2WJWA

Crystal structure of the human ionotropic glutamate receptor glur2 atd region at 1.8 a resolution
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
374
structure length
368
Chain Sequence
NSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALTYDAVQVMTEAFRNLRKQRIEIGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Glur2 Amino-Terminal Domain Provides Insights Into the Architecture and Assembly of Ionotropic Glutamate Receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GLUTAMATE RECEPTOR 2
total genus 122
structure length 368
sequence length 374
ec nomenclature
pdb deposition date 2009-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wjwA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wjwA01
4WXMA 2ID7A 3K4HA 4W5OA 1U04A 5IUKC 5CNKA 3URMA 1EWTA 3IDOA 4L85A 1JF8A 1JFTA 4HNQA 2RJNA 2X7XA 3OQOA 1JHZA 1LJLA 1C4WA 1CEYA 1Z2DA 3SM9A 4JAVC 4RDCA 1SRRA 4H3KB 4F06A 1U8TA 1AB6A 3O2SB 4ETNA 3MF4A 5TQ0A 2CWDA 1ISRA 1ZY2A 3JY6A 3JS5A 1P8AA 4LE2A 5DKFA 2FLKA 2VYCA 5FBKA 1C0EA 1DBWA 2FN8A 1CYEA 5GQSA 3HO1A 1UDRA 2JBAA 2ZWMA 3F6CA 2AYXA 2FVYA 3HV2A 3R0JA 1B00A 1T34A 5JNRA 5BRAA 1Z2EA 4O5AA 3CHYA 4XFKA 1K68A 1RNLA 2M98A 4F8JA 5HM6A 4MR9A 2ID9A 3GBVA 3LUAA 4ZPJA 3RVQA 2MYPA 3F73A 2FKAA 1ZHHA 1PHRA 3HZHA 2J48A 4NV3A 2PUGA 2GBPA 3D8UA 2L19A 3HS3A 1BDIA 3G85A 1OXKB 3N6VA 3RVLA 1FFGA 1FFWA 4Z4CA 4RY8A 5JS2A 1DP4A 1D5WA 2WRZA 1TJYA 2JK1A 4N0PA 4JOQA 2WJWA 3RVMA 2R48A 3T38A 1F51E 2RGYA 3SAJA 3TX6A 5D2CA 4N03A 4F12A 3CZCA 3M9XA 2R4QA 1ZITA 3LTEA 1A04A 4Y9TA 1RPJA 2WMYA 1SXGA 2JVIA 1E2BA 1TM2A 1W9HA 1U2QA 1QO0D 4XXHA 2MYUA 4LRQA 2L17A 4S05A 1DCMA 5KC9A 1U0SY 2MSLA 1XHEA 2YHBA 1DG9A 3DGEC 3O21A 5HSGA 2NT3A 3A0UA 5EWJB 3EAFA 1ZGZA 3H6GA 3LKBA 4OATA 3FFWA 3IP5A 5IC5A 1DC7A 1NXTA 2JVJA 1BDJA 3EDCA 3NNDA 1ABFA 1RXEA 5DLEA 4UHJA 2RDMA 1JH9A 1FQWA 4GNRA 5HQJA 3QLUC 1P6UA 1USKA 2MYNA 3G1WA 3KKEA 3HJFA 3HDGA 1D4ZA 1OXBB 1JDNA 1RZRD 3N8IA 2KYRA 3FGZA 1JYFA 2A9QA 2Q5CA 2MYTA 1Z17A 3Q7SA 4KZKA 3GWGA 4MS4B 4YP9A 3QLVA 4Z4GA 4KVFA 4TLLB 4PICA 2WJAA 1PEYA 3A3KA 2NUBA 4XAQA 4MLCA 1KRWA 1JBEA 1BAPA 3IPCA 4RK5A 2WY2D 4QYMA 3O2QB 2LIVA 3NBMA 1DJMA 3QLTA 4QYWA 4RKRA 4Q6WA 4MRMB 1QP7A 4IF4A 1CHNA 4OBBA 2N9UA 2JCGA 4QICA 4EYOA 1DRJA 3N75A 4MS1B 3OM1A 2JRLA 4PEVA 3Q15C 3B2NA 3O1IC 1DCKA 4KK4A 4RKQA 1PNTA 3EJWA 2QZJA 4NQRA 3KCNA 1DC8A 1YMUA 4G0ZA 2LUOA 3HUTA 1TVMA 2CD7A 3QEMA 4JB2A 4RWEA 5CHYA 4RK6A 3ROTA 4D74A 3EQZA 4XARA 4EYGA 3FDFA 3JPWA 4F11A 3SQNA 4LDAA 3KYIB 4MR7A 3CRNA 2E4VA 1ZH2A 2LBPA 1ISSA 4WUTA 2PUBA 1ABEA 3CKMA 3L49A 4L4UA 5DGCA 5GOTA 2PUCA 4QPJC 3UUGA 4MLDA 3QLUA 4NCBA 1JL3A 3KLNA 3OLVA 4D6XA 3QK7A 2FW0A 5CNJA 5FWXB 3LUGA 3OQMA 3CG0A 4RZSA 5JNWA 3RQIA 2IPLA 2W42A 1KGSA 4KRFA 4OTZA 5IUJC 4Z4IA 3P9YA 4TLMB 1K66A 5T3YA 4CBVA 1PEAA 4Q6BA 