 4PLHA 4M1OA 3EXIA 5DEIA 5K0TA 5LSAA 3MWLA 1KJJA 5DCYA 2X77A 1DXQA 3D1VA 5BQOA 2AXEA 2IOHA 1MEEA 1M8JA 3BEOA 3AOGA 3GUYA 3ONFA 4GX0A 4JUIA 4KZPA 1ZSNA 3F3YA 5IK2A 4BE4A 3KWLA 1FYEA 2IHTA 5CFZA 3UYKA 3ERCA 1W7AA 3RVLA 1SQFA 4HLCA 4K6MA 4J7UA 4XIJA 4XIYA 4CF4A 5GPBA 4CV0A 3D0QA 4NAUA 1E1QA 4J0HA 1MAWA 1Q57A 2HL6A 3IT0A 4KE8A 4Q9AA 4F84A 3TOZA 1WS6A 3B7WA 4B81A 3K92A 1VLZA 2NO1A 5B3JC 3O2JA 4B3XA 2QV0A 4DIEA 5BMOA 2JIQA 4ZYWA 1QF7A 4PZEA 1CEQA 3B9RA 1ST3A 4RM3A 4RD1A 4FFVA 2CBXA 2VNIA 2YS7A 3CBQA 3L6UA 2ZULA 1BO6A 3ZXIA 1UXIA 2APJA 4V0OA 4R7GA 1XTIA 3JY6A 2JZNA 1ADJA 1BDMA 1FZQA 1T0HB 3GCWA 3LUPA 4GKVA 3MIIA 2PGDA 3E5NA 4ZI7B 1ESDA 1WSWA 3VUEA 4J4BA 2YZMA 1NG1A 4OYLA 4X6LA 3GU3A 4YXFA 3G0GA 1RNLA 1LFAA 1Y8AA 1M2OA 1PDWA 2O2YA 2YWDA 4BBJA 3QKSA 4CW7A 4OUDA 4E4YA 4NNPA 4ESHA 2XA1A 1DRVA 2PFGA 4HEQA 3Q2IA 2V58A 5CRIA 5FBRB 4ZEOA 1ZGCA 3F49S 4XEHA 1EJ2A 2VXBA 1DAGA 1E1LA 3O1JC 2EKLA 1NXQA 4B35A 4JXJA 3SLKA 4QVGA 4QJ3A 3R20A 3L5KA 4UUAA 2AR9A 2PXCA 2AFRA 3NBKA 4R9VA 1L4MA 2O2CA 2GHQA 3HE3A 3WY9A 1SUEA 3V8VA 1IN8A 3AR6A 1W36C 4I99A 4HH1A 3BD9A 2CE2X 3SEQA 1RYHA 3ZCXA 1JPVA 1K5PA 3ZDRA 3AKCA 2PDAA 5FX2A 2AK2A 3ETGA 4N5LA 1P0FA 3ZTTA 4OHYA 5ALPA 1EWQA 3EVAA 1Q44A 5KSWB 4GZ6A 2Q6TA 3O84A 3QOFA 4V38A 1RBQA 2JIRA 4JI3B 1RE1A 3MHPA 2VP6A 3ODPA 4JROA 5DU2A 3AKDA 4BNDA 4K9RA 1G20A 1E9SA 4ASUD 4C0BA 1D8AA 1T91A 2BOVA 2ZBEA 3ND5A 4FCCA 5B2ZA 3TIIA 1SB8A 1BW9B 4OX9B 5L53A 4I3FA 3QLEA 4BV9A 4ZTZB 2G0TA 3HO1A 4XYGA 1E79A 3I83A 4DYVA 4Y6LA 2OECA 3H5LA 5ICEA 2B1RA 5JCJD 3HO8A 1DTSA 4OKNA 3KHSA 4ZAFA 4KR0A 3K6RA 1SM4A 1EM8A 2QR5A 3MQFA 3R09A 2YICA 3ZW8A 2DBRA 5CMLA 5D8DA 4W5QA 1CB0A 3KV1A 2CK3A 3AOEC 4CNBA 4OMFG 3EVEA 5E6SB 2G4CA 2WJ4A 2D1FA 3LHSA 1BGXT 3RTEA 5AK3A 3KZCA 1GGFA 1C4WA 4ZVSA 4JLVA 1P8JA 2P2NA 1OY1A 1HL3A 1QO0A 1WMBA 4QFMA 4UNQA 3A36A 4GDFA 2PSHA 2CV0A 4OQQA 1B14A 5H81A 4TV9B 4GI1A 3VAZA 4J0IA 3A9SA 2NVUA 5DF1A 3ROQA 1SCUB 4EQ6B 2YJ3A 1K9SA 4AKHA 4HAZA 1RZVA 2A9OA 4UAGA 3VX4A 1YMUA 3IHWA 4R31A 5K8LA 3CUVA 1HTBA 1TO1E 1V1MA 3EIHA 1N8KA 1KARA 4FZJA 1OYWA 4JGBA 4L5BA 3KX2A 2YYSA 3EF3A 5AJWA 1U0FA 2HSEA 1T5SA 3AQIA 5CT5A 5I51A 3T1YB 3VO2A 1GPH1 3K0EA 4Z9AA 4WBNB 2WKWA 3JQ9A 1P2DA 1ZHFA 4L02A 4P92A 1ODTC 4UQOA 4A92A 4R9NA 2JJ8A 5ESDA 3C24A 1T0UA 4B5LA 1CQWA 3TLGA 1T0IA 2CGEA 3SKXA 3EARA 3H5NA 