2WJGA

Structure and function of the feob g-domain from methanococcus jannaschii
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
170
Chain Sequence
GGSHMKSYEIALIGNPNVGKSTIFNALTGENVYIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSLTANSIDEIIARDYIINEKPDLVVNIVDATALERNLYLTLQLMEMGANLLLALNKMDLAKSLGIEIDVDKLEKILGVKVVPLSAAKKMGIEELKKAISIAVKDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Feob G-Domain from Methanococcus Jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal transport
molecule keywords FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
total genus 54
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wjgA00
2QN6A 2H18A 3QXCA 2KE5A 4MGYR 4TT3D 2GDJA 2JLUA 1Z83A 2GJSA 2QENA 4N0EA 2CJWB 3WYFA 1W1WA 4CEJB 1M7GA 5B58C 1I4DD 4DHEA 1H8HD 1UKYA 1FL9A 1FNNA 3DM5A 5FI0B 4BZPA 1RPZA 3ZYCA 4A36A 1DELA 1CJKC 3PV0A 2WHXA 1OH6A 1CJUC 2BEKA 4OI2A 1GZSA 4PPGA 1A82A 3TAHA 4PPFA 2O0KA 3IPXA 2O8DB 3NH6A 1T5LA 3T15A 3OFNA 3BGWA 3KKNA 4HAZA 4Q4AA 3V00A 4HZUB 2WBLC 2SHKA 5HTKA 3UG6A 1KSGA 2ZI6A 3KKPA 4D0NA 3W6OA 1E94E 4O25A 2ZJ8A 2ZEJA 1Y63A 5FH9A 3AB3A 3ND9A 2HCJB 2ZJ2A 1SHKA 2EFCB 5EE9A 2PJZA 3RHFA 1KI7A 3RNLA 2WVJA 2QPTA 1JB1A 1SKYB 2A2ZA 3GJ7A 5HE8A 2NO9A 2CJWA 4QJ5A 3THYA 3WNBA 4I1UA 4BZQA 4E22A 4C3ZA 1ZUHA 1S1CA 4OQMA 3BBPA 2JLWA 1A2KC 1E4YA 2XOKD 3IBGA 1EESA 3ADCA 1VYTA 4MQBA 2NIPA 3RS3A 1HYQA 3AP1A 2W2TA 1JNYA 4NZYA 4OQFA 5DE3A 5DI3A 3TKLA 4DKXA 3W90A 4LHZA 1CJVC 2B8WA 3L2OB 5KO2A 2V7QA 1TQ6A 2V7QD 1HURA 1L4UA 4G5RA 4HB0A 1E2QA 2OE2A 3LW8A 5F98A 1MABB 2QT0A 1W5SA 4RD6A 3R7WA 2A5DA 4Q47A 2BMJA 4GRAA 3GFPA 2WWFA 3B1YA 2REOA 5DYIA 4II7A 1U9IA 4CEIA 1E79D 1U0HC 3X1DA 2ZRGA 2DFTA 2CE7A 1XTKA 1JPJA 2X2FA 3Q3JB 5KTYA 1KDRA 1XXHB 2ZU0C 2YC2C 3L8YA 1LS6A 4JT2A 4B71A 2C9YA 1M74A 3IO3A 4DBLC 1OFHA 5FTJA 1NN5A 2X77A 3R9XA 1ZYUA 3GLHA 1OH5A 1AQYA 4V0KA 4A92A 2PBRA 2B7CA 2ZRIA 4PQRA 1WF3A 3NDPA 4GI7A 3PENA 4QBFA 1AM4D 1UEIA 3NWJA 3QVUA 4JSYA 4YDHB 3H0KA 4B32A 4OHXA 1NMXA 4FMCB 4AD8A 3DMNA 3I8XA 4D4JA 3AEZA 2J0QA 3ZVLA 4WZ6A 5CLQA 2FFBA 3OEEA 3VMFA 2NZ8A 1J70A 3CO5A 4LUCA 5J4VA 2ZM5A 2Z43A 1I2DA 5IK2D 5JZVA 3OIVA 1KJWA 5FOVA 1TF2A 3K0AB 5AJYA 3PITA 2F1HA 4KBFA 2ZIAA 1OH7A 4YMSA 2GXQA 3FGNA 4OJQA 1G6HA 4GDFA 3LQRA 4EDHA 3HU3A 3G82C 5A5GA 2YWHA 3A1WA 3P20A 4IOJA 4PR0A 1GOTA 2VHCA 2R44A 4ON9A 3K0FA 3DKPA 3EZ6A 1TQ4A 1XTRA 3M6AA 2R6CA 5B2ZA 4TLCA 1M34E 3GLHB 1E9EA 2OHFA 4A8JA 1JAIA 4NP6A 3KFXA 4P31A 2IW3A 5EXXA 3SU8A 8OHMA 1KK2A 3F8TA 2PT5A 2OFOA 4M1TA 1FUKA 2RGNC 4P3YA 4M8NE 5IK2A 3B1XA 5C4GB 1LW7A 2GZAA 5M04A 1IN8A 2VP4A 1H8HA 1Z3IX 1C4OA 3I32A 5EUMA 1IJEA 3QBVA 1XD2B 3P1JA 3K0AA 4WVFA 3B13B 1OW3B 5C46F 4QFMA 5ANRB 721PA 4MKGA 2CNWA 2XGJA 1FX0B 3FHOA 2QM8A 4HAUA 4RFSB 3CX8A 5G40A 4DC9A 4RD4A 4BRUA 2YNMA 4EKDA 2B8TA 2CE2X 1ZU5A 3FFAA 1R0XA 2YOGA 4UNRA 4O0MA 1WBDA 4MGKR 1IQPA 2IYVA 1ZU4A 3B1VA 1E9SA 3U3KA 3W9YA 4JBYA 3IILA 1OIWA 3UXMA 3W5JA 2JJ1A 3U2QA 1EXMA 2DCUA 4KAXA 1Z8FA 2EYUA 5FTMA 1UKVY 1UJ2A 1XRJA 5FBVB 1GWNA 2P0EA 4OHZA 3REFA 2CLCX 1AS0A 2FFQA 4GT1A 3SHWA 5BYKA 1IY1A 4XSGA 2BBOA 1P9NA 4AC9A 4EPVA 4ZCIA 2RGAA 2NMVA 5JFGA 2A78A 2ZRDA 2WSMA 3A4NA 3W3AA 2HT1A 1BS1A 3UWKA 1MABA 4UNNA 3RS5A 1XFAA 1KI6B 3AQ4A 1IXRC 2N42A 4UNQA 1DG3A 2V6JA 2HLDD 4E03A 1NJGA 2F7SA 3I4LA 3TIFA 2WIAA 4QKQA 1VG8A 4LI0A 4AKGA 2ZJBA 3GLFE 2XJ4A 1UPTA 1Z5ZA 2KWIA 3FMPB 4DLTA 2Q9CA 3ASYA 4BGDA 4F4CA 1JQLB 1QRAA 1S3GA 3QG5A 3KJIA 2D7DA 4S2EA 4JJKA 2WM9B 2HXSA 3B7GA 3LNCA 2IHYA 4MKFA 5TVKA 4ZI3A 1XPOA 2F1IA 1NMYA 3DHWC 1B23P 3MG9A 2CMKA 4NONA 3TR5A 1KSJA 1FMLA 1XCPA 3WBKA 4A4DA 2R6AA 2WWXA 2GZDA 3QQ5A 4HAWA 1Q21A 3VR2A 2QMUA 1EWQA 1VG9B 3VU9B 3MJRA 2F1RA 3ZZ0A 3CX6A 1J2JA 2KBFA 1ESNA 1VCOA 1ZCAA 4Q9IA 1W36D 1EFRA 3SQXA 2A5JA 1OJLA 4URWR 1E9BA 1TUIA 4CEJA 3QIAA 1S4QA 3MLEA 1W2HA 4Q1BA 4Q1DA 2XNDA 4WZBE 4PO8A 5LB2A 2NOAA 3OESA 5IHPA 3QI2A 4YONB 3MGCA 4A2QA 3RRMA 4HLDA 2OFXA 3QPVA 4BFWA 4TYYA 1PUJA 2Z4RA 1GP2A 3OEHA 1GILA 1MR3F 2FV8A 1Q44A 3DEFA 4ARZB 1JEEA 1GRRA 4MGZR 4QBHA 4TQ9A 4E5UA 1XTQA 4LYHA 1E1QD 2VBCA 4DIDA 5EXTA 1H8ED 4LJYA 2UZIR 5EP3A 4PZZA 2G1KA 1M7BA 4G5OA 3RDPA 3THXA 1HEIA 2GILA 4Q21A 4C0KA 3GEEA 2CNWD 1P9RA 4TYQA 1HE8B 1AGRA 2WJJA 3CX7A 1Q3HA 1VYVA 2JDID 4LBWA 3UMRA 1TTTA 2EWVA 3KZ1E 1D2NA 1CU1A 5DHAA 4QGHA 5EZ6B 4PQYA 5FOWA 3W5IA 2P5TB 2JA1A 2Q3HA 3QKSA 5CB8A 5AJZA 1VCIA 1YRAA 5BN5A 2VYFA 3BORA 3K09A 3DKVA 3PVSA 5E3HA 4MYCA 4LV6A 2FGJA 3BB4A 3P4YA 4BLTA 3EZFA 3PUXA 4XVRA 4BLPA 4OJKA 2ZS9A 2P67A 5FL7D 1G8GA 1YZGA 2ASEA 4CDGA 1OB5A 1SVLA 4BPBA 5JSZB 3TE6A 3Q5EA 1CULC 1W0KA 3RABA 1DOAA 1QVAA 4BRWA 3KKOA 3T1QA 3TLXA 1G16A 3RWMB 1CKEA 3IHWA 5JHHB 5LBIA 1E2PA 1LTQA 3PUYA 3CF0A 1EX7A 2VHTA 2IC5A 4TYNA 1S9HA 4EJSC 1XZPA 2AXNA 1U8YA 2YWEA 2WKQA 3S1AA 1K5GA 5KDOA 3PR1A 1VECA 3CPEA 4FN5A 1K5DA 3QKTA 4LC0A 2IHBA 1Q22A 2J1LA 1HQCA 1NBME 4TYWA 1NVXQ 5KOYA 3W8RA 2F43B 1XJ0A 4LJ7A 4ERNA 2YC4C 4BFTA 2OFWA 4DSOA 3K0CC 3RVBA 3A58B 2PZFA 3RRNA 4M1OA 2XZPA 4M21A 2HJGA 4BUJA 3OE7D 4DDWA 4LJ8A 5FOTA 3KQLA 4U5XA 1AS3A 4A2PA 1OT3A 3U3MA 1PZNA 4QL3A 1DS6A 4JLPA 2FH5B 4B48A 1SULA 