2WJQA

Nanc porin structure in hexagonal crystal form.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
215
structure length
205
Chain Sequence
ATLDVRGGYRSGSHAYETRLKVSEGWQNGWWASMESNTWNTINDVQVEVNYAIKLDDQWTVRPGMLTHFSSNGTRYGPYVKLSWDATKDLNFGIRYRYDWKAYRQQDLSGDMSRDNVHRWDGYVTYHINSDFTFAWQTTLYSKQNDYRYANHKKWATENAFVLQYHMTPDITPYIEYDYLDRQGVYNGRDNLSENSYRIGVSFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nanc Crystal Structure, a Model for Outer Membrane Channels of the Acidic Sugar-Specific Kdgm Porin Family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords PROBABLE N-ACETYLNEURAMINIC ACID OUTER MEMBRANE CHANNEL PROT
total genus 60
structure length 205
sequence length 215
ec nomenclature
pdb deposition date 2009-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2wjqA00
4CTDA 2WJRA 2X9KA 4PR7A 2WVPA 2IWWA 2F1CX 2WJQA 2JQYA 2IWVA 4FQEA
chains in the Genus database with same CATH superfamily
2N2MA 4KR4A 4D5UA 3LK42 4RL9A 2WVPA 2IWWA 1MM4A 3GP6A 2LHFA 5AFUK 5DL5A 3PGSA 1ZHXA 4AUIA 4C4VA 4AKRB 4GCQA 1HXXA 4C69X 1H6S1 2XTRA 5GV0A 3RBHA 2MHLA 2N2LA 2WJQA 4LSFA 4C00A 1T1LA 2W80C 1S5LO 4U9CA 4GCSA 3SYSA 2M07A 3BRZA 3DA3A 4C4VB 1YS5A 4LSIA 4O4UA 3TZGA 2R4PA 5TISO 3NSGA 3AAEB 4FZMA 4O3XB 5DL8A 3AA0B 2WJRA 1ZHZA 1GFPA 3WI4A 2AXTO 4O3ZA 3VY9X 3O0EA 2K0LA 3PQUA 3FYXA 4AZLA 4AYID 3EMNX 4RJWA 3UU2A 2J1NA 2Y0KA 2PRNA 5AFUL 2XMXA 5H2FO 1OPFA 3A0HO 3A0BO 2F1CX 3BRYA 1HXUA 4O3WA 4AYDC 4AFKA 1OSMA 4E1SA 8PRNA 1BH3A 2GE4A 2MNHA 2KZ7B 3DWNA 5PRNA 4K3BA 2X9KA 4PR7A 1MM5A 3A2SX 2XE5A 3LK2A 1G90A 3POUA 1HXTA 4O4XA 2XTQA 4UB8O 4E1TA 4KRAA 5GTIO 4BUMX 2W81C 4FQEA 4FZLA 4D64A 1GFNA 4GHBA 4Z3TA 5GTHO 2O4VA 4G75A 1MPFA 1ZHTA 4G76A 4N74A 4N75A 5G38A 3T0SA 4GCPA 1PRNA 4O49A 3HWBA 4PJ0O 5JDPA 2IWVA 3V8UA 1Q9FA 3POXA 5FVNA 5G39A 3BS0A 4LSEA 4XNKA 1Q9GA 3PORA 4FSOA 3DA4A 3VZWX 2ERVA 2KZ7A 5T5FA 3AA7A 3AA1A 5ADXK 2R4OA 2FGRA 4JFBA 4AYEC 7PRNA 3VZUX 1ORMA 3G7GA 5G3AA 3SY7A 1PHOA 2XE3A 1QJ9A 3VZTX 4PUXA 5KAFO 5KAIO 3UAQA 4FRXA 3KZIO 5E79O 3PRNA 2Y7SA 3T24A 2J4UP 1ZHWA 4FOZA 1E54A 2R89A 1THQA 2YNKA 