4BMZA 1FDIA 2PX4A 5A4DA 4FFRA 3NOVA 5P8WA 1GPKA 3FDFA 4DWOA 1B3BA 3WIVA 1BYIA 1DAFA 3NYWA 4MO9A 5GM1A 4E1BA 4YN3A 3MZ0A 4G0ZA 4NPCA 5SYMA 2WV9A 4QRDA 2R00A 2IXEA 3GBSA 4MMYB 5CX4A 3TIXB 4AMGA 2EFDB 3TPFA 4ID9A 5FPYA 1J8YF 1ZUIA 3GL9A 3Q4GA 4PYKA 3DFFA 1I33A 1V0JA 5T6MA 1UZAA 2X0FA 3IXLA 4DUZB 2ALJA 5FWYA 2AC7A 4HKTA 1JWLA 3QEAZ 1IEVA 2Q7XA 4HUTA 4L3OA 4YJ2F 1YVUA 1LWOA 3RJTA 1KYZA 5ABPA 1WW2A 3UHFA 5C46F 4M6WA 4FINA 3BMXA 1EBFA 5BV8A 2Z56A 2ZRDA 4G85A 2OZLA 5DM0A 4TUYA 1PR6A 3WDMA 4MITA 3BT7A 2P9JA 3I04M 1TQ2A 3G2KA 1W0JA 4DLXA 1E2PA 1JHMA 2AN3A 2ODTX 1FP4A 2P1DA 3LDFA 3FPHA 4YNBA 1HNXB 4JA2A 1YACA 3S2YA 1C14A 1K7XB 1YCHA 4JUBA 3TKAA 4K6HA 2G08A 1MBZA 5ECWA 3L0DA 1AT1A 5KYGA 1TEHA 5NLLA 1ZZGA 3BGOS 2GD0A 1KY3A 2QTRA 4JGIA 1J06A 4ZDJA 4MPDA 4FDTA 3M0EA 4QBKA 1XTPA 2VHWA 4LVUA 4X71A 4F5EA 1C3OA 1MGOA 1XZQA 4Q6BA 3C0KA 1SAYA 3I9KA 3QYAA 1XKXA 1GRVA 3NYQA 3PGJA 1ETHA 4MS3B 4RTQA 5LQRA 2A0YA 5K99A 4MW1A 1SCNE 4FXOA 1K27A 5A9RA 2G0NA 2UYGA 3CCFA 1PTKA 3E18A 1TAHA 1ELOA 3PDCA 2F90A 1A8QA 3EZ7A 3OP4A 3ONVA 1IWOA 3WHLA 1I80A 3E84A 3O4HA 3WL5A 3FYUB 2C5GA 2O05A 3LO5A 4LZWA 4D56A 3I8OA 2IBMA 3DZHA 4BVEA 5C4IA 1Y6QA 3A1TA 3PX3A 4M98A 1SA0A 3LCVB 3X2FA 5E38A 1O94C 4Q9HA 3HDGA 5EYPB 2BJWA 2BZ1A 2HK7A 4UJ3A 3OTOB 2OXEA 4NICA 1CQJA 1T9HA 4OLAA 4HQNA 2RAFA 3LVRE 3CNOA 3DC7A 5DK6A 2A2ZA 1KERA 3AF1A 2QENA 3DZFA 4YRBA 1VCHA 1DOHA 1K3UB 3BGVA 1A88A 2IHUA 4OF4A 1P4AA 3ZWVA 1UMCB 5P21A 3WLKX 3KBOA 1P9OA 2RGCA 3BWEA 4B8WA 4D97A 1K9VF 4NKRA 4LHWA 3DD1A 1I14A 4YX9A 2ZWAA 4AYWA 1N6HA 4M0UA 1L7XA 1HYEA 4OBBA 1YL7A 1WCIA 1PI3A 3G1TA 3L7BA 2BEUB 4OQMA 4KFTA 3V55A 3B70A 4A27A 2GXAA 1S2IA 1XCOA 2NM0A 1SPXA 1H1TA 1LI5A 3OJEA 2XUJA 2EJBA 2OGUA 3F6YA 3N5CA 5BVGA 4MCIA 3Q98A 4AJ1A 1J6UA 2JS7A 4OQFA 1GKIA 5ITSA 3CG0A 2CE7A 5CUQA 3ANXA 2AQIA 1UP6A 3NBQA 4I5GA 1R74A 3QPBA 4FBMA 5FPHA 3AI3A 1HO3A 1LRJA 5TVGA 1I1NA 2B0CA 4BGDA 1N2SA 1V6CA 1KRXA 1MOQA 4JBLA 4KDEA 1GCIA 3AFHA 4PZLA 5CB6A 1TJ3A 2O0KA 5B58T 4YP0A 3M9LA 5HM8A 3AP1A 1O0SA 4LHSA 3TWOA 2G1UA 1VJRA 2R1UA 4WECA 1W4RA 4TVSA 1FNDA 1VLVA 2RHMA 4AY6A 2JHGA 3IL2A 1HZZA 4F6CA 3X1ZA 3BXFA 1M34A 1XRRA 3OQIB 4TQ9A 5FD8A 2KQUA 4MUMA 1K3FA 3GLUA 4QPPA 1OQAA 3FOCA 3FCXA 5JFGA 1Z4OA 2V97A 3K1AB 3BMQA 2BISA 3EAQA 4GRAA 3LX8A 2DJIA 1F0PA 1UBSB 2R4QA 1GYPA 1NZDA 2R66A 