3I5XA 1KNQA 1M8PA 1Q1ZA 4EUNA 1W2GA 2VF7A 5C18A 4TZ6A 4URVR 2GJ8A 1KSFX 2BDTA 2L0XA 3JVUA 4C0QC 4WZAE 1L4YA 2NZJA 1RW4A 4LCBA 1KI9A 2YYZA 2IS4A 1GL7A 1W46A 1AS2A 2D2EA 1JECA 3NBXX 2HEIA 4KFUA 3AGPA 4B76A 4B2LA 4NU0A 1OH8A 1OSNA 3QE0A 1IAQA 4NCKA 3KX2A 4PX9A 4EQ6A 1U0LA 3Q5DA 3B9PA 2FNAA 4EFMA 4LJAA 4F93B 3GJ5A 1XBTA 2RCNA 3VHLB 2ZYUX 1G3QA 2KBEA 4M1SA 1SHZA 1AZSC 3OFND 1E2LA 4NPHA 4KCGA 1XMVA 2QM7A 1N0UA 1QVRA 2QRZA 2ECKA 3EASA 4U02A 4R9UC 4PHFA 5L8VA 1ZJ6A 4CEIB 1MV5A 2QTVB 1M6NA 3BXZA 4R2HA 1BMFD 2ODEA 4XVQA 821PA 1KKLA 3Q9LA 4KFTA 4DLYA 3K1JA 1TQDA 3LX8A 1E4VA 5DGXA 1S9DA 4R71A 3N5CA 4XWKA 1GM5A 1YU9A 4D0LB 2O8BB 4PTLA 4WBSA 1PVOA 2Q21A 3O47A 3CONA 5GVSA 4Z1MD 2H16A 1W36B 2QU8A 3UG7A 1ZMXA 3BWDD 3SJCA 3VTKA 3MAAC 3AVUA 3U4QA 2F3RA 2ZRNA 4DWJA 1RIFA 5KPJA 5DIFA 1LS1A 4EPYA 3NEYA 2D4HA 2FU5C 4TZ0A 1N6RA 3B1WA 2QNRA 4GNKA 3HWSA 4URUR 4EFLA 4NH0A 1GFIA 1ETUA 4A6XA 3WYGA 2IEYA 4MYHA 5FPSA 1OE0A 5DO9A 2FGKA 5KNDA 3CBQA 3ASZA 1US8A 2UKDA 3P27A 1Q1QA 4KO8A 3ZJYA 5K8TA 1KI8A 5FTNA 2ERYA 4LWZA 4PQFA 4D0GA 1K6MA 5FTLA 2Y8EA 1VIAA 2R2AA 3AF0A 1ZUNB 2FSFA 1W49A 4TL6A 1Z6XA 4H9GA 1CRQA 1DVRA 2KSQA 1UM8A 2QSYA 5DSZA 2C8VA 3TUJC 3WYAA 2P65A 2ODBA 4UXJA 3RRYA 1DAHA 4KVAA 4KFRA 5JRJA 2QY9A 2ZRMA 2GK7A 1F48A 3HYTA 5JI3E 1IN6A 1E0SA 5KSOA 2JLQA 2EFGA 4B33A 2UZ3A 5K8UA 5HR5A 3ADDA 4NHOA 1A5TA 3DZ8A 3U3RA 2FFHA 2V55B 2WWHA 2BOVA 1Z6YA 2QE7A 2J59A 1ZRHA 4GPTA 2AX4A 4OKSA 3MWJA 3AKEA 2ORWA 4JIMA 2ZE8A 3R8FA 3KKQA 4F92B 1E2MA 3GPLA 2ONKA 2WJHA 4M9XA 2O8BA 4OQNA 4JT4A 4XVUA 1E69A 2ZQ5A 4US1R 3VR1A 4XH9B 3CWQA 2CVFA 2EW1A 3QEJA 4AG5A 3K53A 2GCOA 1JQJC 3VU9A 5CLLA 4V0NA 3VX4A 5AUPB 4TLEA 1KI3A 3C14C 2MSCB 3OE7A 3AVPA 4G01B 5HE9A 1LFDB 4QJ3A 2ZXUA 2RB4A 4M0LA 3U5ZB 4Z51A 4BLRA 3AH8A 1UFQA 3FVQA 2XB4A 3BERA 4PO1A 2C98A 2H1LA 1WMSA 1KI4A 1KO8A 1OYWA 2EFEB 3B5JA 3HJNA 2VF8A 4Q1AA 2ANCA 3E2IA 3GLFA 4CYMA 3T1VA 1SGWA 3WMFA 1KAOA 5JMTA 4IDOA 5KSYA 2YWGA 2G6BA 3WHKA 3OF5A 4YQFA 1QBKC 4XIGS 4KYIB 4B34A 4BZXA 4NYMR 4D6PA 3ZVNA 4AKHA 2RGNA 1SVWA 4AKIA 1Z0DA 2GKSA 2O5VA 5LB4A 1MH1A 2N46A 3EARA 1Z28A 4D81A 4K81B 4FMCF 3IIMA 3IPYA 1Q57A 1N6HA 2IYSA 3TJZA 1SXJD 2G77B 1YJ5A 2NGRA 1ZIOA 1VHTA 2QP3A 3HU1A 4BWYA 2HYIC 2N1BA 3TUZC 3U3JA 3B82A 3ZS8A 3RSOA 3GLHE 4UNPA 2PL3A 4MH0R 2XNDD 2J41A 2DWOA 2R6DA 1E2DA 2ZI9A 1L7VC 1EFUA 2GAAA 4QNRA 1NN3A 1SKYE 4YMUA 2FEOA 4HLUA 3QSYA 3IGFA 4QXAA 3NKVA 2JATA 1CXZA 4PZLA 1RJ9B 4F4IA 2GBLA 2IF0A 4LY6A 4OQLA 2E87A 1G9XA 2QP4A 4PAOA 2O0JA 2OXRA 5JHGB 3KL4A 3MUFA 2V6IA 2WSSA 4FCWA 2BKUA 1XMJA 4TTPA 1NVUQ 4B3DA 4BLSA 1OXSC 1G19A 1X3SA 5TMPA 3D6TB 2OCPA 5HKKD 2G1JA 1WRBA 5FBQB 1W5TA 1R8QA 1UBFA 3KJEA 3OEED 4P4SA 4PHHA 2GHIA 3VX3A 4DSNA 1RRGA 4MRRA 3RLFA 2OLKA 1PJRA 1N25A 3RS7A 2J7KA 5CITA 3PUVA 4XSHA 3VR3A 4XWOA 4HAVA 3L43A 1XXHE 1HTWA 1M2OB 2D3WA 2PMKA 4Q7MB 4B2PA 5KHOC 4LPKA 1OXTA 4M1MA 3Q72A 4JLBA 3IBYA 1Z0IA 4LYAA 1KKMA 1VHLA 4L8GA 1XTIA 4JS0A 3B6EA 1TU3A 3NC1C 4ASUD 3C7KA 4YMWA 2EQBA 3JVVA 4HLCA 1NSFA 2OCAA 2IEZA 2IYQA 3NDBB 5GJBA 1CJMA 3QF7A 5JJLA 2A30A 4RD2A 4C2UA 4TSFD 1G6OA 4B35A 4AIIA 2HXYA 2VRWA 3DOEA 4TTQA 3KQUA 1N6LA 4YXWA 5F9FA 3QUSA 4TL7A 2QAGA 3LY5A 3U7EB 3LA6A 3THYB 1R6BX 1QHNA 3THWB 1HT1E 4L5BA 2A5GA 1CF4A 2Z6VA 3LX5A 4Z8XA 4BQSA 1Q1EA 1XPUA 1LB1B 2BC9A 1KMHB 4DCNA 3TAUA 3FYHA 1N5KA 4LSGA 1NY5A 1P7CA 5JRZA 1G8FA 3X1XA 1R4AA 2GEVA 3A1TA 1A2BA 2H8KA 1TU4A 2ODNA 3QNUA 4GZLA 4E09A 4JBWA 3DOFA 1OYYA 2RGGA 4QHSA 1TPZA 1UKZA 4CT5A 2GCNA 3BRWD 4B43A 1XTSA 4CT4B 3EZ2A 1N3BA 4Q1EA 2XSZA 3DL0A 5KPDA 5FR1A 2IXGA 3CRMA 4BFXA 1P60A 1VTKA 2QUZA 1DG1G 3KB2A 4MRNA 3LVRE 4JKYA 2FZ4A 1V5WA 3HYRA 4P0TA 4PC6A 1E99A 3VKGA 1M1YE 1Z0JA 2WJYA 3FOZA 3SOPA 2W2VA 1KGDA 2C2HA 2WZQA 2BJWA 6Q21A 4M22A 5DISB 2ZE7A 1D5CA 4Q1CA 3SR0A 4F4JA 1GKYA 2O8CB 4QHYA 4PSAA 4CVNA 1W4RA 4TMVA 5H1YA 3KXIA 1MT0A 5DH9A 2MSEB 5KSZA 5F9HA 2PZEA 2ZRFA 2QSZA 4DB2A 5JBQA 1FUUA 3LDAA 2QMHA 5KDLA 2OT3B 4QBGB 2KB0A 3FPAA 4RJLA 4QBIA 5HKKA 2VSFA 3WRXC 2ZI7A 3LVQE 3QPWA 2WMOB 1GTVA 2WTUA 2C9OA 3AVQA 1SXJB 3HR7A 1CR2A 4IKEA 3U6KA 2RGBA 2ZSFA 4HUTA 1WA5A 3SE0A 1Z29A 3K9HA 2IYLD 1U94A 3VQTA 4DJTA 4AG6A 1VMAA 2CDNA 1F2TA 3SFZA 2AWOA 1WE2A 4LOAA 4O2RA 5G41A 2AN9A 1RZ3A 3FKSD 3PEUA 3D3QA 3PIRA 3K0FB 2OO7A 1ZW6A 3QOFA 4K46A 1NLZA 1ZIPA 3W6PA 2IK8A 2J3EA 1NIPA 3I8SA 2H92A 4LJ4A 4O2LA 4YMTA 2ZJ5A 1II8A 4QG7A 3W8NA 2OBLA 4BASA 3M0EA 3CWZA 1BOFA 2P6UA 4OI1A 3Q85A 3ZD7A 1IN4A 5FL3A 2JLXA 5BYJA 2NPIA 2GAOA 4AWXA 3FTQA 4B47A 3WHLA 2EU8A 2RGDA 2PMDA 1D9ZA 5E4FA 5KUTA 1E3MA 4F7WA 2XXAB 4JKIA 1RFLA 3M1IA 4IVRA 2ZAOA 4TLBA 2RAPA 3EC2A 3SYNA 4BLQA 1U0JA 1UBEA 3A4MA 1E1QA 5FPTA 2LCFA 1U99A 3PEWA 3EWSA 1P72A 5CJPA 4Q66C 2IA5A 3QXSA 3C5CA 4JYBA 2YV5A 4OQXA 1NBMD 3UMFA 5P21A 5EP1A 1FZQA 2FEMA 1XXHA 3E5HA 2ZROA 4DLWA 1Y3AA 2ZYVX 3IQXA 1KDPA 1ZNYA 4LJ9A 4O3MA 3VR6A 4CF7A 5SZIA 1GG2A 3GLIB 3LRPA 1E9CA 1Z6TA 3P26A 1KO7A 4DSTA 2QA5A 1TEVA 3O8BA 4Q19A 5BQ5A 3AVYA 2HJVA 4TT3A 1UBCA 3T12A 1G3MA 4GMXA 1OPXA 4NCJA 5C4MA 1MKYA 4URXR 2QZ4A 3O8RA 3AV0B 1G4UR 1KMHA 3AM1A 1P3JA 4AKEA 3EWAA 2OUKA 3IKJA 3VKHA 1ZNXA 2FPLA 5DHFA 3FMIA 3UATA 