2WJWA

Crystal structure of the human ionotropic glutamate receptor glur2 atd region at 1.8 a resolution
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
374
structure length
368
Chain Sequence
NSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALTYDAVQVMTEAFRNLRKQRIEIGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Glur2 Amino-Terminal Domain Provides Insights Into the Architecture and Assembly of Ionotropic Glutamate Receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GLUTAMATE RECEPTOR 2
total genus 122
structure length 368
sequence length 374
ec nomenclature
pdb deposition date 2009-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wjwA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wjwA01
4XAQA 3SM9A 4MR7B 4F06A 1FFGA 3GA5A 3EQ2A 5DKFA 2L19A 4YLEA 2QVCA 1EWVA 2HSGA 3OO1A 5TQ2B 2R48A 4YWHA 4F8JA 1NXPA 4RK0A 5IEBA 4G0PA 3T95A 3KYJB 2BGGA 1CHNA 3B2NA 3RVRA 2FEKA 2E4UA 2HJ9A 1U04A 5DLEA 1NY5A 1Z18A 3SAJA 1LJLA 2FMFA 3QLVC 1Z12A 1GCGA 2CD7A 3I42A 4RDCA 3FFXA 1RNLA 3BILA 1FFSA 2CWDA 3CRNA 3MA0A 2FMHA 1C0EA 2JRLA 3JS5A 1FQWA 4JB0A 1R8JA 4MLDA 5TQ2A 4RK4A 5DTEA 1Y1LA 3R0JA 2P9HA 1JBEA 4G0OA 4RY9A 2FEPA 3KLNA 5CNKA 3OO0A 1QP4A 1QP7A 3N0RA 3RH0A 1URPA 4WZZA 1E6MA 3TD9A 1ZY2A 1WETA 1QPZA 1ABEA 4FB4A 4PE5B 4N03A 3RVKA 1Z16A 4Z4EA 2WMYA 4RV5A 4N0PA 1U2QA 4Z4GA 3IP9A 4YCSA 3CKMA 3ROTA 1A04A 4KK4A 2E4VA 4YRZA 3H1EA 3LUJA 2WB4A 3LUAA 3EJWA 3FFTA 5IUKC 4UHKA 3RVSA 3CLKA 2HQOA 4ZMSA 4EYGA 2PMCA 2O20A 1ZESA 3SG0A 4KPYA 3HXMA 2WRZA 4KQ9A 2L2QA 4WWHA 5KC8A 1MIHA 1QQBA 4NCAA 4RKQA 3OLVA 1VKRA 9ABPA 2MSLA 1QNLA 1EAYA 3C6QA 5EWMA 5T3YA 2MSWA 2FXIA 3HS3A 3VNAA 2PLNA 1QO0A 3MYYA 1C4WA 1SD5A 3CFYA 3EAFA 4MGEA 5JS2A 4Z4CA 1ZH4A 5BR1A 3DZDA 5DCLA 5TPWA 1YTUA 2AYXA 5TQJA 3GL9A 3N75A 3Q9SA 4H60A 1PNRA 1VRVA 1AB6A 2R25B 1DCMA 3H75A 4S04A 2ID9A 1CEYA 3F7NA 3F73A 1JHZA 3N6VA 3Q7SA 2YHAA 3UUGA 4KQCA 4YV7A 1P8AA 2HPHA 1DG9A 3HEBA 4MQEA 2M1ZA 4EY3A 3DGFC 5FBHA 1BAPA 1JDPA 1U2PA 1GCAA 4OTZA 4RK1A 3CG0A 3SQNA 3JVDA 5PNTA 3H1GA 3TX6A 3EDCA 3T38A 3JPWA 2A9QA 2PL9A 1PNTA 2PUDA 2PE5A 1SXGA 3CZ5A 5BQ3A 1DP4A 3KHTA 4RSMA 3QLVA 2B4AA 2IPLA 3C3MA 4MPTA 1D2AA 2H3HA 2NT3A 4YGXB 5E3JA 3RVPA 1NXVA 3OMWA 2JB9A 1QQAA 1Z26A 2FKAA 4EUKA 4JP1A 4Q6BA 3T6KA 2JVIA 4LDAA 3HVRA 4EVQA 4KREA 4RU1A 2HQRA 2PL1A 3IPCA 3Q7RA 2W42A 1YMUA 1E6KA 5FWYB 4ZPJA 5EWMB 4B09A 2WJAA 2A9PA 4IMIB 4RY8A 3TB6A 5TQ0A 3HUUA 3P9YA 1JX6A 3NNSA 2FSPA 1YVUA 4MS1B 2QR3A 3OQMA 1Z2EA 4YR7A 1QMPA 1W9HA 3HSYA 4OG2A 3N0WA 1RZRA 4MRMB 3IP6A 3CG4A 3OLZA 3QX9A 4D74A 2JVJA 1YS7A 4P98A 3HDGA 3O1JC 4G0YA 3K9CA 1TMYA 3LUGA 5C5EA 5GOTA 5FWYA 5JS1A 3IDOA 2QW1A 6CHYA 1D1PA 2FVYA 4JA2A 2PJUA 4H3KB 1D1QA 1NTRA 4M88A 2VUIB 1SXIA 5KQMA 4QPJC 3CS3A 4HNRA 3KLOA 2E4YA 2QV0A 1BDIA 1NXXA 1RPJA 3GBPA 2FQWA 1RZRD 3HO1A 1LBIA 4RXMA 3VNBA 3A10A 6ABPA 3NNDA 3HZHA 4H3HB 2FN8A 1PUXA 1Z17A 3HM9A 3CTPA 4O5AA 4LRQA 1MVOA 2PUAA 5KI6A 4EYKA 4Q7EA 1GUBA 3OM0A 3KS9A 3LOPA 2RDMA 1EWKA 4LE2A 4PZ0A 4NCBA 5CHYA 4QICA 1YK1A 1JYEA 2IPAB 4XXHA 4Z4HA 3I45A 1KRXA 2JK1A 4FE4A 4RK5A 4Z9AA 4EYOA 4W5OA 4MR9A 1F4VA 3BRQA 5EWLB 4W5QA 2OQRA 2PUBA 1DCFA 5HKOA 2QZJA 5B3JA 3JPYA 1P6QA 3I5AA 4QYWA 3BRSA 3OLWA 5IC5A 4Z99A 4JAVC 5HQJA 4WUTA 4Y9TA 4IRXA 4XASA 1MAVA 3GT7A 3OLYA 2MYUA 2TMYA 3QEMB 1Z13A 3M9XA 4LX8A 5IEJA 5FBKA 1JLKA 4W5RA 3EULA 4EYQA 3H5IA 3RVJA 2L17A 2MYTA 4D6XA 2HQBA 2F8SA 3Q7TA 4EGSA 3OQOA 1JF8A 4HNSA 4MR7A 3L6UA 5FWXB 2ID7A 3HV2A 1OXKB 5KQLA 3RVLA 5IX8A 1TLFA 3HJFA 1SXHA 1DBWA 1ISSA 4E7OA 3Q41A 3CHYA 2FLWA 1GUDA 2FMIA 5IUNC 3H6GA 1ZGZA 1LBHA 1PEYA 2QSJA 3GV0A 3LMKA 4G0QA 4KZKA 3QLUA 3RQIA 2E4XA 4G0XA 4HYEA 1VLZA 1EHCA 5KC9A 1Z2DA 3KYIB 3NBMA 3OQNA 1JFSA 1H9CA 2XDYA 3QLUC 3IPAA 3LTEA 3MMNA 2E4WA 3JY6A 1EFAA 4KVFA 4ZMRA 2VK2A 1IIBA 2ZAYA 3E3MA 3ILYA 3DGEC 3O75A 3QLTA 4G97A 2Q5CA 5GQSA 4W5NA 4PICA 3BREA 2J48A 2IDMA 4O1HA 4ZJPA 1FSPA 3H6HA 2GWRA 1APBA 2DRIA 3H5VA 3GRCA 4JOQA 4DADA 3O1IC 1BDJA 2IOYA 1A2OA 1DBQA 4N0QA 4DN6A 5KQGA 2F8TA 5DGCA 2NT4A 1ABFA 3O2SB 3BBLA 5TPZD 4N76A 2VYCA 4RWEA 3RVMA 3LUDA 1ISRA 4JASB 5IBQA 2FQYA 5BRJA 1NXWA 4YS6A 1USKA 5B3JC 4RKRA 2IYNA 3EGCA 1YIOA 3FGZA 2VUHB 3KKEA 3MM4A 1DC7A 4XFKA 5TQ0B 1F51E 3LKBA 1GLGA 1NXSA 4LE0A 4MS4B 1U0SY 5JNRA 4Z4FA 3NHMA 5CNJA 4Z0NA 3F6CA 4OLAA 2QXYA 2N9UA 3H5TA 5TPZA 3GBVA 1BDHA 3CU5A 4G0ZA 5ABPA 1K66A 2FN9A 4P1ZA 5HSGA 1ZITA 3K4HA 4MRMA 2JBAB 1M2FA 4MS3A 4RS3A 2PUFA 5IUJC 3KJXA 4Z9BA 5EWJB 2FEWB 4KK3A 1S8NA 1BA2A 4KMRA 3UK0A 1PHRA 3O21A 3OM1A 3FFWA 5TPWB 5C5CA 4ETIA 3KCNA 2JVKA 3O2JA 4HNQA 4OBBA 1NATA 3NHZA 1I3CA 1RXEA 1JL3A 2FW0A 4D6YA 4EVSA 3D02A 1ZH2A 2PAFA 5IULC 3A3KA 1KGSA 4Z4IA 3SNKA 4GPAA 2NUBA 1DCKA 4LDZA 4TLMB 3DLHA 4MQFB 4MR8A 4PEVA 4KNYA 3C97A 5TE9A 1L5YA 4IMJB 4RK6A 3TO5A 5EWJA 4YP9A 2IPNA 4ETNA 1FFWA 2I6FA 4DQDA 3GWGA 3URMA 1NXOA 2QVGA 4RXTA 3NNNA 1XHFA 3A0RB 1JFVA 3GYBA 3I09A 4MAAA 2V0NA 3QEKA 3H5OA 3HCWA 2OENG 3N53A 3Q15C 3MF4A 1DZ3A 1VPWA 4NQRA 1XWWA 2PUCA 4ML3A 4MS4A 2P4UA 3HK2A 3QELB 3RVOA 3CZCA 3O74A 3TMYA 3O1HB 5EWLA 1XHEA 2X7XA 3H5WA 1KMIY 3G1WA 1USIA 2R47A 3JTEA 3UKJA 3LUKA 