2XIQA 3HB7A 4HRXA 4C9BA 2KW5A 5KDOA 5KWVA 2BFMA 5M34A 2IBTA 1L2TA 4TTVA 4NU0A 5B2EA 5KDDA 3S2GA 1YC5A 1Y4DE 2IZ5A 4YCBA 2B9EA 1XDGA 5L7TA 4FWBA 5JHGB 4KDRA 3HA3A 1WBBA 2VOEA 3DBLA 2C99A 3A7EA 2MCFA 5GINE 4RKYA 4BNYA 2WYWA 2PJUA 1PV1A 4RQTA 5AI4A 1IHOA 2EV9A 2AJLI 1NBIA 2A57A 3GWGA 3QXCA 1DXHA 1GD1O 1CUJA 2JI6A 3QWHA 2HHCA 3AIOA 1ES9A 1PR5A 4JVMA 4ZD6A 2P9QA 3UWDA 3K5IA 3L5OA 5JFTA 4DWJA 1BU5A 1LVHA 4TXLA 1Q0ZA 3V7FA 3M4XA 2KS6A 4K6CA 3GY0A 4LXIA 3RUEA 3V7WA 5INTA 3NIDB 4Q4CA 1COWA 1JHAA 1JZSA 2JIDA 3KQTA 3OKCA 5EKUA 4BC0A 3IMKA 2A0UA 5FKJA 2WSIA 1HEYA 3NHUA 1NW4A 3R9KA 4PINA 3C1TA 5JSFA 5LXTF 3RYFA 4YV7A 1NBHA 1PTJA 1DEXA 1GGMA 1ZCZA 2FWBA 3DAGA 4PF1A 5C5DA 3GLGE 3AUKA 4E5PA 3PQ5A 3DTNA 4RZSA 4DADA 4UUMA 4PSKA 2BVNA 2DFVA 3X43A 3Q0TA 2QYSA 1YULA 3PXBA 4RKFA 2I4LA 1L4YA 3QXHA 1F8GA 2Y1GA 3ELDA 4HD8A 3T9BA 2I78A 1M7BA 5AKEA 4B3RB 3SDSA 1JB1A 4ESOA 4P34A 3G79A 2ZPTX 3RE1A 1W1IA 3E81A 3NHKA 3QOWA 4DGSA 6PFKA 1XUOA 1UP4A 3QPVA 1EFCA 3CS3A 4IHJA 4EB3A 2O8DB 4DDUA 3IQZA 3N74A 1E3LA 1GPNA 5COBA 5A0TA 3R4VA 4C0SA 3NDBB 2AD1A 3KDPA 3PITA 4LYFA 2VQEB 4YRIA 1UAAA 3HEAA 1TMKA 2ZYGA 1MOZA 2CSUA 1AV6A 1JUDA 2AZDA 3EASA 3T06B 3UGQA 1PZXA 5IMBA 1MR3F 3JV7A 3AVPA 2NZXA 2BI8A 2J9RA 2DQZA 2XKAA 5JJBA 3TI9A 4UU7A 1L6IA 5FJJA 2A9FA 3HXQA 2GJ9A 2GILA 4IVPA 4B4KA 4L8GA 3K6SB 3I28A 3BK1A 4YRFA 1U0BB 4JLPA 3AONB 4IKOA 1YA6A 4RF5A 1EJ0A 4X3CA 2WJGA 2RGGA 3R3SA 1YASA 1Z2CA 2ZBGA 1PWZA 3PUJA 5LBIA 3GN1A 3U17A 1M2VA 3A4MA 3UK6A 2FVXA 3CHYA 2ZKIA 3H1FA 1N6OA 4AX8A 3AVVA 1OWNA 3GLHA 1DC3A 1JEQA 3H5RA 3K6KA 4BNTA 3TZEA 3K05A 3PC4A 1X7WA 2IUYA 1L5HB 1OJLA 2VWHA 1QBKC 3P9SA 4GSYA 4BLOA 3S8EA 3WQBA 5B2FA 4TLCA 2ZTUA 5EIXA 3QG1A 2FZKA 1EK6A 5CLJA 3F1LA 2OK8A 5JS1A 3PRYA 3WL8A 2IYVA 4XIIA 4V0LA 4PANA 4RIHA 1XNHA 2R4TA 1QR6A 4RL4A 3W3AH 1PL8A 3CX7A 4ZHQB 1F8UA 2O1XA 2GJKA 1S3GA 1NU8A 1ONBA 2YFYA 3ZKAA 3VHXA 1N2CB 4G67A 2PSFA 5JPIA 1UKBA 4ISCA 2QAGA 3ADOA 4TYYA 4RDCA 3UCXA 2EG5A 4NCNA 2OGZA 5KYNA 1Z2EA 3T3NA 3VH3A 2QL9A 1X7XA 4HQ0A 1X7HA 3WSWA 1D5CA 1P0IA 1A8SA 4ZVPA 2DH5A 5KJFA 4GKJB 1DCTA 5LMZA 1JRLA 1T5OA 1TQ4A 1Z47A 3AHGA 3KIPA 5EMNA 2NTVA 1HDXA 1CDDA 4FCVA 2Z08A 1PT7A 3TTTA 4KQIA 4NP6A 3ICEA 2VF7A 5K3CA 3O7MA 3COSA 1ODSA 2JFFA 5A7FA 2HPAA 2ZB4A 1DGQA 2FMIA 3PXDA 2IV3A 5HFNA 2MHCA 4O5AA 4ZTUB 3TO5A 3GD5A 4ED9A 