2WJQA

Nanc porin structure in hexagonal crystal form.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
215
structure length
205
Chain Sequence
b'ATLDVRGGYRSGSHAYETRLKVSEGWQNGWWASMESNTWNTINDVQVEVNYAIKLDDQWTVRPGMLTHFSSNGTRYGPYVKLSWDATKDLNFGIRYRYDWKAYRQQDLSGDMSRDNVHRWDGYVTYHINSDFTFAWQTTLYSKQNDYRYANHKKWATENAFVLQYHMTPDITPYIEYDYLDRQGVYNGRDNLSENSYRIGVSFKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE N-ACETYLNEURAMINIC ACID OUTER MEMBRANE CHANNEL PROT
publication title Nanc Crystal Structure, a Model for Outer Membrane Channels of the Acidic Sugar-Specific Kdgm Porin Family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 60
structure length 205
sequence length 215
ec nomenclature
pdb deposition date 2009-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2wjqA00
2IWVA 2WJQA 4PR7A 2WVPA 2X9KA 4CTDA 2JQYA 2WJRA 4FQEA 2F1CX 2IWWA
chains in the Genus database with same CATH superfamily
4B61A 1GFMA 3AA0B 1ZHXA 4PR7A 1PHOA 3DWNA 4N59A 4C4VB 5DL7A 4GCPA 5DL6A 4O3XB 2FGRA 2IWVA 3AA1A 3LK3A 4RLCA 4AYDC 3C5OA 3PF1A 4AKRB 4FRXA 2XE5A 2PRNA 1PRNA 2WJQA 3AAEA 4O3ZA 1HXTA 4JCHA 2R4OA 4FT6A 1H6S1 2MHLA 1MM5A 2AXTO 8PRNA 4N58A 4RJWA 4LSIA 2XG6A 2JMMA 2XMXA 3AA7A 3KZIO 2K4TA 4FZLA 1ZHTA 3HW9A 3O0EA 4GCSA 2WVPA 5D5DA 5AFUK 5GV0A 1GFPA 1ZHYA 3DWOX 1G90A 3PORA 2IWWA 4O4XA 2R4NA 2XE2A 3VY8X 3VE1A 3POXA 1GFQA 4PUXA 5IYUA 2YPVA 4FSOA 4AYEC 3QRAA 2Y2XA 3AAAA 4LSFA 4AYNA 3POQA 3HOEA 4D5UA 3SZDA 3NSGA 2KZ7B 3VY9X 5G39A 2LHFA 3BS0A 4AYID 2QTKA 2R4LA 5PRNA 2PORA 1MPFA 2ODJA 1IZNA 4GHBA 3SY7A 4CTDA 3VZWX 4AFKA 4GF4A 2F1VA 3DZMA 4D64A 1ZHZA 3LK2A 5G26A 4FSPA 1OSMA 1ZHWA 3PGRA 4XNKA 5DL5A 3T24A 3WI5A 3AA1B 4F4BA 3SYSA 3AA6A 3LK41 3LK3B 5H2FO 4U9CA 2M06A 4XNLA 4AYMC 2N2MA 1MM4A 5TISO 4G75A 3LK2B 2Y7SA 3HWBA 3PQUA 5GTIO 5AFUL 5G38A 5B5EO 3T20A 1OPFA 4E1SA 3SY9A 3AAEB 5KAFO 2ZFGA 1T1LA 1P4TA 4FUVA 3K19A 1ORMA 4LSEA 4C00A 4D65A 4PJ0O 3AA7B 4UB6O 3BRZA 3PGUA 4FZNA 1T16A 1YS5A 3PGSA 5GTHO 4KR4A 4N74A 3WI4A 3DA4A 2R8AA 2XTRA 4C69X 3WU2O 3EMNX 4BUMX 1GFOA 3POUA 3RBHA 6PRNA 4RL9A 2LFUA 1E54A 1THQA 