2WJJA

Structure and function of the feob g-domain from methanococcus jannaschii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
168
structure length
168
Chain Sequence
AMKSYEIALIGNPNVGKSTIFNALTGENVYIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSLTANSIDEIIARDYIINEKPDLVVNIVDATALERNLYLTLQLMEMGANLLLALNKMDLAKSLGIEIDVDKLEKILGVKVVPLSAAKKMGIEELKKAISIAVKDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Feob G-Domain from Methanococcus Jannaschii
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal transport
molecule keywords FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
total genus 49
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wjjA00
1CULC 4IXMA 3SJAA 2WZQA 4ZIRA 4JT2A 4BUJA 1VECA 4DIDA 1J8MF 2GVZC 1GNQA 2Q9AA 2QRNA 3PG5A 4WZAE 5EJEA 2R6CA 1DS6A 4WBSA 5L3QB 4NCKA 1MABA 1MO5A 3NEJA 4HDOB 4LJYA 4TL6A 3RLFA 4DSNA 2KJQA 4AYWA 5JJKA 1GKIA 1D9XA 3H2YA 4R2IA 5CB6A 2QMUA 1X3SA 1KK3A 4YLGA 1ZRHA 4D6PA 2PEZA 2G9NA 3F3YA 3FFBA 1Z6AA 4DLSA 2IWHA 3AKCA 1O87A 1G1MA 2EQBA 3RC3A 1TF2A 4JL6A 1U94A 3TGPA 4B44A 1NN5A 4QG7A 4RY2A 2CLCX 1OFIA 2JJ2A 2G3YA 5IK2A 2QZ4A 3TVTA 4IOLA 3KQHA 3WRYC 3C16C 4BECA 1IY1A 2YYZA 2J7KA 1NBMA 2RGGA 2YVUA 2HF8A 3QXHA 4GPTA 2J0QA 3NBXX 3QKSA 4A0GA 1AZTA 2JEOA 3PEUA 3RC8A 3I62A 4A0RA 3L8YA 1R2QA 1UEIA 1HUQA 1XEFA 3I1FA 3T5DA 4X8HA 3K09A 1R8SA 4M2LA 3KUCA 1N6KA 4Q1EA 3EIQA 4MGYR 1D2NA 4MYHA 4NCHA 2AK2A 4M1OA 4PC1A 2D7CA 4UJ3A 4B3FX 2QEQA 3C4JA 4D4LA 4EPYA 3AH8A 5BQ5A 5HKKD 1IBRA 3LA6A 4GT1A 2ODEA 3THYB 5F9HA 3Q3JB 1U99A 3L2OB 2HF9A 3BFKA 1UBGA 1XTJA 4Q1FA 2CHVA 2VHQA 3TKLA 2ZJZA 1ZJ6A 4Q9KA 1LS6A 1XJQA 2VL7A 3FWYA 1U90A 4PQYA 3CWQA 3IUYA 4BPBA 1ZCAA 5J5CA 3MWKA 4QBGB 1KDPA 3H84A 3QPVA 2B6HA 3REGA 4DIEA 1EFTA 1VCOA 2QG6A 1M1YE 3N70A 3B82A 3QF4B 5BWMA 3EX7C 1UKZA 1G17A 4JKIA 4QBFA 5JJIA 4O2RA 3SFVA 3ZGXA 2RMKA 3V4RA 3RS4A 4BFTA 4TWZA 2GJKA 3VMFA 4DZZA 2JIZD 1U8ZA 4LGMA 1G291 5BW8A 3RRMA 4HLDA 1S4QA 5FUYA 1IQPA 1M34E 2BC9A 4RFSA 1TQDA 5FOWA 2J59A 2ZR0A 2VIIA 1QHSA 5DO9A 4XIGS 4EPRA 4L4UA 1OIWA 2R62A 1YE8A 2OILA 2QP4A 2BWJA 4RD0A 2O0KA 3W8NA 4EJSA 4DCSA 2CJWB 4D81A 5FPYA 2G6BA 2QM8A 1VCIA 1P61B 2IK8A 2X1VA 1KI7A 1OXVA 1R0XA 3IILA 3CIOA 2H17A 1KMQA 4F4JA 1J90A 1QHXA 3TSOA 4NL4H 1G7CA 5DE3A 1P5ZB 1PJRA 1XEWX 3DO6A 3MWYW 2ZREA 4AURA 4BFYA 1A2BA 4PAQA 4B35A 3EPKA 2HEIA 4OK3A 3GFPA 2O0HA 2D62A 4Q4JA 2PCLA 4JL8A 1SVSA 2J0UB 2F1RA 4M9ZA 4CRWB 5KSZA 2PJRA 1OE0A 1QDEA 1N0VC 2B8WA 2FSGA 1KI3A 4RD2A 3UXMA 2RHMA 1F6BA 3IQWA 2FGKA 8OHMA 4Q9JA 3ZD7A 1QG4A 2NPFA 2ZUBA 4URUR 1V5WA 1WP9A 2FPMA 3L82B 1D2MA 1ETUA 2VSFA 4TYQA 4IDHA 2VP0A 4LV5B 2ZS8A 4TMWA 1JR6A 2PL3A 4URZR 5UKDA 2KWIA 1VHLA 2OXRA 2W6JA 2DFTA 1BOFA 4IVQA 2IYUA 4ERNA 5KSOA 1L4YA 1PZNA 1ZD9A 3EC1A 2VP4A 3B8HA 5H8WA 3EAQA 4MQBA 2X8AA 1RJ9A 1X86B 1YQTA 4QBHA 4E03A 1G19A 1A82A 1IXSB 3DOEA 1NMZA 2D74A 3DEFA 4IEEA 4Q4JB 1CJMA 1XCGB 2G0TA 2O8CB 2C98A 1GIAA 3BWDD 1Z8FA 5TDHA 4Y0AA 4LHXA 2IX3A 3AF0A 3QXJA 1LVGA 3CRVA 2D06A 1GVNB 1O3YA 1W0KA 2IT1A 4DT1A 2BJVA 4I99A 2IXGA 3BBPA 4HYYA 1YR9A 4KJZA 5H1YA 1N6LA 1XXHE 4D4JA 1QVRA 1ZIOA 4BEBA 4HLUC 4PSAA 1W36D 2PZEA 1UDWA 4QRHA 3ADDA 2XZPA 4DSTA 1N5KA 1PV4A 4TMXA 2FOLA 2FPKA 4NYJR 3KFXA 2D7DA 4NE2A 3ZLJA 2J41A 3GLFE 1RJ9B 2YKGA 2V4ZA 4PZZA 4U02A 1NLYA 4L15A 3BIFA 4KXFB 4FN5A 2FMXA 5FI1B 5IHPA 2GKSA 4L8GA 4NCIA 2GXAA 4JJKA 3ZDQA 3TW8B 1FUKA 3IO3A 4JSYA 4F93B 1GILA 1K8RA 1GDDA 1OT3A 2BHRA 3K0FA 3B1VA 1SXJD 5JWHA 3X1XA 2OAQ1 1NBMD 3MJRA 4WA7A 2WBLC 3ZZTA 4EPVA 1WA5A 4JLOA 2O8FB 5JCZA 4Q01A 2V54A 2HT1A 4MH0R 3ICQB 1MH1A 1W4AA 1D2EA 1H8HD 2J7PD 2KB0A 4CIDA 1RYFA 2C78A 4A2QA 4HAXA 2JLSA 1WBBA 1KSHA 4IFEA 4RD1A 3TJZA 1F5NA 4IJMA 1D6JA 1KYIA 4HAWA 3X1DA 4TMVA 2OUKA 1NKTA 2KBEA 3I3SR 1RIFA 3WMFA 3RVBA 1OB5A 3C5HA 4CGZA 2CJWA 4I1UA 1TPZA 5F9FA 1CR1A 3Q9LA 2ZETA 2FFBA 1PLLA 2JLQA 2QMEA 4G1UC 4POAA 4BZXA 3V4FA 1LFDB 4MKIA 3HU2A 3LQRA 1N0UA 1TNDA 2P5TB 1MT0A 5AUOB 1OH8A 2BJWA 3P20A 1Q57A 1U9IA 2ZRGA 1FOEB 3IHWA 1I4TD 1NVWQ 3I32A 2OEPA 3WNBA 1KI4A 2HJVA 4PANA 1HQCA 2GJ9A 4IKEA 1VG0B 1G20E 4D4MA 5KSYA 4A2WA 3KZ1E 4ARZB 1DE0A 2W6ID 1XD9A 3GLFB 4D2IA 3F0TA 2ZQ5A 4BRWA 3CW2A 4ZI2A 4GSYA 4PSKA 2ZJ2A 2QSYA 1DAIA 3RDPA 3SBEA 1GITA 2QN6A 2OESA 3AVWA 1M7BA 3ECCA 3LO5A 4V0ME 1DAGA 2J0UA 1ZC4A 3ADKA 3Q5EA 2A5DA 2HYDA 3UATA 4D0GA 4DEYA 1E2DA 3UMRA 1XMVA 2YINC 3L0SA 5EP1A 4EPWA 4JLMA 3TUZC 3QBTA 2HJGA 2GDJA 1Z63A 2VP6A 4M1MA 2H18A 1HTWA 1T3LA 1XRJA 3GCGA 3NBYC 5HTKA 3O8BA 4ON9A 4OQXA 4TT3A 1NF3A 4XD7D 2Q9CA 3SFZA 3MG9A 5EP2A 1Z47A 1EWQA 4G5SA 3RWMB 1I4DD 1QHGA 4G5RA 5J4KA 4LSGA 3T1TA 1Z6TA 1TUEA 4HDCA 4BFVA 5M04A 1XTQA 1OJLA 3NIBA 3OEEA 2AR7A 4LYFA 4Q48A 5FTMA 3U6BA 4CEJB 1NVUQ 2AK3A 3P1JA 3M0EA 5K8IA 4N1AA 4UNRA 2EVWX 2ZYWX 2ZI5A 4ZIRB 3EW9A 2A78A 2BCGY 2FE4A 5GJVC 4DCTA 3W6NA 3AQ4A 4KLNA 1N6RA 4YMSA 4GOXA 1VIAA 4IOJA 4IDPA 2EFGA 3O8CA 4A36A 2H5EA 4LY6A 3CBQA 1TU4A 1VCMA 3TK1A 3IIJA 3TQCA 1J7KA 2OBNA 3X2SA 3U60B 2YHSA 1CR4A 3LQQA 2B21A 3LLMA 1FNMA 3LX8A 1VIYA 2VTKA 3AKEA 1GAJA 3ADBA 2C99A 2EYQA 1HY3A 1RE0A 2IYYA 1LF0A 1QVAA 1AKEA 1FNNA 2C04A 4WXRA 5JRZA 4G5QA 