3H9EO 1CUUA 4JT8A 2WJVA 1IBKB 3IYLW 4HDCA 5LLTA 1RFLA 4DV3B 2AQHA 1JZTA 2CXQA 1EB9A 1ZOPA 3DS8A 1KGDA 4ZAYA 3KJGA 4M55A 2AF4C 4HDOB 5I9MA 1TM4E 3AV3A 5IWCA 1SHUX 5KX5B 1D9XA 4JC4A 4JSYA 3B8HA 3NRJA 3S5JA 3TL6A 3IAS6 4L5YA 4N8EA 1E2EA 1JHRA 3CO5A 1G4HA 3ZNQA 4LOJA 5C5CA 5CH8A 1Q6YA 1T34A 3HZRA 1ID8A 2JI8A 2QX6A 4M0EA 1SXJA 3AYXB 1YFJA 4NBRA 3B20A 4AJLA 2CNWA 3U62A 5A04A 4A0QA 1OX4A 4US2R 1DVRA 3ZDEA 2C9CA 2XUHA 1MVOA 3BUSA 5AICA 4JB8A 5SZJA 2FF5A 3JSXA 1T0PA 2R85A 2N0SA 3ZY2A 1Q14A 3DCJA 1FF9A 1NVXQ 4YV2A 2FCAA 2QTVB 5KTMA 2G07A 1XRLA 3VTKA 4IDBA 4I3GA 3LYAA 1UBMS 3L84A 2DTDA 2IKSA 2XMPA 1PNVA 5IVKA 4R71A 1AKMA 3GXBA 2EERA 2OORC 3CLSC 5BN4A 1N33B 2ZVDA 3WWOA 3GEPA 3M5DA 3A04A 1Z8HA 1MJNA 1XMIA 2EIHA 5LZ5A 4ZI7F 1ZKMA 3NTLA 1ZUNA 4TS3A 3SQWA 2YC2C 2P0AA 2CXNA 2F1OA 4I5FA 1T8WA 3LX6A 3KJHA 4UVHA 2WM8A 3SK0A 2XKKA 1H8ED 4OAOA 4CKZA 2CXXA 4P83A 5I7AA 3ZE6A 3EEOA 3R8XA 3JWPA 3VR6H 2OV6A 1YIAA 4AF8A 1V16B 1WX1A 2ZQZA 2JGEA 1H2RS 2IPAB 2XR1A 5E4TA 3MMZA 3RARA 2C77A 1PVDA 4EELA 1GT6A 1Z6XA 2GAJA 3O9VA 3BVPA 2I6FA 2X2OA 4A8TA 2VJDA 4L6CA 4A8HA 3A4NA 3UY4A 1EGAA 3M6WA 5T6BA 1K88A 3AY7A 4L7QA 3L6DA 1ZO8A 5DNUA 3T35A 1U1DA 1H6BA 1GRCA 1GUBA 1Z08A 4XFKA 2SNIE 4OI0A 2XGSA 4JX9A 3F6PA 1DELA 1NRWA 2WHYA 1NPYA 4IMPA 1PGPA 5F76A 1PLKA 2WJIA 5KMGB 3I2FA 3LFHA 2PMWB 2GPSA 4ZGGA 3R3HA 3EFOA 3VAAA 1E9AA 4JSRA 5J43A 4HI0E 4Y2RA 3T7AA 1U1IA 4F6RB 3H3XA 7ADHA 5KC8A 1NZJA 1OFUX 2VA9A 4LSZA 3R3XA 3NT5A 4KWIA 4ARAA 1EXMA 1GG2A 3GFBA 5IYZA 1UFOA 4HZGA 1Y3FE 2DUJA 5EE0A 5K4HA 4EFDA 1CZNA 4JUCA 4ZQIA 4A8JA 1Y8RB 3JAWA 4LDRA 3ZQ6A 4DJDC 1QH8A 2J9FB 4TWAA 4LXTA 3RS2A 2IYAA 2ZRNA 4QDOA 3P45A 5HK8A 4CQMA 3NMUF 1N2GA 2OAP1 3JQEA 4H9GA 1KEEB 2B4KA 2DFTA 3LXMA 3KEQA 3EGOA 3N0RA 4HG2A 4IH9A 1GY8A 4MK4A 4RVOA 4B8ZA 3K71B 2PA0A 1G3MA 3QX7A 4DR7B 5MHTA 2GZ3A 4MVCA 5JJLA 4TX1A 1CTQA 1SRQA 3H0KA 3MQ4A 2CL7X 3FSGA 4NYMQ 4JLSA 1B93A 5KEIA 4PCVA 3HXMA 3ZD7A 2VAXA 3L6CA 3O9ZA 2NT3A 2Q4OA 2ECKA 4Q3KA 1YJXA 5FEMA 4CLXA 4KKVA 3TDKA 5MGNA 3NETA 3B5EA 3QGMA 4C2TA 3RHFA 2K4MA 3PYXA 4QAQA 5IARA 3WL7A 3M4YA 1JKXA 4RFSB 1L4NA 2YWJA 4RJKA 4TV9F 3OMXA 5HTOA 3D2AA 2FRXA 2C42A 3CMMA 2NZJA 1EIZA 3I62A 3SEAA 1NE7A 2C94A 2HYDA 1K8QA 2Z3WA 3LBYA 4A1FA 3DEKA 1NUHA 1UZMA 4G1CA 1CP2A 3MT0A 4MO2A 5HQ3B 2ACKA 4ABTA 5CLFA 1O96A 3BQ9A 2QRNA 4Z4GA 