2J0SA 5FL7A 1H8EA 4RZXA 4ZO4A 1AIPA 4LYFA 1II9A 1N5JA 3LV8A 2BMDA 4Q4HA 3H84A 1XMIA 1XEWY 4LBZA 4PXAA 4B3GA 1SZPA 3KB1A 121PA 1NLYA 2V3CC 1PUIA 2XOKA 2CL7X 3SDZA 1XU4A 4GFDA 1YZQA 2VPPA 4LJ6A 2NTYC 2YOFA 3MMPA 3GLGE 3GP8A 4TLAA 1CJTC 1P75A 1NJFA 3A6PC 2QE7D 1B0UA 2E1RA 2V4ZA 2ZRCA 3QY0A 3U44B 3RC3A 1T6NA 2JJ1D 1VKJA 1U2RA 4PANA 5SZKB 4EJSA 4Q4AB 2XB2A 3QKRB 1BIFA 3EX7C 1I4LD 3C16C 4B75A 4EPWA 3B2EA 3OZXA 4JLVA 5L3SA 2QGZA 5JJKA 4US2R 4B6FA 1CR0A 5H8WA 3WMGA 1XD8A 2REBA 3TR0A 1DPFA 5CM8B 5AR1A 4AYXA 4RZUA 3TSZA 5L3QB 1CR4A 4L9SA 3R7WB 2CLDX 4I1SA 1MO6A 1FX0A 2ZAMA 3W6NA 1T3SA 3LLMA 3NC0C 3CNNA 4IXMA 4CEHA 2E9SA 2PEZA 2QMOA 2ZRBA 3BFXA 3K70C 3EXAA 1OF1A 1DAIA 1OFUX 1P2TA 4Q00A 1XEXA 1HE1C 3F0TA 1S3SA 1SVKA 2CVHA 4TQUS 5CK4A 1IBRA 4JVSB 1E0KA 1QHHB 1NF3A 1GUAA 1KYIA 2IS2A 4D2IA 2J45A 1DAEA 2J0UB 3HU2A 4UNSA 4M53A 2JLZA 2BM1A 4Z1MA 1ZD8A 2CHGA 3KXKA 5KNBA 1EX6A 3SBDA 1TF7A 4JVNA 2O8EB 3GJ3A 4IRUB 2F9MA 1E2NA 5L3VA 2ODWA 1NRJB 4CIDA 2OBNA 1LV7A 2PCJA 1ZC4A 1YZLA 3SZRA 4NYMQ 4HAXA 1E9FA 1JPNA 3TW4A 3SHFA 3C8UA 2AR7A 4I99A 3I5YA 1DE0A 5J40A 3A36A 3ZVRA 4TWZA 2VP0A 3RSLA 3VR5A 4AY2A 2CHQA 2CEAA 3CLVA 2C77A 3AP2A 4TQAA 2WAYA 2B21A 4DLXA 1G20E 3QKRA 4TMWA 3A1SA 4WIAA 4QM7A 2VHJA 4V0LA 2ZVPX 2TMKA 1E32A 1COWD 2BJVA 4FI3C 3PG5A 1D2MA 4IHQA 3RRZA 1N6NA 3OAAD 4ZCMA 3MCAA 1CTQA 4DEYA 3BJIC 3RS4A 2QROA 4HUQA 4KU4A 4ASUA 2YZ2A 4C0JA 3E1SA 3QXXA 5HZKA 1LNZA 1DAMA 2YVUA 1QG4A 4IDQA 1FPMA 1N6OA 4FMDB 2V1UA 1E2EA 1YE8A 4TSFA 4IOLA 4LHWA 3G5UA 1A7JA 4Q01A 5JJIA 5EP4A 3BS4A 4MYUA 5TY0A 4QOSA 1SKQA 4P33A 3UWOA 1P2VA 3FDIA 3L0IB 4KI0A 4DLRA 2PZGA 4AYTA 1G4AE 1WXQA 4TMXA 4NYJQ 4JBXA 4ZV4A 1E0AA 1E2IA 1N6KA 2AFHE 4UKDA 5FI1B 1C9KA 2IYUA 2ZUDA 3LLUA 5HZHA 2YHSA 4JLKA 3GQBA 2IXEA 3RANA 4LJ5A 3T1TA 2C9CA 2IUTA 4KITB 3AVVA 1P73A 1CBUA 2LKCA 3L82B 4D4MA 4OYHA 3IDQA 1Z07A 2NO6A 1FP6A 1AGPA 3R8CA 4RFSA 1ZP6A 2I3BA 1R5NA 1KSHA 3ZIAA 4HLQB 2XTMA 4TL8A 2C95A 1P61B 3ZQ6A 1HV8A 3CZPA 2XZOA 2MMCA 521PA 1HY3A 2AD1A 1FW6A 5EQTA 5TB5A 1OXXK 5AWFC 1GNQA 1TUEA 1J8YF 1XNJA 2IS6A 4KSCA 1UAAA 3WNCA 2IX3A 2W00A 2BVNA 1X8JA 2BKEA 5FOSA 2P5SA 5AJVB 2C5LA 3VFDA 1J99A 1ANKA 2WKRA 3SFVA 4DDVA 3PUWA 4M1KA 1C1YA 2WWIA 3EA0A 1UDWA 2XEXA 2Q0HA 1EFCA 5FBLB 2XX3A 1E98A 2EYQA 5KYKA 3T1OA 3SI7A 3GJ0A 1U8AA 5J5CA 5EP2A 3EZ7A 1BYIA 4B3FX 2W58A 4YC7A 1X8KA 4QGFA 4M2LA 3ZZTA 1JAHA 3ZLJA 3O8CA 3EIHA 3ECCA 4U7DA 2YINC 1KO1A 2GCPA 1XEWX 2X1VA 4G5QA 2CL0X 1WB9A 2LWIA 1NBMA 4OBEA 1R8SA 3U7HB 4A8JB 2WJIA 1RRCA 3H2YA 4OHWA 1F3OA 2RGXA 3AF1A 2WKPA 4I81A 5D3MA 2Q3FA 2YKGA 2W6ID 1A1VA 4PAMA 1F6BA 1KJYA 2IL1A 2IXFA 5H68A 2OSBA 3TH5A 3D7MA 4RKFA 3LWNA 4DDTA 3OHMA 5TDHA 4EJSB 4I1OA 1GNPA 2X19A 3ADKA 4M1YA 3VNVA 3ZGXA 4N3NA 3TBKA 4M4SA 2OCYC 2CK3D 4FINA 3O8DA 2YJTD 5J4HA 1MO3A 4C4PA 2JLSA 4G0NA 3IEVA 2KJQA 4TMKA 4CRWB 4Z8YA 4BFVA 4J0QA 4NCNA 2ZRLA 1BMFA 1NKTA 2XXAA 3TVTA 2NO1A 2B7BA 5TV2A 2FJUA 2ZUCA 3UIEA 1QZXA 2C03A 1ZM9A 1J90A 2DWQA 4BFYA 1OKKA 1OKKD 1KDOA 4WOPA 1GSIA 4MRSA 1KZ7B 1N0VC 1Z0FA 1VCNA 4JVMA 5LPNA 3MRSA 5AUNB 4OK6A 1D2EA 3KQHA 1KI1A 1T3HA 3VR4A 1E96A 4Q1FA 4P4SB 1LY1A 1YZUA 3B1ZA 4LV5B 3MD0A 3AKYA 1Q0UA 3KUDA 1SVMA 1KI6A 1NN1A 3FE2A 2GESA 3U60B 1UBGA 3EAQA 2PLFA 3KJGA 221PA 3BFKA 3WRYC 3ZQJA 3KXLA 2IYTA 1NL3A 2IYYA 1ZM4A 1PV4A 2FSIA 2GCOB 5C1BA 4W5JA 4EFNA 4C9BA 5E7IA 2BBSA 1E1RA 4WA7A 5E95A 1Z47A 4JYCA 1VCMA 4PO9A 2IS1A 3ND8A 3NXSA 2O52A 4RVCA 1G7RA 3K70D 1AKYA 4JLJA 4YXWD 1UDXA 2IBMA 4B3XA 4HEJA 4RFVA 1E2FA 1TNDA 2QMEA 1DADA 1US8B 5CJ2A 2AKAB 4IOMA 1JI0A 3T35A 4TN1A 1KNXA 5J4KA 4D82A 2ZS7A 3CIOA 5J4LA 3SS8A 2EFDB 4RKEA 3SEAA 3T5DA 1NN0A 3GLFB 3PJRA 1Z0KA 1DEKA 5JWOA 5SZHB 2RGEA 2VEDA 3KKMA 1OIXA 4NYJR 2OEPA 1QHYA 2GETA 2VO1A 1XTJA 2Z0MA 2JASA 1CLUA 3AUYA 4WAUA 5JS7A 4ESVA 3T61A 1XPRA 1OFTA 1AJEA 4C0HA 1H65A 3DMDA 3RC8A 1CP2A 621PA 2I1VB 3CB4A 3EZ9A 3U7GA 2BHRA 1NG1A 3CRW1 3CUEF 1XCGB 3A4LA 2JIZD 2ZRAA 1WQ1R 1YR8A 1KY2A 4Q9HA 2AK3A 5CDFA 4BE7B 3OIWA 5G53C 2PT7A 1T3LA 1WP9A 4RD1A 2GNOA 2AXPA 2CCJA 2G83A 2JLRA 4GSYA 1KK0A 1NNEA 1YQTA 4MGIR 1F5NA 3K09C 1XEXB 5EE5B 2ZSBA 2NO0A 2CL6X 3AVWA 4ZCLA 2OZEA 3C4JA 3UK6A 4IVPA 4Q7KA 2J0UA 1SVOA 1FTNA 3GJXC 2J7PA 3V4FA 2ZPTX 3K70B 3PCRB 1SVIA 1UEJA 4C7OB 5D3QA 1R2QA 4QGGA 4Q9LA 4FWIB 4BFZA 2ONJA 1XJQA 2GJ9A 4KLNA 4X8LA 3WXMA 1T8TA 4XJXA 1P6XA 1YR9A 1Q12A 4XOIA 1FQJA 2G0NA 1II0A 3OAAA 3WNDA 3AVTA 4LGMA 4JLDA 2ZITA 2IYZA 1X8LA 4MYTA 3MSXA 4ACBA 4B44A 4FCTA 4GMDA 3TQFA 5C2JB 3V4RA 4OHYA 1QDEA 1EFRD 1W48A 2BWJA 4ZIRA 4DLVA 4GBMA 1F2UB 3S1AB 4Q9KA 2JAQA 1D6JA 2JJ2A 1G3IA 2QPOA 3CW2A 4IW3B 5HPYB 1L8QA 4DSUA 4IXNA 1TMKA 1GKUB 1XD2A 1P4SA 1OHHA 1ZINA 2EVWX 2QAGB 3ZZUA 2VIIA 3NBZC 3LH5A 1KMQA 4Q03A 4EIWA 3H4MA 4C7OA 2GVZC 2I4IA 3A1UA 3HPRA 5F3WB 4C2TA 1DAFA 4LX0A 3B78A 3K0SA 4A6PA 3TGPA 2ZRJA 3I73A 3GEHA 4L4UA 4DIEA 4YLGA 1RKBA 4M1WA 2D06A 2J46A 3NEJA 2ZR9A 3DVLA 5IRCD 5J4YA 4NMMA 1T9HA 3LD9A 3TSOA 1ZM2A 1AKEA 4JJZA 3RYTC 2IWRA 1JALA 1SQ5A 4I1VA 2OESA 4US0R 3REGA 3IUYA 1G3RA 4Q4LA 2PX3A 4DZZA 2VHUA 2WIBA 4JLNA 1X6VA 2Z83A 5UKDA 3ZIAD 1TAGA 2BBTA 3LBNA 3SNHA 2DB3A 4P4UA 4KVGA 