2OQRA 1Z26A 4HNSA 2QVCA 4YO7A 3TD9A 1QP0A 3JVIA 4G0OA 3RVOA 2PUFA 2PL9A 2JBAB 1RZRA 1DRKA 3GYBA 4E7OA 2QXYA 2FXIA 4KNYA 3ILYA 3LOPA 5C5EA 2JB9A 4MS4A 1P6QA 3OO0A 3C6QA 3Q7TA 4H3HB 3S99A 1QMPA 2HQOA 3GRCA 3BBLA 4W5QA 1QQBA 3H1EA 3MYYA 4ZYLA 1Z13A 3KSMA 3QX9A 4MGEA 2BGGA 2FMFA 3C3KA 4W5TA 3H5TA 2IPMA 3JPYA 3KLOA 4OLAA 2XDYA 5TPWB 1VPWA 3EGCA 4JB0A 2A9PA 4IRXA 3HSYA 3H6HA 4JP1A 1D2AA 3CG4A 2IPNA 4KPYA 4G86A 1URPA 2B4AA 1QO0A 3K9CA 4DQDA 2FQWA 3IP6A 5ABPA 3IP9A 1MIHA 1NXSA 3DLHA 3KS9A 1MB0A 4O1IA 4TN5A 2FQYA 3SY8A 1DCFA 3HDVA 6CHYA 1QPZA 3EODA 4MR8A 2PE5A 3O75A 5JNUA 5TPZA 2PLNA 1NXWA 3OO1A 1QQAA 2NZVG 2QW1A 4KQ9A 3QEKA 3FFTA 3MM4A 1ZVVA 2CHFA 3RH0A 1GCAA 2FQXA 2L2QA 1Z15A 7ABPA 3H5IA 1YMVA 1NY5A 1MVOA 4DN6A 4RK0A 3MA0A 9ABPA 1M2FA 5ED4A 1USIA 2M1ZA 4W5RA 5KQLA 4FE4A 1EAYA 4RXTA 2AYZA 1GUBA 4EGSA 2MSKA 4KMRA 3F7NA 3CNBA 4IMIB 1JLKA 4GPAA 2TMYA 3SG0A 1YK1A 4MR9B 5DCLA 4ZMRA 3RVJA 1NXVA 3HXMA 5EWLB 3MQ4A 3N0WA 3BRQA 5EWJA 3VNBA 3HUUA 1JFSA 3LUKA 1L5ZA 3NHMA 4MPTA 2PL1A 4HNRA 5KQPA 1I3CA 1WETA 1JFVA 4YCSA 2DRIA 3HVRA 1MAVA 3D02A 3QLVC 1DBPA 3A10A 5EWMB 1HEYA 4LE0A 4P98A 4P1ZA 3H1GA 1E6MA 1QNLA 3T8YA 4IGAA 3M6MD 3E61A 4LE1A 4H60A 5EWLA 1PNRA 1D1PA 2PKXA 3CTPA 1YK0A 5BR1A 4FE7A 3H5LA 1JYEA 3O1JC 4G0MA 1P2FA 3TO5A 2V0NA 3KTOA 5IX8A 1MB3A 1ZAYA 3HK2A 1M5TA 2E4UA 3MIZA 4ML3A 4YR7A 1ZDMA 2IKSA 4JASB 4G0YA 1VLZA 3I45A 3N0RA 1EFAA 3LUJA 2QU7A 4O1HA 1JDPA 4E7PA 3E3MA 2CHEA 4ZJPA 2P9HA 1EHCA 3JVDA 1L5YA 1GLGA 3EQ2A 2R47A 4B09A 3DBIA 3DZDA 4RV5A 5F64A 2YHAA 5CNIA 2IYNA 1XWWA 3QELB 5FWYB 1NXXA 1VRVA 4YS6A 4RK4A 1BA2A 1VKRA 3GV0A 3RVRA 3UKJA 2WWVD 1AB5A 2LP4Y 5KC8A 4N41A 5IEJA 1M2EA 4RY9A 5IBQA 4KV7A 4Q7EA 5TQ2A 1APBA 4IILA 4WXEA 4G0XA 4MYRA 1NATA 3GT7A 8ABPA 1BVHA 1R8JA 4Z4EA 3IP7A 3HM9A 3RVSA 2B1JA 3VNAA 1D1QA 3I42A 4MS3A 3OMXA 4OLBA 2F8SA 4M88A 4XASA 3ILHA 5JNVA 2LPMA 3H5OA 3Q41A 3KYJB 1LBIA 4Z4HA 5KQMA 3DLBA 1SD5A 2PMCA 1IIBA 5DTEA 5TE9A 4RS3A 1E6LA 4KFCA 1Z18A 3LUHA 1GUDA 3FMVA 4EVSA 5FBHA 5TQ2B 3C3WA 3RVNA 3CLKA 4YV7A 1NXOA 3TB6A 5E3JA 2R25B 2PUAA 2QV0A 2FLWA 1LBHA 1DZ3A 1SXIA 4FB4A 2VUIB 4MQEB 2VUHB 3C97A 3QELA 2PAFA 5FWYA 2L18A 4XLTA 3LMKA 6ABPA 5KQGA 2HQRA 1PUXA 5TQJA 1F4VA 1JX6A 2MSWA 1FFSA 4D6YA 5I4CA 3FFXA 3L6UA 4G0QA 2QVGA 3SNKA 4EY3A 1Y1LA 1ZGGA 1Z16A 3GBPA 5IEBA 4MQEA 2A9RA 1TLFA 1ZN2A 4EYKA 4MR8B 2FMHA 1NTRA 5IUNC 1SXHA 4Z9BA 4PE5B 1W25A 5FWXA 4MQFA 3O2JA 4YLEA 4Z99A 1FSPA 5TQ0B 1LJUA 1ZESA 3BREA 3NHZA 3LUCA 1RXIA 3BILA 4YGXB 1S8NA 3LFTA 4OG2A 2FN9A 2GWRA 1GCGA 2IPAB 3KG2A 4N0QA 1A0OA 2GX6A 3F6PA 3QX8A 4YWHA 2PUDA 4MAAA 3O1HB 4MQFB 1JWLA 2O20A 4JA2A 2FTKE 3Q7RA 4RXUA 3OM0A 4W5NA 3KJXA 5HKOA 2I6FA 2FEKA 4Z4FA 4KREA 1Z25A 2NZUG 2E4YA 4ETMA 4EVRA 3OLXA 3RVPA 2PUEA 3QEMB 5JNTA 5CNMA 4S04A 3RVKA 4YRZA 2E4XA 2JVKA 4RSMA 2IDMA 2HQBA 3A0RB 