4MQ5A 2O2GA 3JQFA 2JNWA 3V1YA 5B53A 1QQ7A 2N9UA 4TWZA 2BBOA 1NDHA 3TI7A 4G26A 1PZHA 4WBNF 4XYMA 1QFXA 5KYXA 1LBTA 2FSUA 2IT1A 2OHGA 3EQZA 3WLQA 1M76A 4CT5A 4LBZA 2JCXA 3FYUC 3HJHA 3NHAA 1SZPA 5SYNA 4UXJA 3CRW1 3BE5A 1KJZA 6REQA 4EL5A 2UXCB 3V5NA 4ZI3A 2OENG 5FUMA 5FV7A 3I6QA 1PW7A 4MRMB 3U37A 3V1MA 5C5EA 1ZM9A 1JG2A 2HU2A 1Y6ZA 2ZSDA 3GO4A 5E8JA 3PX2A 2YVAA 4CM5A 4DV7B 4KEAA 5B58C 4AULA 1J1IA 3LU1A 1RWOA 4FC6A 1PEYA 4C7BA 1R6XA 4F86A 4I36A 3L05A 4HV4A 4X8LA 4RTRA 1QSGA 1ESZA 2GAIA 4GW3A 4JZYA 4ZREA 5IAGA 2EZ4A 3FF1A 2LE0A 5CDSA 4KMRA 3IA2A 5I01A 1Q1QA 3HFSA 4X44A 2WR8A 2GFQA 5D86A 3SBOA 5DNYB 4LC1A 1GV0A 5CT6A 2I2AA 3SNKA 4RV9A 2H85A 4AXXA 3IULA 1YNSA 2JDID 3B12A 5HA5A 4UM7A 4JASB 1XBTA 1V35A 1Z8DA 2VNKA 2XD9A 4DLBA 5JANA 4II2A 3P4XA 2A1UB 3RS0A 1K6EA 2QN2A 4O4LF 2PWPA 5CYGA 4X62B 4X45A 4I4LA 3SM3A 4BFWA 2REXB 5KTNA 1DC6A 5KWJA 1M1YB 4Z5XA 4DNOA 2NLOA 3R7SA 1N9ZA 3IV7A 2OBNA 3LK6A 4O4IB 4DLWA 1NURA 1L4FA 5L6LB 4OGFA 3DZIA 1RZUA 3DBHB 1LK0A 2UAGA 4I9FA 1CY4A 4BX9A 3MERA 4OHCA 5I9NA 4DR4B 4UXHA 1U5BA 3BXOA 4YR7A 1IH8A 3WHKA 4NI5A 4MW7A 3KM0A 4JFRA 3UK7A 1ZRMA 4UC0A 3ZW9A 3MINB 2I2WA 4GX2A 4FNAA 2KYRA 4CKEB 3RU9A 1KTVA 1EE1A 3EFEA 1RBZA 2F4NA 4GR5A 3SQMA 4Q7QA 2D8MA 2DPHA 2ONCA 4FR2A 6CHYA 1ZJWA 1G98A 5E2BA 4X41A 2FEWB 3F47A 3JWHA 3TTWA 1ZN7A 1L7EA 4RJLA 3E7WA 3IEIA 3QMPA 4WKCA 1V7ZA 5A6SB 1C4KA 2P77A 2FG7C 2GEKA 4K9QA 4DHEA 1U0JA 4NU6A 4JT4A 2IE0A 2D4HA 2K5UA 4RMHA 1Z2AA 4BO8A 4E14A 4W9MC 1VSQA 4KPFC 2POCA 3SICE 5BUQA 1BFKA 2GEVA 3GUCA 3QBDA 1FRZA 1JLMA 3BGDA 2RI6A 5I9BA 5J23A 4H4DA 1USIA 5CK4A 5CEEA 4J16C 4HUJA 3VGJA 1CUSA 3KD2A 4IXDA 1ZJYA 13PKA 3KXPA 3LPMA 4L57A 1BHJA 5FPTA 4Y2YA 2VYCA 3SLRA 1ZICA 5IF9A 3W77A 2WTMA 1LRKA 2ESRA 4HNGA 5KTOA 1K1EA 3GGDA 4R3UC 1SQGA 4F7DA 3OIVA 1V3QE 1HYHA 3EHEA 3EVTA 1TFRA 3FHJA 5EP2A 5T8KA 3AEZA 1T10A 2R6HA 3S2ZA 1HOXA 4KIFA 3JWIA 4OJKA 3GFVA 1ZXBA 3KYDB 4FD3A 1XNQB 5JAZA 1FMFA 2DULA 3FTPA 3EVNA 1TGVA 3L7NA 3T3DA 3IUYA 2B8TA 1Q95A 1ZK1A 2HSDA 1N2XA 1DUIA 2OXCA 3EUFA 3Q72A 5L40A 1TJ4A 4IRMA 5DYGA 3RT9A 1R6VA 3UMJA 3ZEAA 1W5AA 3D5EA 1SCAA 4DLTA 1A7KA 2OHVA 1H1LB 2REOA 3FMFA 3MJ4A 3ZD6A 3JQ7B 1AHHA 2PGLA 3OQBA 3TZHA 4L5AA 4BFTA 4BLPA 3P2OA 3R23A 2NU9B 3IIJA 3SHWA 1U90A 2LZ0A 1WO8A 2ZT7A 3GGGA 3TBKA 2BDUA 1I2ZA 2A5DA 2EW8A 2O7NA 4J76A 4QDXA 1QS0B 