3UPGA 3AAAA 3PF1A 3AAEA 3HW9A 4N59A 3AAAB 4B61A 4FUVA 4AKRA 4AYMC 3JCUO 2R88A 1GFMA 4N58A 3QRCA 1BXWA 1BT9A 3K19A 3LK3B 5B66O 3AA1B 3NJTA 3LK41 4FMSA 3KVDD 2KDYA 3C5OA 4JCHA 5G26A 2M06A 4FSPA 3T20A 3SY9A 3AA7B 4K3CA 1QJ8A 2KXPA 3QRAA 3SYBA 3SZDA 3DWOX 3LK2B 2KC0A 3HOLA 5DL7A 2Y0LA 1IZNA 3PGUA 1GFQA 4UB6O 6PRNA 3PGRA 4QQ1A 4FZNA 3AA6A 2JMMA 4FRTA 3HOEA 4FESA 4IL6O 4AYNA 1P4TA 3AA6B 3POQA 2R4LA 3VE2A 1ZHYA 5ADXL 5B5EO 2K4TA 4CTDA 2OMFA 1QJPA 4KR8A 2R4NA 4F4BA 4AKMA 2X27X 2R8AA 2ZLDA 2LFUA 2ODJA 5DL6A 3SZVA 2KXPB 2F1VA 3VY8X 2JQYA 4D65A 3VE1A 1GFOA 3AA0A 4FT6A 2Y0HA 2XE1A 5IYUA 2YPVA 4O3YA 3DZMA 2XG6A 2ZFGA 2PORA 4RJXA 1IZNB 2FGQX 3JTYA 3PQSA 2Y2XA 4RLBA 4RLCA 5D5DA 1T16A 3WI5A 5EE2A 2F1TA 4GF4A 4LSHA 4XNLA 2XE2A 3WU2O 3LK3A 2QTKA
chains in the Genus database with same CATH topology
4CTDA 2WJRA 2X9KA 4PR7A 2WVPA 2IWWA 2F1CX 2WJQA 2JQYA 2IWVA 4FQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CTD A;  2WJR A;  2X9K A;  4PR7 A;  2WVP A;  2IWW A;  2F1C X;  2WJQ A;  2JQY A;  2IWV A;  4FQE A; 
#chains in the Genus database with same CATH topology
 2N2M A;  4KR4 A;  4D5U A;  3LK4 2;  4RL9 A;  2WVP A;  2IWW A;  1MM4 A;  3GP6 A;  2LHF A;  5AFU K;  5DL5 A;  3PGS A;  1ZHX A;  4AUI A;  4C4V A;  4AKR B;  4GCQ A;  1HXX A;  4C69 X;  1H6S 1;  2XTR A;  5GV0 A;  3RBH A;  2MHL A;  2N2L A;  2WJQ A;  4LSF A;  4C00 A;  1T1L A;  2W80 C;  1S5L O;  4U9C A;  4GCS A;  3SYS A;  2M07 A;  3BRZ A;  3DA3 A;  4C4V B;  1YS5 A;  4LSI A;  4O4U A;  3TZG A;  2R4P A;  5TIS O;  3NSG A;  3AAE B;  4FZM A;  4O3X B;  5DL8 A;  3AA0 B;  2WJR A;  1ZHZ A;  1GFP A;  3WI4 A;  2AXT O;  4O3Z A;  3VY9 X;  3O0E A;  2K0L A;  3PQU A;  3FYX A;  4AZL A;  4AYI D;  3EMN X;  4RJW A;  3UU2 A;  2J1N A;  2Y0K A;  2PRN A;  5AFU L;  2XMX A;  5H2F O;  1OPF A;  3A0H O;  3A0B O;  2F1C X;  3BRY A;  1HXU A;  4O3W A;  4AYD C;  4AFK A;  1OSM A;  4E1S A;  8PRN A;  1BH3 A;  2GE4 A;  2MNH A;  2KZ7 B;  3DWN A;  5PRN A;  4K3B A;  2X9K A;  4PR7 A;  1MM5 A;  3A2S X;  2XE5 A;  3LK2 A;  1G90 A;  3POU A;  1HXT A;  4O4X A;  2XTQ A;  4UB8 O;  4E1T A;  