4KVGA 4LBVA 4X8MA 4YMUA 5B64A 3DOFA 4Z54A 4CDGA 4HAUA 1G6HA 4CEHB 4MRNA 3RSLA 4ILEA 1P75A 2VHTA 2E1RA 1R10A 2R65A 2UKDA 4M1SA 4UKDA 4BLSA 4O0MA 2XZOA 2PMDA 1T4GA 3IKJA 1DELA 3GLHB 3KXKA 2ODBA 3K0AA 2LWIA 3FGNA 3QVUA 2HUPA 2R6AA 1N25A 1KOFA 5FBLB 1HT1E 1XD2A 3NHAA 5AK0A 1AM4D 2K5UA 3B7GA 1Q1EA 3EPJA 3E70C 5BYKA 3DKPA 4WW0A 1SZPA 1G64A 2REBA 4M1TA 3PUXA 5CJ2A 1E1RD 1G8FA 1UF9A 1K5DA 3P26A 2ZTSA 4RD4A 3BE4A 1G7TA 2ZAOA 2QU8A 3CR7A 5CK5A 2WIAA 3CH4B 1EWRA 2F3RA 2NO0A 3NEYA 2O8FA 1Q1QA 2EYUA 2CCJA 4Q47A 1Y63A 4BQSA 2VF8A 3LH5A 3G5UA 4AWXA 4BFXA 5JJLA 5JRJA 3BFXA 3PENA 1JEDA 3I8SA 5J4HA 4MYUA 1NP6A 4DCVA 1NMYA 2V6JA 4TLEA 5CDFA 4CT4B 4CT5A 3AVQA 4U7DA 2WWHA 3PUVA 1FTNA 2CK3D 5FPKA 2ZJ5A 2XNDD 4PPFA 4LJAA 5KUTA 4MDFA 5F2EA 5AUNB 3KQKA 5GJCA 2WWIA 3IIMA 1G6OA 4BZPA 1NMXA 2YWGA 3JVVA 4B73A 5TVKA 1XU4A 1NL3A 3ASZA 1JR3A 3FMPB 1UM8A 2JJ1D 4AG6A 3U3KA 2A30A 3RS3A 4MGKR 4TL9A 4M8NE 3SJCA 3V00A 4DB4A 4ARZA 1ZINA 2AFHE 2YWEA 5JSZB 2R6GA 4QHSA 4IRUB 1QG2A 1KI2A 3HR7A 4KFRA 2P3SA 5D3MA 1IN5A 2IF0A 2H57A 4Z1MD 1UKEA 1Z0IA 3GLGB 2DWQA 3E2IA 5IRCD 5TMPA 2GWHA 3FYHA 4DLWA 5E4FA 2FNAA 4QXAA 1HE8B 1A7JA 1DG3A 2BIFA 1U0LA 4FMBB 3T1VA 1Q3TA 5EP4A 1NJFA 4EUNA 4A15A 5FFMA 2ONJA 2XTZA 1QHIA 2ZJ8A 4Q4LA 2WPDA 4N0DA 3BORA 1VG9B 1GWNA 2BV3A 3FTQA 2J1LA 1VYTA 1R5BA 2BBOA 3HJNA 3Q7QA 3VR6A 4Q4HB 4AIIA 2Q3HA 4Q7MB 5HR5A 3LLUA 3AVTA 3PUYA 1U81A 4GP7A 3WRXC 4U00A 2QENA 3EARA 4A8JB 2DFNA 3EZFA 4XWKA 1XTKA 3QNUA 2FFAA 2WWXA 2IYQA 4N0EA 2A3RA 2ONKA 4PHHA 3CO5A 4B3XA 3DHWC 4JLBA 2OCPA 3A4LA 1RC8A 2NO1A 4OL0A 5FTLA 3AVYA 4AG5A 1CXZA 3KJHA 5KHOC 1PUIA 3BC1A 1PLKA 1AS3A 4MRPA 5EUQB 2WKRA 3UKDA 2ZE7A 4PHFA 3T15A 1JNYA 2YOGA 1E79A 2BKEA 2FZ4A 1W4RA 2Z4RA 5DGXA 5LB2A 1K5GA 3TUIC 2A5GA 4K81B 4B3DA 2JJ8A 3QENA 4JMPA 2CBZA 4P4SB 2C8VA 3LBNA 3EASA 1DEKA 1TEVA 2EFHB 1W2GA 3O8DA 4G5GA 5BN3A 2OE2A 3CRQA 4H1VA 1E1RA 3U7EB 4AD8A 5C4MA 1PVOA 1XTIA 3B85A 3GJ3A 1RRGA 3Q7PA 1G3UA 3HPRA 5CITA 4LC0A 5TARA 4A2PA 1DAHA 4PR0A 2P6RA 3EPHA 5DHAA 2D4HA 4NDZA 1WE2A 2AD1A 4LRWA 1VPLA 1Q21A 3AVOA 1XMIA 3MD0A 4DEXA 2RGNC 4R2HA 3HWSA 3RRNA 4QM7A 1J8YF 1RYHA 5DI3B 2ZRHA 2N1BA 2RHDA 1HE1C 3U7FB 2GCPA 2ZI9A 3AVVA 1YU9A 2Q3FA 4M1KA 1OKKD 1UEJA 1XPRA 5JI2E 3BK7A 1JQLB 2O0JA 1NVVR 1NY6A 2DHRA 5CYOA 4EFMA 2PBRA 2Z43A 2IL1A 1JECA 4HB0A 1UPTA 5L3SB 4KI0A 4XSGA 5TXGA 2PX0A 1KO5A 2IHBA 4KBGA 1FZQA 1P9RA 3A8TA 3LY5A 2G83A 2WTUA 4G5OA 3W3ZB 1YR7A 1OV4A 1U2RA 4MGIR 2JLVA 3UIEA 3MWJA 5C1BA 1T5IA 2JLZA 1RRCA 2OXCA 3KL4A 5FBRB 4YQFA 1NJGA 3AB3A 4GDFA 5J4YA 3NBZC 5DI3A 1CLUA 5JSZA 4W9MC 5FL3A 3WHLA 1KSJA 1E6CA 3H86A 4BFSA 2IW3A 4KYUA 4IHQA 3SYLA 3OEHA 3V9PA 1S9HA 3QG5A 1KMHA 1E94E 3IO5A 4Q1DA 4B33A 4B47A 3K70C 4KBFA 4B43A 1IJEA 1NLFA 4OHZA 3L0IB 2ZJYA 2BM1A 4C0LA 4FIDA 3K0CA 3NDBB 4OHVA 3F5FA 3GLGA 3Q5DA 1Z83A 1CP2A 1T3HA 5KTYA 3DVLA 4KVAA 1G8PA 1R8QA 2NGRA 5FOVA 4KAXA 4MKFA 2P2LA 2PX3A 3O47A 3OIYA 1ZNXA 3TR0A 2YWFA 1KAOA 4HI0E 3KKNA 2WWYA 3KDSE 1WMSA 2NO6A 4A9AA 4DSOA 1H8EA 2OV2A 2F1HA 1QZXA 521PA 3AF3A 1Z0AA 2CNWD 1MRSA 2ZVQX 2VRWA 2WJJA 3ONWA 2MSCB 2QL6A 3B78A 4LJ6A 1IXZA 3FKSD 5G3YA 3GJ8A 3NC0C 1XF9A 1ZNYA 2ZIAA 3M6AA 5AR1A 3ZVNA 4NKRA 3O8RA 3WP0A 4YONB 1E96A 1SKYE 2OBMA 2FEOA 2Q6TA 3IPXA 3AVPA 4YMWA 2HYIC 3SHFA 1EX7A 4O3MA 1LNZA 2J0SA 2GILA 1R7RA 2ZSDA 3K0FB 2IF2A 1JPJA 4BASA 4BLRA 2QROA 1GP2A 2IXEA 4QHYA 1AQUA 1OYYA 3U61B 5FPTA 2RGXA 4PAMA 4K46A 4V0LA 4M53A 3D7MA 1Z08A 3OF5A 1EFUA 2BEJA 2F9LA 4R9UC 2ERYA 3GJXC 1KK2A 3PFIA 1KDOA 4BLTA 2NIPA 4OJQA 1KDRA 5DLQC 2ZU6A 1SVIA 4AY2A 3KFVA 5G53C 1R0YA 3Q72A 1VYVA 2ODNA 3FKSA 1R4AA 2XJ4A 4EFNA 2DFLA 3CPHA 3TAUA 3U4QB 4RSGA 3A37A 2ORWA 1Z6YA 4DKXA 4UXHA 2ATVA 1X8LA 3OFNA 4XH9B 3RS7A 3PCRB 1H8ED 1P62B 3GQBA 5EQTA 1P72A 1KHTA 1VHTA 2ZSBA 1N6IA 1ZAKA 2A5JA 1OH7A 5CK4A 1A1VA 1E98A 1OKKA 3OE7D 4R98A 5L3VA 1NVVQ 3ZIAD 2PCJA 5FR1A 2ZS7A 1R5NA 2DPXA 4Q9HA 1AGRA 3QI2A 4BRUA 4Q18A 4DLZA 4FW9A 1NIPA 4RFSB 1GFIA 2EU8A 3ZJYA 2GTPA 1KK1A 2RGBA 1TADA 5DSZA 1SHZA 1HEIA 5EXSA 5FBWB 1KJZA 3KKQA 1II8B 1KO1A 4KYIB 2BKUA 2PEYA 2A5FA 4BFUA 3KTAA 4URYR 3GLHE 4C0HA 3UK6A 4KU4A 2QMOA 4EAQA 1D5CA 4DLTA 4Q03A 4U5XA 2P6UA 3K9GA 2VPPA 1SHKA 4RD3A 1Q0UA 1YR8A 4LYJA 1P2UA 4FXPA 3CZQA 2FH5B 4JYBA 4X8OA 3TNFA 3U44B 4IVRA 2KE5A 4TL8A 4JIMA 1RKBA 3QXSA 3TVDA 5A5GA 1KK0A 1E9EA 1XD8A 3AP1A 4F4IA 4PC7A 4Q4AA 4MITA 2F1IA 1ZCBA 4P3YA 3WHKA 1AS0A 4C7OB 1KJYA 1W48A 4NONA 2CK3A 1SGWA 3U3JA 2LKCA 3BERA 5K8TA 1GTVA 3NVAA 4PPNA 2FDCA 1KMHB 4IDNA 4PC6A 2ZR7A 1Q1BA 1G8HA 1XP8A 1II8A 2RAPA 1Q12A 1AIPA 2ZUDA 1ESNA 3A4MA 3BXZA 1QHYA 4L9WA 1IN6A 2WKPA 2BMJA 3CZPA 4V0MA 2GETA 2ZROA 1QHHB 2V3CC 4TYWA 4GP6A 4Q21A 5FBVB 1HH4A 1NN3A 2ZSEA 1YHNA 4ABYA 5KNBA 4OI0A 1ZU5A 4UJ5A 5JEDA 2PLFA 2BBWA 3KQLA 2ZR9A 2O52A 1BKDR 3PUWA 3UPUA 5KDLA 2IS2A 4B75A 3ZH9B 2QTHA 4A6PA 3THWA 4NP6A 4Y0VA 1JI0A 4H1UA 3SC3A 5ANRB 1IY2A 5BN5A 4CEHA 4BFZA 3OZXA 3OIWA 2QAGC 3RNLA 5EXTA 5AJYA 1LY1A 1VG8A 1U9IC 3U3MA 5JMTA 4LCBA 1H65A 2ZE8A 4YMVA 4Q00A 2PT7A 4JJZA 1N2CE 3GLIB 2JDIA 2PJZA 2Z4SA 2JATA 4NCJA 3D31A 3QG1A 1ZC3A 2ZI4A 4TYNA 3ADCA 1TQ4A 4WZBE 4DC9A 2GNOA 3ZIAA 