5CA1A 2FMFA 1Z5VA 2NVWA 1IBMB 3MMXA 5IC6A 4BNGA 1UDAA 1YRYE 3B36A 4S04A 1QAMA 1RTKA 2FNAA 1S8AA 2Z4TA 1UKVY 1X9HA 3A06A 3JRWA 5AVJA 3TNDA 2ZUUA 3EXFB 1JDUA 3OU7A 3Q7IA 3WJ7A 2QXTA 1GJRA 4JSTA 4KUEA 4Q12A 4S0ZA 3FOBA 3HLYA 1OREA 1ZGHA 2HF8A 1C3XA 1RRMA 2PLWA 3JPWA 3NNNA 4PTLA 1UFVA 2J07A 4YPVA 3QLUC 5DXJA 3S55A 1XF1A 4YRQA 1XRPA 3JVEA 4PXSA 1T6XA 1XLTA 3IQEA 1KXJA 2GKOA 1TK9A 1ZH2A 4L2IB 4YPOA 4KFUA 4Q01A 1J2JA 4F4FA 4HAOA 2MYUA 4QZVA 3OAAA 2D3TA 4M36A 1DXOA 1NUUA 2IGBA 1AMUA 4LIPD 2X6QA 4PGMA 1NVFA 2I62A 1M54A 1VHJA 4GXQA 4R54A 1E0KA 1Z34A 3JRNA 2R4UA 3NAMA 3QEMB 1JG4A 5CB4A 4RVCA 2GK7A 1GTL1 2BP7A 2PTHA 3OE4A 3R5KA 2IIVA 4P6VF 4QGBA 4REMA 3UW1A 2PUBA 3KQKA 1UP7A 2Y2VA 1KEWA 4OYRA 3OM9A 4M99A 1FW6A 2OUIA 5F23A 2D2XA 1IG0A 1P0QA 1IK6A 5I7FA 2BHTA 4JQSA 1ZAKA 4P3YA 2HTEA 3G17A 4JC8A 4EPRA 4HLUA 2PO5A 3PQ7A 4EBFA 3EB9A 2XMDA 4QFDA 3OFSA 1N2IA 3A2MA 4DLRA 1O0CA 1JSLA 1VMAA 2HSWA 1SIUA 1QHGA 1YWGO 4YALA 1F3LA 4JL8A 4BJ3A 1RWWA 1A8PA 3SYTA 3QUBA 1A50B 1Z35A 1XTJA 2DT8A 2Q1TA 1XO1A 2EEPA 3L6EA 4R3WA 1JP7A 1GNQA 1KAEA 2P9TA 3PGKA 4EHKA 1IEQA 1KZ7B 5C2JB 3F0TA 2J3EA 2Y76A 2EFGA 4A5SA 2P4EA 2JLXA 3CLHA 3W2FA 1M2HA 1YS2X 3P7MA 4AJNA 1VE5A 1V8ZA 2J6BA 4X6XA 2FPRA 3HBFA 2WM9B 2WICA 5T4HA 1RKXA 2Y71A 3L79A 4X7BA 2WAXA 4XCQA 4DF3A 4EG4A 4ZICA 1A7JA 4PVDA 3E5HA 3EE6A 3JSAA 4G6ZA 4TROA 4ZMSA 3WOHA 2WYOA 3EW9A 2ZI4A 2HMAA 3M6LA 4YDSA 3QVLA 3RIXA 4BVLA 3TAHA 3PHJA 2Y0CA 1XWIA 5E9AA 3G2NA 1VJTA 2E1RA 3E7FA 4DIBA 2ZRHA 3PQDA 3FKSA 4PG6A 3RC8A 3ZWMA 2HJRA 3CISA 5K5EA 5DP1A 3VU0A 3ZTYA 4CIYA 4TWIA 5KJ1A 3SSMA 2LV8A 3FTDA 2PZMA 5L7WA 4I55B 4GPIB 1GLNA 2FWRA 2QTWB 4ALNA 1RIFA 3UG7A 3BIJA 3ZXXA 2HJGA 5HEKA 1OU0A 1U4SA 3GPIA 5KNDH 4Q18A 2QZPA 5KOIA 4C4ZA 2J8ZA 3W7VA 2GTHA 2W6ID 3A14A 1KJ9A 5HZKA 5EIAA 5BSEA 3F6SA 2PE5A 1GN8A 3RVOA 1Q84A 1A5AB 2BONA 5AVSA 2HCRA 3FETA 3CW9A 5L8VA 2FDCA 4BVKA 1RLUA 2FFJA 2G9NA 2QUBA 4BOYA 4NBVA 1FU7A 4EFNA 4HDRA 2EKBA 3PPXA 4NZYA 3VR5H 2HQ1A 1MNAA 3KOWA 1KFKB 3T9AA 1KZ6A 3ZWXA 3OMWA 4WN9A 1AURA 2VYVD 5EVJA 4YV0A 3LC7O 2ERYA 4L4RA 1NLMA 5LN1A 5AIAA 4C14A 1KJIA 1UBEA 3JYHA 1AXEA 4M87A 4BCBA 2FN8A 3W8NA 1U8AA 5CAEA 1SCIA 1BDJA 1A0OA 3PKJA 4FX2A 1F14A 1SIOA 2ETVA 2WG2A 3TCKA 4CIXA 1FE8A 4G9EA 3IQDB 5IJ9B 3D6AA 4EW6A 3VHQA 1E5VA 1VKOA 1F9EA 4E33A 3RSLA 5D84A 3EVGA 1BYUA 2V1XA 