4LDZA 4WZZA 3LUFA 4MS1A 4F3TA 3IPAA 5T7BA 5TPWA 5B3JC 3T95A 5C5CA 4EUKA 4IMJB 2FEPA 1KRXA 4MRMA 4UHKA 5BQ3A 1EWKA 3I09A 3GA5A 1YVUA 3OLWA 4G97A 3MMNA 4LZLA 4NICA 3JTEA 1U2PA 1NXPA 2H0AA 4RU1A 3HEBA 1USGA 4G0PA 2IOYA 4EVQA 4N47A 1DBQA 4DADA 2FSPA 1J56A 4MR7B 3W9SA 3M9WA 3BRSA 5KWSA 4Z9AA 4NCAA 5EWMA 3O74A 2A9OA 3GL9A 3DGFC 5IULC 4MS3B 1YS7A 2E4ZA 4ZMSA 5PNTA 2GKGA 4WT7A 3T6KA 5KI6A 1XHFA 1QKKA 3NNSA 2HSGA 2FMIA 2HJ9A 1QP4A 1M5UA 2HPHA 2NT4A 3H5WA 4RY0A 3N53A 2E4WA 2H3HA 3CS3A 5JNSA 3LKVA 3OLYA 4KK3A 2OENG 1Z12A 4KQCA 1H9CA 4LX8A 2VK2A 1KMIY 3N0XA 4PYRA 4PZ0A 2WB4A 3UK0A 2QSJA 4TMYA 2QR3A 4N76A 3CFYA 2F8TA 1YTUA 3H1FA 4ETIA 3EULA 2GI4A 3OLZA 2FEWB 2RJOA 5TPZD 3TMYA 3CZ5A 2PJUA 3H75A 3Q9SA 1LK0A 2ZAYA 3C3MA 2FMKA 4WWHA 4HYEA 5B3JA 1ZH4A 5JS1A 3I5AA 1YIOA 1A2OA 3CU5A 4RXMA 4RK7A 3H5VA 1EWVA 4Z0NA 3OMWA 4RK1A 3KHTA 4EYQA 1TMYA 3HCWA 5BRJA 3NNNA 3LUDA 3OQNA 1YS6A 2P4UA 1E6KA 3ROFA 1BDHA
chains in the Genus database with same CATH superfamily
1XJWA 1CBUA 3OD5A 5EJ5A 3PZBA 4A0HA 1RYHA 1WY5A 4G5GA 2ORYA 4P36A 3IVXA 1UZUA 1AVTA 1DO2A 4W63A 4D44A 5A6SA 3R9XA 3NR2A 3RUEA 3PX2A 1XPOA 4XYBA 4HNQA 2VSYA 4IKPA 1R4AA 3ULKA 3Q3HA 3N0TA 5JCOA 2FZKA 2BFEB 3JAMA 2FPWA 1QKIA 3DG9A 4CL0A 2ZTVA 4KXWA 3P2JA 3VTFA 1RQLA 4JLDA 3CSSA 5SV2A 1VP9A 2OESA 3DM5A 2FDRA 4PC7A 1Z47A 3MOGA 1P8JA 4TXJA 3E0QA 1PF7E 1BDMA 2JFHA 2ORED 2QN7A 4ZDWA 3COWA 3G9XA 2YL2A 3IUBA 1P8AA 2JGIA 3U17A 9ATCA 2ZSIA 5AJYA 2E0IA 3DKPA 1WDKA 2XB6A 3EW9A 1AUXA 2DJIA 4CM8B 2V8BA 2YMQA 1HDEA 1FX1A 4R8KA 3R74A 1ODKA 1QP8A 3DDNA 1B26A 4ZJUA 4QZVA 5KTKA 2HTEA 2VTBA 3OIDA 4OK3A 5M29A 2Y3IA 1GP2A 4CF4A 1K68A 1NHWA 1RNLA 2A58A 1G7RA 1OVMA 2G4LA 2WUDA 3MRVA 4CKEA 1EIWA 1NOKA 2GTPA 2PO5A 5E2IA 3ITDA 1TTHA 3U3XA 3WYGA 2O0JA 2ODPA 3GRZA 3QTTA 1ORHA 5CCEA 1RM4A 1FDUA 2ODTX 4P81A 2O7QA 3SEAA 3WXBA 4KO1S 4ZT5A 2IHBA 1UKYA 2YJTD 4MSUA 3WGVA 4DCVA 1GFSA 1SEPA 3SZLA 1IL0A 1BDIA 5C1IA 3N6VA 3CJRA 2ZRHA 3WIDA 2OBFA 2ZI6A 4V2UA 2VDJA 4OYRA 4TRRA 1WHTA 4ZGGA 4EO4A 4J1QA 4QTZA 1C8VB 1N1GA 3DTNA 1SY7A 3U80A 5HJ7A 3FCYA 3O8BA 2Q3DA 4GP9A 4AZ3B 1PFQA 5CP8A 2R48A 3T38A 3PQ8A 5F3RA 1ZOIA 621PA 4X0EA 3QOYA 3QW4B 1N2SA 2WFMA 2GTIA 4R9VA 3L1JA 1TM2A 5D86A 3M5DA 1NRWA 4GI2A 5ELLA 1Y9AA 1PS0A 1UJ5A 5HTOA 2ZJ1A 1QBGA 5AW8A 2TECE 1IDN1 3L82B 4X20B 1U3UA 2GQ0A 1ULAA 1PR5A 1UMKA 5A03A 3SF8A 3LKBA 5DYYA 2Q4DA 3LY7A 4OPMA 1MPXA 3FFWA 5A3SA 1JS1X 3P9IA 3TIGA 3GEIA 1ZISA 3NIBA 4BBZA 1E4VA 3H2GA 4EQ6A 4F8EA 3O8CA 3G0GA 4Q39A 4UHJA 3HYTA 1VSBA 3BRWD 4R1NA 4Q03A 3UJNA 1G21E 3SQWA 3OKAA 1UJ6A 1VQ1A 2HV8A 3OU2A 3ONEA 2IHUA 1SWVA 4P83A 2AZTA 3OVMA 1TU4A 1XDWA 3L92A 1KY4A 2C0QA 3PUWA 4BGDA 3SYMA 1JDNA 4JUBA 2GJ9A 4WOPA 3R7NA 3ROMA 4HH1A 3ZE9A 1OLXA 2AOWA 5I51A 3AQ4A 2A9QA 2Q5CA 3TCKA 5HUHA 2ANCA 3GWGA 3FOCA 2D7DA 1ICEA 3GCDA 2RGAA 3E7FA 