1R5OA 4ABYA 2ZYTX 1OHHD 2XJ9A 2V8OA 3MJHA 4S35A 2WMNB 4DLZA 1W7AA 4MUAA 4ITRC 4C0LA 5HCNA 1ELOA 3T06B 4ZDIA 1E9RA 5EE3A 4DCSA 3AKCA 1TL7C 4IDPA 4HZUA 4QHTA 3MWYW 2H5EA 1JEDA 3K0EA 2H17A 4XTCS 2HF8A 3MWLA 4DT1B 2ZS8A 1GAJA 2JGNA 1YR6A 2VH5R 5SZJA 2R8RA 2VHQA 2PJRA 5BWMA 2Q9BA 1FNMA 3I72A 3AUXA 4G3XA 1XX6A 1ZBDA 1P9WA 2ZRKA 1N0WA 5EUQB 4ZDWA 1ZD9A 3SQWA 1ZAKA 4LBVA 4KJZA 3WMEA 1G21E 1KK3A 1NLFA 4AK9A 4OK3A 1IY2A 1I4TD 5G3ZA 2BMFA 3A1VA 3IO5A 4PSVA 2FN4A 2QQ0A 4A8JC 3LBIA 5JWHA 5JCPA 1OB2A 1IOZA 2DFNA 3QXHA 3BB1A 4MUBA 1WBBA 1XP8A 1G291 2W83A 2F43A 3AGQA 1JR3D 2W0SA 4MRPA 4KLZA 2O8FA 4JVLA 1DO0A 4A1FA 3NG1A 421PA 2WSSD 3AF3A 4LHXA 4POAA 2XTNA 3QXJA 3B8HA 3Q7PA 3SN6A 4IFEA 2FSGA 1IJFA 1SXJC 2XSZD 3UPUA 3AVXA 4NDZA 4NCHA 2QTFA 4QGAA 3LO5A 4RY2A 3UKDA 3AP3A 4KYUA 5L3QA 3EPKA 5GADl 2NO7A 2ATVA 3HR8A 3ONWA 4DUGD 2GEUA 2LKDA 3NHAA 4JSTA 2IYXA 3EW9A 2QRNA 2R65A 1G7SA 3L0SA 2NPFA 4A0GA 3J81k 1SXJE 2BEJA 4Y0AA 4DCVA 1T0HB 4LC1A 1GDDA 2WWWA 3ETLA 3H86A 4Q4JA 2XZLA 2K5UA 4JL5A 5DN6A 1GITA 4ZIRB 3U6BA 5BN4A 3HDTA 1E9DA 2G88A 3UANA 3CNOA 3CR8A 2Q3MA 4TTRA 2MMGA 4CZ2A 2GXUA 2WOJA 2CXXA 3RS2A 2J5XA 1W0JD 1IXZA 5FUVA 3TSWA 5DI3B 4DLSA 2ZRHA 5AK0A 4V0ME 2ZI3A 4LK2A 5KSPA 2ZSAA 1EWRA 3GCGA 3W34A 4E07A 4HSEA 3GLGA 4F91B 1Q1BA 2BCGY 2ZU6A 2ZR7A 4W5HA 2OM2A 4I4LA 5LD2B 4EPRA 1N6IA 2C96A 3N2EA 3WY9A 1G3UA 3K9LA 3B85A 2C04A 3I1FA 4CGZA 1MRSA 3CR7A 5CDFE 4L9WA 4A0RA 3KQKA 5JI2E 4JMPA 1WDTA 3CNLA 1XMSA 3FKSA 4PFSA 3NBFA 4D4LA 1J8MF 5AJXA 4B73A 2OBMA 2R6FA 4YDSA 4LZZA 4FIDA 2QI9C 1NY6A 4NYIR 4Q7LA 3Q8XB 2FPKA 1FOEB 4KFSA 3HP1A 4HI0E 1W4CA 3IHLA 2HDNB 4LYJA 3EG5A 4X8OA 4EPXA 1ZM3A 2CHVA 1E2JA 4Q7JB 1NSTA 2ZVQX 1LF5A 3JZAA 1T0JB 2QBYB 5GJVC 1DBSA 2HCBA 4BEJA 2GTPA 3FB4A 4L16A 4GOXA 1N5IA 5DLQC 1XZQA 4C30A 4DT1A 4ZPXA 5L3SB 1Z22A 2G3YA 1GNRA 4FW9A 4HATA 1PLJA 2ZSDA 2ZETA 1Z6GA 1U8ZA 2P6NA 2PCLA 2QQEA 1ONBA 3AF4A 5BN3A 2ZJZA 2VSXA 3QENA 3WBJA 1OLOA 1ZC3A 3BAFA 5CYPA 2F55A 2P6RA 1O87A 2QGNA 1SVSA 2O0HA 1OXVA 3KJHA 5JS8A 1P2SA 1U9IC 4R2IA 3AKDA 1XEFA 3SBEA 1GIAA 3SJZA 2AFIE 5EJEA 2GBLC 1DO2A 4DRZA 2OAQ1 2WJGA 4UXIA 4PSKA 4TYPA 1L2TA 3GMTA 4RD0A 4EQ6B 4JLAA 3GLIA 2EWWA 4NE2A 2O8DA 3D8BA 3DZDA 4W7SA 3QBTA 3SC3A 1Z2AA 1JBKA 4IVQA 4U00A 1M7HA 5DYGA 1G1MA 1X1SA 4CW7A 2R62A 3C15C 4OK5A 1VYUA 3FMOB 1NVVQ 1MO5A 4PPNA 5B57C 2RHDA 1YZKA 1FMJA 4CEHB 3QVVA 2XNSA 3K8YA 2OLJA 2IUSA 2AWNA 3TW8B 1S1MA 2WPDD 3QG1A 3GFOA 4IOKA 4AURA 2WWYA 3C41J 4JLOA 2DWPA 3X1YA 4QM6A 4QC2A 1QHSA 1ZM7A 2GEDA 1J7KA 5EE0A 1Z0AA 2O8CA 3BK7A 3CM0A 1U90A 1S8FA 2ZJAA 1W47A 5B64A 3EPJA 1EK0A 2W2XA 4K8OA 1W0JA 5K8LA 5TXGA 3TNFA 4PHTA 4QNMA 3NVAA 1FQKA 2PH1A 2AK2A 4ZKDA 3C5HA 1S96A 2HUPA 1HA3A 2VSOA 4DDUA 1MRNA 1ZCBA 3FMFA 4X8MA 1T91A 5DI9A 4ZDJA 3CZQA 3GD7A 4MRVA 5FTKA 3VNUA 5EE1A 1NVWQ 4DCTA 1IY0A 4RSGA 4XWAA 4GZMA 2C99A 1FP7A 1R0ZA 1S0UA 2FSHA 2NG1A 2IWHA 4GL2A 3GJ6A 2FWRA 4QRHA 3BD9A 4Q5IA 3SYLA 2J9RA 2G0TA 4A9AA 2F9LA 4ZI2A 2J87A 1EFTA 1P62B 5JEDA 3ZD6A 2FF7A 3LBHA 5A4JA 3EA5A 3I62A 4PC1A 1IHUA 3U7FB 1JXMA 2ZJYA 1E9AA 4KHZA 2H57A 3T34A 4C0AC 5AJWA 3CRVA 1AZTA 5FUYA 4XD7D 4M9ZA 1G7TA 2GXAA 3FKQA 1E0JA 4L15A 4FMBB 1FFHA 3ADBA 3QJYA 4NCIA 5TARA 4WW0A 5BXQC 5K8IA 4KXFB 1GVNB 2ZSEA 4PC7A 4JZKA 1QHHA 2GK6A 2FDCA 4PC2A 1G18A 4FWTA 1P2UA 3SJAA 5GJCA 4NBSA 3N2IA 1D9XA 1G8PA 5FR2A 1LVGA 3WP1B 1HQYE 1HUQA 1X86B 2RKOA 4TL9A 2PLRA 5IDVA 3EIEA 2WOOA 1YHNA 3PXGA 1PLLA 5E7JA 2QTHA 5CK5A 1G8HA 1XWIA 3DDCA 5JSZA 3W3ZB 4RCZA 3U4QB 4PC3A 3BB3A 2WJVA 5CIWA 1QHGA 3IIJA 4P4TA 1TX4B 3P4XA 1NP6A 4Q4HB 2OV2A 2OG2A 2I1QA 4N1AA 1I2MA 4W5WA 1Z63A 2XITA 3ZVMA 1JJVA 1KAGA 2MSDB 4JL8A 4Q4JB 1OIVA 4C0BA 3GEIA 5AUQA 1XDBA 1XB2A 2F3TA 1MO4A 3TVDA 4V03A 4AI6A 1F2TB 2FG5A 4IEEA 3L0OA 1ZNZA 3BOSA 3CPHA 3I61A 3FWYA 2FOLA 3LAWA 1DTSA 2GRJA 3I92A 1KY3A 4GP6A 3I3SR 3U61B 4FMDF 1KDTA 1R0WA 1RE0A 2OILA 3DO6A 2VL7A 4QJ4A 4HYYA 4D80A 4KODA 4GP7A 2JLYA 1E1RD 1JJ7A 2VP5A 5EZ5A 2AL7A 2HYDA 3BIFA 4GOJA 2BBWA 3KTAA 4LDJA 2BM0A 2IUUA 1EG7A 1N2CE 4EPTA 3WP0A 1IONA 3BFVA 4R98A 4BLOA 2BV3A 2YWFA 2P3SA 2DFLA 2R6GA 4LV8B 4BFSA 2HV8A 2KI5A 1JR3A 2HT6A 1CS4C 5FPYA 3ZDQA 1V43A 1OV4A 2RH5A 2D62A 1VIYA 1DAKA 2JDIA 3AVOA 1Z06A 3V9PA 3TUIC 2ZE5A 4NL4H 1RC8A 3F3YA 4UQOA 4RD3A 1AK2A 2AHOA 4IDHA 4HB3A 1ZVQA 2Z4SA 2CLSA 1Z6AA 1ZUIA 3THOA 1R0YA 2F1JA 1KK1A 3K9GA 2ERXA 1S2MA 4M9QA 1RJ9A 1NIJA 1T8UA 2A5YB 2ZRPA 4WXPA 3H1TA 3TRFA 4MKHA 1KOFA 1PLKA 2JLVA 3EPHA 1QHIA 1IM2A 1BO6A 2ANBA 4G1UC 5LDDC 2GXSA 3QF4B 2ZI5A 3L0PA 1KO5A 2DHRA 2DPXA 4MKIA 1BYUA 4RZ3A 5CM9C 2VQSA 2FFAA 4HB4A 5EXPA 4IDNA 3U3OA 2CCKA 3P32A 3UMSA 2WPDA 1AA9A 1VG0B 1X1RA 2D2FA 4OI4A 5JEEA 1TF5A 3K0CA 3ZH9B 3R9IA 3CKLA 1KHTA 2BCJQ 1YR7A 3BH0A 2B92A 3OIYA 4Y0VA 4N0DA 3TK1A 1OFIA 4XTRA 1R10A 2GJKA 4LHVA 4LRWA 1VDZA 4BEBA 2XTZA 2ORVA 1QG2A 4Q02A 3D31A 4LPSA 1LF0A 2OCBA 4Q48A 2J7PD 3PEYA 2QP9X 4H1UA 2CBZA 4JL6A 5FFMA 5GVRA 4DLUA 4A15A 3QPUA 3DPUA 3OEHD 4DCUA 1OXUA 1UKEA 1F60A 3HPQA 3TMKA 3EIQA 2BMEA 3G0HA 3B9QA 5JLJA 2VP6A 2ZTSA 3N70A 1SXJA 4P32A 1HT2E 1GL9B 1KO4A 4TMZA 3RWOA 1RYFA 2HLDA 4M9SA 2X2EA 2GF9A 3IEUA 1BKDR 2NQ2C 