4OHFA 1OFTA 3CNNA 5K3SA 3KOZA 2GN1A 3B6JA 5TMBA 1W19A 5KX5F 1RD4A 1FRVA 2IVZA 4C0QC 1UJBA 3R4CA 3LT2A 4F1JA 2OV1A 5CDHA 1IB0A 2JJ2A 3B1WA 3FBTA 1Y9ZA 2POQX 1QX3A 3A7DA 3GRPA 1K4MA 3C6XA 1E96A 3LF2A 4OP2A 2IPOA 4JJ4A 2CJWB 4RMIA 3AM1A 2YV4A 4OXNA 5IHPA 4PN7A 3UOWA 4DL9A 1I10A 1OIVA 1OA1A 1OWMA 1WKCA 3PVZA 4P38A 1B4DA 4ZT6A 5E7MA 3FPBA 4N01A 3DM5A 4JL6A 4XCVA 3TKLA 3VSDA 1CXZA 1KVQA 3WGIA 4DUYB 2P9ZA 3E53A 1PV4A 1ZC3A 4XEUA 2FZ4A 3HSKA 3T7SA 2GUWA 4D92A 1QMPA 1ZN8A 3W4IA 2AN9A 3OFVA 1KMMA 4KLAA 4EA6A 1OB5A 3CLKA 1HT0A 8ATCA 1ODJA 1VSUA 3SIPA 2X4GA 3CPHA 4RIGA 3QVGA 4XFDA 4J7AA 5DGTA 1B0UA 3BREA 3EXHA 3PF9A 4CKBA 1NY6A 1T2FA 4XUGB 1NYLA 1X3LA 3L7LA 3W1WA 1TTTA 2JFXA 4ZOAA 3N7AA 5EOVA 1EVJA 1MO3A 2P8SA 3G8AA 4H6PA 3L7MA 1N2JA 1QKJA 4YT4A 5L45A 2WHPA 2ZUSA 3AF0A 2H8KA 3DDWA 4LNAA 3ETLA 3ZOZA 1Y3BE 2EKQA 2OAQ1 2ON6A 3FZYA 3VJLA 3EIFA 3JVIA 1YH3A 3FTQA 4RJIA 1IRIA 3VHLB 4NEQA 1DIHA 4E08A 2FEXA 2TSYB 2VHZA 1H2WA 5SZIA 5F7ZA 4GOOD 4AP5A 2XUZA 3ND6A 3OKPA 1R8XA 2YJ6A 4CZ2A 1SQ5A 1CUFA 2IL1A 1KQFA 1NDUA 2VNJA 4R05A 1TVKA 3TSAA 1JU9A 5JSKA 2HJHA 1QQ6A 2UUOA 3N8KA 4UUPA 3VU1A 3V4OA 1JXQA 3ZW7A 3OH8A 1BN6A 4BVGA 1Y3CE 2LRHA 2W2OA 4QPCA 1S0UA 2D54A 1NW7A 2CL6X 4NONA 3UJ3X 2GHTA 2H4YA 1JNXX 1F4LA 2W8ZA 2Z9DA 4Y67A 3WFIA 4BU1A 5I8PA 2VCYA 1GTZA 3QF7A 4DQKA 1BX0A 3EA5A 3MWKA 4UE2A 1KQOA 5GWXA 5JD5A 2PKYX 3DBRA 1BOOA 1IZ8A 1GWNA 3OUUA 3Q3JB 4YJKA 4U2FA 4M0KA 3OEHA 1M6NA 2Q2WA 1JXMA 3MCAA 4U0KA 5FBVB 5JSZA 3PFHA 3NBXX 2Z6UA 2JLSA 3E22B 2QJFA 2VHQA 2WE8A 4TVKA 2EX0A 3H7IA 4Y8VA 4ZHSA 1I2CA 1K5GA 2WJJA 3HNRA 4IIXA 4P3OA 2A92A 5JU6A 4MUJA 2EHJA 1XXHA 2QLNA 3BXGA 1GCAA 1ZD5A 2IEAA 1U3WA 2DQKA 3IAM1 4GZ5A 4X6UA 5EGSA 4EYEA 1QJ4A 4PE5B 3CU5A 4K1XA 4HAYA 2FX3A 2QR3A 1NXSA 4FIDA 1QK4A 4GPEA 3WLSA 2NADA 2J9GA 1D1SA 1LSOA 1KNQA 4L0MA 1U1GA 4UD2A 2FQXA 4O2AB 5LA6B 3ZHCA 1K2VN 1NAHA 2PQ0A 3GPCA 4CR8A 2R6JA 1K06A 1O8CA 2FG6C 4JN6B 1ZSYA 2O23A 4FLEA 4R1NA 1GVHA 1YBHA 3TF5A 5BXQC 1HRDA 3NVMB 1T1JA 3OOJA 3NTRA 5ES3A 4CL2A 4FW9A 3BD6A 4WUTA 2X7JA 2Q0QA 1EVQA 4ZC1A 4DUGD 2B20A 1X2BA 2D0OB 2A30A 3QI7A 3DCNA 3OKAA 4GICA 1RZ3A 1E6CA 4KE9A 4K9PA 1D8TA 3BZUA 1ZR2A 4KGXA 3PDUA 2R5NA 3DAOA 2GFHA 4V0RA 1GG8A 1TZJA 3F78A 4YA6A 4D0SA 1M6WA 1FXWF 1EVLA 3DEHA 3CG4A 2C7QA 1UQUA 2WYHA 3MAAC 4RVHA 4LQLA 1KFEB 5EZQA 3VH4A 1CWUA 