1CY7A 3CR8A 3B82A 2C4HA 4NMXB 5GINE 5C4GB 3T5GA 4RM2A 2JLYA 1VPDA 3IQZA 2PZKA 1RXUA 3CNQS 5CX1B 4O3MA 1XZBA 3GF4A 1KFBB 1N0WA 2Z4RA 4J3JA 1ECFA 4X8MA 1J2RA 3IPCA 5KWJA 1Q0PA 1H2XA 1EX6A 4ZRMA 4RTRA 3VH3A 3Q12A 5IF3A 4MQBA 5JZSA 3IMFA 2DB3A 4UOZA 3TW4A 3N2NA 5FQNA 4B0OA 4DDTA 3RSOA 2O7RA 4DJJA 5JS8A 2XX3A 4RMHA 4PZCA 4C22A 2UUBB 5AUOB 3WMGA 3N75A 2VTDA 2NU9A 1WDMA 1W0KA 2XCUA 3VH4A 4C0AC 1KSJA 1CQIA 2AZMA 2WKQA 4A91A 5AQEA 4H1TA 1W75A 2FPOA 3CBGA 1RIFA 3VDQA 2Y77A 2H1FA 3TX2A 2YHUA 1KEVA 3OQIA 2LUOA 3EZ7A 2Q28A 2ZSFA 5F2EA 5G4KA 3NDIA 4LVCA 2FFBA 4OHFA 4CV1A 5HBGA 4DDWA 2O3SA 4U2KA 4PX5A 4JX9A 2ZAGA 4M53A 3K1YA 1WW8A 4D8TA 5IJ0B 1RXWA 4KG7A 2LBPA 5HR5A 2C84A 3M4XA 4DLLA 1OR8A 5BWMA 1SD1A 3I73A 5K8TA 3K1TA 3L49A 1QK4A 2E9SA 3UPDA 4BE4A 4ZXPA 4Q4AA 4UEKA 2CVZA 5KTYA 2NYUA 3OE7D 5EZYF 4R2LA 3ZDXB 5I6DA 4FCCA 1JL3A 4RJLA 3D31A 4O4IA 4B4KA 2R7NA 3AHIA 4O0MA 4IMPA 3H42B 2BMAA 2WAMA 5BWNA 4TWZA 3HR7A 4LJLA 2AN4A 2VPQA 4JXXA 3M6XA 4M36A 1RRCA 4NE2A 1QX3A 1QMGA 1ZN9A 2XTJA 4OTZA 3OKFA 1SIWA 4B87A 1J33A 2CL0X 2ISQA 2Y1KA 1I51A 1TTPB 1IPHA 1OTHA 2UZ0A 5AKIA 4AY2A 5EZQA 1M34A 1M8GA 2IEZA 5G0VA 4PYOA 2CC2A 4XH9B 2EW1A 1X8XA 2FXIA 3Q5EA 3F9CA 2HHJA 1L7RA 4BLRA 3BH7A 3HXPA 1D2EA 4ERNA 5ADHA 1E1DA 5GZ1A 2YRFA 4P33A 1NF3A 4W5QA 2ZIVB 4IJUA 1QVVA 3NTRA 3AL2A 4EECA 2KB0A 1LDBA 2JCSA 1S2OA 1E2PA 3KT3A 2D13A 1UQUA 1ZNWA 2JASA 3M33A 2PKQO 4FQ5A 4PZEA 3SHWA 2ZJZA 4MB0A 4L0MA 1OY1A 3PC2A 3U1BA 1R50A 3SDSA 1U0OC 3DHYA 3K16A 4EUNA 3G8YA 4QOGA 5EE3A 1UXOA 2GVDC 3UOWA 2UV8A 3L06A 4Y0VA 4X60A 3TZHA 3OUTA 1EUCB 1L7AA 1TX4B 2OAQ1 3RUDA 4YP0A 5CH8A 3I6BA 3MJCA 2FSHA 4HS4A 4BFXA 4ZO7A 2FQWA 4WY2A 4LFAB 4TLAA 4AJOA 2RAUA 5DPMA 4KIUA 5IYZB 3F6BX 4QU8A 4MW2A 3MFYA 2ZW9A 3L7DA 2C2YA 4X8OA 3RRZA 1P7VA 4BL5A 1UP7A 3LHFA 1EM8B 3KOWA 2X1VA 3OLQA 5LCXA 3VHXB 2G9RA 2W2NA 2NAFA 3CKLA 2NOAA 4I5DA 2PUVA 4O4HF 2C3OA 4Z51A 5MF6A 2BKVA 3F5FA 4BVFA 4OJNA 5ICSA 1I4DD 2OHHA 3W05A 4AM8A 3EGXB 5DHAA 4DN6A 2XBMA 1T26A 4YIKA 1AQLA 1IM8A 2F64A 4EHFA 1FBTA 2WYHA 1JBKA 1SA0A 4CQNA 4G65A 4AMUA 2VZ0A 1N7HA 3G2QA 3P9NA 1A27A 4AJ4A 3NAMA 4B3CA 1JDUA 3BGWA 2PS0A 2I7DA 4CTJA 1Z39A 2OOSA 4MARA 2EHJA 2LRHA 4HI0E 4PZLA 5DO9A 4YYEA 3AVTA 3KLBA 3PRKE 1M2HA 1XLTC 1LF0A 1YCGA 1A9PA 2IU3A 1ZQ9A 3WWEA 1U3CA 2QJWA 4PQYA 3EAGA 3KHSA 2EDAA 4MUYA 3HVRA 1BW9A 1CR1A 3VRHA 5LR6A 3OCYA 2CLDX 4IPTA 2O8EA 3QOWA 3N28A 4IJWA 2Q1TA 2BFNA 3HEMA 1X7DA 4NCXA 1A8HA 2ZFUA 1KWGA 2EKDA 3FSEA 4FVTA 4MIOA 4NSNA 6REQB 5IKPA 4X54A 4OGWA 1Z2PX 1ATZA 1T9GR 1WKBA 3C6MA 4E5NA 2DLCX 2VJDA 4QGAA 2ISCA 3DNMA 4E6EA 3K8ZA 4MGEA 3E7WA 5K6RA 2HBZA 4F3YA 3FBWA 2C03A 2GAJA 3P2IA 3NAZA 4MWGA 3VNQA 1SQFA 2YTZA 3MJVA 3ZZTA 3DHNA 1RRGA 3I45A 5JUWA 2O3RA 2HB6A 5CYPA 3VU8A 2C98A 5ADWA 1ZM9A 3SCZA 3ZV4A 5JD5A 4AUMA 1KVUA 2AFVA 4NU0A 2B8NA 1QTNA 