4LHYA 2DBYA 4W9MC 2W6IA 3U44A 1G8YA 1GKIA 2X8AA 4OL0A 5HCIA 1N5LA 2ZJOA 3OIUA 4A2WA 3THWA 3KDSE 4IEIA 1G5PA 3GFTA 3RS0A 4DEXA 1N6PA 2ZYWX 4TMTA 2IT1A 5B30A 3PFIA 2CK3A 4G5GA 1IXSB 5D3MB 1G64A 2W6JA 1O3YA 3CF6R 3VHXA 2Q9AA 3FHTA 3CH5A 2V1XA 3GJ8A 1YVDA 1QHXA 1Z2CA 3BC1A 4A0HA 1W4AA 4ILEA 4D26A 1IN5A 2ZUBA 3QKSB 4NTZA 3LXRA 3NIBA 1QF9A 3A37A 3R20A 1TEXA 3LXXA 2RHMA 1KZGB 5FUWA 2JEOA 1CR1A 5LD2C 2D7CA 3Q7QA 3BH7A 3L8ZA 4B3BA 5FPKA 3SJBA 1NMZA 2ZREA 5FPHA 3QKUA 2QORA 2ZE6A 2GJAA 4EAQA 2IYRA 4A82A 1GRQA 1MOZA 2VP9A 1ESMA 3EPLA 4ESHA 2V54A 4UJ3A 4B3CA 2V9PA 4NYIQ 2ZR0A 4RZ2A 3X1ZA 5FOUA 3VAAA 1W0KD 5A0FA 4F38A 5FUXA 2FX3A 3DM9B 3BE4A 1XF9A 4OHVA 1UF9A 4ARZA 2VTKA 1YZTA 2A9KA 1NI3A 4B74A 2J0VA 2PX0A 2ZANA 5FOXA 1RVDA 5BW8A 1II8B 2F6RA 4HAYA 3THXB 1NG9A 4IFBA 1JR3E 4UJ5A 3TQCA 2H7VA 2DR3A 5J47A 1XCMA 2QAGC 4ZKEA 2ZI4A 1ZNWA 3FHCB 4HZIA 2RGCA 1HH4A 2IF2A 3LW7A 2IYWA 5KU1A 5H70A 3CF2A 3KFVA 1XD9A 1Z08A 2GVDC 3IQWA 5FBWB 2DFKB 5EXSA 3PQCA 4BECA 4DUGA 1AN0A 5IF9A 2GA8A 4C0SA 3CH4B 2WV9A 2FZLA 1W4BA 3FFBA 1RRFA 3X1WA 2UVQA 4MDEA 1BH2A 1FTSA 2P2LA 4V02A 1IN7A 1RYHA 2QPAA 1XJCA 2GF0A 5F2EA 4DVGA 1A4RA 1ODFA 2A5FA 5G3YA 1ZD1A 4HUQB 5JWRA 1E2GA 1P5ZB 4B2IA 3K9NA 2FA9A 3CRQA 2FPMA 5FBRB 3GLGB 2EFHB 1E2HA 1KTVA 4MITA 1R7RA 2OXCA 2QAJA 3VKWA 5CB6A 4WXRA 1CEEA 1AQUA 3B60A 4B6EA 1YZNA 1NKSA 2GWHA 1K8RA 3MFYA 4ZDKA 1Q20A 4HDQB 4FCVA 3A8TA 5JECA 2O8FB 2QT1A 3ICEA 2CCGA 3ZS9A 1R5BA 4UXHA 4V0OA 2A3RA 2W0MA 3KTAB 2WAXA 3KUCA 1E6CA 4OI0A 2FMXA 2REXB 1GL6A 4Q9JA 2JIZA 4XD7A 2O8EA 2R9VA 2DYKA 2Z5FA 4DB4A 5DNYB 2G9NA 1COWA 1F2UA 4Z54A 2QEQA 4LBYA 2RMKA 2C78A 2WWGA 4NKRA 5IT5A 4G5SA 2AKYA 4URYR 4A0FA 1D8TA 1VPLA 4KV9A 4JLMA 3BH6A 1VG1A 2HF9A 2BIFA 5AUOB 4KSBA 3GLIE 2XAUA 1EGAA 3NHBA 3NH9A 2QBYA 3SYKA 4MDFA 1G5RA 3JZMA 3CPJB 2Q6TA 1Q3TA 1NVVR 4MA4A 1RRPA 4Q18A 1TADA 4FD2A 5KDDA 1T4GA 4KBGA 2VLIA 1WCV1 3QEOA 1E79A 3IIKA 1YRBA 1KJZA 1JXOA 2PEYA 3AF2A 2W6JD 4PHGA 5CIQA 5DN6D 3CRRA 1G17A 5E7MA 2WICA 3E70C 1JR6A 2ATXA 4HB2A 5KNCA 2OAP1 3EC1A 4HLUC 2GZHA 2B6HA 1E2KA 3LQQA 1TQ2A 3NBYC 2VA8A 3GJ4A 4RCYA 4HDOB 3PEVA 5L3RA 1T5IA 2FE4A 3NTUA 4PPQA 1YKSA 2QL6A 3X2SA 1G41A 1U81A 1U98A 1G5TA 5CYOA 2YOHA 4ACAA 1DAGA 3ICQB 3M4YA 2VP2A 3RAPR 3R9WA 5GJWC 3QF4A 2AD5A 2D74A 2JCSA 4H1VA 4PZYA 3T5GA 5JCZA 4D4KA 1KI2A 1UADA 4DXAA 3KQNA 4D25A 2A7QA 2JJ8A 4R7ZA 2DY1A 4TLDA 1DARA 4IJMA 1KIMA 4FXPA 1G7CA 4PAQA 3F5FA 4GOKA 3MWKA 1W44A 1EFHA 2ORIA 4URZR 4AYWA 3LFUA 3PUZA 4BFUA 1W36C 4YMVA 1CRPA 2QG6A 1GRNA 4V0MA 2JJ2D 4X8HA 5ELXA 1CIPA 4HDCA
chains in the Genus database with same CATH superfamily
5IM4A 2QN6A 3EMVA 3OMXA 4KPEC 4MGYR 5C5IA 4HGRA 3C3CA 2ZUVA 2QENA 4JGBA 3R7LA 4E3WA 3AEUB 5B58C 1I4DD 2QNBA 3C6KA 3ISTA 4PO3X 5IJAA 3CCCA 1FL9A 3BN3A 5JPCA 1W7AA 2AOVA 3NEAA 3AZPA 5CH5A 2ZBQA 1S8OA 4O2BF 1HYBA 3ANTA 4XEUA 4N9QA 1XKLA 4KQIA 4DA8A 1G2IA 5KWSA 1QRTA 3OP1A 4JUDX 1GZSA 2R11A 1QKKA 4PPGA 4C03A 4PPFA 2O0KA 1ICEA 3RIXA 5DYWA 3NH6A 1T5LA 4TVKA 2NSLA 1YTLA 3BZUA 2PYDA 4HAZA 4K6HA 1WTCA 2WWVD 3L6RA 4Q3BA 3VHRA 3C43A 1KSGA 1RACA 3D7LA 2VNHA 2ZI6A 2AC4A 5HKOA 1ZG3A 4BKMA 9ATCA 1E94E 2Q1XA 1GNSA 3VISA 2PGJA 2XUFA 3FX2A 2X2PA 3L1UA 5L40A 4IGAA 4GX1A 5F2OA 1SJ9A 1FVOA 1KF0A 2EFCB 3GRCA 4HDNB 4GM0A 5EE9A 1KI7A 4MPRA 1PGJA 2QPTA 3DFUA 1IEVA 4BGUA 3I0NA 4I1UA 3IAM6 1PRYA 5FFFA 4BZQA 3DMFA 1BEUB 1S1CA 2E5FA 2HB6A 2PBLA 2JS7A 3QKWA 4ECAA 7MDHA 4LW8A 2FF5A 5SYNA 3IBGA 3VRHA 4HKTA 1FP4A 4CU2A 5KMGB 1PTKA 4MQBA 5C1PA 3SS9X 1X7WB 3O4RA 1NATA 2NXJA 4YCBA 5DI3A 3RSFA 1S3IA 3TKLA 5CVVA 4D5GA 4B80A 2PSDA 4ZT2A 2B8WA 4DUYB 1J97A 1TZMA 4C5AA 1VRWA 5E0KB 3EGEA 4RQUA 2V7QA 4IHJA 5E9AA 4DWWA 5ITZA 2W37A 1L4UA 2B1RA 4HB0A 3FJ1A 3LW8A 5P8WA 3RT1A 2XVYA 8LDHA 3R7WA 2P35A 4OBWA 2VXBA 3KIPA 4Q47A 4QYSA 5GV8A 3MTGA 4CV2A 3GFPA 2H31A 3T4XA 4GEKA 1RBYA 2XD9A 3B1YA 5B1EA 2IZ0A 2REOA 5DYIA 5IVDA 2P9FA 2J07A 5JVDF 5ALOA 1CHDA 4G25A 4XCVA 5DW0A 1XTKA 1GEEA 1JPJA 1RR6A 4MYDA 1KDRA 1XXHB 2A1TS 5KQMA 3QVXA 1CUDA 4RTMA 3GLQA 1LS6A 1BCRA 2O4CA 5ADUS 2C9YA 1M74A 2J3LA 1TIPA 1T29A 3MW8A 4XM2A 4ML3A 4GWKA 4N65A 4RA9A 1V8ZA 2X77A 1A3CA 2AIRA 1BX1A 1AQYA 1OH5A 2PBRA 2ZRIA 4ZAZA 3T3OA 1GCGA 4DR5B 1NUPA 3F9RA 1K7EB 1AM4D 3REQB 5K8CA 4TYMA 5ECYA 3H0KA 3GLTA 3WV4A 3PE4A 4B32A 1Z7BA 5DGDA 2WYOA 3JAMA 2GBGA 1EYZA 2XBLA 1MORA 3BMQA 3DMPA 3I8XA 1XG5A 4K3UA 3E18A 3FJYA 2CXOA 4RMGA 3ZVLA 2O2CA 3A26A 4NHEA 5CLQA 1AO0A 1JDBC 1SUSA 3LUFA 1JAXA 3MS4A 3CZ9A 2ZM5A 1I2DA 1LLQA 1SZJG 4MUYA 3FFWA 5IK2D 1OGJA 5CCEA 5JZVA 1KJWA 2PUDA 2EKZA 5C7LO 5K09A 2E18A 4ZZ3A 4QZVA 5AJYA 3VH2A 3NRJA 3DEZA 6AT1A 1XVVA 1IWOA 3EGIA 2I29A 3FGNA 3G0GA 1TZ2A 4OJQA 1UXKA 3ZDEA 4GDFA 4EDHA 5K01A 3PXUA 4H3KB 1DWQA 3D8TA 1LLFA 2WJWA 5A5GA 2PGDA 4NNOA 2H4JA 5AKIA 1BWSA 4F86A 3LRTA 3DKPA 3HGMA 1E4OA 3EZ6A 1SBQA 1CUBA 2Q27A 1U8CB 3LRXA 3O2JA 3HS3A 5B2ZA 3T99A 3K6RA 5C7YA 2I67A 3RAGA 3AR8A 1R18A 1Y7PA 2OHFA 3IXLA 3PCXA 4P31A 4JBNA 1QKJA 1WW3A 4CG3A 2DWCA 1R5JA 3TD9A 1KK2A 1YDWA 1YRWA 5SYMA 2OFOA 3RK1A 4JVOA 1SPXA 2RGNC 2C2KA 1ZXXA 4Y6GB 3B1XA 1LW7A 1V0JA 3QVOA 4O8CA 4U1RA 1N2XA 3OT5A 4O2AF 5LDHA 