2GX6A 1E2BA 1M5UA 4MR8B 4N47A 3H5LA 4WXMA 4F12A 2GI4A 3KG2A 5JNWA 5JNUA 1K68A 4JB2A 2NZVG 1P6UA 3KTOA 3HUTA 3F6PA 2PUGA 3JVIA 5KWSA 1Z15A 1LJUA 1Z25A 1M5TA 5ED4A 1ZVVA 1DC8A 2WJWA 2FQXA 4NICA 3T8YA 1PEAA 2RJNA 3IP5A 2GBPA 7ABPA 2CHFA 3LFTA 4XARA 1SRRA 1ZDMA 4PYRA 3MQ4A 2JCGA 3QELA 1U8TA 1DRKA 2LP4Y 1HEYA 3S99A 4MS1A 3DLBA 1D4ZA 1QP0A 2LUOA 4IF4A 2NZUG 1DJMA 3CNBA 3FDFA 4MQFA 3E61A 1TVMA 4FE7A 3IP7A 1JYFA 1L5ZA 1CYEA 1ZHHA 1AB5A 3RVNA 4ZYLA 1BVHA 1P2FA 2GKGA 5T7BA 4CBVA 5KQPA 1JH9A 4OATA 3FMVA 4RK7A 4WT7A 1B00A 1OXBB 3O2QB 3HDVA 4L4UA 2CHEA 1DRJA 1YK0A 2RJOA 4NV3A 3DBIA 4Q6WA 3MIZA 4F3TA 1T34A 4TLLB 3N8IA 2MSKA 2B1JA 1M2EA 2WWVD 2FMKA 3SY8A 8ABPA 1JDNA 1ZAYA 3H1FA 4W5TA 3RVQA 3W9SA 1RXIA 3EODA 2PUEA 4N41A 3OLXA 3ROFA 1LK0A 3C3KA 5CNMA 2PKXA 4GNRA 4MQEB 1J56A 1D5WA 2LPMA 1A0OA 5D2CA 1NXTA 2H0AA 5HM6A 4KRFA 1DBPA 4EVRA 5JNVA 1TM2A 2KYRA 4TMYA 4TN5A 4KFCA 4UHJA 1ZGGA 1MB0A 3N0XA 4RZSA 2LBPA 3KSMA 5JNTA 4MYRA 1JWLA 3LUHA 4S05A 3QK7A 4IGAA 4MR9B 4XLTA 2E4ZA 2FTKE 5BRAA 1QO0D 1QKKA 3C3WA 4RY0A 3M6MD 2A9RA 1MB3A 5I4CA 2M98A 2L18A 4E7PA 1W25A 1ZN2A 3L49A 2AYZA 3EQZA 1JFTA 1EWTA 3LUCA 1YS6A 4L85A 1UDRA 2LIVA 2WY2D 4MLCA 3OMXA 4G0MA 3LUFA 3QX8A 4WXEA 4YO7A 3M9WA 2FLKA 3QEMA 2IKSA 5F64A 3A0UA 4RXUA 3ILHA 4O1IA 4IILA 4ETMA 5CNIA 2A9OA 1KRWA 2IPMA 2RGYA 3D8UA 2JBAA 4MS3B 1TJYA 1YMVA 2MYNA 5JNSA 5FWXA 2ZWMA 4F11A 4LE1A 2QU7A 4KV7A 4OLBA 3G85A 2R4QA 4QYMA 2MYPA 3LKVA 4LZLA 4G86A 1E6LA 1USGA 2YHBA
chains in the Genus database with same CATH superfamily
4XAQA 1HFKA 5JBNA 2GF9A 1XP5A 2FZGA 2WLSA 1SXQA 5E1BA 3V32A 5E1MA 2A5DA 2WP8J 2XQIA 3E22A 1C7RA 3Q3JB 4OP1A 3G8AA 1DAKA 4F8JA 3DZBA 2C9CA 4A91A 1Y5IA 3QTTA 3DV9A 5IEBA 3AVQA 1Z5OA 2ZWIA 4G0PA 5KJ1A 1QG4A 2Y1OA 2DBZA 1WJGA 4MYUA 5CPBA 1K2WA 2CNLA 3WYAA 2HCJB 3BA1A 3LYUA 2PGOA 3W6ZA 3KSBC 1OT3A 1BE1A 1KH3A 2CD9A 3A04A 1C0KA 3JYQA 4MZXA 4V0OA 1RRCA 2A3NA 3V2HA 2KBEA 4GPBA 2EW8A 4LGYA 3PRJA 4K2HA 1ZGHA 3LX5A 3UMBA 3GH3A 3IMKA 3V55A 2ZVQX 3PRYA 1PX2A 1RADA 4FLFA 4RIIA 1E4YA 5DBHX 1U9IC 2CDCA 1OIWA 1M34E 2CBGA 1YBHA 2FZWA 2PUWA 1BRMA 3AP3A 4HKTA 2YICA 1AKWA 3GJ8A 2BZGA 3V33A 4RTPA 1VE6A 4MOWA 3DKVA 2X8JB 5I7EA 4PHFA 5LB4A 3D54D 1L1FA 3KQNA 5CNKA 4V24A 2OBXA 1V48A 1KEZA 3PHIA 5E0KB 3FE2A 2VJQA 5JAHA 4JOCA 2CUKA 3SD7A 1EFRA 4KODA 3THWB 1FPQA 4OQZA 1XQYA 2R00C 1D1SA 1HK7A 2WFZA 2X6QA 2Q4BA 1M7GA 3ET5A 1EIZA 1PL8A 2ZIXB 2R8EA 1F8FA 2UVPB 2ZKLA 3SHFA 3T9AA 3TNYA 1JQ5A 3CEAA 2WJVA 5EGNA 1UMCA 3GHYA 4PTZA 2G28A 3QOYA 5C4IA 1CNFA 1DKLA 3K09C 1Y5NA 3LY9A 3ZYCA 2I2CA 3QF4B 3QXHA 2X13A 3DFMA 3SG0A 4FJ1A 4BJ6A 1YBFA 2I4RA 4B0OA 1BOOA 3HNOA 1L8XA 2BFPA 2NWQA 3MGBA 5EWMA 1JG7A 1QZXA 3OWHA 5JS7A 3K94A 3DEKA 4LYJA 2UVQA 1C4WA 4B5KA 1JR3A 4AWXA 1QCZA 3H86A 3TQRA 1DG3A 1S2MA 5TQJA 2GD2A 3C1OA 4E2ZA 2AUTA 1GNLA 3M6UA 4UZSA 2EP7A 1A50B 2JS7A 2IP1A 4KDFA 1WXDA 2GBGA 3ZDDA 1JDTA 5B2ZA 3F7NA 4M98A 4YV7A 2NUPA 4LBYA 4CGZA 2I3AA 2WQ7A 1RHRA 1T0BA 5EZQA 1P7WA 4IGFA 5BNTA 4FIDA 5JZSA 2XD9A 1Y81A 4YJGA 3WGOA 4DCPA 1UPCA 4RF4A 4BCDA 1ZK0A 1YS2X 3ZVRA 3VUFA 4DUPA 3D2LA 4F04A 1R16A 5CFPA 4HNTA 1EXWA 3G2NA 2GK7A 3Q8KA 5K0FA 5HMMA 4Q7MB 3L7NA 3G5MA 3JPWA 2KMLA 3BCRA 3R6GA 5L7TA 1YKGA 2I4TA 3NWJA 3V8EA 4YY3B 3MT9A 2X2EA 4HH4A 2YL2A 2ZYGA 5EN4A 2V54A 1GN8A 5ITVA 3AWDA 5DYNA 1FK8A 2GM9A 4Q3OA 4Q9LA 1KWGA 5EZ6B 4S1OA 3BWMA 3C3MA 2E87A 2CZGA 3GT0A 3RVPA 3ZCPA 3RROA 1GY8A 5L3RA 3ZY5A 4D9JA 2WB2A 1LNSA 4K05A 2ZI6A 4FGUA 4MKFA 5HJ7A 1WB6A 3IPCA 1C9EA 3NV7A 1KZ1A 2ZITA 4ISBA 4ND1A 4ZV7A 1G6HA 1Z8NA 1T3SA 2EGHA 1Q77A 4J07A 1U31A 1ZU4A 4TKMA 3U48A 3H8SA 3TB6A 2ZS8A 5A6SB 1JA9A 3RLFA 4TSKA 4WINA 4WA8A 3UH1A 3U80A 2O5EA 1ZNXA 1N9KA 4I5FA 4BN0A 1M76A 1E4EB 4J7XA 5JJCA 1GD1O 3E0QA 4OHRA 1L5HA 3WQRA 2D4AA 3PQFA 1QMGA 1ZNYA 1ZWLA 4C7JA 5E2BA 1D2RA 3UKDA 1UH5A 3IALA 5IN4A 3KT8A 2BE7A 3VYVA 3AHEA 2SKDA 1GDDA 2W2MA 5FPPA 3OFJA 3USCS 5AI9A 1VTKA 4FMDF 4O3FA 4CLHA 1D3AA 2GHQA 2BIFA 2YXNA 4HUTA 1WULS 2JK0A 4JJZA 1UT5A 3ISVA 3QFFA 5DK6A 4FOOA 5ALMA 4M88A 1UBTS 1SXIA 3IP3A 1HQDA 2C9YA 3CS3A 3Q6NA 4CL2A 1HE4A 4YGYA 3RCBA 3EQ8A 2OYSA 2EGGA 2KI5A 3LU1A 4CQLB 2ZRKA 4ED9A 1NNEA 2UV8A 1BDIA 1KU6A 3ZH2A 3K0AA 1W96A 1AE1A 2P69A 1QOZA 5DP2A 5TB5A 4BO4A 4DLRA 1Q17A 1ZBQA 3Q12A 2XOKA 4CNBA 4AYTA 1MXFA 3QV2A 4LF8B 4NJOA 3TD2A 1G66A 1W4LA 2DPLA 5CVCA 1DEXA 3CSDA 2C4VA 3T3PB 3KS9A 3ONNA 3NMUF 1ATZA 4UM7A 5CEJA 3DW3X 4EA8A 5I7HA 3AEQA 3LQKA 1RC0A 1R5NA 4BVGA 4QYTA 3IOBA 3A26A 4XWGA 1NYTA 2XWQA 4WXRA 1I1NA 1WKCA 3PPYA 4RQAA 5B6JA 2QT9A 3K8ZA 3N5CA 1C3EA 2PWBA 3GGCA 1LX6A 4FHCA 1HE3A 4UNQA 5B1IA 4EYOA 1GFWA 3QQ5A 2Z09A 4MR9A 1HLGA 3JZMA 4CMBA 2XV1A 1KYYA 1RCUA 1CR6A 3VSAA 4PSDA 2OQRA 1YQUA 2NW6A 1GQ2A 3P0JA 4NFLA 2RBEA 3RC2A 2XB8A 1Y7LA 2QZJA 1F2DA 3TGWA 4CEHA 1HNZB 4H15A 2H4XA 3SPXA 4JS0A 2WKPA 3DZJA 5KDLA 1CJUC 5MN5A 1Y37A 3OIYA 4N48A 1FPMA 2CLKB 5BSUA 2FUEA 1V71A 1CZOA 1XJ5A 1XL0A 2CLIB 1N2OA 3KR0A 1Z13A 5HDQA 3QPWA 1T4BA 1UC9A 1ZW1A 2A5YB 1H66A 1WUIS 1FMJA 2XVZA 3C5EA 4JBXA 4XB6B 3E82A 3TI9A 3EK2A 4DR5B 1KEPA 2PLRA 4C0AC 2NVWA 4DV1B 3DD5A 3VKWA 2PX8A 1V4NA 1CY0A 1PO7A 1TQDA 4CDMA 4EITA 5M3BA 