3FMOB 2O5VA 5DYGA 4C0JA 3DMNA 3QEOA 1Z0JA 2R6DA 1ZVQA 1COWA 1RRFA 4GL2A 2GBLA 2PZGA 2CLSA 4M0LA 4RCZA 2QNRA 2H8KA 2RB4A 3CM0A 4YDHB 1XTSA 3TAHA 4JBWA 3CWZA 3K0SA 1XPOA 5KU1A 2CEAA 5BYJA 1FP6A 2IEYA 2DB3A 3OAAD 2O8DB 4OBEA 5LDDC 1D9ZA 3QSYA 4URXR 1E9AA 4ESHA 2GXUA 2NZ8A 1P3JA 2HT6A 5EZ5A 2AWOA 4BE7B 4C2TA 2GJSA 2ZVPX 3SOPA 3VR2A 3DZDA 4LX0A 3U4QA 2OAP1 3KKOA 4RJLA 1Z06A 4UQOA 4WVFA 2J9RA 2BDTA 5DIFA 1BS1A 1AQYA 1T5LA 4RZXA 1JJVA 4E09A 2YC4C 1FQKA 2AN9A 1JJ7A 3GEHA 1OFHA 3AVUA 5FTJA 2GZHA 3R8FA 1GZSA 2C9YA 2J7PA 1M74A 4I4LA 2R6FA 2GHIA 1ZP6A 4Z51A 3VKGA 3DM5A 3AGPA 1WBDA 2KBFA 3NBFA 3FMFA 4FMCB 1N6HA 2QQ0A 4UNSA 5KDDA 5KDOA 3L43A 1P2VA 1ZNZA 1ZM9A 2F43A 3ND9A 5SZHB 4R71A 4D82A 2A2ZA 1CR2A 1G18A 2FSFA 3VR1A 2ZRMA 4WOPA 2WV9A 4FWTA 2J5XA 5FUVA 4GBMA 5D3MB 3L0PA 2X2EA 1DAEA 1ZIPA 4URWR 6Q21A 2VA8A 1ZM2A 3AVXA 1DOAA 2IEZA 2BMFA 1E2IA 3U7GA 1A5TA 3KJEA 3QXCA 5EE9A 2ASEA 2OHFA 4MKHA 2A7QA 3KB2A 4QJ4A 3CX8A 1CIPA 1ELOA 1W36C 2JJ1A 4LZZA 3IGFA 3F8TA 1AKYA 4HZUB 4ZKEA 4HSEA 2V1UA 1TEXA 2XITA 1RVDA 1G7SA 2QBYA 4D26A 4O25A 4Q4AB 1E0AA 3VR4A 4TMZA 1S96A 4C7OA 4OI4A 2QTFA 1N6OA 1WF3A 2WJHA 4Q4HA 3RRZA 1TTTA 4AKIA 4LBWA 3WYFA 3K70D 2F3TA 4LV8B 2ZSAA 4A8JA 1CRQA 5CJPA 2BM0A 5HCIA 1SXJE 1SVMA 2YV5A 2ZRLA 3OFND 3B13B 2YJTD 5FPHA 3W5IA 4K8OA 3K9NA 3GEIA 2VQSA 4F91B 3P27A 1G9XA 5IT5A 2AWNA 2MSEB 4HDQB 2CXXA 1ZBDA 5JFGA 1AK2A 2OCBA 1W5TA 2AL7A 3DKVA 4TMKA 5JWOA 4HB3A 2QMHA 4DLUA 3TR5A 3HYTA 4HLQB 3I61A 1N5IA 3CNNA 2CNWA 3RS2A 3U7HB 1NBME 2G88A 3CX6A 5AJWA 4QL3A 1UAAA 4IFBA 1F2UB 1MV5A 3S1AA 3FFAA 2IHYA 4LHYA 3KQUA 2RGDA 4ASUA 4B32A 4XSHA 3QBVA 2VP5A 1KNXA 4AI6A 4P33A 2FU5C 3THXB 1VDZA 1G8GA 1XJCA 3NWJA 4TLBA 4QHTA 4W5HA 1N6PA 4KO8A 1FFHA 2PH1A 4NYMQ 4B71A 2HCJB 3GFTA 1G7RA 2G0NA 1I4LD 2XGJA 3EZ2A 3A58B 1VTKA 3LW8A 3AF1A 4DLYA 1G3IA 3HPQA 3D8BA 3QKUA 4EKDA 4Z1MA 3U6KA 3LAWA 4WIAA 2RH5A 5ELXA 1E79D 4Q5IA 2J3EA 3IEUA 3UANA 2FWRA 1BMFD 4WZ6A 4PAOA 2C03A 2JIZA 5J47A 1W4BA 1GSIA 4B6FA 1NKSA 3AF2A 2NMVA 3IDQA 2JAQA 2DBYA 4Z8YA 1IHUA 3T06B 3QPUA 2ZE6A 1TMKA 4FMDF 4ZKDA 2YOHA 1L4UA 1Q22A 5EXPA 2CE2X 4L5BA 2EFDB 2IYRA 5CM8B 3MCAA 1IN8A 4V0NA 1DG1G 3IPYA 3DDCA 4Q7JB 5TY0A 3MFYA 4LJ4A 3SR0A 2D2FA 5HCNA 1Z3IX 1OFTA 1OHHA 4WXPA 3U5ZB 1MKYA 4EQ6B 4TQAA 5H68A 4KSCA 5CLLA 3D3QA 4GZLA 3EC2A 2BVNA 2IYZA 1KO8A 4P4TA 5KO2A 2WMOB 5JBQA 3I73A 2QY9A 5FTNA 5JZVA 3UMFA 2CL0X 3SBDA 4DLXA 2WICA 1KI1A 2F43B 3FMIA 2IWRA 3R20A 4UXIA 3HU1A 2XTMA 4LYHA 4MDEA 1V43A 2CVFA 2JDID 3WYAA 3HYRA 3QF7A 3A1VA 3SS8A 1SXJB 4PC2A 2B92A 3RANA 3LXXA 2WOOA 4QJ3A 1M7HA 1NVXQ 2QGNA 1QBKC 2W6IA 1TAGA 1ODFA 2FZLA 5JECA 2FF7A 2GZDA 3MLEA 3EZ9A 821PA 3ZQ6A 1AJEA 4LJ5A 5AJZA 3KXLA 3VX3A 3NG1A 3TW4A 3BS4A 3RSOA 3SYNA 4CW7A 4CZ2A 1NNEA 1P9WA 4XTCS 5J40A 4P31A 2DFKB 1Z0DA 1MO3A 4B3BA 2XXAB 2JLXA 2FFQA 3FKQA 3PUZA 2ZS9A 1KY2A 4TLDA 2Z6VA 1KJWA 1C4OA 2CL7X 4PZLA 3GEEA 3ZD6A 3MSXA 1XEXB 1FPMA 2V1XA 1VKJA 3GJ4A 3H1TA 5L3QA 2OFXA 2IC5A 4V0KA 2IUUA 1BYIA 2GCOB 5EE1A 4QGHA 1J99A 2HDNB 3KUDA 4ZCLA 4DUGD 4G0NA 3KQNA 2N42A 1BIFA 4LWZA 3L0OA 1JBKA 3BAFA 4CEIA 3FE2A 4A0FA 1IY0A 1TF5A 2GESA 3VU9B 4BLOA 2CCGA 2OFWA 4ZDIA 4KHZA 4RVCA 3PV0A 2MMCA 2WOJA 4MRSA 2ZRFA 4JLKA 1JXMA 4LPKA 3T61A 4I1SA 2XXAA 1II0A 1N5LA 5CB8A 3KB1A 1BYUA 1HQYE 3EWAA 1UBCA 1F2UA 5FTKA 3CNOA 3CPJB 4TTQA 4KV9A 1MO6A 1XEXA 2FA9A 1PUJA 1XDBA 4EDHA 2FN4A 3SJZA 1OHHD 1GNRA 4NYJQ 4JVLA 3KKMA 4NYIQ 3K0AB 2D3WA 4DSUA 5C2JB 4IVPA 4B6EA 1YZQA 3A36A 3LBHA 3A6PC 2ZRDA 4W5WA 4D4KA 5G3ZA 4J0QA 2GEDA 1ESMA 2Q21A 4L16A 3CRW1 1HA3A 4CEIB 2VHJA 1E9CA 2BBTA 3W9YA 2ZITA 3U3OA 4FI3C 2ZM5A 3GMTA 4JBXA 1XMJA 3AM1A 2QE7D 1X8JA 4OHWA 3BD9A 4EIWA 4JT4A 3K9HA 3MAAC 4PHTA 4DCUA 5JWRA 3GJ6A 4OKSA 3W90A 2RCNA 4F92B 3GPLA 2Y8EA 3THYA 1FUUA 2ORVA 2R8RA 3SZRA 1M8PA 5EZ6B 3ZQJA 2NOAA 1XZQA 4V0OA 4Q1AA 3CLVA 4MUAA 4B3CA 1M2OB 1S8FA 4XVRA 1AN0A 1GL7A 2YNMA 1F60A 4KLZA 3GLGE 2CHGA 1EGAA 5E3HA 4DWJA 4EQ6A 1GM5A 3B6EA 3Q85A 4W5JA 1UDXA 4XWAA 3OIVA 2HXSA 3CRRA 4GFDA 4MYTA 1IAQA 3W34A 3MMPA 1ZM3A 1N3BA 4FMDB 4BEJA 3NTUA 4I1OA 2LCFA 4JVMA 1FX0A 3EZ7A 2I3BA 2CL6X 4HUQA 4DXAA 5BXQC 3G0HA 4PTLA 3CPEA 1YZUA 3U44A 4ZCMA 4FD2A 2RGCA 5LD2B 2Z5FA 2Q0HA 5G41A 3EA5A 1GRNA 2X77A 1DARA 2ZRKA 2P67A 1A4RA 3BH0A 2GXQA 4HAVA 4PPQA 4DDUA 5AWFC 2ZSFA 4IEIA 1ZM4A 2BCJQ 1W0JD 2DY1A 2IS6A 3MGCA 2JLWA 5J4VA 4LOAA 4F7WA 2CMKA 3KJIA 5FOSA 5JHGB 1E0SA 1CTQA 1SVOA 4C0QC 1E2EA 4IOKA 4NH0A 2QPOA 3RRYA 4TZ0A 4JL5A 3I72A 1KDTA 3K8YA 2OCAA 2PMKA 4ZDWA 5K8LA 3DM9B 5B30A 2QA5A 3R7WB 5CIQA 1S2MA 1E99A 3KKPA 3GJ7A 1D8TA 3B9PA 3HU3A 2OSBA 3CF0A 1KTVA 3U3RA 2FPLA 4JKYA 2JCSA 2NQ2C 1F48A 1XPUA 2OT3B 3N2EA 1OSNA 4C9BA 1GNPA 3TSZA 5FBQB 1SQ5A 1ZUNB 1IXRC 2ZJOA 2QP9X 1NG1A 1AGPA 3B1ZA 1C1YA 3EZ6A 4LBYA 5L3RA 1ZD1A 2UZIR 5KSPA 3SQXA 1QHNA 4ZDJA 2NTYC 4HLCA 3R9WA 3VHLB 4HAYA 2EWWA 4AC9A 1P73A 3ICEA 3B2EA 2JA1A 2V9PA 1WDTA 3X1ZA 2RGNA 4GMDA 4G3XA 1NY5A 3AUYA 4HZUA 1Z29A 3M4YA 1W4CA 4ZI3A 4US2R 1YRAA 1P7CA 2IS1A 1KAGA 4CEJA 1E2LA 3QJYA 1Z2AA 2YOFA 1UFQA 3H4MA 4KCGA 2WSSA 4KODA 4LHWA 5J4LA 3B1XA 3RS0A 2FSHA 1E4YA 3AF4A 4NHOA 4P4SA 3UWOA 2QPTA 1U8YA 1E1QA 