4KRA A;  5GTI O;  4BUM X;  2W81 C;  4FQE A;  4FZL A;  4D64 A;  1GFN A;  4GHB A;  4Z3T A;  5GTH O;  2O4V A;  4G75 A;  1MPF A;  1ZHT A;  4G76 A;  4N74 A;  4N75 A;  5G38 A;  3T0S A;  4GCP A;  1PRN A;  4O49 A;  3HWB A;  4PJ0 O;  5JDP A;  2IWV A;  3V8U A;  1Q9F A;  3POX A;  5FVN A;  5G39 A;  3BS0 A;  4LSE A;  4XNK A;  1Q9G A;  3POR A;  4FSO A;  3DA4 A;  3VZW X;  2ERV A;  2KZ7 A;  5T5F A;  3AA7 A;  3AA1 A;  5ADX K;  2R4O A;  2FGR A;  4JFB A;  4AYE C;  7PRN A;  3VZU X;  1ORM A;  3G7G A;  5G3A A;  3SY7 A;  1PHO A;  2XE3 A;  1QJ9 A;  3VZT X;  4PUX A;  5KAF O;  5KAI O;  3UAQ A;  4FRX A;  3KZI O;  5E79 O;  3PRN A;  2Y7S A;  3T24 A;  2J4U P;  1ZHW A;  4FOZ A;  1E54 A;  2R89 A;  1THQ A;  2YNK A;  3UPG A;  3AAA A;  3PF1 A;  3AAE A;  3HW9 A;  4N59 A;  3AAA B;  4B61 A;  4FUV A;  4AKR A;  4AYM C;  3JCU O;  2R88 A;  1GFM A;  4N58 A;  3QRC A;  1BXW A;  1BT9 A;  3K19 A;  3LK3 B;  5B66 O;  3AA1 B;  3NJT A;  3LK4 1;  4FMS A;  3KVD D;  2KDY A;  3C5O A;  4JCH A;  5G26 A;  2M06 A;  4FSP A;  3T20 A;  3SY9 A;  3AA7 B;  4K3C A;  1QJ8 A;  2KXP A;  3QRA A;  3SYB A;  3SZD A;  3DWO X;  3LK2 B;  2KC0 A;  3HOL A;  5DL7 A;  2Y0L A;  1IZN A;  3PGU A;  1GFQ A;  4UB6 O;  6PRN A;  3PGR A;  4QQ1 A;  4FZN A;  3AA6 A;  2JMM A;  4FRT A;  3HOE A;  4FES A;  4IL6 O;  4AYN A;  1P4T A;  3AA6 B;  3POQ A;  2R4L A;  3VE2 A;  1ZHY A;  5ADX L;  5B5E O;  2K4T A;  4CTD A;  2OMF A;  1QJP A;  4KR8 A;  2R4N A;  4F4B A;  4AKM A;  2X27 X;  2R8A A;  2ZLD A;  2LFU A;  2ODJ A;  5DL6 A;  3SZV A;  2KXP B;  2F1V A;  3VY8 X;  2JQY A;  4D65 A;  3VE1 A;  1GFO A;  3AA0 A;  4FT6 A;  2Y0H A;  2XE1 A;  5IYU A;  2YPV A;  4O3Y A;  3DZM A;  2XG6 A;  2ZFG A;  2POR A;  4RJX A;  1IZN B;  2FGQ X;  3JTY A;  3PQS A;  2Y2X A;  4RLB A;  4RLC A;  5D5D A;  1T16 A;  3WI5 A;  5EE2 A;  2F1T A;  4GF4 A;  4LSH A;  4XNL A;  2XE2 A;  3WU2 O;  3LK3 A;  2QTK A; 
#chains in the Genus database with same CATH homology
 4CTD A;  2WJR A;  2X9K A;  4PR7 A;  2WVP A;  2IWW A;  2F1C X;  2WJQ A;  2JQY A;  2IWV A;  4FQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...