3G0HA 2B7CA 3OEED 3TDMA 3BL5A 4JYAB 2OFXA 1O87A 3FHOA 1LLDA 4TXNA 4KSYA 4NZPA 2NPFA 4MRVA 4EY5A 1G8JA 2PZEA 1XDUA 3RFUA 5EFOA 1KYXA 2ONZA 3DDHA 1AGNA 3I9NA 2B5VA 4UTXA 3RRBA 4CMBA 1KYQA 3H3FA 1ODFA 5KBYA 3CWQA 3IQGX 2W0MA 4LI3X 3A4VA 2XCIA 3KB2A 3P9XA 2R7NA 4GQIA 4JLBA 4LCJA 1NQXA 2FKNA 4G1MB 3IBGA 4KHZA 4W7SA 2RBKA 5LQKA 2BCJQ 3UKJA 1HNNA 4RESA 3KD3A 4KFSA 1XZFA 2PKEA 3Q2KA 1A9XA 2NUPB 3SJCA 1PFWA 1U8TA 3KAJA 1QE0A 5BV7A 5T3YA 5CIYA 3KZVA 3U6BA 4U9HS 4LDJA 1GNVA 2COEA 4K6KA 2ZYRA 2E4UA 1DPFA 1NZFA 3KB8A 3ROGA 3LRTA 5TT1A 3ROPA 5JAUA 3L40A 3OZ7A 5C53B 1CERA 2DSTA 3KVVA 1QCDA 3FNIA 4WCDA 4CQLA 3BE6A 4LJ8A 4D41A 3FPGA 1ISMA 5GM2A 1MN6A 4O4IF 4DAEA 5B1DA 5HGXA 2ISQA 2XXJA 3QVOA 2Q5EA 4TTQA 1OZFA 3W05A 4DJTA 4O0LA 3ZYCA 4DCJA 5JJ5A 4BFUA 3L46A 2BBSA 2O8BB 2HC9A 3TE7A 1XCMA 2VHYA 2ZOSA 1GYQA 4NFLA 4LZZA 3OCZA 4QGSA 3CF4G 1MGPA 3NJRA 4UATA 2Q1SA 1ZEMA 2BF7A 3RYIB 3PDHA 3DZJA 1V6AA 3GLIA 1RRFA 1IE3A 2RHRA 4D9KA 2FPGA 2E2WA 2OO5C 2ZAYA 4QEKA 1T2VA 3JQAD 2DBQA 2ZLBA 3UXHA 4AU1A 1M2KA 5LCXA 4ENQA 1VYTA 5K8VA 3CURA 3GH1A 4FYHA 2ACWA 1PNRA 1DKUA 3LLMA 3UJDA 4EY6A 4Q47A 4KI0A 2PPLA 3FBWA 3PWKA 1QIKA 2WRZA 5IUKC 3PHIA 4U7PB 3ZZNA 2PT7A 3GLIE 4MA4A 3IIMA 2A9QA 4I4TF 3BWCA 4TN1A 1R5NA 4QBTA 1TCVA 1Q16A 3CSUA 4HLQB 3SR4A 3E27A 3G5UA 3SYNA 2MSWA 5EESA 1P9NA 3BMOA 4GZMA 4D8UA 5BSUA 2IYQA 4FHZA 1I7LA 1NP3A 2WIGA 4DA0A 1UMDA 4YK7A 1PYGA 3O4GA 4YRMA 2P2DA 1D6MA 1E32A 4R4JA 4EFKA 1YV9A 4C6TA 1TZ2A 5AKGA 3M82A 2JLYA 2ZBQA 3Q7EA 2X40A 3COPA 1GLGA 3GA0A 1EP1B 2P5TB 1QIIA 4U7WA 3IUEA 3W04A 3FCOA 5DX1A 2HO5A 2YQZA 4K87A 5B12A 3RHTA 1G8PA 5L9AA 3GJXC 2B8EA 4RZHA 1NBMA 1JSZA 1BMDA 1C1XB 4LF8B 2ZTLA 2FJUA 1OIXA 3ENKA 1E69A 3E9CA 2A5YB 2G3YA 3KUCA 4Q39A 1KAQA 2I3BA 4FSXA 3DEJA 4Q3DA 3M3DA 4CCSA 1YZGA 4JUFA 4L22A 4N9WA 1Q0TA 1BE6A 3IBYA 1KS2A 1P18A 4S1PA 1KWGA 3COJA 2JEOA 3EF0A 1TQDA 2XGMA 4Y2TA 4Q1CA 2I4IA 1Y6FA 2WUGA 4FCTA 3Q3HA 4P8RA 2HT6A 3KJXA 2FGKA 3QNUA 1H0HA 1USWA 4UCQA 2XUQA 3UPDA 2QVBA 2PK3A 5IM4A 2BH2A 3QK7A 2X4IA 3FDXA 3CR7A 5BOVA 1ZAYA 1U04A 2VJMA 2G9ZA 3KJNA 3ZDAA 1KSHA 4OHMA 2LKCA 2ZRPA 4G65A 2C88A 3R5FA 3NORA 4FNOA 4IGFA 4L9WA 1Q0SA 2DTXA 3DHEA 3EYWA 4UQLA 1YKSA 3LYUA 3OLXA 3L9WA 4OXKA 4RA9B 4UE3S 2BT4A 2BZSA 4XWTA 1GZSA 2QZJA 4CF6A 2W4MA 1MJGA 1ONOA 1F5SA 1BJTA 3NCHA 4QGHA 3SDBA 2WJPA </