8ATCA 1SB9A 2VJKA 1IB0A 2X0NA 4RIGA 3VHLB 4FEYA 1U7WA 3DZHA 4L78A 4TTSA 4FJ2A 5IJXA 3A25A 4AKSA 2FMIA 5LMZA 4OQNA 4J9UE 3UMSA 4P4SA 1X7ZB 4RTQA 2E4XA 1GQFA 3CEPB 3PHCA 5FR2A 4C21A 5JDIC 4XQ0A 2X5OA 1YIAA 2XRMA 3HGTA 2DQZA 1LI5A 1T9CA 1KZ4A 1A76A 2JHCA 1NKTA 1VI2A 3AXTA 3BZUA 3JYPA 1M83A 3GJ3A 3MCAA 3MWDB 2CYBA 3BMQB 1GSIA 1QC5A 2E4WA 2P2NA 3PX2A 4PZPA 4IIVA 4J8PA 3AHIA 1P4JA 2RKWA 3Q4GA 1E5DA 5ILOA 4MGIR 1NFQA 1N75A 1QGOA 2A86A 1KRHA 3JWGA 3PD1A 4PICA 4XR9A 1LK7A 4CHTA 2YKGA 4JI4B 2G9VA 1GRVA 1S3GA 2K2WA 3A3NA 4DADA 4Q9AA 2RGBA 5ANRB 4G9EA 4I6GA 1SHJA 1I5OA 4M1WA 1WTAA 2CMKA 3IKJA 1YR3A 3LH5A 5CM2Z 4DBLC 2GZDA 1IM8A 3O2SB 1FMTA 4ND7A 5G1OA 3V1TC 1ILEA 4L02A 2O8BA 4NBNA 5B4UA 1A4XA 1EHYA 3VR6D 3ETNA 1RR6A 2IYEA 3WZLA 4LF4B 1OFGA 3RBXA 2AKEA 4Z86A 3VPHA 4FYMA 1P1HA 4L8FA 2IYNA 2FR1A 1MMFB 1WSDA 2PRIA 2Y92A 4EZEA 2ZJYA 2CSXA 5CFLA 4OSPA 1SJ9A 5JLAA 1DC7A 5F51A 2OXEA 1GLGA 1X0VA 1YR6A 2XTJA 4Q9KA 1UCFA 2K87A 2QF7A 3NHMA 2D0PB 2ZJOA 4HGRA 4KVGA 3I8XA 4RPIA 2OOKA 4D45A 2HA0A 1PJ8A 1SOWA 1RYEA 5TPZA 4TTIA 5FD8A 1BDHA 4I5IA 1CZLA 3C6BA 3HKDB 4IFIA 2MSNA 4G1BA 4W7HA 2XUKA 3IAM6 5E6RB 4B4UA 2ID8A 3VZPA 3A9CA 3PR1A 4OKSA 4H1UA 4HP8A 4WLNA 1BA2A 5FLEX 3K92A 3FTCA 2UXCB 1IY8A 5JXIA 1XV5A 3ZGYA 3LFHA 2IWHA 4D9KA 2AWNA 3D81A 1COWA 4LXQA 1UAYA 4IWNA 5ILQA 4BZPA 3NIGB 4PIPA 1RYFA 1THMA 4AULA 4F5EA 1M67A 2GM5A 3UENA 1EFLA 1RXSA 2HBRA 5FLXA 4N7MA 2HV8A 4LQCA 2CMGA 4A8TA 5A4MS 3L5KA 4Z4IA 1CQJA 1DUVG 3WIVA 2CFOA 2ECKA 2NXWA 4CM6A 5BWBA 121PA 3FHTA 2BMAA 2QX8A 3PXXA 3WGYA 4MJ3A 3RAGA 5JMWA 1GADO 3LI2A 4WKCA 1Z7YA 3ZV6A 3LX8A 1FDSA 3GQBA 1COWD 2QTZA 1RDFA 1Z4JA 3HQ4O 4TKUB 4Q47A 3LXUX 2EJWA 1QANA 1C4OA 3A0RB 4CLXA 2JD1A 3FJYA 2RGUA 4M1SA 4RD4A 1WXFA 5LXTA 4UAJA 2ZTMA 3HRIA 4FFRA 1GT6A 3L7DA 2Q5FA 2QJRA 2YRFA 3LA6A 4YP0A 4RV9A 2QJFA 4HS9A 2X3FA 5DYYA 3VMFA 3VZQA 3O1HB 4FKMA 4ZEXA 2H1CA 2DTXA 2BHSA 3O03A 3SFTA 1BNCA 1CEQA 1EMDA 2CK3D 3B1JA 4MKHA 5FV7A 1DAIA 2NTEA 3PBKA 3U49A 1CYEA 3INGA 1GKYA 2ECQA 2ZCVA 4Q9NA 4JXJA 4TSFD 1K68A 4L5IA 3FFAA 4O0LA 5ARBA 4UD2A 2EW1A 4HNAB 2GNAA 3IOCA 3TIFA 1RLUA 1ULBA 3A3OA 3E7FA 3H19A 4RQUA 4U2FA 4B76A 3CUEF 5E7IA 1Z15A 2GUWA 1KDRA 1F9EA 1A8UA 1OBHA 2QOEA 4MAMA 4AZ0A 2R85A 1K63A 1XMJA 1MN6A 3K32A 1QR2A 3R6LA 2D7CA 1MJ5A 3E9EA 4F46A 1CZNA 4REQA 4WE3A 5K0SA 2FZVA 3KQOA 4F6CA 3R0ZA 1E3SA 4LRUA 4DZZA 3PXCX 4BFVA 1KQPA 1VPDA 5DLYA 4UU1A 2OFOA 4FCVA 2AOUA 4BYMA 3BH7A 1KHTA 4O4JB 1QG2A 1TYDE 5K5EA 2P6RA 2FP4B 5L95A 1ZO8A 3HPQA 1VKOA 3IP7A 8GPBA 3C98A 5LWQA 4WACA 4PG5A 3ODPA 4M83A 4FNMA 3ILXA 1OKKD 1U2ZA 2DLNA 1WF3A 3N0TA 3NM4A 3O4VA 4KO8A 4Y7DA 4ZQGA 1C1XA 2CGEA 1MLDA 3HP7A 1UBKS 2BFCA 3FMVA 1AZTA 4OLFA 1BXKA 3QXGA 4C04A 1LVHA 2F17A 2OHVA 4HDKB 1Y82A 2IOQA 3MUOA 3NBAA 4I7EA 5K3FB 1JV2B 4JMPA 4K9LA 3JQAB 1MT3A 3OCVA 1MB9A 1NT4A 4URWR 2QENA 1TT5B 3AUTA 4FYXA 3DBOB 2LKDA 3RVQA 3T5PA 1R27A 1YFZA 1CJVC 1TB4A 3S2FA 4BE7B 4C29A 3FR8A 1OFHA 2W22A 1J2UA 1QM5A 5D2CA 4R2IA 4P4NA 2JFHA 4AO7A 3CX7A 2WYUA 1R64A 5JNVA 1UQRA 3IIKA 1ECLA 4L0MA 4U3JA 1YB5A 5EJ6A 3Q72A 3WB9A 3M33A 1GR1A 1HLDA 4TZ6A 3A27A 4XLTA 4A6DA 1N1EA 3WK7A 1BCRB 2BOVA 1QO0D 1TYZA 2QKYA 3FTDA 3PIIA 4JENA 4JU9A 5SICE 2XKBA 5AKZA 3WGQA 1YTLA 4CM4A 3PL5A 2BISA 4DYHA 2V0GA 2VWPA 1WMEA 1UDCA 2B4KA 1F8YA 4BTEA 1SZPA 1JFTA 2ZIWB 3MTBA 2FWRA 3LVFO 3W34A 4BLPA 4TV8F 3VHXB 2QL7A 4R3NA 4HPWA 4Q3LA 3VYTB 4DLZA 1NYLA 1NIJA 1PZEA 5EP2A 3H5AA 1TTTA 2IPOA 3I8SA 1YZYA 3EX7C 5J59A 1N6PA 2QROA 2RHWA 1AHIA 4FK8A 4H17A 4IILA 3ZJUA 1MD9A 1SHUX 1Z4PX 1KRWA 4IHJA 1IMOA 1AU9A 1MC8A 1RQXA 5D6NA 4RORA 5KNCD 5KOJB 3TDMA 2XMPA 3F4KA 4V0SA 1VECA 1RQRA 3EFBA 3IPRA 4KV7A 3ZWBA 5K6RA 2W4QA 4WEOA 5EJ2A 2CFRA 3AM3A 1R0RE 2P9FA 3MCVA 4MQBA 4CQMB 3PNKA 1MFZA 4D9BA 5L4SA 1HF3A 1MDFA 1VL1A 1XQ6A 1ZIPA 2O1XA 2FUG6 2YHBA 3T3GA 4OQXA 1MA3A 1SQGA 5K20A 4NBWA 3WLJA 2DMRA 4Q3DA 2INGX 3GO4A 2Z4TA 3ERCA 1E94E 1A8QA 3E5HA 3G82C 1GU7A 3O0DA 4G85A 3DLIA 5FIUA 1OF1A 1DX6A 3A6DA 1DIAA 2B82A 5A0TA 1IONA 3MJEA 4HEA6 1Q0RA 1YU6A 3I9KA 3TTUA 3RVRA 4JC8A 2I22A 1FMCA 7MHTA 3DFZA 1PRYA 1SG0A 5DISB 3EWNA 4GL2A 4EHHA 3BD7A 5H5JA 5K8CA 1ZOIA 1JIKA 5ISMA 1A96A 2I8CA 3FOWA 1XZEA 2ORED 4QOSA 1XPOA 4IXWA 4R2LA 1RP7A 4I2NA 5FWYB 1R00A 4TTJA 2HA5A 2PX3A 1P0MA 3T4EA 4CN9A 2B8WA 5BORA 3D6NB 3VGPA 3ZZ0A 1I0ZA 2YV1A 4NBUA 8MHTA 2BMJA 4C4PA 3BGVA 5E3HA 3DG9A 2AFVA 2X2PA 3EPLA 1SCDA 2AOTB 2CYAA 2H5JA 4A6EA 1FRQA 1DCTA 2GBLA 4GMXA 4GSKA 5I4IA 3CCBA 5C53B 1CLEA 4BFLA 1Y42X 1NJFA 1L7VC 1JHVA 3Q7PA 2QAJA 4K6OA 5EKXA 2PLWA 1E6MA 1GCOA 4D9NA 5CDTA 4BAUA 2E37A 1NUQA 4NYMQ 3RFXA 4AX8A 1KJ9A 1RWVA 2AEEA 2P62A 3IHKA 1ZCZA 1U7TA 2VP6A 2OT3B 4NR0A 5KSOA 5CLIA 1M75A 1SBCA 4JKIA 1RE0A 4P81A 5DLDA 2GBFA 2MIIA 4DEXA 4JI8B 4N5IX 4OLJA 4U2KA 1I3LA 2Q62A 1EK2A 3N7TA 1YAJA 1Z7WA 4FDLA 1ZD4A 4MITA 1WQ1R 3C7KA 1EI9A 3FNHA 4DG5A 5EJ9A 3WA7A 1VZ3A 4KXWA 3R7SA 5DLPA 3FDZB 5AW2A 5AD1A 1O2DA 5C8ZA 1PF7E 3AVXA 3R7LA 2I6GA 2DKFA 2H2IA 2JF0A 3EXEB 2PV0A 3DDOA 4HDMB 4TTTS 3TNDA 3ZXUB 5BWOA 1Z0ZA 4BTLA 2UXBB 1E9FA 4X62B 1C9DB 3F3MA 1A9TA 4XJVA 5K99A 2MSWA 3Q8XB 5REQB 4RTJA 3KYCA 4RF2A 1E20A 4QREA 3LL4A 