2WJRA 3JCUO 3AAAB 4O3YA 3UU2A 5E79O 3VZUX 1HXUA 2Y0HA 2J4UP 4FZMA 3VE2A 1GFNA 2O4VA 2XE1A 2R4PA 4UB8O 5T5FA 1Q9GA 4FQEA 2ZLDA 2F1TA 3AA0A 3GP6A 1IZNB 4O3WA 2X27X 4FMSA 4AKMA 5ADXK 1S5LO 1BXWA 5ADXL 4K3CA 5G3AA 3JTYA 3PRNA 4C4VA 2R88A 2X9KA 4RLBA 2W81C 3SZVA 2JQYA 5FVNA 3KVDD 5B66O 4O4UA 1QJ9A 3A0BO 3AA6B 4FOZA 4N75A 2W80C 7PRNA 2K0LA 3T0SA 5JDPA 3UPGA 4JFBA 2MNHA 4AKRA 3VZTX 2KXPA 4LSHA 3PQSA 4K3BA 3DA3A 3A0HO 1QJ8A 2XTQA 3BRYA 3G7GA 5KAIO 1BH3A 2R89A 2N2LA 3UAQA 3HOLA 4KRAA 1BT9A 2FGQX 2KDYA 2KXPB 4O49A 4G76A 2YNKA 5EE2A 3V8UA 1HXXA 2KC0A 1Q9FA 4KR8A 4AZLA 3SYBA 2J1NA 4E1TA 3NJTA 1QJPA 3FYXA 4FRTA 4Z3TA 4AUIA 2M07A 3A2SX 2Y0KA 4FESA 2GE4A 3QRCA 2OMFA 4IL6O 3LK42 4RJXA 2XE3A 4QQ1A 4GCQA 2Y0LA 2KZ7A 2F1CX 2ERVA 5DL8A 3TZGA
chains in the Genus database with same CATH topology
2IWVA 2WJQA 4PR7A 2WVPA 2X9KA 4CTDA 2JQYA 2WJRA 4FQEA 2F1CX 2IWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWV A;  2WJQ A;  4PR7 A;  2WVP A;  2X9K A;  4CTD A;  2JQY A;  2WJR A;  4FQE A;  2F1C X;  2IWW A; 
#chains in the Genus database with same CATH topology
 4B61 A;  1GFM A;  3AA0 B;  1ZHX A;  4PR7 A;  1PHO A;  3DWN A;  4N59 A;  4C4V B;  5DL7 A;  4GCP A;  5DL6 A;  4O3X B;  2FGR A;  2IWV A;  3AA1 A;  3LK3 A;  4RLC A;  4AYD C;  3C5O A;  3PF1 A;  4AKR B;  4FRX A;  2XE5 A;  2PRN A;  1PRN A;  2WJQ A;  3AAE A;  4O3Z A;  1HXT A;  4JCH A;  2R4O A;  4FT6 A;  1H6S 1;  2MHL A;  1MM5 A;  2AXT O;  8PRN A;  4N58 A;  4RJW A;  4LSI A;  2XG6 A;  2JMM A;  2XMX A;  3AA7 A;  3KZI O;  2K4T A;  4FZL A;  1ZHT A;  3HW9 A;  3O0E A;  4GCS A;  2WVP A;  5D5D A;  5AFU K;  5GV0 A;  1GFP A;  1ZHY A;  3DWO X;  1G90 A;  3POR A;  2IWW A;  4O4X A;  2R4N A;  2XE2 A;  3VY8 X;  3VE1 A;  3POX A;  1GFQ A;  4PUX A;  5IYU A;  2YPV A;  4FSO A;  4AYE C;  3QRA A;  2Y2X A;  3AAA A;  4LSF A;  4AYN A;  3POQ A;  3HOE A;  4D5U A;  3SZD A;  3NSG A;  2KZ7 B;  3VY9 X;  5G39 A;  2LHF A;  3BS0 A;  4AYI D;  2QTK A;  2R4L A;  5PRN A;  2POR A;  1MPF A;  2ODJ A;  1IZN A;  4GHB A;  3SY7 A;  4CTD A;  3VZW X;  4AFK A;  4GF4 A;  2F1V A;  3DZM A;  