2F6RA 3CUEF 2W2VA 4TT3D 3HDTA 1WB9A 4JLNA 4ZCIA 4GMXA 1YKSA 3ETLA 2QTVB 3ZYCA 1EG7A 1LTQA 1YRBA 2Z83A 1WXQA 2QUZA 4H9GA 4MYCA 4TSFA 5LD2C 3T34A 2R2AA 4YMTA 1OIXA 1YZLA 3W5JA 1TF7A 4P0TA 2X19A 5DN6D 2PZFA 2DR3A 4F38A 1S9DA 4HZIA 1JALA 2BMDA 3QUSA 1FMJA 1Q1ZA 2GZAA 2IYTA 3OEED 3Q8XB 4M9SA 5K8UA 3OHMA 1B0UA 1XNJA 4HATA 2NG1A 1OH5A 5EUMA 1UJ2A 1DO0A 1IM2A 4C0BA 2W0SA 3IIKA 1CJKC 2VYFA 1KO7A 2GXSA 3BJIC 3P32A 4LBZA 4ZDKA 1RPZA 2GF9A 3TMKA 5L8VA 2OFOA 2QGZA 2XOKA 1JAIA 4JYCA 2ZRNA 5JEEA 1T91A 1XD2B 1NN0A 3CNLA 3QXXA 2V7QD 4RZUA 2JJ2D 1BO6A 5GJBA 4TQ9A 3ND8A 5C18A 3I5YA 1DPFA 2BBSA 1UBFA 2EFCB 2AKYA 1TQ6A 3PVSA 2IXFA 3I8XA 2AKAB 3AEZA 2G1KA 1H8HA 5CDFE 1W1WA 3WXMA 1Y3AA 3B5JA 2C9CA 2J46A 5FI0B 1M6NA 3KJGA 3QY0A 5JI3E 4AKHA 1KI6B 1US8B 2FJUA 2CHQA 5IF9A 1IONA 1P6XA 2IBMA 3OAAA 3C7KA 1JB1A 3K09C 4NCNA 4GOJA 4JLVA 2W2TA 1E2MA 1T8UA 2H1LA 1JR3E 2FGJA 4MRVA 4JS0A 1E9SA 2V8OA 4B48A 2VLIA 4LDJA 1EFCA 1COWD 4TTPA 4QGFA 1GKUB 2R44A 1L8QA 2WAXA 5SZIA 2QAGB 1NRJB 1NSTA 3FHOA 2J45A 4Z8XA 4PO9A 3A1SA 3JVUA 4RFVA 1TU3A 2EWVA 1KNQA 4LJ9A 3RHFA 1MO4A 2WMNB 2XOKD 2Q3MA 3CRMA 5AJXA 1XB2A 5JS7A 1HYQA 1DAMA 1Q3HA 2J0VA 1DVRA 4LI0A 2ZJBA 4TYPA 4AYTA 2IUTA 5C4GB 3I5XA 4Q02A 4UNNA 4E07A 1SXJA 2HCBA 2HLDD 2GAAA 2OBLA 5SZJA 2OCYC 2RGAA 3WBJA 1QHHA 1GG2A 4LV6A 2HV8A 1KZ7B 1JEEA 1KI8A 2CDNA 2ZI7A 1M7GA 1AZSC 1P9NA 2C9OA 1GOTA 2GVDC 4GZMA 2F9MA 2VHUA 4YXWD 2QT0A 5P21A 4O2LA 4A6XA 2ZE5A 3WMGA 2X2FA 2XAUA 4XOIA 2C5LA 1JXOA 4KITB 2WWFA 4NZYA 3TSWA 1MR3F 2FEMA 5D3QA 3RS5A 3X1YA 1G4UR 2ZRPA 1Z22A 5CM9C 3W6PA 4D0NA 3EPLA 3GJ0A 2QPAA 4DCNA 4OQMA 1OLOA 3LNCA 3FDIA 1ZU4A 4A0HA 1G4AE 1E1QD 2ZXUA 4AK9A 1JPNA 2GK7A 4LJ7A 1P2SA 1ZMXA 1OH6A 2GCOA 1G8YA 2PLRA 4P4UA 3GLIA 3W3AA 3OEHD 2KI5A 1F2TB 3CH5A 3IQXA 2XZLA 1IN4A 1MOZA 3NC1C 5EP3A 3IHLA 2ZJAA 4Q1CA 1E2FA 2CE7A 2VF7A 1T3SA 1N5JA 3SI7A 3VHXA 2NO7A 1G5TA 4LHVA 1N0WA 1OIVA 2VSOA 2HXYA 3FPAA 4HUTA 4IDQA 3PEWA 2VBCA 2R9VA 1EFRA 1BMFA 2QE7A 4Q7LA 4DRZA 1NLZA 2O8DA 2F55A 1E9FA 4CYMA 3EWSA 3BRWD 4NBSA 1II9A 1CR0A 2ANBA 1SKYB 5DHFA 4DLRA 1RW4A 3LBIA 1R6BX 1E2JA 1W44A 1XJ0A 4DT1B 1VCNA 1ONBA 4PHGA 3E5HA 5HZHA 3G82C 2ZRBA 5IDVA 2YWHA 4PQRA 4CF7A 1E0KA 1GRQA 2OG2A 3M1IA 4BLPA 2CVHA 4PC3A 3C41J 2FG5A 2XX3A 3R9IA 2AX4A 3IBYA 2AD5A 1W0KD 2P65A 2GA8A 1P60A 4W7SA 1LW7A 1YZTA 4YDSA 3LWNA 4V03A 1A2KC 4B2LA 2V6IA 5B57C 1J2JA 3MJHA 1CJVC 3VR3A 4QBIA 1W46A 2W00A 1X1RA 1CF4A 2GK6A 1E2GA 4EFLA 1RRPA 5KYKA 4AKGA 4JLPA 2FX3A 1N6NA 3LXRA 4ACAA 4CVNA 1US8A 2IS4A 2A9KA 3AGQA 3GJ5A 5DI9A 1GKYA 2QRZA 3SU8A 5JLJA 1FP7A 4AKEA 2ZI6A 3EIHA 4XJXA 4DUGA 3ZZUA 2JLYA 4E5UA 3W8RA 2LKDA 2XNDA 3K0CC 2QAGA 4OK5A 3OESA 1S0UA 4OI1A 4B3GA 5EE0A 4G01B 1P2TA 4A1FA 2W58A 2Q9BA 4QC2A 2ZAMA 1E0JA 2QBYB 4OYHA 4JSTA 2VH5R 2V7QA 3BH6A 3VR5A 1OB2A 1T0HB 3TRFA 2N46A 5GJWC 3ZVMA 1L7VC 3AP3A 5E7MA 4GI7A 1NI3A 4DDVA 1L2TA 2ZRCA 2FFHA 721PA 2H16A 4FCVA 1G3MA 2AXPA 2NPIA 4MGZR 2NZJA 2EW1A 1T0JB 2XSZD 3EXAA 3KXIA 3UWKA 1LF5A 5DH9A 4RD6A 4AYXA 1KSGA 5FOTA 3LFUA 4A92A 1T8TA 1GL6A 1DAFA 1XCMA 221PA 3BGWA 3K70B 5HKKA 3TH5A 4ACBA 3BH7A 3QE0A 4S2EA 1TL7C 4OQNA 4PX9A 3OIUA 1E4VA 4C3ZA 5H70A 1CRPA 2CLDX 3ZVLA 2WSMA 2ZYUX 3KX2A 1GL9B 3MUFA 2O8CA 4ASUD 5CYPA 1G3QA 4Q7KA 1CU1A 3I92A 2KSQA 3FVQA 1FTSA 4IW3B 4QGAA 5G40A 2WVJA 3VAAA 5JCPA 3QEJA 2GAOA 4PQFA 4LUCA 1E2KA 1EFRD 4E22A 3N2IA 4RZ3A 1W5SA 2ODWA 2RKOA 3BB3A 4ESVA 2WJYA 1EK0A 3HP1A 3U2QA 4PXAA 4LYAA 5E7JA 3ZS8A 1YZKA 5KOYA 3K53A 2IA5A 3DL0A 3LX5A 3QPWA 4NMMA 2OM2A 3QKRB 1SKQA 3PR1A 3ZZ0A 3A1TA 4IDOA 4ZPXA 1G3RA 2WM9B 4MKGA 4MUBA 4P32A 2W6JD 1G16A 3CF6R 2JLRA 2VEDA 121PA 5A0FA 1S1MA 3C15C 1W47A 1OXSC 3E1SA 1NG9A 4BGDA 3B1YA 3SN6A 3RAPR 4DLVA 2ZYVX 5LBIA 4A82A 2GCNA 3WNDA 1IJFA 1T6NA 2C2HA 1JAHA 2UZ3A 3NHBA 4B74A 4GRAA 4Q9IA 2W0MA 1ZUHA 4M1YA 2VP9A 1R5OA 3VKWA 4PO1A 3LW7A 4WAUA 2YZ2A 1XX6A 5FPSA 4ZV4A 2GJ8A 4OI2A 3VFDA 2I4IA 3R7WA 4HB2A 4US1R 1YJ5A 3T1OA 1EX6A 3MRSA 1OW3B 2GEUA 4MA4A 4XWOA 3SQWA 5GVSA 1ZUIA 1RZ3A 3GLHA 2C77A 2ZRJA 2GJAA 2P0EA 1XZPA 5AUQA 3GD7A 1Z6XA 5A4JA 1S3GA 3KTAB 2GRJA 5IK2D 2AXNA 1E2HA 1Q44A 1KY3A 1G5RA 3LVRE 1TUIA 5DISB 3QF4A 1IOZA 3GFOA 3K0EA 4QNRA 4UXJA 4YC7A 3FOZA 1G21E 2GBLC 1KKMA 3K1JA 4M9QA 1AA9A 4MRRA 4XVQA 2G77B 4QM6A 3TUJC 1XMSA 4TZ6A 5EE3A 1ZD8A 2ERXA 1R0ZA 3RABA 1SVKA 2DWOA 4Q66C 4DJTA 4PO8A 2GEVA 3C8UA 4JZKA 2MMGA 5CIWA 3GLFA 1NSFA 1EESA 2ECKA 2IYSA 2C95A 3S1AB 3WP1B 2QI9C 3VQTA 1B23P 4EJSC 3QIAA 1FL9A 1KZGB 1Z07A 2W2XA 5DNYB 1C9KA 4OQFA 3SJBA 5AUPB 2P6NA 3GP8A 2O8BA 2VO1A 3THXA 3SNHA 1E2PA 2C96A 2UVQA 1BH2A 3AV0B 3BOSA 4URVR 3FHTA 4LK2A 4V02A 3VKHA 1SXJC 5DYIA 1YZNA 4KFSA 5B58C 3VNUA 1XCPA 1WRBA 4HAZA 4F4CA 4XD7A 1X8KA 1IN7A 4R7ZA 2XTNA 3TIFA 5DN6A 3HR8A 4OQLA 4TL7A 5HE9A 1I2DA 4QJ5A 4TSFD 3IBGA 5GVRA 3WNCA 2EFEB 5HPYB 3LV8A 3RWOA 5KPJA 1SULA 4X8LA 1E9DA 3SHWA 1VYUA 1CJUC 3W6OA 3PIRA 4LHZA 3K9LA 2O8BB 5SZKB 4II7A 1U8AA 2TMKA 4EPXA 3CX7A 3A4NA 3WYGA 4FWIB 3ZS9A 3LD9A 3PEYA 3SE0A 2IYXA 3SYKA 4ZO4A 3CF2A 1F3OA 5KNCA 2AHOA 2JLUA 3QKRA 3ZVRA 3MWLA 1GUAA 1SVLA 4IOMA 4M9XA 1XXHA 3A1UA 3JZMA 5C46F 1VG1A 3PEVA 2WJGA 3L8ZA 4NYMR 4B2PA 