4LHSA 1H8HA 4J4BA 2DKNA 2XWJI 1U2DC 4Z9XA 5IKMA 2OGSA 3QBVA 3RVRA 4CMIA 4EB0A 1NHWA 3K0AA 4GX2A 3TIGA 1MB2A 1LA2A 2Q2OA 1JV2B 1ONNA 4YX9A 5HK9A 2IOHA 3H04A 3JQ7B 1OW3B 3WBFA 1SC3A 3MTIA 2OHIA 4FFBB 3FHOA 1NOJA 1UWVA 2IU4A 4LZLA 2EEZA 4DC9A 4RD4A 4UU8A 1FA9A 3AR5A 4U6SA 4EKDA 1GCOA 1JR4A 3HB4X 2CE2X 3GGCA 4RHCA 4XQEA 3RS8A 1YJQA 3E7DA 1ZU5A 3FFAA 5D1HA 5AOBA 1V7CA 4BMCA 4MGKR 1WKVA 1IQPA 4XX0B 3ZWCA 2IYVA 1TLFA 1Y7IA 1E9SA 5DCLA 3W9YA 4IS2A 2HIHA 4RK0A 2HZBA 3ZE9A 3DBIA 1BW9A 3FWNA 3KT0A 3S2UA 5B4UA 1Z6PA 1XZNA 1A7KA 1KXZA 3FZNA 3MIZA 4LXIA 3U2QA 1AXEA 4LOHA 4H6WA 1L5GB 4FUQA 5FTMA 1UJ2A 3HM2A 5CLGA 3ER9A 4TUYA 1GWNA 4E88A 4OHZA 3CZCA 3W05A 2FFQA 3SHWA 2JC3A 2JFVA 3X1JA 3TRHA 4QVKA 3V3KA 4BS9A 1AKVA 4XDZA 5CXQA 2DGDA 2F8MA 5EHNA 2RGAA 1RZRD 4P0QB 2A78A 1NVMB 3EE6A 1ZHOA 1MIHA 4AJ2A 2HT1A 4NE7A 1KS9A 4UNNA 2X1MA 4CKWB 4DQDA 1V41E 2VTBA 1QWOA 2QLNA 4LTNA 3D5QA 3Q9NA 1E8DA 1YDFA 4N6OA 2QN7A 1OGIA 1QONA 3TIFA 2P78A 2PH7A 4DLTA 4QKQA 1C50A 2JI6A 2V96A 1UPTA 4F4CA 1LJLA 1VL2A 5FAKA 1JQLB 1JHOA 3PS9A 3W7BA 3QG5A 3KS9A 1DGQA 1GZ6A 3D6UA 3EBLA 3R0IA 2WM9B 5AKHA 3UQYS 1O6GA 5KOHB 2HXSA 1E7QA 1UBJS 1ZI6A 2I6XA 3AEUA 3B7GA 4KQGA 4R1PA 3RC1A 4EBBA 2VT6A 1E6WA 1SXHA 1XPOA 2PH5A 4OFBA 3TTUA 4B6PA 1B23P 5LJIA 2CMKA 1PL7A 2NLOA 4NONA 3TR5A 1XQVA 1KSJA 1FMLA 2GLTA 2X6QA 3WBKA 1MEOA 3KEOA 1IUKA 5KYUB 2B1IA 3QQ5A 3KL2A 2WYIA 1XDWA 5KNCD 2YJNA 2P40A 1GSHA 4BNZA 4MJ7A 3L84A 4KJXA 3JTMA 2F1RA 2IXAA 1J2JA 2FPIB 3I52A 1V95A 2KBFA 5LZ8A 3MERA 2X0RA 1NR7A 2ZUEA 3STYA 3S81A 1V7ZA 3NTLA 1D7OA 1Y3IA 3QTLA 4UVGA 1W36D 3SQXA 2QV7A 2DM6A 1E9BA 2P2YA 3ADPA 4Q1DA 4WZBE 5EJ8A 1WV0A 1TCAA 2NU7A 1IC6A 2YQ4A 1X1BA 4MPDA 4UM5A 4KR6A 5CW1A 4YONB 1QG0A 4A2QA 1WOMA 2HSDA 3LP6A 4G1VA 4LTDA 4QDKA 4BFWA 1SG6A 1BE1A 4HQKA 4TKLA 1PUJA 2Z4RA 1J39A 5L53A 1TUBB 3DEFA 1IB6A 2OHHA 1JEEA 3DDSA 2J9YB 3PVCA 3BWVA 1P9OA 4TQ9A 4V3CA 2QX8A 3RBVA 1QE3A 2YVAA 4OLJA 4AMGA 3OPNA 2R1UA 5BN3B 1SXPA 1H8ED 4LJYA 5ABPA 4PZZA 2G1KA 1M7BA 1MOSA 4H3SA 4PIPA 2V4MA 1EXWA 1HEIA 4C0KA 1YBMA 1EESA 3I23A 1SRRA 3CISA 3O1JC 4NSNA 4ZO7A 5HX7A 2O5CA 4MQLA 3TQOA 1Y98A 5IEJA 1ORWA 1A7UA 2G6TA 1T2AA 2EWVA 4F9FA 2KQUA 1D2NA 5HSGA 4B8WA 3B6MA 3QFFA 4OGKA 9MHTA 4AWBA 3E9DA 2JNWA 4EG1A 1YBVA 5LLDA 2JLAA 3ESCA 3NTXA 3TRIA 1VCIA 1AHHA 2VYFA 3RC9A 2O05A 3O82A 4WADA 4LV6A 3O3OB 5E3HA 3MJCA 3E5MA 1PDOA 4XVRA 2AQHA 2PYZA 4OJKA 1F6WA 1Z0ZA 4ZZ2A 1F8GA 1QYRA 3AIKA 3RW9A 3MTAA 2XECA 5JSZB 3TL3A 2Y1WA 3MJVA 4FFMA 1TJ3A 3Q5EA 3TGLA 3IQDB 1OI7A 3PK0A 4TRRA 1QVAA 3MD9A 1BCRB 1MC5A 3BREA 4DRXB 5TF4A 1G16A 2VJDA 2UZ4A 2RI0A 1C0IA 1BXRB 1E2PA 4KB5A 3JAKA 4TWIA 3JQBC 3PUYA 5E9JA 4OM8A 1E0DA 2JLBA 2BFCB 3NDRA 4J2OA 4UHEA 3O3MB 4UULA 4O5AA 1S9HA 5FIUA 5JOQA 3TZCA 1MC1A 5CVUA 3OEYA 4FTWA 1U8YA 2YWEA 2WKQA 5CH3A 4X64B 4AX8A 4LECA 2J08A 4XRGA 5A5FA 4ER7A 3CPEA 4RE5A 4ZCTA 4FN5A 1UEXC 3QKTA 3K8QA 2IHBA 1T2CA 3G79A 5BNZA 1KR2A 2YUTA 4H4CA 1J00A 3GVCA 2QV0A 2F43B 5DHPA 4WBNF 4RZHA 1KFCB 3ZN2A 3BMNB 2JI9A 1JKJB 3RRNA 4M1OA 2OC4A 3V55A 2QIOA 1CUJA 3CUYA 2RAVA 1EAMA 3UBMA 3Q4GA 4O02B 3RGWS 5CLJA 1UAYA 4I19A 1AS3A 1PR6A 4UHJA 1QE0A 4KXMA 4DHWA 2A7XA 1EAYA 1PZNA 2OHOA 1BGWA 3HCPA 5L95A 1R1DA 4OF4A 5JADA 4X90A 1DB3A 2O50A 4GKVA 4HEQA 4Z7OB 4WNAA 3EIUA 3I9LA 5DHTA 4AF6A 4WZAE 3UHPA 1DQPA 1G2QA 2IXTA 3BF7A 1WETA 5G1OA 2QYTA 1BC5A 3IBSA 4GM1A 3MBKA 4MTLA 3RPEA 5WRFA 1IVSA 4NU0A 2WF7A 2Z08A 3ER8A 1OSNA 3NT4A 1IAQA 4Y6RA 4AS3A 2AEEA 3O4GA 3ONEA 4BX0A 2H2AA 1J0XO 1U0LA 3S99A 3ZEIA 4EQ6A 2ZWPA 1TU0A 3CEPB 3LE8A 2O20A 5ALNA 1CRLA 3MBOA 4F93B 3GJ5A 2WC1A 4FQ5A 1RP1A 4L4RA 2Y1OA 1DJNA 4LDZA 4WN9B 2V5VA 4V0QA 3RU2A 4Z4HA 2B3DA 3EGXB 2UU9B 1AZSC 2JI4A 1E2LA 3ABQB 4U2DA 3VH3A 5FRDA 2IGTA 3BD8A 2QM7A 1QVRA 1V71A 3EMBA 3BXXA 5LZ2A 4U02A 2VQFB 2AA3A 2YWXA 1ZJ6A 4PHFA 4TS4A 3W3AH 4B6QA 3I6BA 1M6NA 1EE2A 4OG2A 4R2HA 2ODEA 4PIMA 4F6RB 2D59A 3T5MA 5HQTA 3W77A 2NUAA 3FWZA 4GPAA 4TM7A 3DJFA 1ECJA 4Y7CA 4B46A 4ZJZA 3C8ZA 1ZVVA 1UQTA 2R6R1 1S9DA 4JHLA 5H9WA 4XWKA 1BX3A 2QK4A 2QMZA 2RHGB 9LDTA 3BTOA 2XADA 2HX1A 5IDQA 1C0PA 3T1YB 5HCUA 3ZLVA 3TMYA 1J0DA 1IK4A 4Y6LA 1QRDA 3TOCA 2H16A 3LGAA 1W36B 4YT5A 4N01A 5JCJA 3WQSB 2JGEA 1SC9A 1TC1A 1X39A 2I80A 1H0SA 3BWDD 4WFKA 3W5VA 3WWCA 3UHFA 1RFGE 2HC9A 3PD0A 5DIFA 1LS1A 1L5QA 4RHUA 5TPZD 2D4HA 5IH7A 1DC3A 3B1WA 2W43A 2PX2A 4KQHA 2VG8A 1C3EA 3DKRA 5EN4A 4EFLA 4RTLA 4G5XA 4QUKA 3EGCA 2YHBA 2J0EA 4PLPA 3ZNPA 2NT3A 3PHBE 5EWLB 3AZOA 3DA8A 4DM4A 3NTOA 3R5JA 1AK1A 1CRZA 4PBSA 4U7TB 2FGKA 5AHOA 3CBQA 3OQMA 3FDZA 4KMRA 5K8TA 1KI8A 5K0GA 5L4LA 5FEUA 4NIMA 2FSPA 3L0DA 3I01A 5AVTA 1SUEA 2Y8EA 3N5KA 1VIAA 1SXGA 2XQJA 4TV8A 1UMDA 4WV3A 1GQSA 1WDMA 2R2AA 4U2CA 3Q7RA 1DDGA 1LC3A 2FSFA 1QGDA 1MGPA 2B5VA 5AHXA 4TL6A 4WINA 1GGEA 3ZY5A 1XK6A 4J91A 1UM8A 5DSZA 3C39A 3DE6X 3WYAA 1NC1A 3JWJA 4YJ2A 2HBYA 3L41A 4UXJA 4WEQA 3FPBA 2GTHA 2O2HA 2X15A 4KFRA 1K68A 3G02A 4H35A 4CM4B 2AB0A 2ZRMA 1T34A 2TMDA 2I1LA 5HFJA 3ZHZA 4R3UC 2AS0A 4IXTA 5JI3E 1IN6A 1E5DA 1FU8A 2YVQA 3FRJA 4W5OA 2H1RA 3IEMA 4B33A 1VBFA 1K3UB 2UZ3A 2EFYA 5LQRA 3ADDA 2V5UA 1WMDA 2XKAA 3BRWA 1K08A 3A27A 