4D64 A;  1ZHZ A;  3LK2 A;  5G26 A;  4FSP A;  1OSM A;  1ZHW A;  3PGR A;  4XNK A;  5DL5 A;  3T24 A;  3WI5 A;  3AA1 B;  4F4B A;  3SYS A;  3AA6 A;  3LK4 1;  3LK3 B;  5H2F O;  4U9C A;  2M06 A;  4XNL A;  4AYM C;  2N2M A;  1MM4 A;  5TIS O;  4G75 A;  3LK2 B;  2Y7S A;  3HWB A;  3PQU A;  5GTI O;  5AFU L;  5G38 A;  5B5E O;  3T20 A;  1OPF A;  4E1S A;  3SY9 A;  3AAE B;  5KAF O;  2ZFG A;  1T1L A;  1P4T A;  4FUV A;  3K19 A;  1ORM A;  4LSE A;  4C00 A;  4D65 A;  4PJ0 O;  3AA7 B;  4UB6 O;  3BRZ A;  3PGU A;  4FZN A;  1T16 A;  1YS5 A;  3PGS A;  5GTH O;  4KR4 A;  4N74 A;  3WI4 A;  3DA4 A;  2R8A A;  2XTR A;  4C69 X;  3WU2 O;  3EMN X;  4BUM X;  1GFO A;  3POU A;  3RBH A;  6PRN A;  4RL9 A;  2LFU A;  1E54 A;  1THQ A;  2WJR A;  3JCU O;  3AAA B;  4O3Y A;  3UU2 A;  5E79 O;  3VZU X;  1HXU A;  2Y0H A;  2J4U P;  4FZM A;  3VE2 A;  1GFN A;  2O4V A;  2XE1 A;  2R4P A;  4UB8 O;  5T5F A;  1Q9G A;  4FQE A;  2ZLD A;  2F1T A;  3AA0 A;  3GP6 A;  1IZN B;  4O3W A;  2X27 X;  4FMS A;  4AKM A;  5ADX K;  1S5L O;  1BXW A;  5ADX L;  4K3C A;  5G3A A;  3JTY A;  3PRN A;  4C4V A;  2R88 A;  2X9K A;  4RLB A;  2W81 C;  3SZV A;  2JQY A;  5FVN A;  3KVD D;  5B66 O;  4O4U A;  1QJ9 A;  3A0B O;  3AA6 B;  4FOZ A;  4N75 A;  2W80 C;  7PRN A;  2K0L A;  3T0S A;  5JDP A;  3UPG A;  4JFB A;  2MNH A;  4AKR A;  3VZT X;  2KXP A;  4LSH A;  3PQS A;  4K3B A;  3DA3 A;  3A0H O;  1QJ8 A;  2XTQ A;  3BRY A;  3G7G A;  5KAI O;  1BH3 A;  2R89 A;  2N2L A;  3UAQ A;  3HOL A;  4KRA A;  1BT9 A;  2FGQ X;  2KDY A;  2KXP B;  4O49 A;  4G76 A;  2YNK A;  5EE2 A;  3V8U A;  1HXX A;  2KC0 A;  1Q9F A;  4KR8 A;  4AZL A;  3SYB A;  2J1N A;  4E1T A;  3NJT A;  1QJP A;  3FYX A;  4FRT A;  4Z3T A;  4AUI A;  2M07 A;  3A2S X;  2Y0K A;  4FES A;  2GE4 A;  3QRC A;  2OMF A;  4IL6 O;  3LK4 2;  4RJX A;  2XE3 A;  4QQ1 A;  4GCQ A;  2Y0L A;  2KZ7 A;  2F1C X;  2ERV A;  5DL8 A;  3TZG A; 
#chains in the Genus database with same CATH homology
 2IWV A;  2WJQ A;  4PR7 A;  2WVP A;  2X9K A;  4CTD A;  2JQY A;  2WJR A;  4FQE A;  2F1C X;  2IWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...