2AFIE 3A1WA 4KSBA 4C2UA 3NXSA 1XTRA 3H0KA 2CCKA 2FV8A 1CJTC 4KFUA 4RZ2A 2REOA 3QVVA 5EXXA 4C0AC 3C5CA 3QOFA 3ASYA 2WSSD 5TB5A 1KKLA 3NDPA 1DO2A 2WWWA 1ZNWA 2XB4A 2QP3A 3NH6A 1F2TA 5FL7D 2WAYA 3VTKA 1QRAA 1OFUX 2DWPA 1E32A 1KSFX 4PPGA 4TN1A 3B60A 2ZUCA 2ZU0C 1DADA 1XBTA 4HLUA 4JLJA 1MRNA 4NYIR 4OJKA 5FUXA 1J70A 3PQCA 1S1CA 1FX0B 2JGNA 3OE7A 3FHCB 3R9XA 5AJVB 3PITA 3PXGA 1W7AA 3T12A 1CEEA 3NH9A 1HT2E 4OHYA 4IXNA 1RFLA 2L0XA 4NU0A 2IUSA 1K6MA 4Q19A 4RKFA 4M22A 4C30A 1KO4A 4HB4A 2BMEA 1DAKA 2D2EA 4GOKA 4S35A 2F1JA 2NO9A 3CR8A 3P4XA 1E2NA 4M1WA 2O8EA 3I4LA 1UADA 4JBYA 2I1VB 3JZAA 4FMCF 5FL7A 4NTZA 1NIJA 2IYVA 4KFTA 4NPHA 3QKTA 4N3NA 3IEVA 5LB4A 4FINA 2QSZA 2OLJA 3BB1A 4DB2A 5LPNA 4HEJA 2RGEA 2ZRIA 3R8CA 3VX4A 2VSXA 1TX4B 1Z0KA 3TLXA 3VU9A 4A4DA 3REFA 3EIEA 1Q20A 2WJVA 3C14C 3AKDA 5CLQA 2BEKA 1HV8A 3T5GA 3AKYA 5JHHB 4B34A 1JQJC 4JVNA 1WCV1 1JR3D 3CB4A 1OXUA 1W36B 3CONA 3VNVA 3X1WA 1E9RA 2REXB 1MABB 5FOXA 5GADl 4Q1BA 1GRRA 1E3MA 1I2MA 1LS1A 2WIBA 2DYKA 2H92A 2XNSA 1T9HA 3B9QA 2VP2A 2ATXA 5F3WB 4BZQA 1LV7A 2WJIA 1EFHA 1Z6GA 4TLAA 1OXXK 4PFSA 1G5PA 3TBKA 5FUWA 2QM7A 4B76A 1U0HC 3UG7A 4D0LB 5F98A 1KIMA 3QQ5A 1X1SA 4Q9LA 2IYWA 2WPDD 1XWIA 3EG5A 3DMDA 4M21A 4FCTA 2JASA 2QAJA 1TQ2A 1ZW6A 4QKQA 3THWB 3SEAA 4D25A 1NN1A 4DHEA 4OHXA 2VHCA 3SDZA 4QNMA 1UKVY 2SHKA 2P5SA 3QKSB 2ZPTX 5BN4A 4BLQA 1E9BA 1X6VA 1EXMA 1DBSA 1UBEA 4TQUS 2QQEA 3D6TB 1XEWY 2OO7A 3NKVA 5EE5B 4C4PA 4EPTA 1PLJA 3RYTC 2MSDB 2HLDA 1QF9A 4DDWA 4PSVA 5HE8A 1Z0FA 1U0JA 2QORA 3N5CA 5E7IA 2F7SA 4QFMA 5FH9A 4C0KA 1AS2A 1CBUA 2WWGA 4XVUA 1Z5ZA 4PZYA 1DTSA 3UMSA 4HUQB 5TV2A 1W2HA 4I81A 1VMAA 1XXHB 4DBLC 2G1JA 3CKLA 2PT5A 1KGDA 2ZRAA 1ZYUA 4BFWA 3WY9A 2ZANA 4LC1A 3T35A 4TLCA 1Z28A 4I1VA 3TQFA 4C0SA 4D80A 2XB2A 3LDAA 2WKQA 1XFAA 3DZ8A 1E2QA 1UKYA 3LRPA 3AUXA 1KI9A 1R0WA 2E9SA 4QGGA 5FOUA 1FMLA 5KPDA 2XEXA 4JLDA 4LPSA 2ANCA 1ZM7A 3THOA 4QOSA 1OYWA 2J87A 2B7BA 5B2ZA 4OK6A 1W0JA 2B8TA 4DVGA 2BOVA 1E69A 4UNQA 2QT1A 2Z0MA 1YR6A 1CKEA 2A5YB 1FQJA 1OF1A 1LB1B 4FCWA 4YXWA 2ZI3A 4JLAA 1YZGA 2ZEJA 1Z2CA 3BB4A 2W83A 2XSZA 3UG6A 2IYLD 2I1QA 3T1QA 3AP2A 2XJ9A 1CS4C 1KI6A 1W49A 2WHXA 4L9SA 3WMEA 4JVSB 4TYYA 5HZKA 2GF0A 4TMTA 1U98A 1OXTA 2V55B 1P4SA 4US0R 5E95A 2OLKA 1G41A 1ANKA 2YC2C 4EJSB 3GLIE 5L3SA 4RKEA 4B2IA 4RCYA 2FSIA 5FR2A 4M4SA 1OPXA 1SVWA 4GNKA 2O8EB 4LJ8A 3PJRA 2H7VA 421PA 5KNDA 1S3SA 2B7CA 3J81k 2E87A 2OZEA 3WBKA 4BWYA 4A8JC 5JS8A 2DCUA 3B1WA 3LVQE 4ITRC 1FW6A 3BFVA 1WQ1R 4DDTA 2ZYTX 4XTRA 1YVDA 3FB4A 3DPUA 621PA 3EA0A 3TE6A 4UNPA 1HURA 3P4YA 2ORIA 4TTRA
chains in the Genus database with same CATH superfamily
4XDGA 1CULC 2XWPA 3HP4A 2UUOA 1F17A 4P7BA 4I5DA 1VGQA 4MVJG 4W82A 3VSAA 3GRCA 4HADA 2GVZC 3L06A 5LQDA 4IMJB 2R1VA 1KR5A 5EJEA 4H3SA 1DSSG 1V1RA 4UVDA 3C1TA 4C6TA 1MO5A 5HIJA 3B48A 4DSNA 1KH2A 3MB8A 4ZRDA 5JJKA 2BTQB 2GHTA 4QICA 1X3SA 4D6PA 1TKCA 4N3AA 2UYGA 3FZNA 4AZSA 5GZ3A 4TOIA 3E1GA 5CP8A 4DNFA 5H3LA 3GNQA 1NT2A 4X7BA 3G8AA 5HHTA 3I2GA 4EATA 3RC3A 3A9UA 2I8CA 4TTVA 3WK7A 4C7KA 4EB6B 3VAZA 1IM5A 5JYBA 3KSDO 2VYCA 1NN5A 3T7RA 5J3JA 3ASVA 2D5AA 2RGYA 2XVZA 3QUQA 2CLCX 2X8WA 2A4MA 1K6JA 3TINA 3P9IA 5IK2A 1RBZA 4IOLA 2V6BA 5ILQA 2HMVA 4YA6A 3PVCA 4BX0A 2WG2A 4WSOA 1R4ZA 1ZH6A 3DHNA 4TZTA 1NBMA 3N0TA 3UB4A 1Z7WA 2RIRA 2YVUA 3KEGA 3QXHA 4GPTA 1FU8A 3NBXX 4KRXA 3LQYA 1S2LA 4LGVA 4UARA 4GO1A 4JOBA 2FTKE 2KHZA 1QIIA 2JEOA 2WTBA 2YHIB 2Z2IA 2ZSJA 5C8VA 3VPSA 3L4SO 2Z1DA 3BFJA 3L8YA 3OEYA 4YRJA 1XV5A 5C1DA 5DGIA 5E9AA 4IINA 1R2QA 1UEIA 3NJ4A 3F8SA 1XEFA 3JQCA 2PO5A 5ECDA 5HCUA 1B74A 4MARA 1MAUA 1R8SA 3G2QA 3KSBC 1MOPA 3HGMA 3I5UA 1M34B 4MZXA 4XRGA 4HSGA 1HDXA 2I1LA 3ORQA 2AE2A 4FDMA 4P92A 1X15A 4CMEA 4UJ3A 3HE3A 1POWA 2LDBA 3A0UA 4XDHA 5BQ5A 4YRIA 5HKKD 1ORTA 3THYB 1IEWA 3B3QA 1U99A 3PC8C 3Q3JB 5F9HA 1VM6A 3VSEA 2PUCA 3LZ6A 3AETA 2CHVA 1TZKA 1RP7A 4IH9A 1AHIA 1YUNA 2C2ZA 3RF7A 1W52X 2BFPA 3TKLA 1BCSB 4JYAB 1HBJA 5C8ZA 1LS6A 3ITNA 1J0CA 3TRDA 4J3JA 1WXFA 1HYBA 1T0UA 2ZBEA 3C5EA 3FPJA 3FWYA 4MWBA 4PCUA 1AKRA 1U90A 2E7ZA 1RYDA 2JKVA 3DG9A 3IUYA 2H1RA 1ZCAA 2PHZA 5J5CA 1Q17A 4H0NA 4QBGB 4JJ6A 1NV8A 4BBAA 3QPVA 2RGWA 4NMXB 5CA0A 3REGA 4MO2A 1VCOA 3RRXA 4DLAA 3OCWA 5LNK6 5YASA 1AKUA 1JQAA 1JDZA 4WERA 3JASA 4QBFA 3MYRA 2GM5A 3V4RA 1VE1A 1VPVA 1WMAA 5JXHA 3TG8A 1FW8A 4O1IA 5BW8A 2YV1A 3RTBA 1UQRA 4W7HA 5F52A 5CNKA 2TSYB 4O2BF 4JB2A 3W2GA 1IUKA 2RB5A 2QVXX 3I6QA 5AJHA 2IU0A 2AMVA 2VIIA 1JKFA 2MYNA 4QG3A 4EPRA 2AC7A 1D0SA 1YV9A 1OIWA 2XQFA 2BF7A 3A11A 3MPOA 1S3FA 4I50B 2C00A 2BWJA 2R66A 2HNAA 2O0KA 2PSSA 4DBVO 2CJWB 2C3YA 3GUUA 4ZU3A 1LBIA 1WG8A 3KEQA 5IW8A 3RD5A 1OA1A 2G6BA 2AMYA 4P58A 4CPDA 4AZ0A 1VCIA 1H3NA 2OO5A 1PHRA 1L4NA 3P2MA 4BLUA 4M55A 1PQYA 4KE6A 1V16A 4QTUB 5DB4A 4D4GA 3AFMA 1U5CA 3HRHA 4JGIA 3D64A 4UEKA 3T3EA 3U4DA 5JJ5A 3B9BA 3VO1A 2CXQA 4AJ2A 5LC1A 4BNGA 4F4JA 5A2GA 1ABEA 2GN4A 4H7JA 4DW8A 2C29D 3L6RA 1QHXA 4X44A 3FN4A 3L7DA 3TSOA 2F8TA 1HDOA 1G7CA 4OYLA 3G5LA 5DE3A 1A0OA 1XEWX 2ZREA 1JDSA 3DTTA 1S2DA 4AURA 4J2OA 4B35A 2FSUA 1QIEA 1KYTA 3GFPA 1XYVA 2D62A 3RVPA 3NXKA 3PWKA 4JL8A 2BTQA 2R4TA 4C29A 5ED4A 