2XXAB 3CXUA 4QJBA 3UWPA 1IQUA 1XRJA 4OIFA 5EMNA 5DM2A 2Y93A 3KETA 5LMUB 2XZDA 5ARCA 3VTAA 3IIJA 1PL0A 1LPPA 3DNMA 3G2MA 1BJTA 3KVVA 2PMEA 5I7VA 3QKWA 5KPDA 4FN4A 2VT2A 1EX6A 1QH0A 1I6LA 1GGHA 3UZUA 3P2EA 5K0TA 4ZGGA 5G53C 3FI0A 4ZVNA 3F7TA 3FNBA 1VBMA 2C2MA 3IAS1 3SDBA 1E58A 1OUMA 4XM0A 2GZHA 3PYXA 1CRZA 2P2ZA 2ZRLA 4E1VA 3VKHA 2VDUE 1FOEB 2J67A 4HMPA 4M9ZA 3EWIA 3IKTA 1ISPA 5PNTA 3BGOS 3MFYA 3OE7D 3KKQA 5HILA 1C9KA 3CX4A 2J85A 3S6JA 1AKUA 2XE6A 1OLXA 1PNTA 1Z35A 3WX0A 2PUDA 4P7KA 2R7MA 3KVOA 1M3SA 4R3UC 4BQEA 3G8YA 1CQZA 1U2GC 2I03A 2PWAA 4MVWA 4I55A 4Z0TA 1P39A 2NT3A 1LH0A 4KOEC 3T9DA 2YXLA 1ADCA 2BDEA 5I6DA 4Q6BA 5KTPA 2X23A 1J1ZA 3L92A 2PL1A 3N2GA 2CMDA 1VPVA 4D81A 4BVAA 2XTNA 3P4YA 4BX9A 3DNPA 4HB0A 3F6YA 1ZGAA 2R5WA 1MDBA 1DBVO 2J4DA 1MW9X 4G4SP 4TOIA 3NV9A 3NDPA 4JCOA 3OQMA 3GPLA 2JLCA 3REOA 1T5LA 3VNQA 3PR2B 1Z2CA 1T5DX 1GQOA 3RPEA 5JSZB 2EFHB 5IVDA 4DY4A 3RNLA 2JH3A 1TAHA 4WK0B 4FYPA 5A3SA 2FDRA 4Z7JA 3UJ8A 3MS2A 4CKCB 1XA0A 1OGYA 2X9LA 4M9UA 1K8QA 1H8HD 3B89A 4JVMA 1HM5A 1KSGA 5LQUA 2WSSA 2DECA 1Z4OA 1YS7A 4U0KA 5F77A 4CTNA 1C30B 4G6ZA 1O57A 1X8XA 5NULA 3U7EB 1B0UA 2CJXA 4CKWA 1JMYA 1E1DA 1RAAA 2VXCA 3OP1A 1EGAA 3OZIA 4JA2A 4BMVA 3ICQB 1GAEO 3CKLA 5HGJA 3V8NA 3UK1A 1T1RA 3CMCO 3UQYS 3ANMA 1HH4A 2YQ4A 1Q7GA 5TC4A 3RREA 4FGLA 3ZK7A 1DKQA 1RPJA 4E09A 1EA7A 3RHFA 3WHLA 4BV9A 3HL0A 1RZRD 1YJBA 1LBIA 3HO1A 1JT2A 4AN4A 1O1YA 4B31A 4US2R 3HZHA 3ZE7A 2VAMA 3EBOA 2CLMB 4IIDA 3MIIA 4TZTA 4NU5A 1N7IA 1PT8A 1Y9ZA 2ROQA 1TUBA 4EYKA 1LBQA 3IR5A 1S02A 2C4MA 1UBSB 2PEZA 3N8HA 5MFZA 3TZKA 2Q6TA 2GJ4A 1FDUA 3DMPA 1SXPA 1AZWA 2EZUA 4JA0A 4DSAA 3S1AB 3FPGA 4F3CA 4ENRA 3VR3A 1RYHA 4KN8A 3LT1A 2J6HA 1WCYA 3CF6R 5MDHA 3GW8A 3NDBB 3IUYA 1WKBA 4NCXA 1OBCA 4QARA 2GAFA 1E59A 4BUZA 2RBKA 3JATA 3RJTA 4AY3A 4W5QA 3CKKA 3T4UA 5AVZA 4MW4A 2QR5A 3H2ZA 1WOMA 4QYWA 3STTA 4FBGA 4ZAVA 1YR9A 5BMOA 2P0YA 4XWYA 2BGJA 2WSIA 2NUAB 3I6ZA 3JQFC 4NMWA 3PXGA 2DY1A 3UA4A 1O7JA 5HQJA 3O8DA 1KMCA 1QLJA 3AM4A 4RD0A 5DI9A 2FOLA 1AQNA 3D0KA 4CUKA 3M49A 1VPTA 1Z37A 1C3LA 3OLYA 3UV3A 1XVVA 3AERA 3GPDG 4YAEA 2M6KA 3UCFA 1F2TB 3B9BA 1WUYA 2OGUA 2B8JA 4M6WB 4PWZA 3CX8A 5B58C 3WRYC 2PKWA 3LLCA 4GMDA 3KPJA 2VKQA 4D8VA 3CZ4A 1JF8A 4DIUA 1EZ1A 1E2DA 3KPWA 3BRWA 3R9IA 1DT5A 3ID6C 3W9BA 5K4GA 4HX2A 5LZ4A 4DB4A 3D7MA 1HYQA 3RVLA 1L4YA 4GXTA 1T5BA 4R1PA 1IN8A 1SC3A 1VSBA 1U0HC 1U4NA 1E79A 2QNIA 4X92A 2BAGA 4WJKB 2P1RA 4FDUA 3GA0A 2PBFA 4G0XA 4JT2A 2YFKA 5GVRA 1WSBA 5JH7F 2M32A 4DFDA 4FB5A 1ESEA 3MWGA 4FFSA 3K16A 4EWLA 4EL0A 1JQKA 1C0PA 1CULC 4JR0A 5BMVF 4I9HA 3QLUC 5AI0A 4Q1DA 3AYXB 1QOQB 3LTEA 5DRYA 4ACAA 4FZJA 5LR6A 4D8XA 2HDOA 4CIBA 2Z6QA 4LYDA 5T3UA 2AMVA 1X1TA 3O8OB 4I81A 3JD4A 3O75A 4G97A 4OMFG 4ZJYA 5A3JA 3I62A 2HWWA 3SC4A 4HRAA 1FDTA 1D03A 2GK4A 3S2UA 3EQ7A 2OFFA 4YC7A 3R20A 5A02A 1H9AA 5D87A 1UBMS 2GWRA 1Y33E 4RM3A 4C03A 3CF0A 1E8DA 3E2IA 1AGNA 5DP1A 3WAJA 5JSUA 4TYWA 1G1MA 4JOQA 3DFUA 5AICA 3WADA 3S8MA 4EHFA 3QIVA 3ES9A 4LYGA 4QULA 1NV8A 1XQ1A 3EF3A 4PCVA 2GEVA 2O54A 3TR0A 2IXBA 3C3EA 3ABIA 2AJ8A 4TWAA 4AZ3A 2C96A 3GC6A 1RJ9A 2PKCA 1KMHB 3CW9A 3WIEA 3RSZA 1CRPA 4X6XA 3WL4A 1OWMA 3MYRA 4DARA 3OEHA 3FH0A 5F1KA 1WRBA 2P2CA 3PTZA 4YAUA 4TLDA 3HKBB 1Z8DA 3KUDA 1CV2A 5HKBA 1G5FA 2JL1A 1I1HA 3MUFA 3OUUA 1NNI1 4G36A 2WZCA 1PP4A 1G9TA 5DF1A 2BBTA 2VRCD 1YT5A 2ZXFA 3FGOA 1R8XA 5K7SA 3ZWNA 4KLNA 4B0PA 3ASVA 4PHHA 3F6CA 2NGRA 4NOKA 5ICSA 2XMSA 2GF0A 1J07A 2OHXA 1I2CA 1KYWA 1VIAA 1Z82A 1GZ5A 2FP3A 3DM9B 3HP1A 1KQNA 4BGEA 2CCJA 1WMDA 3DYVA 4IGEA 4IUBS 4YP5A 2QRJA 2ALJA 3FPBA 4GQAA 4EI7A 2YYSA 4G1VA 4G0UA 4B33A 4YAFA 3LCVB 5JBQA 4I55F 4RS3A 5A03A 3KXKA 4LJ7A 3OVMA 4G25A 3H0CA 2HMYB 4BJ1A 5AW8A 1HFJA 2P77A 3FAKA 3TLMA 4B6QA 4H18A 2VNHA 2O7NA 2QX6A 2VNKA 2G1JA 2J9XB 3FKSA 4EVSA 1L8QA 4Y1RB 5IN5A 4DWVA 2GJ8A 1SXJA 3R5HA 4G8CA 3DDUA 1O5IA 2C3UA 3BHMA 1UOQA 1Q12A 3AVWA 1O95D 4Y2JA 5KX5A 2VIIA 4Q12A 2QPLA 4E3ZA 2Z6UA 4YJHA 1VSVA 4BC1A 3QZUA 4P83A 2C88A 5A5VA 1ML4A 3OQBA 1HT2E 1G8HA 3FB1A 3NH6A 1L5YA 2YN4A 1TMGE 2YY5A 1UF9A 2XUIA 3TO5A 4RHFA 4CLRB 1ORIA 4YUYA 2P2SA 2EHDA 1G16A 2R00A 2ZRGA 4K9DA 2W6ID 1FS5A 4HNAA 3D1JA 3ZE2B 3KCQA 3GLGA 2GCEA 2ZJ1A 4X3OA 1OHHA 4X1YA 2VP0A 2JLYA 5EJMA 2OCBA 1CZKA 3SEAA 4MKXA 2H4JA 4FFLA 3MD0A 4HDNB 1E99A 2JEYA 2RAPA 2NZWA 3KOWA 1ENYA 1FP1D 1OD6A 1DBRA 2VUSA 3LCMA 1KJYA 3G8CA 4ERNA 3W2GA 2CL7X 1XWWA 2NU9A 4OUDB 1N6OA 1J9GA 3AESA 3OIUA 4HX5A 3VO2A 5LNK1 3RVOA 4W1QA 5C51B 3R41A 3TMYA 1NZDA 3DDSA 1CJTC 2XYPA 3OICA 1USIA 3JTEA 4XUDA 2BP7A 2JGLA 3W5IA 3ZZMA 1ADJA 2B94A 1SUEA 2ZBUA 1KZHA 1LWOA 2V0CA 4YT4A 5ADVA 1ZCFA 2AFIE 5E8JA 1J7JA 4KE6A 1ARZA 2YMLA 4LC1A 5EIBC 2Y2UA 3VJLA 4RSRA 2EKLA 2ZSEA 5IAJA 1DI0A 2FWNA 1WBDA 3NDJA 2IHBA 3DAHA 3DV2A 2HMSA 1ZONA 3N2KA 2AR9A 1YC2A 2D2EA 4JGGA 4W7SA 4XFJA 3UJ6A 2WF7A 3FNRA 3S99A 4MB0A 1DRKA 3E9MA 5KNCH 3WLFA 1PVVA 2PVCA 3ZVMA 3A6GA 1L0BA 4ZJZA 4JODA 1EUDA 1OFTA 2FPLA 3CR3C 4RNDB 1PWZA 2CHGA 2OV8A 3OQVA 4DA0A 3EXHB 3FGPA 2FE4A 2RB4A 3P9NA 3L02A 4M8NE 4DIDA 4CM3A 4DUGD 5LSAA 2J3EA 4DWWA 1X70A 1A27A 1LDYA 2TS1A 3S5JA 1MABA 3AVUA 4R6XA 4BE9A 2YVUA 4WT7A 