2AT1A 1YUMA 1Z2OX 1IZ7A 4YREA 2X40A 1BXRA 4Y2TA 4I7EA 1W0KD 4OQLA 2PT6A 3ESRA 1NXXA 1TW2A 5JEEA 2QTFA 2XGSA 3H9GA 2IF0A 3EH2A 2EG9A 4GL4A 3S6JA 3BHNA 4LXTA 4QECA 1CZLA 1Y5LA 1PEKE 1I3KA 3HVHA 3RYHB 1GPNA 1G20E 1W1IA 5JAMA 4IMRA 4PHCA 2JARA 3UJ9A 8ABPA 2HPVA 5KTOA 1OLXB 3BAFA 3O2NA 4FD2A 4G0NA 4Y9SA 4YH1A 3E1GA 2NQTA 4ER5A 3AM3A 4BXOB 1Z6TA 2F1OA 1F4LA 2G9VA 3GBSA 4LF4B 3OMXA 4ZEXA 1ZX1A 3V48A 4ZVTA 3ICVA 4RJKA 5DYWA 5HUQA 3RROA 1RHUA 1Q20A 3B52X 3DVSX 2GAAA 1UINA 3JQFA 2BMDA 4L75A 3ZKWB 4ASUA 3Q6NA 3WFJA 4Q9DA 4DR2B 2FR0A 2VLIA 4KPFC 4EVSA 2WABA 1SCUB 5TQ2B 1LI5A 4HG2A 3T7JA 4OQPA 1E0JA 3L7AA 5ALZA 4BJ5A 3T3HA 1HKHA 3ZJ4A 5KYXA 1KZHA 1GG5A 5DSZA 3U40A 3TIVA 5HX7A 1Z7GA 3R3SA 4XVHA 4V0OA 2W98A 5FWYA 4OGKA 5DSXA 1XQ1A 3VVCA 2ZSAA 1OT3A 5LXTF 1QG6A 4P54A 4R2XA 1CQIB 2WICA 4C88A 4ZFNA 2MSWA 3M3DA 3PIRA 3CPSA 4NFHA 1DBIA 1H8EA 3DCYA 3RT9A 3RRNA 4M1MA 4MQEA 5LNK6 1CB7A 5ES3A 2RAFA 5AKZA 3EIEA 4EYKA 3KZNA 1G38A 2C78A 2PRSA 5DNEA 1QYXA 5HW0A 4N0MA 3DLPX 4NDNE 4P84A 2FSVC 1HL7A 4PGFA 1Z3IX 1I80A 1H2HA 2CT8A 2FCRA 2H5IA 2QTRA 3LUCA 4PZYA 1EDZA 5CLJA 4WOCA 4RWZA 4Z9FA 4H4EA 1T4CA 2B21A 2JAOA 4A92A 1GHTA 2ZJ6A 2H7VA 1EGVB 1DAMA 3ZI7A 1FMLA 4KAJA 1TT5A 3IUPA 4KXQA 3NHPA 4MGYR 5IG2A 1A9RA 3OT4A 4D9NA 3V8EA 2O20A 3DOCA 2FTKE 4IDQA 2D74A 4PLFA 4D99A 8GPBA 2BTEA 4FZ5A 3OJLA 2YN0A 2FEKA 4KREA 1AKEA 3BOSA 2AMJA 4KXXA 2NZUG 4NS4A 3CRMA 1XT6A 2P1DA 1DG3A 1E94E 5LP6C 3BWBA 4KLCA 2BVNA 3CEJA 1P1BA 1X0XA 3FNRA 3R8XA 3W5UA 1U90A 1OZGA 1ESEA 1RFLA 4RCZA 4YCAA 2EZ9A 4ARVA 3OFJA 1KH2A 1SU7A 3OC6A 3O4HA 2DP4E 1TO6A 4MO9A 5DRYA 5C5CA 2VPIA 3EUEA 1MCZA 1Y3BE 2IV7A 1CFJA 5DGDA 3UMMA 4EJ6A 1UDXA 2ZTHA 1FJHA 3JQFC 2AZ4A 4RHXA 2HWWA 1KJYA 2WM9B 3RU3A 3WDLA 3WXMA 1IN1A 3GNLA 1COZA 2UUAB 2XYRA 3N87A 4L5BA 3LP8A 4UXIA 3UGJA 4KJZA 3KZVA 3OP4A 5IVPA 1BMFD 1BKDR 4BEWA 5KOYA 1AS2A 3GT0A 4JBIA 4EX7A 2IIBA 3GUYA 5TX7A 1VPEA 3C3AA 3DUFA 3CEMA 4C20A 1WW2A 3O74A 3U44A 3HCPA 3T1VA 1CWUA 1R6BX 3CH5A 3IRUA 3TBFA 1NF9A 2GKGA 4BNDB 4WT7A 5DN6D 1EFKA 3G7UA 2Z5VA 2ODEA 1HDCA 2P9BA 4QBFA 1N2BA 4MV3A 5HNKA 3P9KA 4C0HA 2XE6A 5ALTA 1JRLA 2ZRAA 2PWPA 3ID6C 1X92A 3THSA 5E1DA 4AZVA 4DRXA 1GPAA 5C46F 4CMKA 1XZLA 4I6EA 1U7PA 3ZIAA 4YAKA 2EP5A 1E1CA 1BCRB 5K45A 1FU4A 3WDSA 1DSSG 3ZJUA 5AKXA 5HOQA 2OBYA 3CZ5A 2ZAOA 5ICMA 2JAHA 2GXSA 3RUHA 3R9WA 1T5BA 2J67A 2XNCA 3C3MA 5ALUA 2IZ0A 1AF4A 2ZQZA 3ZCSA 3SX2A 3GRRA 3CB4A 1BYIA 1ZVQA 3HA2A 3TFWA 4QL3A 2JHCA 4N40A 5AW9A 3T1QA 2BEUA 2OLKA 1GGNA 2O5EA 2Z58A 4JS0A 1ODLA 1MX9A 4MPPA 3ZV3A 4AMZA 3EF1A 3TGWA 5K6AC 4NC9A 2FVXA 4Q01A 4JKOA 1ULZA 1CQJB 3HCWA 1YZQA 4F6RA 2IK8A 4PNPA 3MGBA 3T1NA 5IDVA 1UZAA 1VHLA 2PZEA 3HDYA 3IBGA 1YZTA 3N2EA 4HAIA 3RC3A 4BP3A 4HXFB 2UUOA 2YJ6A 3I5YA 3K2IA 2GD2A 2VDNB 3LHSA 2ONCA 2AG1A 2CDRA 3KJFA 3AWIA 1JF8A 4G5YA 1V4VA 1BE8A 