2RC6A 1Y81A 4EJ0A 4AL4A 4GI5A 2GTHA 5DCUA 1YFZA 2ESRA 1N0VC 2JHCA 1JHXA 2C58A 2XYGA 4R8RA 5IUJC 1CHNA 2FPUA 4NMHA 1Z4PX 3O74A 3H13A 2PWPA 4EB8A 4BAUA 5B36A 2J4DA 4EWLA 2BE9A 2C0QA 5KTRA 2BI8A 4EVRA 3EQZA 3DT9A 3LQKA 4R41A 3GPDG 4Q9NA 1JR6A 4PSCA 1DXOA 1JG1A 2KWIA 2IIPA 2C31A 2IP2A 4OU4A 3SS7X 1ZGBA 4IVQA 4NV0A 2OCKA 4DQUA 1GPBA 3EQ6A 2X5KO 4GKBA 3K9WA 1T9BA 3BCRA 1L4YA 4ERNA 2NYAA 3EC1A 1GEGA 2VP4A 4U7PB 2XA1A 3EAQA 3FCUB 1L1FA 3VBEA 3LHKA 3WNQA 3ZWBA 4QBHA 2Y0EA 1XTZA 2J9ZB 4J0HA 1G19A 1ULHA 5JXIA 3GQVA 2D74A 3DEFA 4BVEA 2J4CA 1XCGB 1T2UA 1K5PA 4YR9A 1WCWA 2J0EA 2EZTA 1Z8FA 5HQJA 5BMVA 1QO0A 2IX3A 1F2VA 4E5SA 5KJ1A 3IR6A 3MF4A 4NAUA 1H6BA 4UW9A 1O3YA 3LNTA 4B9EA 4CCWA 4DT1A 4BN0A 3LUHA 1PSWA 4JUCA 4REOA 1S6YA 3DEZA 3RTEA 5K0FA 2OTCA 2FPGA 3GDGA 2IXGA 3HSKA 3FSGD 1C2TA 3D2BA 4IAOA 5AQEA 5EHZA 5HM6A 5ITWA 5E4JA 1N8SA 3P9NA 4D4JA 5HNKA 4PNHA 4PSAA 1M1NB 2PZEA 3GRRA 3PKZA 5B7QA 3TL2A 2E1PA 5L40A 1Q5PA 2P9TA 4KRGA 4X65B 4G6ZA 1N5KA 2EBUA 4K6KA 4NWIA 4TMXA 3GEGA 1MG0A 4ZI7B 2DLNA 2IEGA 2D7DA 4LVCA 1C8VB 2V4ZA 2YQ5A 4BKOA 2N1MA 4G5YA 1U1FA 2RG7A 3GJTA 2QVCA 3AI1A 3K2BA 1RCUA 4L15A 1O94A 4FGWA 4YYEA 2MDTA 4EKIA 5I01A 1G20B 2XKAA 2LPMA 4WKOA 4C4SA 2X0FA 5FI1B 1VPEA 4MA5A 5IHPA 5ED0A 1YI8A 5LLDA 3AEKA 3CUKA 4Y2JA 1ID8A 5EG5A 3NHLA 3TW8B 4JSYA 3RGGA 3KAJA 4M6WA 2YFKA 1KC1A 3ZTYA 2O50A 2WHRA 3HY3A 5GV8A 2WBLC 1OZGA 4MS1B 3SYMA 4RCVA 3G23A 3NTOA 2JHPA 4EPVA 5J43A 4Z53A 2Z1MA 1U7ZA 2DBQA 4N3CA 1U1IA 1SCBA 3QX3A 3RIGA 2HT1A 2YRFA 1JLMA 2VUSA 4XM1A 4MH0R 1G1AA 3RV4A 1H8HD 1VL6A 3VZBA 2KB0A 3O8LA 4PNPA 1JG7A 1SZJG 2B2NA 5FUBA 1KFJB 4IFEA 4K9RA 4X1KB 5ESDA 4HAWA 3VM6A 5AVWA 4TMVA 2OUKA 1NKTA 2KBEA 3I3SR 1YCGA 1Z6ZA 2VDMB 1EP1B 4QPDA 4CGZA 2CJWA 1O94D 3QFCA 2H3HA 1KEVA 1NMSA 5DGCA 4ZYXA 2ZTLA 1OLSA 2JVJA 4MWZA 2J32A 3OPXA 2FFBA 4KQEA 4JI4B 2B9EA 3I2YX 4MKIA 4V2UA 3HU2A 5I7OA 1TNDA 1UFVA 3K6RA 5ICGA 1BEEA 1Q57A 1SC1A 3PPYA 1FOEB 4K9MA 1VIDA 3SIPA 2XIQA 3RJZA 2JGDB 3HXTA 1PQ4A 1HQCA 1YZFA 1T0BA 1U0EA 1VG0B 1KA9H 2VK2A 3OSZA 5B3LA 1JDTA 3HADA 2DPMA 4HWGA 5IXSA 3KZ1E 4D57A 1QCCA 1PR3A 2H9YA 2W6ID 1L4MA 1S02A 4D2IA 3EUWA 2V3VA 4HNSA 1YMVA 4BEWA 1TZCA 4FEGA 4NDAA 2H1HA 4GPD1 1QCDA 1HK7A 2QN6A 4YMLA 3IBFA 3JQ9C 3OD1A 1PGNA 3AVWA 4RMJA 4R1NA 1XTUA 4UCFA 3JALA 3SD7A 3UATA 1ZC4A 1F20A 2E4VA 2HSWA 1GUDA 4D0GA 4JBHA 4EPWA 3TUZC 2IUYA 3U09A 3LK6A 3V4OA 4JLMA 4L6CA 1UPCA 4I4NA 4Y8VA 4GKJB 2VP6A 1WMFA 1UJNA 3E2MA 3PQEA 4CF5A 1XRJA 4DSZA 3CVUA 4EYKA 2VFAA 2DJIA 1R0BA 2IYPA 2WT9A 3ROXA 3H19A 1NF3A 3MTEA 4XD7D 1HZJA 4V38A 4G5SA 5L95A 1I4DD 2HTEA 3F9CA 3KALA 4G5RA 4OTZA 4KZKA 4ZCTA 3T1TA 3DZJA 2EEPA 3TF5A 4EX7A 3SGLA 1OJLA 1E7YA 2AR7A 3OEEA 5JD4A 1NVUQ 3NVKI 5K8IA 3M0EA 4Q3BA 3AHEA 1L5WA 2ZYWX 1NXOA 4MKXA 3EW9A 4LF8B 2R8OA 4V1CI 5TPZA 2BCGY 5GJVC 2DR0A 3G02A 3BGVA 2WJ6A 3WGKA 2IVFA 3D1VA 4BYMA 2KM1A 4A36A 3OPQA 4LY6A 3L4JA 1LJLA 1XAHA 1TU4A 3P2OA 4RH1A 4F4HA 3AM5A 3O7MA 3TQCA 2FR1A 3GFRA 5IJXA 1CR4A 3DHYA 1CJSA 3HCEA 3OTHA 1FNMA 4Q16A 2PA0A 2VTKA 4IFIA 4YQEA 4ZICA 1SXHA 1OASA 1G8AA 1TM5E 1M5TA 1L9XA 1LF0A 2GO7A 3UYLA 3UMGA 3HFJA 4G5QA 4ZC1A 1J22A 2O2XA 4DC1A 1MT3A 2DE0X 2CFTA 3DOFA 4C3VA 4HAUA 2BLLA 4D3YA 1BWQA 4CEHB 2VPYA 1Z0SA 3M6VA 3WFZA 2QRVB 1MH9A 2ZCVA 3I9JA 4H16A 4ILEA 2I1WA 3R75A 16PKA 2E1RA 5C1IA 3T7TA 3HLYA 3JQ6A 4GQIA 3T95A 2ZT5A 2R65A 2UKDA 4M1SA 2CV0A 4MI3A 1G20A 4UKDA 5BSFA 2PMDA 2XZOA 4NDNE 3TIVA 5BN3B 4G9GA 3CT4A 3RYHA 4AJJA 4DR3B 2PXHA 3AM3A 3ZY3A 2GN8A 4KOEC 3MT8A 1T5HX 1GGFA 3D6AA 2BSAA 5FBLB 1AM4D 4QFCA 4FKMA 3U81A 1RBMA 2VH1A 1MPXA 2AJCA 5E1DA 2OFFA 1XDUA 1SZPA 3TR6A 1ORIA 1UANA 1XRNA 1EX1A 2J9XB 1G8FA 3CLRC 5CJ2A 5EIFA 2PMEA 1G8KA 1HLGA 4IYRA 3E9ZA 1Z0ZA 3LUBA 1T6ZA 4HFJA 1SBQA 5BSRA 1Z4MA 4EBFA 1LD3A 2GN1A 3PLNA 4L7VA 1ITZA 1Q1QA 1XZ8A 3FUWA 3CSUA 2AQKA 4MQUA 3WRXA 5JFTA 2QJOA 4LVUA 4CE6A 3QYPA 1TT7A 4BQSA 3G5UA 2CYAA 5JJLA 1D2AA 1JEDA 1S8NA 2O19A 3JZDA 2JAOA 2V6JA 1K2VN 4MVJP 4HWTA 3ONFA 1PVDA 2W5UA 3ENVA 1NXSA 2WWHA 2IEIA 4QEDA 5FPKA 1F0NA 2XNDD 2BN4A 3BRQA 2VYQA 4NOKA 1T35A 4J0FA 3Q87B 2ID4A 5KUTA 3O0TA 3CVWA 4MDFA 5GJCA 1ONSA 1OLSB 1JJAA 4A5SA 1G6OA 4CLDA 4HDSB 4WK6A 3WGUA 2GBGA 3DNMA 2JH8A 2FZCA 4R2LA 5TVKA 1SHLA 2EP7A 4P84A 4DLNA 1D1QA 2JJ1D 2JIRA 4OHBA 3CZAA 1U2DA 2A30A 3IKLA 1S2NA 5ERGB 1HDYA 3DBLB 2B3TA 2JKZA 1IATA 1ZINA 3DWEX 4HX2A 4R6XA 2YWEA 4G4SO 4D9KA 4QHSA 3CW8X 2AG6A 5EPOA 3WWOA 2I03A 1R64A 1N57A 1YE5A 2PL5A 1QG2A 2NQ8A 2P3SA 4MR9B 5D3MA 3LT2A 5IFLA 1C30A 2H57A 3VH4A 3UN1A 2BUCA 4EFDA 2PANA 3D4PA 1Z0IA 3AZPA 1WKVA 4JEUA 2DWQA 4YIKA 2RHTA 1V1MA 1OCEA 3BDIA 1Y3BE 1TQHA 1VRCA 5IRCD 3WK4A 4NCAA 2JIOA 1W96A 3I9LA 3MS4A 4B8WA 4QXAA 4OP2A 2PKRA 2BIFA 3OX1A 2HLHA 5LLSA 3T1VA 3DOIA 4PRKA 1UBJS 1A76A 1Y3CE 2ZULA 4HS9A 4CMHA 1MGPA 1JEAA 1D6NA 2ODTX 4HTFA 5JCJD 3GLSA 4MWEA 4JOQA 1H42A 3GEMA 5EQFA 2C3MA 1AB6A 3D1LA 4RXUA 3VC3A 2CJPA 1GWNA 1VGVA 2HJHA 2OCLA 5CMLA 3KKZA 3FTQA 1A4XA 2P3LA 2QTZA 1VYTA 3JARA 4QPJC 4Q4HB 2QN8A 4W5RA 1QTIA 4FZJA 2NU9A 2QZZA 3AVTA 2AUNA 4GP7A 4JMLA 4QVKA 4U00A 3GCZA 3BIJA 2DFNA 2CBGA 4OU5A 2TMGA 5FNVF 1G6Q1 4ZVKA 4WFKA 4URHA 3WYCA 