1AXRA 2P27A 1EVEA 3CE9A 3LX6A 3LQRA 1M2NA 1JALA 2V5VA 1KVSA 4YRTA 3O9ZA 2BDUA 4PQEA 5E3IA 3O47A 5J4HA 4MV6A 2CEAA 5ALLA 1EJBA 1VKJA 4M0UA 4HLUC 4WDQA 2AR0A 3V8RA 4J1SA 2HRBA 1P2SA 2FEMA 1W29A 3O91A 3M6IA 3U37A 1DHRA 1JAZA 4JXXA 2FE1A 2CE2X 2RIRA 1AUXA 1C3VA 1FUEA 2DUMA 2ZR7A 3ENVA 1WB4A 2JPDA 3HJUA 2JIBA 4JR2A 4HYTA 1HA3A 4TSFA 2AG1A 1QPBA 5HM6A 1L4BA 5LYYA 4UBOA 4KRFA 2YJ3A 3RTBA 5JISA 4Y9DA 2J6BA 1LQ2A 1SK8A 3K20A 1N2IA 5FADA 5BSVA 3JQ9A 3OT1A 2NU6B 2PIDA 4ILKA 4URYR 2XBMA 1NM5A 2CXNA 4BWFB 1F8UA 4F7WA 4QBHA 3I05A 3BX1A 2E4ZA 3BL8A 2W6NA 3AH8A 3IV6A 4GMGA 5JD5A 1YCHA 2ONYA 4J6EA 2BR3A 4IFBA 3WQQA 4DQUA 3V4VB 3IUQA 1GRNA 1ZC3A 1KP2A 4E7PA 4FFNA 1Y5LA 4BMDA 1JJFA 2AJLI 3QVXA 1KDPA 3L49A 3A4NA 4AUEA 1CRLA 3E9RA 3K70B 4UCQA 3NEJA 5A6VA 2C2OA 5EKDA 2J9FA 2P9CA 3MPUA 3QX8A 1EGQA 3V80A 2V7EA 4LVCA 3WB2A 3SC6A 5ALZA 1CB7A 4DYVA 4PX5A 4FYYA 2V4ZA 1JIUA 1ENOA 1EYZA 1J70A 1EKXA 5CYOA 1C7FA 3V7NA 3HWRA 1VXRA 3NVMB 3ITEA 2W11A 1UDAA 3IAEA 3LRXA 5SY4A 4LY0A 1LRKA 1L1RA 4LWOA 1FFDA 1SBHA 1KKMA 4YI5A 4ZOEA 1UWLA 1ZD2P 3MLAA 1F0NA 4RFSB 1Q0SA 4EUSA 1OI7A 3RAEC 4G86A 1PNVA 3QVUA 2WAYA 3TKYA 2Y1KA 1QFSA 2BY4A 1PWHA 2FRVA 1T15A 1UJ2A 1WM1A 2OC4A 4FT4A 5EQJB 1UBHS 2IP2A 4INPA 5HF9A 3EVCA 2C5LA 1E4OA 4D6PA 3D7LA 1X9HA 4B74A 4BNDA 3TBFA 4Z3KA 1RJWA 2HSGA 1ORRA 3AKEA 4JLSA 4ZO8A 4EG8A 2ECPA 4IVPA 3PPIA 4CMEC 3TW0A 3DDWA 3TRKA 4RK0A 1P31A 2OD7A 4QO8A 4F9FA 1AF7A 1CHNA 1Z0AA 2ZRBA 3GU3A 4ZOLF 4DDTA 3LOUA 2QRKA 1YZ3A 3G2LA 1N2GA 4BO6A 2D5BA 5CH5A 5MGNA 3DVQX 4IOLA 2PX2A 3GEDA 3ON5A 1IM2A 1DS6A 1K8YB 1XKTA 1ZYUA 3P0IA 4Z1MD 2XXAA 3SMQA 3AF5A 3I42A 3R6DA 4HAUA 1T8UA 1XXHA 5KCZA 4JSTA 3UGKA 1S2GA 4H35A 4KYUA 3QLJA 4IJUA 5CITA 1FFSA 2FZEA 4B43A 1DO8A 4L3WA 2WV7A 3E1KA 1ZA1A 2B0JA 3TR5A 3WHKA 3HUEA 3WGKA 2VUTA 2ORIA 4RGVA 1WX1A 5MF6A 2H17A 3NRJA 3RE1A 5DTEA 2G8LA 1XLWA 3NUZA 5DOZA 2BBWA 1NMEA 1DQZA 2J6CA 2HJRA 2YRXA 3SZRA 1FDRA 3KXLA 2UUBB 1DKPA 1KFKB 1UINA 2XEXA 2XGMA 3AOGA 4WN9B 2O0MA 4HN9A 3KQYA 1G5IA 2IEDA 4J1QA 4BIMA 4BY9E 4EF4A 1M5RA 3LZDA 4FDAA 1WPXA 3LBNA 5CB0A 3W2IA 4ACBA 2EF0A 4MH0R 4MMZB 1AO3A 3C7TA 1F5SA 5HOQA 5I8WA 3AG6A 3R9XA 2AZMA 4B3SB 2OEPA 2EP8A 4OXQA 5KYYA 4MHTA 1E3MA 2JAWA 4IQ0A 4M99A 3FJ1A 1CERA 2FWAA 4B48A 2CN1A 3EJWA 2HB6A 5DBEX 5FWAA 3T34A 4IM7A 4Z0PA 2ZJAA 4KI0A 2HYDA 1K7XB 2HO5A 1ZJYA 2PMCA 4Q48A 3EISA 5HK9A 3PCXA 4MUNA 1NVXQ 2HFJA 2L2QA 3P0HA 4YT5A 2YC4C 2CBXA 5IT5A 1FLDA 1RAFA 4J91A 3GLHB 3U3OA 3IV9A 1FBNA 1LDGA 1H23A 1QV6A 1U3FA 3HV0A 2B2XA 2FXIA 3PGA1 4UEQA 3TW8A 1CNEA 3CZMA 3VNAA 3OTIA 2QZZA 4JI1B 4RF3A 2ZRQA 4A2PA 5ITZA 5AQEA 4AP9A 4O59O 2VSYA 1OXVA 2B34A 4GZ6A 5A5EA 1ZUIA 4MVJG 4QQ8A 2AYXA 1M2KA 1S2OA 3K6RA 3OPQA 5AI8A 2ZT5A 5SZJA 3HR4A 1KJJA 4NZ9A 3OHMA 3WLKX 4HGOA 4S04A 1XDBA 2O07A 3HH8A 3KTAB 3Q7SA 5BOSB 4OKNA 2O52A 1E18A 3SIPA 2HBQA 2O2XA 5CAEA 2JBWA 2RE8A 4Q01A 5EOVA 2DPHA 4JK3A 3VR5H 3T9FA 4NZZA 1K86A 1CP3A 3UTDA 1ZKMA 1J39A 1F0PA 2QLNA 3BL6A 2WLTA 3AVOA 3JVDA 1WKVA 3PVSA 1DOZA 2NQ8A 2QTVB 4B3MB 2WSBA 3I12A 1ZXBA 2XMQA 3BFKA 3MWYW 5ENZA 1DVRA 3CWZA 4UBNA 4JZYA 3HVJA 4XD7A 1EH5A 4MUKA 4LTNA 3JQAD 4J3NA 4CR7A 5A06A 1KHHA 4WXHA 5HIJA 2R44A 2QXTA 2AOWA 4BNUA 5BQ3A 5KYKA 3CRZA 1U0BB 1B41A 4NDZA 1K3FA 4DRXB 4FWIB 4BZXA 4OXKA 2WSMA 1MUUA 2XF2A 1XRQA 1M74A 4LZNA 2JB9A 1LRJA 1T25A 3F3SA 3LQ2A 2RHOA 4R1TA 5EIBD 1F06A 1KBZA 2RG7A 3HVRA 2HQRA 1GNTA 1E4VA 3W7VA 4X71A 1AUVA 1V8FA 3DPSA 4OI4A 2YN2A 1V16A 4ZPJA 1WW8A 2GVZC 4N0DA 4QA9A 2X4LA 1HX7A 1BGWA 1V25A 4W1SA 3IUPA 3V7WA 4D4JA 4JIMA 5IBPA 1ES9A 2C8KA 2X3YA 1SN7A 2J4CA 3ZS9A 3OZWA 1DHTA 3H4VA 3ZCVA 4GG1A 1N78A 3MS7A 4YR7A 1ONOA 1UM8A 2J09A 3IIEA 1BEUB 2JHGA 4YXWA 1CS0A 4DQVA 1C9JA 4FS8A 4XPIB 3LAWA 1XZGA 1M6WA 1BFKA 1V47A 3ZY3A 3MS4A 1RACA 3UG7A 3O1JC 2GOYA 3DOCA 3LHFA 5C5EA 5JS1A 1LSOA 2BFEA 4HUQA 2M6RA 2OHOA 3C8ZA 4YRLA 2Z30A 4O1MA 4X90A 3S3TA 4MW7A 1G21B 1XROA 4X44A 5D6OA 4HN4B 2PYIA 1NUUA 3PV0A 1IPEA 3TYXA 4RXMA 1NN5A 2VBIA 2OM6A 2A9KA 4C0LA 5BQFA 4IS2A 1LC3A 1WIWA 2I7CA 1O77A 3JALA 1FQOA 4PX2A 4DE5A 4RZIA 4EMSA 1XEWY 4MV7A 4QO7A 3V4SA 1WOYA 2HF8A 3JYNA 1Q3KA 1YI1A 5DX1A 2CFCA 3SF8B 3GZNA 3O4JA 4YDRA 1E77A 2BTEA 4OL0A 2HC9A 2FG6C 3FW1A 5EUQB 4F4IA 5L53A 5J2UA 1YQTA 1ONSA 3K9FC 4ZVSA 5HR5A 3WZMA 4A8HA 4B6SA 3P0RA 1BN7A 1IC6A 3T1TA 1SCQA 1BMTA 1Q84A 2RCYA 4IIBA 3K71B 4Q4DA 4BECA 1SELA 1L7EA 3U39A 1NQTA 1KRXA 1UBLS 3VV3A 4Z9AA 2I29A 2JDID 2QN3A 3EGDB 3IO5A 2ZM5A 3IHTA 3CZAA 4JLAA 5G4KB 1OA1A 1HG1A 1GPKA 3B1WA 2BKUA 3H9QA 4QBTA 4WCFB 1Y3FE 4I1SA 4GPTA 3K35A 2G4CA 3EOZA 4HN2A 2P9BA 1TT7A 3DO5A 1ONPA 2QYHA 3H16A 4IFEA 1YB6A 1AKEA 2BEJA 2UZ3A 4TKLA 3IUEA 3OLWA 5GADl 2CJPA 3AV3A 2B7BA 3WLHA 4RD2A 2K2QB 2HT1A 5H02A 2OKGA 1ZM2A 3AJRA 4YV2A 1DX4A 1NOIA 3B20A 3O3OB 2R6R1 3INTA 3AGQA 4G0NA 4BBAA 2POCA 4W5RA 1M1NB 2WJZB 3EDQA 4NHOA 4Y6RA 3TIGA 2F55A 2AZXA 4FWBA 4M49A 2ISQA 5DJ5A 5E6UB 5C3MA 2FPSA 3NALA 1R4ZA 4F4FA 2BEVA 3WZ2A 2W98A 2WINI 1RABA 3PLNA 4FVTA 3CBQA 1P60A 3ND5A 3BVPA 5LWHA 4ZI3A 1JWBB 3PP8A 4GD3Q 1Z45A 1XJ0A 1FNMA 1NX6A 4C88A 2GDJA 2ISSD 2Y66A 4E0BA 2DBVO 3BXEA 1JVSA 2CVPA 4Y30A 4F85A 2P3QA 3QGMA 1E3WA 