3T9DA 3QNMA 4KEAA 4YMTA 3Q88A 1LDYA 1S3GA 3K6KA 4UU8A 1N4AA 1JHZA 4E08A 1F06A 4HV4A 2QLBA 4LZNA 3U4QB 4NZZA 4GHWA 4IX9A 4XYLA 5TRTA 3E9ZA 4F7WA 4EY4A 4BZZA 2OORA 3N2GB 4M87A 4PWYA 5AM1A 3HI4A 1KPGA 2D1QA 1ZUIA 4H27A 1XE3A 4O2BF 2Q41A 3TWOA 3UAOA 1A5AB 1TYEB 2W83A 3DMRA 1M8JA 2G83A 2FSIA 4X6YA 5DHTA 3ONFA 4QSMA 2FLKA 1WTAA 1THMA 4HAVA 1CS0B 4KO4S 1WB9A 5CD1A 4BO5A 2NQ8A 3TYXA 4LJ7A 3GQBB 3A25A 4TYWA 4N4AA 3HV2A 1H42A 4AO7A 3ENVA 1QH0A 2XD4A 2CB0A 3ESZA 3DE5X 3WWCA 3NRCA 5LFAA 3TECE 1AKYA 1SBYA 4LQ4A 2HK9A 2OYCA 1U1DA 1NJ5A 3LDUA 5CVEA 1TJPB 4CMEC 1CSEE 1P17A 3L1VA 4A0RA 3VKHA 3AZPA 4YRNA 3TBHA 2R60A 2YIMA 3N3BC 1DRVA 2F62A 3RSHA 4RKWA 2HMYB 3SIWA 3GLFE 3QVVA 5E9QA 1OXKB 2IBSA 3IE1A 1IIRA 1JIIA 3IJ5A 4RFVA 3OZCA 5F33A 1E2QA 2FOXA 4KXMA 2WWYA 4JNCA 4MDEA 5BYBA 5LPNA 2X8JA 3QU7A 1LD3A 2DHDA 2FPGB 3T4EA 4CKCB 3M3HA 4V0ME 4B3GA 3P2EA 3QXGA 4M49A 2H2FA 1EUQA 1ADFA 3D9QX 1PW7A 2CZCA 1S2LA 2QQ0A 2V03A 4DKJA 2C4VA 4HWPA 4POAA 4RFSA 4TM7A 5J23A 1TEXA 3KZ1E 2G76A 3K8OE 3R1IA 4PXAA 2ILTA 4MHOA 1E99A 4RBNA 3G9ZA 4KMMA 1G20A 4UE3S 4WASA 1GTVA 2TSYB 4IVRA 4BNMA 2UXCB 2PGIA 4LRQA 4M22A 3JQQA 4ICIA 1GGEA 4NH0A 4ZCLA 2MSLA 4Q3EA 2OLEA 3ZUPA 1AC5A 2RH5A 2P6MA 2PBZA 1WCXA 2EFEB 1X86B 4JLAA 1G8GA 2NU6A 3FDZA 4OATA 1OAAA 3WWZA 4IEIA 3A6DA 4G01B 1L7QA 4LRXA 2XMSA 1Y8CA 1F14A 2FU5C 3GFRA 4H77A 1G8JA 4MKRA 4U1RA 4B74A 2VDWA 3BCRA 3ET4A 2HW8A 5J4LA 1RRKA 3MMSA 1EK5A 2WSBA 3KKEA 3MJEA 4X1OA 3OQ6A 1V8OA 4P4NA 1QJ4A 4NYJR 4X95A 1U9IC 1T8UA 3FI0A 3U6KA 2V65A 4G26A 2QLFA 4H1HA 4J16C 5EUQB 4DJEC 5I7SA 4WUVA 1O8CA 5BMOA 4YHHB 5EIHA 4KZKA 3WX0A 1HDZA 3Q7SA 4L2IB 1R6AA 2RGUA 4LQDA 1SHLA 2FZVA 2IZOA 3H5RA 3QLVA 4KVFA 5AHKA 5ILQA 1AUQA 4M7WA 2J4DA 4PICA 4RLSA 1PEYA 2ZJYA 3GVIA 4FP9A 4NTZA 3RS0A 1OSNA 4ZCTA 4DQKA 3TLGA 1KI3A 4BMDA 2CNWA 3KEOA 1J1IA 3RIXA 2WZBA 5AJWA 5CB6A 1F12A 3QXJA 4M9UA 2YV4A 2PUWA 4UAGA 5ADUS 1SIOA 1BX3A 2PX4A 4UHBA 5TV2A 5JYDA 3G1UA 2V7GA 2QRNA 1CRWG 4X97A 1HE4A 3AF0A 3MRSA 1PK8A 1ZOOA 3MQFA 5CDYA 1P72A 1VG9B 3KXDA 4OBBA 4UNNA 1AXGA 1VE9A 4MEJA 4AJ9A 1STOA 1ONPA 3PNVA 4QDTA 4YAUA 3K92A 5HVNA 3IL2A 2IEIA 3B2NA 3NHUA 2DUJA 3B6MA 4WE3A 2OECA 5GP1A 2ODWA 2HXYA 2QZJA 4NQRA 4WVLA 3GP5A 1DKQA 4C4ZA 1W4LA 1GR0A 1ZNYA 1YMUA 5ETJA 3E7XA 2DR0A 4D02A 3H2ZA 2W2PA 1TVMA 3K9BA 5CVVA 4ZQIA 4D74A 1IHPA 3TPFA 1ZG3A 5ALKA 1IOLA 3TRDA 3R09A 3G2OA 3QKWA 3L7KA 3L77A 3VHLB 2JANA 3H8JA 1MC4A 3FH0A 3HCDA 3KUKA 4CR6A 1B6TA 1YA4A 2GUGA 5JZ9A 4GBMA 3ICCA 4DARA 5IBRA 1SXJA 4DWJA 3SI7A 5AI4A 1P74A 5KVAA 3LUPA 4PLVA 4YAWA 3VSCA 4IDDA 1MEJA 5C8YA 4JSYA 2QRHA 1X2BA 3GXOA 2HD4A 2AN1A 3IERA 3UT6A 1XP5A 4NCBA 1U6KA 3G2IA 2VBGA 2Y92A 1W85B 4W82A 1T2FA 2ID8A 3GK3A 3PGXA 2X41A 4OQ4A 2H2AA 3PT9A 4O2RA 1FYVA 1KQOA 1WQ1R 2Q3MA 1Z5OA 4NBWA 4JITA 2Y68A 2JJQA 5HQTA 2G4CA 3NT2A 4IJ6A 5J58A 