1LRKA 3G0GA 1FNDA 3DHWC 4FNMA 2PQ2A 4JLBA 2XQKA 4UBMA 3VKVA 1UMKA 4OL0A 3W6UA 3AVYA 5FQOA 4I3FA 1DFGA 1R0KA 1XA3A 4GUAA 2QUJA 4R1SA 1JPUA 3RASA 2FR8A 1T4CA 2Y6UA 1E79A 3PRJA 3KT6A 2BKEA 4DJ5X 1W4RA 1I3CA 2Z4RA 3KUXA 5EHGA 3SQOA 2G04A 4RTJA 1K5GA 3I2FA 4K81B 4OCZA 1W8IA 1ZISA 4QOHA 2QXTA 3OOEA 3N05A 1SA0A 2MWMA 4JOSA 3LBNA 1VKNA 3R7BA 4R2XA 1YAJA 1O58A 3TTTA 2EFHB 1YVRA 4ZWNA 1MX3A 4AZ3B 2YMMA 5A62A 1YQXA 1E1RA 3ICWA 4NMWA 1XTIA 3MJTA 3RU7A 1RRGA 5AM5A 2RHGB 4LNAA 4TS9A 4BOYA 1JQDA 3I01M 1C3LA 1RQGA 1FB5A 1J0XO 3H8WA 5TARA 5B6IA 2QIPA 4O4HF 2D4HA 2HIGA 4Z3OA 3CQ9A 3PR3A 5CDHA 3AVOA 3ZNNA 2J9GA 3M6LA 3GPIA 5A7HA 1JG2A 1Z39A 1FVXA 3RRNA 1WZ2A 1RLOA 4E7OA 3G2KA 3PFWO 5DI3B 1QTNA 4B3HA 4J29A 1YFJA 3MELA 1XCJA 1A88A 2GCPA 1KQPA 1PG0A 3T7AA 4PYQA 3ZDFA 1UBNA 2DRIA 2Q3FA 4M1KA 2VJYA 3OU6A 4E5YA 4P4GA 1XPRA 4LXUA 5JI2E 1OFUA 4KQFA 2XUPA 3I6ZA 3Q41A 4M38A 2P35A 5HBRA 3ZV7A 4FYPA 5AW9A 2C2XA 2DHRA 2D13A 4AJLA 4KWIA 1Y6GA 2FHSA 1UPTA 3DL4A 3DT8A 4UEQA 4ZODA 5DWDA 1KO5A 1QIKA 2W93A 3WL7A 1E2UA 4Q3LA 2PH5A 1XVIA 2WF8A 3O8OA 1ADYA 4CMIB 3DULA 4QATA 3LY9A 1OV4A 1U2RA 3QOYA 4MGIR 4PAWA 1EHIA 4HG2A 5HJEA 4RV4A 1GPUA 2DH5A 1IVYA 2OXCA 3E48A 3HKEA 2EKPA 3AB3A 3D3JA 4DMFA 1DQSA 5COQA 1QIHA 3PC3A 2VTDA 1VP9A 3KYDB 5FL3A 4C5CA 4Y6PA 4DREA 4WY8A 2IW3A 3CWCA 4IHQA 3V9PA 1A2QA 1YMQA 3QUAA 4DDKA 2ZJ4A 5LQCA 3ADOA 1E94E 1VJ1A 4D9GA 4B3RB 5E8JA 4CMJA 4KBFA 4W9NC 1UJCA 3HNPA 1EHCA 5NLLA 4OHZA 4D9NA 4F60A 4ENSA 2FZEA 1X42A 3ZWWA 1RAGA 2H1CA 3K0CA 4G9BA 1K0UA 3EXG1 4MTCA 2XMPA 3GLGA 3Q5DA 3DH0A 2X14A 2PUHA 4FDTA 1YZ3A 3T8YA 1OBOA 2I4TA 2MSKA 3O3OB 4U8GA 4IIDA 1TEHA 3AI7A 4JCOA 3QX7A 5TGZA 1J5XA 1R8QA 3IBSA 1SBNE 4EKYA 4XW2A 2XRZA 4J3NA 4GYYA 2JEYA 2OXFA 5ICEA 4C7BA 2QN3A 2AA3A 3I9FA 3L8EA 5EIBD 4J49A 2WWYA 4U7WA 5CW2A 1EE1A 2CF6A 1B8OA 2NO6A 1H8EA 2OV2A 3I42A 2F1HA 5AOVA 1Z7GA 4DSOA 4P3XA 521PA 5KTTA 1E4EA 2P9FA 1F0YA 2CNWD 2QD1A 1NZJA 2VRWA 3MTAA 1ORRA 3ONWA 2MSCB 2DKFA 3HDQA 2QL6A 3R76A 4LXHA 2A9QA 3MFQA 2WYHA 4IO0A 3VO2A 5G3YA 3GRYA 4B4WA 1BA3A 3N2NA 5LQSA 2H2FA 4MP8A 2Y1LA 4YONB 3ZHSA 1ZA1A 4MVJD 3U37A 2WF9A 3K5PA 1FFCA 4XCXA 3AVPA 2GBFA 1EX7A 1LNZA 2W22A 2X6RA 3KQSA 4X3CA 1LZKA 2J0SA 4ADSG 1O89A 1SG6A 3R6TA 3EGDA 4NICA 2GBIA 3ELWA 4M6WB 4ZOCA 1GP2A 4BASA 4BLRA 4QHYA 1EZ1A 1N9ZA 2IEBA 3HN2A 2E5WA 1H0SA 4V0LA 3WTCA 1UMCA 3TCNA 4M53A 3ZNOA 1IIRA 4BATA 1EFUA 2R3SA 1JILA 1PNRA 2ERYA 3RAJA 1RTTA 4XCQA 5ALHA 3OSUA 2GYYA 3NTRA 3OHPA 5TVGA 1KDRA 3WJAA 1DGQA 1DJMA 1SVIA 3WZ2A 5G53C 1R0YA 2LIVA 1Y33E 3A6ZA 4UUOA 5K01A 4J0CA 2ODNA 1IQUA 1R4AA 2YRWA 1LPNA 2CWWA 1RPAA 2DFLA 2YBEA 2XMRA 1B93A 1U9YA 3AG6A 1XDGA 3BSYA 3ABOB 4CLOB 4IUYA 4UXHA 4Z4FA 1X8LA 3BCUA 1QP4A 4INPA 4MICA 2PMBA 4MCHA 3LGXA 3FOBA 4RSHA 3FPBA 1L5LA 3Q6MA 3GQBA 1NGSA 5EQTA 4K0KB 3DLIA 1F1JA 1WW8A 3BHNA 5EKTA 1BD4A 3HCAA 1TTPB 3KAQA 5CK4A 1C0KA 1E98A 1OKKA 1VXOA 1NVVQ 1MZPA 3ZIAD 2FPSA 3CEAA 3PGJA 2ZS7A 4DV6B 3ZCTA 4K0RA 2OXIA 1UWCA 4L75A 4MHTA 3OE5A 4N0QA 3FFXA 2GPSA 2PT6A 5DSXA 1J0AA 3AIOA 4UPDA 1M0WA 1SHZA 2BDEA 4Q9DA 4RPLA 3BD6A 5DXAA 3RU9A 4CDNA 2Y2UA 4H31A 2G5TA 3KU1A 2PEYA 1M5RA 3OH8A 4JC4A 4BFUA 4IR7A 3GLHE 4URYR 4EY7A 3A25A 3JQ8B 4IV5A 3EDCA 1FU7A 3O5AA 2P6UA 5IPFA 2P9GA 2ZTVA 1ZR2A 2VNSA 1Q0UA 1T2EA 1M1ZA 1U0TA 1KJ8A 1Y8RB 2YN2A 2QUAA 3L8CA 3IKMB 4DWOA 1NJ2A 2WHYA 5BWNA 2JVKA 5COAA 4AM8A 1QRTA 3TNFA 5JPCA 4GYWA 1ENZA 4IVRA 2KE5A 4CV3A 1RKBA 3ZK7A 3TVDA 4XIIA 1KK0A 1WOYA 4FX2A 1E9EA 2CFCA 1XD8A 3UTCA 3UY4A 5A5VA 4XVHA 4DMUB 4WJLA 5MDHA 1UMDA 3AQIA 5CPFA 2F1IA 5F1OA 3CSDA 1J8QA 1ZEJA 1KJYA 1W48A 2DSNA 2EJTA 3CEHA 3JR3A 4OJTA 3RCBA 5T4HA 3B3JA 3U3JA 3OF3A 1GTVA 2HK9A 1JYSA 5CNMA 4IDNA 3CXUA 1TGVA 2RI1A 3A4MA 3N75A 3V7FA 2IZ0A 5DV9A 4YUAA 4RHXA 1IN6A 1O96A 4G5HA 4NV3A 1UKCA 2AI3A 1GTG1 5LA6F 5CX1A 1J2UA 3HCBA 1H0HA 2AB0A 3CE9A 2PBFA 2ZROA 4HWOA 4DDMA 1C3EA 1DEOA 1RQNA 1U0OC 3PQ7A 1KS2A 1EAMA 4Q21A 4CQMA 3TOVA 4JI5B 1QGZA 2QTGA 4KXWA 1LLFA 1FDTA 1LNQA 3QVOA 5KNBA 4AY3A 4WLFA 3HYNA 5EJMA 2PLFA 1LPSA 2BBWA 1BQEA 2QNIA 3C7TA 4UTPA 2ZR9A 4BU1A 1JPVA 2W6PA 1HR0B 3N59A 2IS2A 4NV1A 3FNQA 4MRMB 4ETIA 3THWA 3QP9A 4NP6A 1N9GA 3FRIA 3SC3A 5K6TA 3LDHA 4I55F 5ANRB 1IY2A 3DCIA 5BN5A 4DR6B 5AJTA 2Q99A 1K2WA 2IELA 3OZXA 3UUFA 1C9JA 3RU3A 2QL7A 3RNLA 4K9DA 4KAFA 2EHJA 5AJYA 5SY4A 3U3MA 1ZJJA 2OLEA 5JMTA 3EMDA 1H65A 4YMVA 2HLPA 4JJIA 2NP6A 4B5KA 1Z88A 4ZK2A 5D1NA 4D99A 4HD8A 4PYIA 1NQUA 1SZDA 3R09A 3CZ4A 4BVAA 3EGDB 5CIYA 2X4DA 2HPZA 5GM2A 4Y1EA 3TRIA 1PX2A 3FZGA 3ZIAA 1S2IA 4J0DA 1MTZA 1SCNE 2BZ0A 4K9NA 3DR5A 4L02A 5EI5A 1QFSA 4AMZA 3S2EA 5JASA 3VYVA 2WF6A 2Q5LA 1LSUA 1Z0JA 1ZVQA 4Y2SA 1COWA 4S1TA 2RK6A 4M0LA 4PTYA 4FWBA 1CUUA 3EGEA 2H8KA 1L5SA 3CM0A 4GM0A 2IYEA 3ISVA 1FMCA 2P2GA 1UJMA 3ECAA 5KU1A 4OLHA 4QQRA 1AUXA 5FI3A 4ESVA 2A1TS 3CF4G 1ICIA 2HL6A 3OAAD 4YGYA 3ZLUA 4TV8B 4D9JA 4EX6A 4Z4QA 1ST2A 1Q16A 2A8YA 4HDRB 4BMZA 4KWTA 1NTOA 2X9GA 4URXR 3TW6A 2XKKA 1P3JA 2BR4A 2QTVA 2FUNB 4C22A 3PXBA 1E6EA 1FTYA 1H0RA 1SURA 4C2TA 1DRKA 4DA9A 1J23A 1K1EA 4JP3A 3KZNA 3RFVA 4RJLA 2BMWA 5DTIA 2RHBA 2BDTA 4GGPA 1YBHA 4GC5A 4RZXA 1WCXA 1R9NA 