4IX9A 5IMSA 3KQVA 3P9ZA 2FFHA 2V55B 3U3RA 5BYAA 1ZRHA 1USIA 2H1IA 4EZEA 1ZKMA 3MWJA 3AKEA 4OKSA 1WDWB 3BL6A 4G23A 3SJ7A 2IKSA 4R2KA 3KKQA 4FDMA 3NM4A 1PR0A 1ZN7A 2ONKA 4M9XA 3WX0A 2Q4DA 3IRUA 2O8BA 1EINA 3FZEA 1FFGA 4YAWA 3T0FA 4US1R 4F46A 2GCGA 1SK8A 1NUHA 3F8WA 3JVEA 3OJWA 3QEJA 1YS9A 3IAM1 5AUPB 3WL5A 3C14C 4J0CA 5JXIA 2MSCB 1OFGA 3MXTA 1O5OA 4O2BB 2V7EA 1V9CA 1HSZA 1EDEA 3ANSA 5HE9A 2ZZNA 1C1XA 4JJGA 5BVHB 5JVDB 4QJ3A 4JUAA 1ZHHA 4WLUA 2RB4A 4Z51A 5FUQA 4BLRA 1I7QB 3AH8A 1UFQA 1BDHA 2BUAA 1IWPB 2H1LA 3AFGA 1WMSA 1KI4A 1LQ2A 1OYWA 4BDTA 1JFTA 4HDMA 2XVMA 5T8KA 2ZUFA 1B2RA 2I6SA 3OJFA 4IFTA 2WNSA 2JIPA 4IDOA 2C2XA 5TQ0B 5KSYA 1HX7A 3OQPA 3PQDA 4YQFA 4B34A 4XIGS 4KYIB 4CM3A 3I09A 5HS6A 1DFHA 3X2FA 4AKHA 1TKBA 3H3JA 3AY7A 2I4OA 2PUVA 3OLZA 1Z0DA 2O2SA 2QXTA 2GN4A 1CUVA 2HM7A 4H7PA 1J33A 2H1WA 3A6LA 4G4IA 4MK4A 1WVGA 1U80A 1Z28A 2HA0A 5LB4A 3SIPA 3WAGA 4G0XA 3DOIA 1X1DA 4D81A 3QMPA 4FMCF 2H4HA 3JPWA 4RH0A 4D0RA 1Q57A 1N6HA 3K1AB 1MBZA 5BV8A 2EBUA 4Y98A 4ZAGA 4BWYA 1T25A 3FOFC 1D2GA 3C5EA 4I9NA 5ELLA 1VPWA 4JROA 3ZS8A 1CB7A 3IX7A 2MYNA 3HEMA 4I5IA 4UNPA 1W19A 3LZDA 2RH8A 1B2LA 1HNXB 4MH0R 4X41A 2Z5LA 2J41A 3UT5B 1E2DA 2ZI9A 3X44A 1L7VC 1ORDA 4PX3A 3DH0A 4IRMA 1XP5A 1E2BA 1SKYE 3RFXA 3TG8A 4MW6A 3PSAA 2FEOA 4AULA 4EHKA 4QXAA 3REOA 3R0JA 1X3LA 4PZAA 4LC9A 1RJ9B 2DQKA 4F4IA 1H22A 1U11A 1FUEA 1AQLA 1P1BA 1TB4A 4OQLA 4CMKA 5T8KC 5BNIA 4I1RA 2X22A 3MUFA 3QVSA 5JHGB 2WSSA 3Q88A 4L08A 1XMJA 1ZNQO 2Q45A 3E9YA 4OFZA 5IKXA 3O93A 3D6TB 2OCPA 2VA9A 4HXYA 2G1JA 1WRBA 2GCIA 4W1SA 4KYVA 1B8OA 2R00A 1UBFA 3WLHA 4PHHA 3OEED 3VX3A 4CE6A 4E0BA 2FUNB 4S05A 5KTPA 1FNSA 2FEPA 1SUFA 2PKRA 2A9RA 2OLKA 4IVNA 1PJRA 1YS7A 3N9IA 4TLMB 3ERCA 3CBGA 4NU8X 1JSZA 3NTQA 4XSHA 3VV2A 1WULS 2YZMA 3VR3A 4KDFA 4BNJA 1YS2X 4BBZA 2A0YA 5KHOC 1I7NA 4Q7MB 4QAQA 4ENTA 1J8QA 1BQ4A 4BUCA 3G13A 4L74A 1OXTA 4QAJA 2FW1A 3Q72A 3GAMA 1BWPA 1Z0IA 2XTJA 4LYAA 2JD1A 2GNPA 1W85B 5F5LA 4M6WA 1EH5A 2NAFA 3B6EA 2WU0A 3TAXA 1CFZA 3C7KA 4XFKA 4YMWA 4ZVNA 2CV1A 3RVOA 2G25A 1B8VA 3LKZA 4J2HA 3RYCB 4HFNA 4KR7A 3P7MA 3UUWA 1DX4A 2FHSA 1QFMA 3QF7A 3HCNA 4TXNA 6PFKA 1MDBA 2A30A 2C0PA 3RSZA 3JATA 1YS1X 4TSFD 1G6OA 1KEPA 4AIIA 4TTQA 4KDRA 1N2CB 2XQKA 1GZHB 1YJAA 4OOEA 5KKAA 3LYUA 4TL7A 1Q83A 1R0KA 4DR2B 1WV1A 2A5GA 2Z6VA 3HLKA 3LX5A 2XOEA 4BQSA 4YUVA 2K7ZA 4N4AA 4F2PA 3ASVA 3EQ8A 4RO0A 4LSGA 3VPXA 1P7CA 3KOWA 3KR1A 1F6DA 1R4AA 2ACEA 4BGEA 2Z6QA 3F7OA 1A5BB 2H8KA 2JAXA 3D0QA 5G0SA 4NQRA 1LX7A 3SZMA 4B3MB 5E4TA 1OXKB 2QUJA 4Q1VA 5EJ9A 3HYCA 1WHSB 1NI4B 1OYYA 1VPTA 4NNJA 1TPZA 1UKZA 4CT5A 3C7CB 2BELA 2QN8A 3BRWD 4MA5A 4CT4B 4HVLA 4CIAA 3DEJA 3DXXA 3R6DA 4C3VA 4EJ6A 2W7TA 3Q8WA 3JQGB 1VCHA 4KGVA 1V8FA 1P0QA 1AXRA 1DG1G 3KB2A 1OCEA 4MUFA 2BFAA 4UEWA 4BO5A 3DV2A 3VKGA 5JNVA 3AX6A 2W2VA 3MYYA 2C2HA 2CNOA 1I4OA 1N2GA 2MCFA 1JFFB 6Q21A 3FNFA 1D5CA 4K6FA 3KR2A 4KC0A 4W7HA 4EKNB 5GY7A 4PSAA 2FMFA 3IAS1 1GRCA 2YFKA 4WD3A 1DKNA 2QHXA 3QOWA 3M5PA 1Q2XA 1Y9DA 4TMVA 1FFSA 2MSEB 2FY8A 4EW1A 5EWLA 2CJFA 4V0RA 2QSZA 3ZKAA 4PLZA 1DKUA 5JBQA 1EFDN 4I4TF 1G5IA 1XV5A 2VF4X 4LCJA 3SG0A 3B7WA 2OT3B 4N8DA 3NVDA 3L7JA 2QVZX 1KC3A 3FPAA 3KC2A 4AS2A 5C9ZA 5A0TA 1EUCB 2VSFA 2M1XA 1E3EA 2MT9A 2ZI7A 3LVQE 1GTVA 2VJBA 3JD2A 4FGUA 2O7QA 4BQIA 4YPVA 4Q16A 2P2ZA 5DNDA 1LPPA 1H3NA 1ZUWA 3HR7A 4EAAA 1CR2A 4IKEA 3EDMA 3AILA 1PGNA 2BSQA 2ACKA 5M3BA 2XBUA 3ED1A 5A4IS 1OT5A 2P9EA 2FN3A 4DJTA 1DKLA 2CDNA 3I9NA 4KBYA 4FE3A 2AWOA 3SFZA 4RPHA 2HZ7A 1I24A 1W9HA 5GV7A 1ZISA 5G41A 4X1KB 1YD7A 3CNQS 2ZB4A 3PEUA 2WKWA 1PJLA 3JR7A 3LPNA 2VYQA 4XCXA 1ZW6A 4ZI7A 3H4IA 1ZIPA 1C1XB 1YQXA 5AKJA 4YP6A 3I8SA 2J3EA 4QYWA 3W6PA 4DLKA 5BVHA 1NUTA 1Z33A 3NBKA 5CTAA 4B4WA 5L45A 4KMOA 2XE8A 1NPDA 1BOFA 2CWWA 2ZVJA 1O5TA 4TMYA 1PFUA 4XM1A 3QFRA 5D5QA 1OBOA 4FHGA 5JD6A 3P0EA 2GAOA 4AWXA 3WLTA 4KXQA 1SA0A 3DWIA 4G4SP 2EU8A 2ZIUB 2PMDA 4Q9DA 1HBJA 2WG0A 3OX4A 1XZCA 3I6MA 5E4FA 2PUGA 4B6SA 1XCJA 3M6LA 1B6RA 2BFEB 4BBJA 1UBRS 3ZI7A 1Z17A 2R0QC 2GAIA 5EIXA 3IOBA 3M5DA 2DHEA 5K51A 2Q5EA 3KXDA 1JWLA 1NFRA 3AUSA 4DJJA 1AUPA 1ULZA 4KWEA 2AZXA 5CJPA 1P72A 3ID6C 4Q66C 5K6AA 2IA5A 2WUEA 4MJ3A 1PQPA 1TM7E 4OQXA 1NVFA 3VPDA 2FWMX 4XDYA 2UYOA 2SCUB 2EZ4A 2YCBA 2ZYVX 3IQXA 3WQRA 2PWAA 1Y9AA 3WHIA 4X84A 2WF8A 3AERA 5SZIA 1G2PA 4BZWA 3GLIB 3DO5A 4AY4A 1E9CA 2XUOA 1GYRA 1GO2A 3EPRA 4DC1A 1EVKA 2JARA 1CK4A 4M0FA 3AVYA 5BQ5A 1BE0A 1GGMA 1QV9A 2XRFA 2HJVA 2R1TB 4OA8A 2R60A 4D41A 5MFPA 1TEZA 2B34A 1G3MA 4GMXA 1O95D 4NCJA 5L6LB 5C4MA 3H1EA 4C2AA 2AW5A 1URPA 3AESA 1B74A 3MOGA 3IKJA 1DDIA 3P2IA 4HAOA 4HBGA 5LJLA 1NVGA 5DHFA 2J0SA 3AFHA 2D5IA 4WEOA 4C2BA 4P4GA 2IEIA 3JQFA 2CMDA 4LYFA 3E03A 4Q4HA 3H84A 3TSYA 3OUZA 1L7AA 2OY0A 3GPBA 4QQ8A 1YWGO 2DSNA 2HQBA 1SZPA 1C29B 1JA1A 3GA0A 121PA 3KB1A 4NV3A 4QTYA 5K0SA 5GINE 3CEHA 5DN9A 5DCYA 3JD4A 4K9DA 5H82A 4M36A 3PA8A 2Y1GA 4ZYTA 5LOVB 1YZQA 2VPPA 1T8PA 4A0QA 2GEBA 5BR4A 2C3YA 1LLUA 2YOFA 2LPMA 3VJLA 2O3JA 2MYPA 2EAUA 5CP8A 2ZJ0A 2Z2IA 4G85A 4TLAA 3A6PC 2E21A 3D8RA 1SIOA 3FIJA 1B0UA 1PFVA 3GJYA 4LMPA 2HA3A 2V4ZA 2ZRCA 4X20A 1QK3A 3NUZA 2IEAA 1P3DA 3CW8X 1YACA 