2R8PA 2ZU0C 3JD4A 1NVUQ 4Q1BA 3PFNA 5H80A 3BICA 1Q0SA 3E7DA 2A1UA 1V3TA 1VXOA 3VR4H 4CIVA 5JALA 4E7OA 4ZVLA 3KDPA 3MUOA 2OCYC 1GQRA 1UUFA 2OPHA 2AXQA 1YKGA 3D2AA 1P62B 1IOWA 2QNIA 4N8SA 1LK5A 4QUKA 5CPBA 1S3FA 5HILA 3LT2A 3RLIA 2AMFA 1OW3B 1XDSA 1ZK1A 4NYIQ 4F2GA 2I3ZA 3EOZA 3R3WA 2X0EA 5D84A 5FBWB 2BE9A 4RX1A 1X1BA 1LI4A 3H4MA 2Y1EA 1YF3A 1J97A 2OV3A 2RHOA 4B2LA 1N5KA 2R6R1 5JYEA 1TU3A 2EYUA 1L1QA 4MXDA 5FWAA 3BSWA 3AIKA 5FOXA 4EA6A 3GJYA 2WMNB 4G86A 4XDGA 1TPYA 2A7XA 1ABBA 3L3BA 2CV2A 4RV4A 4EKYA 1GU1A 1P7YA 2NIPA 5F9MA 2ZT8A 4NYMR 3GJRA 3IP9A 4M8KA 3MB5A 4LTMA 4UEWA 3JZMA 4WPGA 3K20A 3C5VA 3KS9A 3V6MA 3VPDA 2JFGA 3ZVLA 5BYKA 5KJFA 3QLEA 4ZKEA 4BNJA 1EP9A 1TGVA 1O7JA 2WSSD 2ZQYA 2NO0A 5AKEA 2Q5QA 3VTZA 3EEOA 2PE5A 1A4RA 1U0GA 1GPDG 1X7GA 1DAFA 2J3QA 2QXUA 3MAJA 5ECGC 4Q48A 1F8UA 3A36A 5JPIA 2ZPAA 5BN5B 2HLDA 3W3AD 4BS9A 5HKBA 2G0TA 4E5KA 3SVZA 2BMFA 5IYZA 2RH8A 1PDOA 2FQXA 2OQIA 4NMWA 1UOQA 4IH9A 3SN6A 3E58A 4LJ4A 4MHSA 3B2QA 2J0VA 2VYFA 2KJQA 4UXJA 5JXJA 2OGWA 4IGIA 1BEEA 3TQHA 2PNJA 4Q4DA 3HHEA 5FTKA 4R7ZA 4Q9NA 4ITUA 3Q4GA 5JCJD 1WHSB 4Q4AB 1E8MA 3QFCA 4FR0A 2CB9A 3QG5A 4HFMA 3WKAA 4F46A 4GPAA 3UQZA 2AXNA 5TDHA 3ETGA 3QVWA 1CRPA 2WUWE 2AHOA 3N0WA 3UH1A 2PX6A 5FO1A 3ODPA 4KQIA 1NC3A 3AFGA 1NKTA 2C3YA 4FUQA 1MB9A 3G2HA 1G5HA 2AG8A 1Z7WA 2CFRA 3Q3GE 3OT5A 1VOTA 2VNJA 3RFUA 3PEEA 3LBFA 4RNCA 1DBPA 3RS8A 3MTDA 1OBCA 4OYYA 1EZ1A 2GBGA 4LJKA 4Q7QA 5IXSA 2Q9AA 1E6MA 3AFIA 2C9ZA 3AP1A 1SBCA 1BXKA 3TOSA 1Z6ZA 3R6LA 4OIFA 4BVAA 5C7OO 5AUPB 4DDKA 1ECLA 5JH7B 1WSBA 3BXZA 3QFFA 5BR1A 2X3YA 4N9WA 5G1OA 1V1MA 1A5BB 1O77A 4F1KA 3V1YA 2D59A 4Y2JA 2NTEA 5K5EA 5D1NA 3RUCA 2GAFA 1G5FA 4HNGA 2ZP1A 1MB3A 1P44A 3RSLA 1M5TA 4LW8A 3PGJA 5CT6A 1U65A 3U7HB 5DP1A 3S1AA 2Q07A 4MKIA 2ZYGA 1L5MA 2YJZA 5ED0A 3VR3D 2I4RA 4M8SA 4RVHA 2I3GA 3AI2A 2CHEA 1ISHA 3H99A 4IDHA 1L5YA 3C70A 3QVXA 5KSOA 2NUAA 4KSYA 1RPNA 5BVHB 1QGZA 2QR2A 1HSOA 3EF3A 3BF7A 1V1MB 2Z3VA 4Y6SA 4DWWA 3ZHZA 1L5QA 3DNPA 2BP7B 4C7XA 1GAXA 1KNXA 4O5OA 3ABRB 4E21A 5CA1F 1I7SB 1BW9B 4GVXA 3W34A 2HBRA 4HRAA 1IEQA 4K2HA 2PUJA 4DV0B 3RBAA 1R18A 2YNMD 3S8YA 2GPNA 4MNTA 1FNCA 3WK7A 4KBGA 5IBQA 1B43A 3CF4A 1K97A 1W30A 1APBA 4H4DA 1NVFA 1GXSB 1S9HA 3FUUA 1DTEA 1R8JA 4OA5A 4BMZA 1R2QA 4RZQA 3WOVA 1FB5A 4ZTUB 1BHO1 4QJ3A 3I2KA 3WP1B 5FBQB 4RJ2A 1JG2A 1IAQA 1B41A 1IN4A 4ALIA 3QA9A 2QP4A 2I1WA 3ZIAD 3VVLA 4IAOA 2RMKA 1E92A 1WSWA 2FMXA 4AB1A 1MVLA 1NBAA 1IIBA 2C96A 3VQTA 5CJPA 3V7UA 2ZIGA 1P2BA 3DFKA 4ZAFA 1JR3A 3UATA 2CCKA 4U3JB 5CB0A 3RRFA 4HDKB 1NDUA 3FYSA 4Z53A 2X13A 5FUBA 4MUIA 1IVNA 5TGTA 1NXOA 1T2VA 1O57A 1QFXA 1T3HA 5JFOA 1YSCA 4JLNA 1E0SA 1VJ5A 4HAZA 1NQVA 1JFLA 2H4JA 3R9KA 2VDVE 1CJVC 1R4NA 3KQMA 4IIHA 4MW6A 4QGBA 4FB4A 5B36A 4XX1A 4JQYA 2OZLB 2XTMA 1Z37A 2VPYA 3R40A 3UA3A 1Z62A 1GFWA 3DBHB 4EJMA 