3EXHB 4XD2A 2YC4C 4UOEA 2AN9A 5K8UA 1JJ7A 2ONCA 3NRJA 3A1NA 3GBVA 4FS3A 1GZSA 5REQA 1M74A 1JQKA 4KI7A 5B12A 2A0KA 5BR1A 4TVBA 2XGMA 5IG2A 1U02A 3DM5A 1ZJWA 3PTLA 2Q8PA 2G8LA 1DUVG 3NBFA 3UBTA 3L8DA 3KS9A 1CW2B 1T5DX 3JD0A 4UNSA 3N8NA 5KDDA 2H4YA 3L43A 5DLDA 4G0PA 4NU5A 1LI5A 1PJ3A 3A6LA 3RBZA 1ZNZA 3ND9A 2ACKA 5SZHB 4R71A 4D82A 1CR2A 1G18A 4NS4A 3R6GA 1T6YA 1MIOA 3HJTA 2AX3A 4XRRA 2J5XA 2OMKA 3AOEA 3FCSB 3I09A 4BVFA 5CFZA 2Q3JA 4CM7A 1IWBB 1WTCA 1SC9A 1EKXA 1GV1A 2AG5A 2CD7A 6Q21A 3W2HA 1KEEA 1I7NA 3U7GA 2BMFA 3NRBA 4UHHA 1A5TA 2QJWA 4Q9AA 3JR7A 1FJHA 1TCUA 2LNDA 1PJBA 4X41A 5SY9A 4B4UA 2A7QA 3AESA 5LMNB 3H17A 2QTCA 3KB2A 3ZW8A 3M70A 4WZBA 1ELOA 3WB0A 1W36C 2JJ1A 2XVYA 3R3UA 4OO3A 4PYMA 2EHDA 1NM5A 3JYQA 3F8TA 1AKYA 3D7NA 4HZUB 3QKWA 4ZKEA 1TEXA 4G09A 3STHA 3PD7A 5I7AA 4H7IA 4L08A 1PR0A 1EVLA 1P5FA 4XYMA 2TMDA 5CBPA 4D26A 2ACEA 1VHJA 4JH0A 1CUHA 2FSVA 1S96A 2A0XA 4TMZA 1N6OA 4LTMA 3K70D 1R0SA 2CLEB 1JVBA 2FZVA 1OZAA 2F3TA 3HGQA 2P5YA 2Z30A 2ZSAA 4XX1A 2AG1A 2XR1A 4YJ2B 1EFVB 2YV5A 5ILOA 4B80A 5BQ3A 1YL6A 4CQMB 1E8DA 5FPHA 3W5IA 4GLJA 4F91B 3P0JA 1R8XA 5JXWA 1LWOA 2ZFUA 2YNMD 4NBWA 4PAGA 1EJ2A 5K0GA 2CXXA 3HXPA 1YXMA 2FMTA 1LPBB 1T4BA 3GRAA 5JFGA 3EGXB 3DKVA 1W5TA 2AL7A 2YW9A 3FMGA 1W30A 2QMHA 4PX3A 2BEVB 4KX5A 1N5IA 3CNNA 3QITA 3U7HB 3OZ7A 4R9VA 2WFAA 4XQ9A 3CX6A 5BOSA 2Q5FA 4IFBA 1MVNA 1F2UB 4P36A 1NUAA 2QK4A 4RIHA 5FWYB 5MHTA 1E5QA 1NVFA 2L42A 4B32A 5IJ9A 4XSHA 1KNXA 4JT9A 2ECFA 2FU5C 2VJOA 2XMCA 2Y0PA 3L8HA 4DR5B 3VNQA 2E6UX 4EA7A 1VDZA 1L5GB 3TTWA 1D0IA 4QTZA 5TMBA 4CIVA 3NWJA 4GLBA 1KEPA 1N6PA 2VATA 1NVTA 1NWHA 1VL2A 4KO8A 1Y89A 2HCJB 3AEKB 1UIRA 4NYMQ 1G7RA 4R3WA 5BQXA 2G0NA 1I4LD 3A58B 4OHCA 4DLLA 1VTKA 4HY3A 2BGLA 2HBQA 3G6KA 5CEJA 3HPQA 3D8BA 4MJ3A 3QKUA 4EKDA 3U6KA 3LAWA 1EAYA 2P6OA 3OMXA 1E79D 4K05A 4KJXA 5IULC 4LJRA 4HEA6 4KR2A 3C3KA 5EZYA 3D2LA 2IEDA 3DE2X 3RVRA 1Z4NA 2I34A 2CXNA 4IKOA 1F6WA 4B6SA 3B7PA 2R68A 4Q15A 2GFQA 4RY9A 4FXOA 1QPBA 1T1SA 4HDKA 1JR4A 3VOBA 1L1QA 4LXYA 1XA4A 1DHRA 3AF2A 4R4JA 3F7NA 4IZHA 3TLYA 2JAQA 2AOTA 2I7XA 3EWNA 5JQGB 2GEBA 1BCSA 1IBSA 4MROA 5JATA 2RBEA 1JZTA 4HDRA 4ZKDA 1L4UA 4Y6GB 1E5XA 2OYSA 1Z35A 5ALSA 2G28A 5IH3A 3ROMA 5IVHA 1KFKB 4K40A 4E6PA 1IN8A 1DG1G 3IPYA 3DDCA 4G8CA 1I4OA 3MFYA 4Q7JB 2EG9A 1Z8NA 1A9TA 2P3QA 1Z3IX 4WXPA 3WVNA 4EQ6B 5H68A 3PHHA 2K7FA 4U0KA 1E1NA 2W71A 1UAGA 1E3SA 2XW6A 1F14A 3IVRA 1EBBA 3NHFA 3KVYA 4FZ5A 3QW4B 2CKMA 1UCFA 2BVNA 4GZLA 4GS5A 4P4TA 4S0XA 4TWAA 4ZT3A 3FAZA 4NULA 3NJRA 1VQ1A 3I73A 3TEJA 4B6PA 1H23A 4YUWA 1HRKA 1DJNA 2HADA 5K20A 3F5QA 3SBDA 4AMBA 1Z18A 3SQMA 1KI1A 4URFA 2V8BA 3FMIA 1DCMA 1FUIA 3GN1A 2C2MA 2XMQA 5IAJA 1DXQA 1RYYA 4ZANA 3BREA 1V43A 2AF3C 3BDVA 2HWYA 4P34A 4EO9A 5IZ4A 3NUQA 4RHEA 2M6LA 2JC3A 4HEA1 3OC0A 2IX9A 4FDVA 4C2BA 4F4UA 1EWVA 1RMQA 4PC2A 1MC8A 4ES6A 5K0LA 2LDXA 1EJBA 3LXXA 1Y9DA 3JD2A 4G1FA 2QSJA 4N12A 1NVXQ 3U9LA 3DJFA 1T43A 2FXIA 1ODFA 5C8DA 4FONA 1J0BA 3RNOA 1ADJA 1RADA 1MOQA 3ZQ6A 3KR1A 5AJZA 1AJEA 4AKTA 4WZBB 1T6BY 1PEDA 5LP6F 3BS4A 3DF9A 5H4GA 1NP7A 3RIHA 1IAVA 1KIFA 2YCLA 2G76A 1CUVA 3EFOA 4ZOLA 1M73E 4P31A 1Z0DA 1V7ZA 1ECPA 4ZVQA 2JLXA 3FKQA 2GFHA 1F3LA 4BNYA 4C78A 1TOAA 4TLDA 4Z2AA 5C5EA 1IEXA 1L5VA 3QE9Y 5KYVA 3MOSA 4QQKA 3LY7A 3HZHA 1Q92A 3DYBA 5B1SA 3UJNA 2QVBA 3ZD6A 3MSXA 3A3NA 3WNVA 2AN5A 2FX2A 2V1XA 3MJFA 5K4AA 2IC5A 4EUHA 4KQIA 1MXHA 4KQJA 1J99A 3KUDA 4RA9A 3UYKA 5B3JC 1FZTA 3C6KA 1T10A 1NONA 3QVWA 3ZHCA 4RZIA 2JCYA 1BIFA 4IGKA 4NBLA 1FY2A 5JO0A 3L0OA 2YJ5A 3BAFA 5TQ0A 1P4JA 3PS9A 2A5LA 3VPFA 2V7VA 1Z5VA 1TLFA 1JDUA 4BLOA 2GESA 2O7QA 3K71B 3DTNA 1IULA 6YASA 3RT9A 1XNRB 4JWTA 3GZNA 5GY7A 2WOJA 3KLMX 4OLFA 1P9OA 1F51E 2VN8A 3D5QA 2CUKA 3L05A 3WQQA 5I8WA 4DCPA 1IJKA 3T61A 5AESA 2YH2A 1Q15A 1VL5A 3ILVA 1O7JA 1TYZA 3W0LB 5CA0F 1UWKA 1FYXA 1NBWB 1BYUA 3EWAA 1F2UA 2CVZA 2N47A 4CCAA 2B8EA 3CNOA 3M4JA 4REMA 4KV9A 1IU9A 2HQSA 3ZHUA 5LP6B 4XLTA 4EDHA 2C7QA 3BF7A 4F3KA 4FYHA 1GPWB 2FW9A 1WPGA 1AGNA 1HL7A 2AJ8A 2DPYA 5C2JB 4L6IA 5EJ5A 1WO8A 1ULTA 2ZRDA 1UBMS 1T8PA 1L5HB 3CUWA 4J0QA 3LJKA 3GJZA 2Q21A 4PG7A 1IBLB 4OGKA 1Q77A 4CEIB 1U63A 1SCDA 2IIVA 4Q93A 3RT7A 2O3QA 2F17A 1PR2A 1QLHA 3FSJX 1S01A 2ZLBA 4XDYA 3TS1A 3Q7IA 3WZLA 1PJZA 2QX6A 5G1OA 2G1UA 2B5OA 3U3OA 3VSDA 4JBXA 2NZXA 1RXEA 4XIJA 3GLVA 1SB8A 3IJRA 3QVTA 2D6FA 1X8JA 3BD9A 3FZQA 3CX4A 1R8JA 4PHTA 3IIIA 5BVHA 1G5IA 2VDWB 3RUEA 2RCNA 3GPLA 1G5QA 1M6HA 1FUUA 3FOCA 1APBA 3A6GA 1M8PA 4HH4A 3ZQJA 8GPBA 2V4UA 3FTFA 3BAZA 1U7OA 1RPTA 2NSYA 5AVJA 4MMXB 2PGIA 2GUGA 3IPCA 4Q1AA 2NT3A 4IQ8A 5KNBD 1H2FA 4H0CA 4KLCA 1T4DA 1GL7A 1YA4A 2YNMA 1F60A 4GNRA 2C7RA 1GM5A 5E3HA 4QQ8A 4EQ6A 1C1HA 3Q85A 4W5JA 3GU3A 3DR3A 2G4CA 2HXSA 2J30A 3A28A 2W7TA 3ZWQA 4CMEC 5HUQA 1DV2A 1D09A 3PFBA 5KINB 1YOVB 1ZM3A 4UNIA 3QRWA 4EHNA 3NTUA 5KNCH 4JVMA 4QOFA 2XYQA 3WWZA 2I3BA 4ONEA 3IALA 4HUQA 1NXPA 4GZ5A 3UWPA 5BXQC 3G0HA 5JD5A 1LBTA 4TLLB 1YZUA 2IV7A 4YPVA 3U44A 2CXHA 4FD2A 1XVAA 5M29A 3RLIA 1G66A 3DBHA 4RX1A 4U2CA 2Q0HA 3WKDA 1EXDA 2HB6A 1P7VA 4HDNA 2G1PA 1B8VA 2J5KA 3MT0A 4YACA 1OTXA 2X77A 5T6BA 2P67A 1A4RA 3BH0A 2GXQA 3WGLA <