3C8DA 3JTEA 3RIHA 1BXZA 2J9GA 2WHPB 4PANA 2XB2A 5IVIA 3HCRA 4QLAA 3CSDA 3FLMA 4UC0A 2DQYA 2NSDA 3QKRB 3SF8A 2R1VB 4FFVA 4LMAA 2HWYA 1WMFA 1T9KA 4B75A 2HLPA 1GPMA 2QGZA 4Q3EA 4US2R 2FRDA 4B6FA 4BJHB 3GLVA 4GH5A 5IKOA 3WMGA 5BSRA 3PHIA 4WY8A 3LO8A 1E5TA 4QU8A 1DPFA 5AKZA 3TR0A 3SKVA 2NNLD 2RB5A 3RAJA 2DSTA 4RDXA 2XPCA 1ZXBA 1Y7TA 2F00A 1WCIB 2CLDX 1MO6A 3UFXB 3HCWA 4MR9B 3NAGA 3CR3C 5IPFA 3LLMA 2R7KA 3NC0C 5JAOA 5LYJF 3ZD9A 3HFRA 3A6GA 4CEHA 3G85A 5L4NA 5GZ3A 1E20A 3BQ9A 3WOVA 1OF1A 2BR5A 4Q00A 1XEXA 3C6YA 1SBZA 5B5SA 3O3NB 1SVKA 5CK4A 4TQUS 1F0KA 4JVSB 4O3MA 1GUAA 1KMNA 2I8LA 2X0FA 2AW3A 2FR8A 5CX1B 2ZCJA 1DAEA 3V4PB 3N7TA 4WX2B 3PB3A 3PPVA 5DYYA 4NATA 3CJTA 2JLZA 4KNYA 1IK6A 3TZKA 4IMPA 5EPOA 1Z25A 4IZIA 1R0RE 5HDQA 1I9GA 4JVNA 4CMAA 3GZTB 1W0CA 4PS0A 1J5PA 2ZDGA 1RSZA 5CHEA 5AJTA 1NRJB 2G06A 3AHJA 3N74A 1RWMA 3TDKA 4JNCA 5A4KA 1LV7A 4EF6A 1E9FA 1JPNA 2ZBPA 3IELA 3FUCA 3LPCA 3I5YA 4MEJA 4GGMX 1DE0A 4HN9A 1J49A 1TCBA 3UMCA 4CL0A 3ZVRA 3DP9A 4DMRA 2VP0A 2RBGA 2C0CA 2GARA 3KJXA 4O4JF 4PYIA 3W8FA 3JQAA 3FVWA 1V6SA 2WAYA 3QLVA 5LMUB 1G20E 4TMWA 5AIAA 3B20A 4W5QA 1VMKA 4JV5B 2XWBF 4MVJG 4WK4B 3TPCA 1RZVA 2B4YA 3W2EA 4WESB 1VI6A 2I22A 2D4AA 1OZHA 3EAFA 5F9HA 4EA7A 5C5CA 1VKZA 1COWD 2ONCA 1YDMA 3GCZA 4R8KA 3CE9A 1NLMA 4J0JA 4R31A 4ZCMA 2ET6A 5ARBA 2JBAA 2MINB 1CY1A 5AK4A 4BN5A 2NZUG 2XRYA 1QS0B 4I2NA 1N8SA 4X0EA 5CB0A 1J2RA 4U7JA 4KU4A 4DE5A 2H8GA 4CIBA 4LJRA 4C0JA 5F7OA 2X7XA 1VSTA 3QXXA 3BXEA 4ZODA 1V8OA 5C8YA 4GWLA 1XXLA 4FU0A 4ZJPA 1QG4A 1H2ZA 2HPVA 2K2QB 3VPAA 4IDQA 1FPMA 1Z5UA 4IDFA 3FTNA 1UKBA 4TVOA 4FMDB 4DRXA 4BLVA 2R2GA 1U2GA 1IDOA 2GK3A 3F90A 1BFUA 5JJIA 1E5LA 1NMEA 1ATZA 3BS4A 3TOVA 5TY0A 4OSPA 4QDZA 1H2RS 5CEFA 1P2VA 3TRJA 2QTRA 1NC3A 7ABPA 1JMVA 2PZGA 3DE5X 1G4AE 4TGLA 4WCDA 4DV1B 1GQ2A 3OQIB 4NYJQ 3RHTA 4P81A 3VV3A 4JBXA 1K06A 4CKBB 3WLJA 4PWYA 2BMAA 4RDCA 4KWHA 3TX6A 4YT2A 1N6KA 3A9UA 5I48A 2H7YA 3L1IA 3H2GA 3EGWA 3RVMA 4CG2A 3D6JA 3BMCA 4MPJA 3IKMB 3G1UA 5JMPA 1I7SB 3MINB 3LLUA 1ND5A 2YHSA 3A9WA 2BPOA 3LFTA 1E7YA 3GQBA 4JLKA 4LG1A 4R0VA 1KE2A 4LJ5A 2JAPA 4MWEA 1WPXA 3JVDA 3DDZX 1L6RA 2PX6A 2LKCA 4AQYB 1WKBA 4R0NA 2XR1A 2FZVA 1OBHA 3IDQA 1JKJA 1AGPA 2W2PA 5JARA 2PQMA 2R4QA 3FLEA 3ZDZB 3ZYZA 1YV9A 3FUWA 3OCJA 4FIZA 1KSHA 1LKZA 3SHQA 2QN1A 4QYXA 1GYQA 4I9GA 4XQ0A 1Z3CA 2XDWA 3ZK9A 4M0EA 4I50A 1O0CA 1GZ3A 2Q41A 3K2IA 5FORA 4IG9A 4FM9A 2XZOA 3NGLA 4R2XA 2AN4A 521PA 2I66A 1FMCA 3L7LA 1YOVB 4RY0A 1A9XB 5F1PA 5HKBA 1FW6A 1CEYA 5AWFC 1X8XA 1XNJA 2IS6A 3IC5A 3UWMA 4L7VA 4ZI7F 2NU8A 4JDUA 1W75A 5A6SA 1FYDA 3W5AA 2C29D 1LVHA 1UBSB 2C5LA 5EWMA 5KZMB 3ZY6A 3MGBA 5C31A 2WKSA 5DK4A 3RVNA 1HMPA 1I4WA 2WFMA 3BQNB 3MUEA 1Y3CE 2IYFA 3DDNA 3SKYA 2VJQA 1S89A 1BZYA 1E92A 2BD0A 2Q0HA 3VGJA 2Y77A 2W6CX 3DEAA 4PNPA 2XT0A 2H11A 4FX5A 1KQNA 4D6YA 1RT9A 3OKCA 5HBGA 1M2JA 4LWOA 3GJ0A 1KJQA 1WM1A 1FNDA 1ILWA 4KQMA 5EIBD 5J5CA 4BCBA 3ILYA 5GP1A 4B6RA 1BYIA 2E55A 3JYQA 2PGOA 2BF7A 4BYGA 1HF3A 3OZIA 3PLAE 4XUGB 3LQ4A 1DPGA 4WFQA 4ZWNA 4M2LA 3HSYA 2AI3A 3E8SA 3GN2A 3M81A 4X63A 4JODA 2E4AA 2I6UA 3ZLJA 2ENWA 4I1IA 3ZR4B 1CVRA 2YINC 1KO1A 3DOOA 3IODA 3KZXA 1XEWX 1MF7A 2WIKA 1KKUA 3RS9A 2R7AA 3ZZNA 3T8YA 2HRBA 4BKUA 3ZVKA 4ZYXA 5FLXA 2RSLA 2WJIA 4CKCB 4K9NA 1UK8A 5IFKA 3H2YA 4OHWA 3NKLA 1XKXA 2JCBA 4ZN6A 2WKPA 1GFZA 4I81A 4U2FA 3DT6A 1CC1S 3BG5A 3FBWA 1SU6A 2WF5A 3VYRB 2W6ID 4K6KA 1N5MA 4FKZA 5BN4B 4H1HA 4WESA 5H3CA 4IJQA 4J0KA 2RGYA 1ISPA 1PHRA 5F7XA 3D7MA 5EFZA 4ARSA 3LWNA 1TYCA 1T3TA 2OLEA 5DASA 3NU1A 4CFZA 4DDTA 4XM0A 2OP1A 4TTJA 4ZMRA 1FPQA 1GNPA 5L7WA 2BGLA 2H6EA 4M1YA 2ZPUA 1TM1E 2C7VA 4N3NA 3CCBA 2CK3D 4EJ0A 3O8DA 3GA5A 1E6MA 2YJTD 3I76A 1M1UA 2R1ZA 4HFJA 4X62B 1BHJA 1GAXA 2ZGVA 4X3CA 1IQRA 2CUZA 4C4PA 1TRHA 3DYVA 1Z0UA 4G0NA 2QM0A 4NF2A 1M34A 3FDZB 4L3OA 4CRWB 4Z8YA 1RPJA 3LHKA 3C6QA 3DLIA 4NCNA 2ZRLA 4GEGA 4OAQA 4Y2XA 4PN7A 4K40A 4X3OA 5BOSB 1BMFA 1XJWA 4PGMA 3TVTA 1S2IA 2NO1A 2G09A 3NNSA 4AZ3A 2XXAA 3V2GA 5A7FA 2X41A 4Q34A 3GA7A 1ZM9A 2DWQA 4E6PA 1V16B 1W96A 2WMDA 2ZWOA 2G4VA 4MPPA 4W8OA 1GSIA 2YZ7A 4Y1RA 3AWDA 4GR5A 2YJZA 1Z0FA 4JVMA 3ICWA 3A4TA 4OK6A 2WTAA 3BMXA 3IUNA 1KI1A 3OC6A 3IMFA 3VR4A 1XTBA 4IIYA 1NUUA 1WSAA 3R41A 1Z4IA 3KXPA 4D9IA 4RSRA 5EC8A 4DY4A 1ZH2A 3UCEA 1Q0UA 2ZWIA 5ILGA 5IF3A 2OCGA 1I4EB 2VC2B 3B7PA 4NFYA 4IYRA 3BUSA 3GT0A 3I0ZA 4D3SA 4W9RA 2CUNA 3B3QA 3GAZA 3ACBA 2QDXA 1JHRA 2PLFA 3TTSA 3WRYC 5JD3A 3CLUD 3E82A 3H2SA 3ZQJA 1KFEB 3KXLA 1NL3A 1UOEA 5CG1A 5A9SB 1I5EA 2GCOB 3WK8A 5C1BA 2Q7OE 4EFNA 2RHOA 2BBSA 5DLEA 5FJIA 1ABBA 3I9FA 3FCCA 3LUDA 4JYCA 4NICA 3AFNA 5TR9A 1Y1SA 1U8TA 3BWBA 1PZHA 3ND8A 3NXSA 5D51S 3RK4A 3F7MA 1AKYA 1JQ5A 3BXFA 5EIFA 1UDXA 3JSXA 1F2VA 4BNWA 1TVEA 3VAYA 4RFVA 3UA3A 5I9LA 5FYDA 1DADA 1RJGA 1US8B 5CJ2A 4NQZA 3I9V1 1JI0A 3TI9A 1ZICA 1N2IA 4TN1A 5KYUA 1TUBA 2C61A 3H9EO 3Q6IA 3SP1A 4UMDA 3TVYA 3SS8A 1JEYB 2EFDB 2FRXA 1UK6A 4F4FA 1DXHA 1VXRA 5EHIA 1GA1A 2W6OA 2IHTA 3ZEAA 3H6KA 2MINA 4NYJR 1N77A 1KYZA 5FADA 4GKJB 1M5UA 1L8OA 2GRUA 3AUYA 1DEXA 4WAUA 5JXHA 3N8GA 2X42A 5FAXA 5K8JB 2VWQA 4ESVA 1OFTA 4C0HA 2DUJA 3RC8A 2WFLB 4AXXA