4II7A 5IH3A 4BX2A 1XOIA 2VF2A 5T57A 4QGHA 3IUJA 1C9NA 1COZA 3BDVA 4RMHA 3PU6A 2QI9F 3V7YA 2XUDA 1SHLA 3ZDXB 3SR0A 3HKBA 4DJAA 4W6QA 1EFAA 1WV0A 3M7IA 3J81A 3K6KA 1LF5A 1UZLA 3PS9A 4U9UA 4G5HA 1MPTA 4B6OA 2HJHA 4BVBA 3QX7A 5JJ5A 4W5NA 1P0IA 1TK9A 2BN4A 2NSHA 4RMJA 2IDMA 3KOXA 1WHTA 2EX0A 3L1UA 5D3MB 1J8FA 2C1XA 3CJTA 3D7RA 5G0WA 3H5VA 3JWIA 4NBKA 3NTLA 1J1IA 2W48A 4B3DA 4KFTA 3SXJA 2IXTA 4I9UA 4L72A 3W79A 4GKJB 1H69A 3INYA 1E3IA 3EIHA 2ACWA 1EEHA 3PGJA 4IIGA 3ZG6A 2CXQA 2NT4A 3SQMA 3VZBA 4OBXA 1B73A 4Y0AA 3UGJA 5KKAA 3C3AA 1QZUA 2VJCA 4OHPA 1WABA 3OFNA 4UTZA 4CYMA 1Y4UA 4I6JA 1PAUA 1WNFA 3MWLA 1V39A 5ALEA 3RRJA 4XSGA 1W30A 1NF9A 2X4IA 4JB3A 5EEGA 3QW2A 1J2TA 2BGRA 4MS4B 2C2HA 2IWRA 1JR2A 3DV0B 3OFVA 4OLAA 4R0MA 2VO1A 4DXAA 4IDNA 1NW4A 2JFZA 3WLAA 3JAMA 2ANBA 1PIWA 3ZGLA 1U02A 3AVPA 1VYVA 4AJHA 2BI8A 1YV9A 1ST2A 3K5PA 1EU1A 1M2FA 1V8PA 2RGCA 2WOJA 2WZBA 4MUEA 4PC3A 2VTBB 4IVRA 4R81A 1RYMA 1C1HA 5HOEA 3IERA 2CXUA 3W6NA 4ETIA 1G1AA 5LP6F 3C1UA 2ZI7A 2DBQA 4FPXA 5KBYA 5CDFE 1RXEA 1GYPA 2BM0A 4KYVA 2ON6A 1UXGA 1BWSA 4JIGA 4ZVUA 2OV4A 3OC0A 4N39A 3FY4A 3ORHA 5FUBA 1PT6A 3RIHA 4Q9IA 1PT5A 1YXMA 4D0LB 1NQXA 2UYHA 3HRHA 1EM8B 2FSHA 3A3YA 3GI1A 4OK6A 5C81A 2XOEA 2HHLA 3DQPA 4RKFA 3A1NA 4LJAA 4MR8A 1Y4ZA 4RABA 5E2IA 4ZT6A 4CM8B 2BE9A 3OEHD 4TXHA 5C5DA 1N0UA 3ER6A 3PEFA 1T35A 4C7MA 4ZZ2A 4E22A 2OGSA 1JLLB 1QU2A 2Q9CA 2CUNA 4NK5A 4LF7B 1KO7A 4V0LA 4RD3A 1QHEA 3ZLBA 1Q14A 1YWGO 5THKA 4QQRA 1AOXA 2VH2A 2OENG 2ZAOA 3C5VA 3H65A 3SZUA 4K2AA 4F60A 1PTJA 1GCUA 2JHPA 3DF7A 3ZDYB 1E9SA 1E0KA 1JSRA 1JEDA 3I73A 4Q4CA 1ZUNA 2ZP1A 3PICA 1O94A 1B14A 1NF8A 1PUJA 4TT3A 5CCDA 3VNSA 1KMIY 3K2EA 5J2TB 1TM5E 1TKBA 3NLLA 1QE5A 1M5UA 2CSUA 3A1CA 3FUVA 2LKCA 2DFKB 4IZHA 1ID1A 2DPGA 2IYAA 1X80A 2HA3A 5EZYA 5KZMB 5JLJA 3U40A 3SXUA 1NSYA 3JVIA 1KTVA 3ROXA 5HVNA 3UJ9A 3N2GB 1XTTA 2C20A 4MGYR 3TOSA 1DO2A 1LBTA 4BNKA 2GBPA 2OE2A 4PM4A 2XMRA 5DSZA 3OUZA 3SQOA 1QRAA 4QVKA 1IDN1 3GX1A 4P6VF 1YCFA 4DA7A 3H9UA 4BMXA 1KYIA 4MHOA 5DB4A 4R9VA 1L4UA 4UOZA 3CY6A 1E0JA 2O2IA 2Y1FA 4GOLD 4NBSA 3UXMA 4COKA 1D4FA 4HH1A 4NCNA 1UANA 2BKXA 2GQ0A 3PFBA 4D4GA 1HRKA 4R1MA 2VEDA 1ZLYA 3CNBA 3DFIA 4LQDA 2C5FA 2SBTA 3ORYA 5DBOA 1DSSG 3KUUA 3B3FA 3IMEA 3P4XA 3PDUA 4YAWA 1HSZA 3TZHA 4AJKA 3H9BA 4E4YA 3LNTA 3RVNA 3N70A 4BPRA 2V98A 1XCOA 4CBVA 1VFNA 3L7BA 4N65A 1WXGA 4N3CA 4OATA 3OQHA 1SHZA 1QV7A 1E2HA 3FIUA 1YK0A 2MINA 3A6JA 3MIZA 3IR7A 3JWEA 2WOOA 1M2OA 1C1DA 3WRWA 1LPOA 3R76A 4Q9HA 1JDNA 4JNCA 3NJ8A 5KINB 5ESWA 2C2ZA 2JFBA 4WLEA 4TMVA 1R5JA 2GHRA 3UAZA 2KWIA 3V3TA 1RWBA 2OUIA 3HXLA 4NH0A 1GYQA 1RM3A 4LHSA 3TZQA 2AOUB 4OHVA 3M1IA 3WA6A 1A0OA 4DDWA 5IM5A 4Q7LA 4MULA 1RRMA 1V7CA 2FN7A 2FW8A 4RYDA 4TMYA 4TZKA 4HNUA 4D74A 1Q7TA 3A8TA 3NWBA 4PO1A 3UHOA 1RCTE 2GD0A 2LBPA 4BO5A 2L0XA 1JA1A 3GRPA 3EWAA 3K30A 4LHWA 4MGHA 2IU0A 3ZCUA 4S05A 2JLXA 2YVQA 3R3YA 2FTKE 3TMKA 1WXHA 1DIRA 3WIDA 2RHBA 1H0KA 1U8ZA 1Y8QA 2E6KA 3GDOA 4W5JA 3U1TA 5A4JA 2M98A 5F12A 4HNVA 1ZMXA 3ZXSA 4AU1A 4YAGA 1YZUA 3GJRA 4D1YA 3L1IA 4DV2B 1JS1X 4RJIA 1LF0A 4LJ6A 4QGFA 2OPHA 2HA4A 3DHWC 4UTVA 2DXIA 3IUNA 5ERYA 1E2JA 4G09A 4OHXA 5C34B 3ZOKA 3DFKA 3L0ZA 3PRHA 2QTRA 5AKJA 1M8GA 4HCJA 3ETHA 1II8A 1JU3A 1V8BA 2YFYA 2Q4DA 1M73E 3LPMA 3HA3A 4HGNA 5CB4A 2FHSA 2HGSA 1SCNE 4P35A 3Q6IA 4X7MA 1I7NA 1KI6B 7REQB 3QV1A 3C3JA 1MRZA 5D1HA 3TPZA 3ETCA 3GNTA 1M8JA 2DWQA 2P67A 3O1LA 4O5OA 2WUDA 4QYMA 2IYLD 3RUDA 2AK3A 1SOAA 1IOLA 2JJQA 3T7JA 2XADA 1OLSA 4UUBA 3LPDA 3SIRA 4UTRA 8AT1A 2RI0A 3U4GA 3DULA 2JIQA 3THXB 3C15C 4CTOA 4KIUA 4LXHA 5AKXA 3ZHOA 2AYYA 1XWIA 1S01A 4POAA 2EP5A 1X7XB 4PF1A 2YVKA 1FXWF 1PLKA 5CB4B 1YS4A 3B51X 3OZUA 5ITWA 4RFVA 1X7ZA 1NRIA 1W7AA 2X7HA 1PTKA 2VHWA 2QY9A 5KTMA 3LHKA 3P9IA 1FP2A 7REQA 4ECAA 3NS7A 4DG8A 1U2GA 2BHRA 2JA1A 3T06B 1GCGA 1TTHA 2M6LA 4RULA 4I99A 1UJCA 2OM2A 1E1CA 4FYKA 4IJMA 2OXTA 1I7SB 4NATA 2R8XA 3AY3A 5IPFA 4ZGBA 1CUHA 3TM5A 5K9ZA 4ALNA 3TGPA 3L82B 4JB0A 3LXXA 1G8SA 1XMSA 2A58A 3EIXA 2FJUA 5TQ2A 2J87A 2HBZA 4UHDA 1MIOB 3T9BA 1TZKA 4KIJA 3GNSA 5KVQA 1F38A 1QK3A 5KS2A 1CDEA 5I5EA 1O54A 2DPMA 5LQKA 4LVUA 3RYHA 3PTAA 1QCCA 3D8HA 4ATNA 1V5WA 4CETA 3FLMA 1HI9A 1JJ7A 4J4BA 4WZZA 3BJMA 1QV9A 1OWNA 1G2PA 3T61A 1O95C 1QPZA 4FB4A 1VE9A 1GYRA 1WXXA 1ZJJA 4EHAA 3RVKA 1RIIA 1Z16A 3NAGA 2WQZA 2Q5LA 4L0DA 1DE0A 2FR8A 3BBPA 3JXEA 3TH5A 1X38A 3KQLA 3CO0S 1U2QA 2IXAA 4EJ0A 2XCUA 3CRVA 3K0SA 2ZUTA 5HQ3B 1B3RA 1R6XA 1FYWA 1GNQA 2VSOA 4ZEVA 1P1FA 1Q15A 3RG2A 1SC6A 4EYGA 4EBBA 2ZYSA 5IYZB 3RTDA 3DA8A 1MTZA 1VLJA 3K0FB 2CXTA 4N8SA 1Y4DE 2W9XA 1QQBA 1W48A 1JQAA 4BC0A 4QUBA 1O96A 2ZI5A 2HXGA 5DYIA 2BJHA 1TA0A 2RGAA 2LW7A 1ORHA 2G9NA 5JJLA 2HMVA 1A9RA 2XA2A 1D9ZA 5BY2A 1T8TA 4NG4A 2HJGA 4DLBA 1CUWA 5TPWA 2AUNA 1HZZC 3BQ9A 1U8YA 3R40A 1FNBA 1RI5A 3Q9SA 3ESAA 1FDOA 2H3EA 2GN8A 1G9XA 1MAWA 4Y1RA 1O0BA 1QOPB 1SUIA 1GGKA 1XDUA 2VBGA 3EJ6A 3JQBA 1U8EA 3ONVA 3QUTA 1CUCA 4O2AF 3ZUPA 4RENA 3ZU4A 4JKYA 2Q3CA 1NU8A 3KZMA 3Q7EA 1N4AA 2ATXA 2B4TO 2WSLA 1G4UR 3N2YA 4ZU1X 4IWYA 1NUTA 2ZTSA 5BR4A 1VE3A 2OAP1 5HUQA 2Q3DA 3VR2A 5JDCA 1GEEA 1H2HA 1FCJA 2VHYA 4J0FA 1ONBA 4ZDKA 5EIFA 3CT6A 1YH3A 4DEYA 1BOFA 5LOVF 3AMVA 1WG8A 4BO9A 1NAHA 2CXSA 2Q5QA 4JQOA 5AM0A 5K4HA 4J94A 1Y6FA 4OEHA 3ROKA 5L40A 1RLMA 1P7CA 2GCGA 4C07A 2GBCA 2FA9A 4BNXA 4O4LF 4RSMA 5LP6C 2B4AA 2IPLA 3CEJA 3TTWA 4U7GA 1Q0QA 3AHCA 5E3JA 3T94A 1VOTA 3QVWA 4NEGA 2OORC 4NYJQ 2X86A 5CVJA 5GONF 5HQTA 2JVIA 1JPVA 1PFQA 1FVFA 1SU4A 2F1OA 3DVLA 4PQYA 3SLGA 4BLUA 4CI0B 3C24A 4DV5B 1ZPDA 4O33A 3OPNA 3GXOA 2RC6A 1E5TA 3UW1A 2EYQA 2OZVA 1ZCAA 1JIQA 4AZTA 5LA6A 5IXJA 1HZJA 4P2BA 4RY8A 4IIXA 4AXBA 4ZOQI 2HIHA 1N9ZA 2BHLA 3GLQA 3D2BA 4OU5A 2HWYA 2XWBF 4AW9A 1JR3E 3B3JA 5EHNA 5F21A 3JATB 3RIMA 4DLYA 1H0SA 2XNKA 1Z2EA 2Z3VA 4R9SA 4OX9Y 1RZ3A 4L4RA 3DAYA 4D0SA 3MGKA 1K08A 3N0WA 3QEJA 4OG2A 3RV4A 3T4XA 3TJRA 2VDLB 4YMHA 2WJYA 1LTQA 1U5AA 3GZNB 3GIDA 1QDUA 3RFTA 4FUTA 4G5QA 1GA6A 3DEAA 1BVYF 4RFLA 3CR8A 1VI6A 1Z7BA 1XKQA 3IDOA 3LYLA 4ASUD 2FVYA 5KCMA 2VT7A 4H3KB 1CIVA 3NASA 4MB6A 1JI0A 2IF2A 5JXWA 1HKUA 1IEXA 3BFPA 2GTHA 4PAQA 5EHGA 3NT2A 3A1EA 2VYVD 1HV8A 2P6PA 4ZYUA 4M36A 2NUTB 3EEFA 2GEJA 4GM4A 3NTOA 3N3BC 3H3FA 4S2EA 1Z9BA 4XOUA 4ZHQA 1WP4A 3A10A 4FOPA 2X3UA 4MK4A 3RSLA 4H3HB 2FETA 3FCAA 4HS4A 1K88A 1VG8A 1KEVA 1A9ZA 2NPOA 2VDQB 2ZJBA 1CR1A 1A71A 1DRUA 3NO4A 4R3WA 3SSNA 2B4QA 2V55B 2XSZD 5F33A 1VPEA 5AK5A 2R4TA 2PGIA 2QAGB 4ZVMA 3EXFA 3VPGA 2XLCA 2OYCA 3DUWA 4J2TA 4G84A 1E3LA 1EXDA 1UMKA 2GZRA 4RVHA 5AOVA 5CA0B 3WO1A 3TBHA 1R8YA 3Q5DA 3GF4A 1JG6A 2R751 2VWQA 1I4TD 4J7UA 1FXWA 3KVYA 4YRGA 3K6SB 2VNSA 4G67A 1O03A 3RJ5A 3WC4A 1FTYA 1P7YA 5JMOA 4P22A 3WDKA 2OXCA 4OFXA 5HCNA 1LDBA 3WMWA 4WBNF 4Z54A 1C7EA 4IV8A 2WPDD 3HR7A 4LISA 3OKFA 5D3MA 5FPHA 3UA3A 5AUPB 1D2GA 1G8KA 3IH5A 2EZTA 3PT9A 5HKOA 3NDRA 4GGOA 4Q66C 1U9JA 2OVBA 4GAEA 1JG2A 2NAFA 3LGXA 3L4KA 5B1SA 3W0LB 1N0WA 2DFLA 2N1MA 1KQGA 3TJZA 4X5OA 4UHEA 3G49A 1XCPA 3E3AA 4H4EA 4ENTA 1K7FB 1TUGA 4KFRA 4F1KA 5JHGB 1XEWX 4AYXA 3QEMB 4Y7CA 3VM6A 3D5EA 4G8JA 1Y3BE 3GJ6A 5DI3A 3PF9A 4RVDA 3T3NA 3REFA 2VWHA 3T7TA 4J9VA 4FD2A 2MYTA 4BNLA 1RRVA 2H6EA 2ZGVA 2QN8A 3QA9A 4I1YA 2O5RA 4ZKDA 4MR7A 4O4IB 3SZOA 2EG9A 4K0KB 3UMVA 5KQLA 4KQJA 1FSSA 1YDHA 4QFBA 4QQFA 1XLTA 5BT9A 1E98A 3E8MA 4ZAGA 4OBWA 1QGAA 4RHCA 4ARZB 3CF4G 2FLWA 5TIIA 3A3PA 2PMKA 2A14A 5U4XA 1S89A 2FF5A 1EFVA 2OHJA 2W6OA 3GLSA 5AVOA 2GCNA 2ONJA 3SX2A 4B8YA 2B2CA 5IC6A 1W49A 3D6AA 3KQSA 4NABA 3SP1A 4DANA 3R9WA 1MVLA 1UOPA 3PI6A 2GJAA 1XYVA 1O6ZA 1DT3A 1SEPA 3C1AA 2MSDB 4UDXX 5T64A 5E4YA 1FFYA 1GKUB 5EYPA 4IG9A 4KVFA 1PFVA 4P34A 3ICPA 3E3MA 2B4RO 3QLTA 4PSVA 1UFOA 3B1XA 3DP7A 4EG7A 3QEAZ 2IHKA 5EP3A 2IH4A 1L1QA 4KP7A 4IO1A 4MV5A 1OWLA 1WS6A 3SSOA 3HLYA 3EDOA 3QEBZ 5KQGA 2F8TA 1DU4A 2QB5A 5E4TA 4ZCIA 4ZKEA 1Q1EA 1U3GA 3IBYA 3HHPA 3CLRC 4HATA 5JQGB 1NW5A 5D01A 3RVMA 3BULA 3JQRA 5CH8A 3GLGB 3H11B 4JASB 5J40A 1QLWA 2I80A 4XYBA 4Y2UA 3THSA 3K15A 5JYCA 1P9LA 1I2ZA 1JDVA 1USKA 4HEHA 2JHAA 2XNSA 4MV1A 4UULA 3O7MA 1JB9A 3R7AA 2PKQP 4UUOA 3H2BA 4XFKA 2J9FB 2NQ2C 4C7BA 1JKXA 3AR3A 5T5QA 2HDHA 4FONA 4Z0NA 4G1CA 4N8EA 1MJGM 1VB5A 2VP9A 1S1MA 1L5GB 1KZ6A 3RJMA 4EQ6A 3UYKA 1NPTO 4NCKA 2FFBA 1KERA 1MQ8B 2X77A 5FBRB 2D5CA 5G3ZA 5HDBB 3U7QA 4B79A 1NWCA 1BMDA 1IZ9A 3II6X 4W9NC 1RC1A 3KJXA 4MVXA 2FEWB 4A16A 1E2QA 5IVKA 3QBTA 2ZEJA 4XIJA 3UK0A 5IK2A 2AN9A 2O2CA 2AEFA 1IZYA 5TPWB 2GZAA 3SVZA 4P4LA 3K1JA 1IAVA 4EP1A 4POOA 4KFSA 3DT6A 3ICOA 3BWCA 2D1TA 4M9CA 3NHZA 3AWIA 2QAGC 1OIVA 3DE1X 4YAJA 5F98A 1Z39A 4RTLA 1TM7E 3PC6A 2CFSA 4KV9A 3TB4A 4IQFA 2PAFA 3H83A 2Q2WA 3N8NA 1USWA 4P7FA 3NHUA 2WVHA 3DEHA 3OJOA 2RHHA 3SNKA 1ZCBA 4X1KA 4YAKA 2H0QA 1XZIA 4JL6A 3DS8A 4YROA 2PDAA 5LYJF 4DM3A 3V4PB 3U7QB 4QXRA 1KZ9A 4DR7B 1BHJA 3F5FA 3QXSA 4PLFA 4E4RA 1SCUB 3O95A 4LBZA 1FP4A 1P4AA 5TE9A 2PXAA 4DJFC 4E33A 4BP9A 2HYIC 2ZB7A 2QUAA 4PN7A 2J5XA 2IPNA 3D6JA 3KZNA 3GFRA 1HORA 1NW8A 2O7VA 4GHWA 4HDSA 4IP0A 4XRGA 2XWSA 2QVGA 4RXTA 4A7PA 4RESA 4R1SA 3UIEA 3ZLJA 3GYBA 3E81A 1BRTA 4V2UA 1AN0A 3ZZTA 3QEKA 1K1EA 4QFMA 2Z4RA 3F96A 2PKEA 4HJXA 4HXGA 3QVTA 4OY3A 2DBRA 3BJIC 3V4ZA 4QGSA 2ZJ6A 2HW8A 2PFSA 3DT9A 2ZWPA 4I4IA 4C5AA 2HIGA 3NDIA 1XA3A 3NANA 3BFXA 4MS4A 2GN4A 1DTWA 3A1DA 5ETJA 5J63A 3TVYA 4FYHA 1XHEA 3V97A 4US1R 3H5WA 4GM1A 4D3DA 3UKJA 1U8FO 1ZCJA 2O48X 4C76A 2ZRFA 2NO4A 4EHNA 1Y1QA 4I9FA 4MYTA 2EZ8A 1SG9A 3GVXA 4YCDA 5BVGB 1MO3A 3AW9A 4C22A 4WESA 2NZVG 1PNQA 2YH2A 1K8ZB 3SHWA 5FNVB 3WGGA 2VT3A 2ZRCA 2BDTA 3OH8A 4U7WA 4DJJA 2PUGA 3FKSD 3R0XA 2RGNA 3IB6A 2PHZA 1DLJA 5JXHA 4EIWA 3ANSA 1YC5A 2BI4A 1AQ6A 3HM2A 3LC0A 4S3MA 2HXYA 1SRRA 2IE8A 1JMKC 2XUPA 4D57A 4Q18A 4BFZA 4D9MA 4M0PA 1E9AA 1HEIA 2IUYA 3RK4A 3AB8A 2GTPA 5JZVA 1X1EA 1XEXB 2BBSA 1GL6A 4GRIA 1Y89A 5BNFA 1HXHA 1OJ7A 3FNEA 1ZUD1 3KYDB 2PD6A 5K8TA 1U2EA 1CXZA 3E61A 4HWGA 1L5ZA 3I5MA 3IC5A 4U7JA 1VSTA 2ATEA 4KACA 5FNVA 3IBFA 1N5RA 2R6DA 3H9EO 3UN1A 1DQRA 3EA0A 3BGSA 2ZBQA 3ZK9A 4FT2A 2PZEA 2QVXX 2ZE8A 1AV7A 3L7AA 3WBJA 4D2IA 5JT1A 5JXJA 1PG2A 2CHEA 1P62B 1V3VA 3SC2B 2MMGA 4PO8A 5JECA 1PU2A 1V41E 2QMYA 3AC0A 3RV3A 2Q4TA 4B4DA 2NO1A 4IX1A 3SY8A 1MKYA 1XPRA 3R77A 2VI5A 1XF1A 4W5TA 1OASA 2XOKD 3TGLA 4CF5A 4QNRA 2P3OA 1EK6A 3C3KA 4JB8A 3U3DA 2QAGA 3R9XB 3E35A 3GLFE 2B78A 3NHYA 3RRZA 4WOBA 1C7JA 3GAZA 3ZNQA 3LLSA 1NMYA 2FRDA 2YZGA 3D0QA 2DCMA 3K1YA 3IE2A 4KAAA 5K8VA 4MDFA 4RZSA 3U0BA 1EFKA 5JAPA 2FFJA 4RKWA 1KZ7B 4ME6A 4DWOA 3FPSA 5MN6A 3F9IA 4BB9A 3AHJA 4IJ5A 4F97A 3C3WA 2WUGA 3QTBA 4CODB 2G4VA 1I3NA 4C0XA 1K9SA 2EWMA 1V5IA 1PFKA 1ZINA 3J7TA 4ZCLA 2KLHA 1J5XA 2OXRA 3KV1A 1HDOA 1IXYA 2HREA 2ZDGA 5A04A 3G88A 2HLNA 3KAPA 3N87A 2OV1A 2Z2JA 3UMRA 4FZ5A 4GDFA 4MDEA 2P11A 2PU7A 4R1NA 1BVUA 1I51A 1T6ZA 3IJEB 3Q3EA 4G56A 2VDOB 4R54A 4FZVA 2ODBA 3Q7IA 1OFUA 2HQSA 4M7RA 2PVPA 4F4CA 4D82A 3PFIA 1RFLA 3HHEA 4EG0A 3KE8A 1PJBA 3AFOA 3VR4A 4ABYA 3EUFA 3CLTC 3GNLA 2A3RA 4FM9A 3AL2A 1VBNA 2Q3LA 4I14A 3TECE 5BQ5A 2G5CA 4MPJA 5DM60 1ZVJA 1VHJA 2HBYA 2PSFA 1JQBA 1V8DA 2ZBDA 3G85A 1OMOA 4LOHA 2QW0X 5HBRA 3AEZA 3L3BA 3TL6A 1CEXA 4BLOA 1MGOA 3WYFA 1G5TA 4L8VA 5EXDA 4A0RA 2AC7A 3NP9A 3P1JA 3JWPA 3AVVA 3IQZA 1FFGA 4UXIA 2V9CA 4N5DA 4B6JA 4YLEA 2ZOSA 3GAMA 2CNDA 1SA0B 3DJFA 2ZCJA 4FYJA 2JIZD 3ND6A 1NXPA 3V1YA 1F3OA 3W8EA 3NHFA 4LBWA 3LS2A 2YJZA 3EEIA 3VNRA 2BGGA 2CEKA 3VOSA 2Q8NA 1A82A 1E3QA 1KF0A 1ZJ4A 5ENDA 4CQLA 2OC9A 1V1MB 2HSDA 2X1HA 3INNA 1V6AA 4MRVA 4U02A 5DLEA 1NY5A 1IULA 5NLLA 3SAJA 2VNJA 5IFKA 2FMFA 3TQFA 1B42A 2WF8A 4A8JB 2WMOB 4IVQA 3TQIA 5LA6F 3EIQA 3KB2A 2WJHA 2PA0A 3WLOA 2ZSDA 1CFZA 1L4MA 4INAA 6NULA 4YQYA 3ZBPA 1D2MA 1C0EA 2JFYA 5FOSA 3MAAC 5CVTA 2FY8A 1L7BA 3OZBA 2WIDA 4IO0A 4EENA 4E15A 3O9VA 3O3NB 3QPUA 4L5JA 5L4LA 5DTJA 3ZQ6A 3UOWA 1DWOA 2GDZA 1YOVB 2P9HA 3OE4A 1FS4A 2AIRA 2ZREA 3QVSA 5EE3A 4YACA 3SLRA 1IZ0A 4J3JA 4L28A 3CW2A 4ZO7A 1IWPB 2IEIA 2YWDA 3RFUA 4CN8A 4GC5A 4WBSA 3N0RA 3TKAA 1QFZA 1VE5A 2J45A 2WR8A 4AP5A 1ZD1A 3ZVNA 2P6MA 1WETA 3W5UA 4L6IA 1SC1A 1AMUA 5B4VA 1IOVA 2W6MA 1FSZA 1M2WA 3BUSA 2ZI4A 3ZQUA 3ZW9A 2ZYHA 4M1EA 2BCGY 4QSMA 5EZYF 5C8YF 4G2NA 2DWUA 1XTUA 5I9MA 1L5QA 4P08A 4YRZA 3M83A 2YWEA 2V45A 3ZWKA 1O97C 4TYQA 2ZTLA 2ZJ3A 5FHRA 4BYGA 1G20B 2F00A 2Y2VA 3R0VA 4Z2AA 1L5LA 2QRZA 3LVBA 3ZIDA 1U1FA 4ICIA 2GPSA 1T8PA 3A9TA 3QPVA 4L5AA 4RA6A 5HXAA 3ECAA 4JMLA 1QAMA 3WWDA 3C6QA 1QIFA 2AS0A 4DIBA 4GBJA 3RUIA 1VL2A 1I33A 2FMTA 2BBOA 1UEXC 2E5FA 3PWSA 3BK7A 5CCXA 4M54A 3FJOA 3WRVA 5EVCA 2A30A 1GTG1 1YZVA 4HY3A 4YCAA 4D4IA 1EVQA 5BR1A 2QE6A 3PITA 3EVEA 4X1KB 3WK4A 1GL7A 1L7DA 4HFMA 2YMMA 1R4MA 4JJEA 4LVNA 1S2NA 3QFHA 4H60A 4Z49A 1C3OB 3ETGA 4PS1A 3ZGOA 1A5BB 4E70A 3AV0B 3E15A 4UUQA 5AWFC 2V7UA 3Q9LA 1CVLA 3EPPA 3N6VA 3C39A 3GMSA 4L9RA 4PG6A 3GPBA 4PRKA 1KE2A 3TRHA 1AJEA 1GTSA 2GD6A 4KWHA 1TFRA 2RBGA 2QUJA 3NM6B 4LJ5A 3FZNA 1BAPA 1U7XA 3O31A 3JYOA 4BLVA 1FB5A 5I3ZA 3G9XA 4G4JA 3HVIA 2YWJA 4M0KA 2X0EA 3E2PA 3VDMA 4C5CA 1EK0A 1SVKA 2CHVA 2Y68A 4WFQA 4TVOA 4RS4A 3BMCA 4BGVA 2GJ9A 5C5IA 3AZOA 2PL9A 4JEIA 3PDCA 5JQWA 4QASA 1A77A 4AUNA 2VNAA 1J0XO 1SXGA 1YD7A 1ZEJA 1V5EA 1PD1A 1OYVA 2P78A 2YW2A 3F98A 3GCXA 3L8CA 1QWSA 5CM9C 2HMWA 1CUZA 1MG0A 4FU0A 4QG7A 1YDMA 4IDAA 4DWJA 2HF7A 3FMPB 3B9PA 4OSEA 3U7HB 3D7SA 3OMWA 4DNXA 4PVCA 2P30A 4C4OA 2AKAB 3D4PA 4Z3DA 8ADHA 5JY6A 4IW3B 4CMGA 2C99A 3KQKA 1GT91 1PJSA 2VDVE 2QTMA 1L7AA 3OE5A 2IZ0A 4KR0A 2CBZA 1WBJB 3C3XA 2P5SA 4IH1A 4CL3A 1E1YA 4RADA 1G3IA 1UP6A 2IHZA 2ZVPX 3EFOA 4MWTA 1R8QA 1SUAA 4LJ4A 2E82A 2V4MA 1GGJA 3EBLA 4PTLA 1VHLA 1QJCA 1WA5A 1PG5A 3C5WP 1NVBA 3C5CA 3MINB 2IYVA 4GR5A 4RHTA 4A9AA 4F4DA 5H9WA 3U61B 1IQPA 1W0JA 4LRSB 4BQQA 4R98A 4WA7A 5AM5A 1Y7HA 1BWQA 1G7CA 3HDTA 1T3HA 3NOXA 4P31A 4EPRA 5CEEA 5CFNA 1OIXA 3F46A 3I04M 4YYEA 4IIJA 1K5HA 1WV1A 2YHSA 4LDNA 5GGXA 3ZCTA 2JVJA 4MW2A 1EUDB 5DK4A 1RLOA 1V6CA 2Q6VA 1B2LA 4LC0A 1XDDA 4PG8A 3PC2A 4NU6A 5KJCA 1U1EA 1MORA 6CHYA 2PY6A 3KIPA 4EFLA 4DUGA 1XRLA 1OV6A 1Z0FA 2PBZA 1LTKA 1KS9A 2FPXA 1JU4A 3BIXA 1MOZA 3DBHA 3O6VA 3KWMA 1J7KA 4L5CA 1B7GO 5JU6A 3PEUA 2P90A 2HY7A 4MJLA 5DPMA 2GK3A 1Z63A 1G0NA 2RCNA 4C14A 5B30A 5JH7A 6ABPA 2QN2A 5E0OA 5B6PA 5CK5A 2LV8A 2LIPA 4JVOA 4XD7D 5AOCA 4DPKA 3VSBA 1DFGA 2IZ6A 3IESA 1RYBA 3G9ZA 2P5TB 1QH8A 3HUDA 2VSNA 3L79A 3T95A 5BR8B 4JL8A 4NCBA 2E6UX 4M9RA 5JWHA 2O1WA 5BW4A 2W6IA 4PLZA 1CVIA 2AQIA 3BIWA 3PJRA 3ICEA 4DV7B 1T2DA 4AQDA 1O87A 5BYBA 3DP9A 4YUAA 1TVEA 2PD4A 1HL7A 4ND4A 2Y1GA 3IULA 3QW4B 1H2BA 2ZJ5A 3RIGA 1FFCA 1L7OA 5HZKA 3OU7A 5J5AA 3WGUA 3MGCA 1ND6A 3BWBA 1U0EA 3ESBA 3PFHA 2BH2A 1WHTB 4IHAA 5AW6A 4JLVA 3FXAA 4JQSA 1PJTA 1VL5A 4KGDA 3ZNOA 1DQPA 1PWXA 3QBVA 1T3ZA 1V7PC 4L7VA 2AZTA 1NVMB 2ENUA 4OGWA 4TKZA 4L4ZA 5CX1A 3KHSA 5FTLA 2AB0A 2F6RA 2W71A 3I0NA 2O1SA 4AT1A 1Q19A 1W8IA 1ZX1A 2Z9DA 3GCGA 4E1AA 3R3WA 4RMNA 1CD5A 1YKSA 2VL7A 3FN4A 3WR5A 3ZEAA 5HM8A 4FHFA 3EPJA 2C3PA 2OV2A 4BNIA 2DBYA 1WAMA 3G2QA 4XX1A 3IIMA 2ECFA 4NHEA 4OQFA 3VKGA 3MPOA 2HSZA 5IEJA 1X2BA 4UFNA 1JG1A 2TMDA 4QQNA 2E21A 3H5IA 4FGSA 4AUKA 3F6RA 1P29A 4JBLA 2ZIAA 4N6GA 2CV0A 1L5OA 4KXNA 4EGSA 1D7AA 4R9NA 2IBTA 5J4KA 1O6CA 4HZUB 5K45A 1V11B 4BVJA 1J20A 4GXQA 3VU0A 4BQOA 5TEVA 3VC3A 3X44A 3OT5A 4A82A 3CHYA 5BV8A 5AUNB 4G4SO 3A6HA 3ONDA 5H7XA 2XNJA 3W5VA 3DMYA 1D4OA 1SR8A 3CZPA 5DDIP 4CM1A 2PTGA 2VA8A 1T1EA 2W70A 1EHCA 3LBFA 1ZVMA 3LTNC 3IBCA 4V0QA 2EGUA 4WBNA 2OGTA 4GE3A 1H9CA 2VJPA 1CE8B 1WTCA 4MVJM 5B37A 1SGWA 4B84A 4KMMA 2DEUA 5KTSA 4YLGA