2FDXA 5JFTA 1X39A 4QG7A 3D8NA 4JWTA 4IIBA 4ND6A 2ZT7A 1UPUA 2ZBVA 1JHPA 1FXUA 3ETNA 3TKYA 3F7TA 4M6WB 2QORA 1K89A 3K73O 2PSSA 1TD9A 2Z2ZA 1M67A 4D5GA 3R3YA 2PCJA 2PQ0A 1SXHA 4OP3A 4Z9BA 1L3BA 2AUTA 4PE5B 4EITA 5F12A 5LVAA 5FWXA 2FQQA 4NZ9A 4YLEA 3RS9A 4EG4A 4FFBB 2C83A 4OQMA 3UIEA 3G0DA 5CB4B 4KB5A 3OF3A 4AL4A 1PFUA 4RQBA 3BFPA 3SVTA 3FYTA 4JEUA 4NECA 2P9CA 1JLRA 3QH4A 2GK6A 3ZWBA 3I9FA 1EGHA 4JQSA 1GQYA 5FD8A 3H9QA 1H2RS 2EX4A 3QX8A 4KQXA 1KDVA 2ACKA 3K96A 3Q3IA 4L16A 4P4SA 2K6GA 3FTCA 1U8AA 4YRAA 3USZA 2B5WA 3IYLW 3LD9A 4PFJA 1KFJB 4UUMA 4F21A 5JD4A 4AKSA 1ZBQA 4W5NA 4XWKA 1BOOA 3KFXA 3THYB 4DV3B 4C01A 4U5XA 2NNWB 3R0QA 2BGRA 2W6NA 3QEMB 1TQ2A 2VT6A 1EQUA 1WKCA 1T2AA 3ZQJA 4RETA 2GRJA 2PXAA 2WF8A 3E9DA 2C5GA 2QSUA 4NS1A 4NZPA 4X6LA 1TYZA 3TNYA 3DPUA 2FZWA 3PFGA 5CVDA 3UV7A 1BQ4A 1MHTA 3PJFA 1TGYA 3GFBA 1DJLA 4B6RA 3I6ZA 4QNRA 3BX1A 5TF4A 3IRVA 4R9SA 1WXWA 2ZJ3A 2OMKA 1S2MA 3AG6A 1XD8A 4WZBA 5DBEX 3KKNA 2WAYA 1R6XA 3GROA 1FQKA 4RU1A 1XEXB 4BRWA 2IU4A 2RI6A 1ZK4A 4EVQA 4QAJA 3RTAA 2DTDA 2YFKA 4OHZA 1J56A 1R6UA 1W5EA 3UJHA 5F9FA 1CXZA 3TRIA 3HABA 4G8BA 2DPHA 4FKBA 2QD1A 4Z9AA 4Q1VA 4QJ5A 2A9OA 2B2CA 2GEBA 3OZAA 1JHOA 2E4ZA 3AV0B 4E5DA 4RYDA 2VUSA 3CRQA 1A97A 2H92A 2GF9A 3Q7EA 5FL7A 5AVKA 1DIHA 1GDDA 1A1SA 5IJ9B 1VCHA 4PCUA 2FMIA 3G7SA 3LRXA 1H3EA 1KDRA 4DB2A 1EYZA 1SNYA 3JYQA 2XJ9A 3MTJA 1SUFA 2D8MA 3HN2A 2L69A 4J8PA 1S7CA 4NHEA 4KN9S 3P20A 3GLIA 4PZZA 1CJMA 1Y1SA 1Z12A 2IP2A 3A4TA 3NTUA 2DFVA 1EXDA 2C2WA 1CUCA 2QLTA 2XWSA 4MI1A 2WB4A 5DEIA 3A14A 3A4YA 3DDUA 3P9ZA 3E05A 3LSYA 1A2QA 4TTAA 5BXQC 2EVWX 3CLSD 1ZOSA 5HK8A 2CVQA 5IZ4A 3CVYA 4N1AA 4JY7A 2CLCX 3U61B 1OH6A 2FF7A 3N2KB 2FPPB 3CX8A 1TK3A 3RYFA 1YIOA 2I7XA 2ESRA 3YASA 4LDNA 5AUNB 2UYHA 3LZ6A 4JJKA 3T0GA 1XJ0A 1AGXA 3IOCA 1NV9A 3NBYC 2JI8A 1BGXT 3I6YA 3O8NA 4CLHA 4AK9A 2G5PA 5G3ZA 4LWPA 1AKWA 2H4ZA 5BRJA 1X80A 4OP1A 4IH1A 1M66A 1YS6A 2BT4A 5EQTA 5C35A 1BEZA 3T5DA 1P75A 3N59A 4EI8A 3C43A 5JR3A 1FE8A 1NQUA 4L28A 3ZE2B 5JBQA 1QIHA 2X76A 3CLUD 3GGGA 3OJOA 4UDOA 2R5FA 2JDIA 3JV7A 1JQAA 3IDOA 4CM8A 1VKZA 1Y33E 3BKXA 3AY0A 3DFMA 2BFPA 1H94A 2X7XA 3KUDA 1JHDA 1Z5WA 1Z83A 4TS1A 5CH5A 4EG5A 4IHJA 1LJLA 1C4WA 3AQIA 5DM2A 8OHMA 1CEYA 3L18A 2F3RA 4ND4A 2HHLA 3TW0A 1KJIA 2CXHA 1R27A 3LDGA 1A71A 4H3KB 2VG8A 4QDOA 2BBSA 3ABOB 3I76A 3OCJA 4QOIA 1YFLA 2JG3A 1C9JA 1TZJA 2RARA 1SVUA 4AUEA 3E8XA 4NARA 4LE2A 4RD3A 3O83A 3RTGA 4EA8A 2QMQA 1CYEA 3BMCB 5ESDA 1HZJA 3E7PA 1U4OA 3PBKA 4YJGB 3RNLA 5I9IA 1FYFA 1L7VC 3QMWA 1N9GB 3DDOA 1TEVA 4IW3B 4FGKA 3KK0A 1BSVA 3KZOA 1HTWA 2X7HA 4XGRA 3Q3VA 1JJ7A 1TB4A 1ODFA 4Y2YA 3ZGXA 2HF8A 4KU4A 3RC1A 2OVFA 4W6QA 1I1NA 2Q4RA 1E3JA 5JMWA 4H1UA 3CXUA 4KVGA 3RSQA 4JOSA 5AIBA 3BVPA 1XLTA 4TTTS 3L4BC 4IQ8A 4HZGA 3EW7A 4IZIA 1XV5A 1NVAA 1X7WB 3HB7A 3ND9A 4MV7A 4OH1A 3RVLA 3TTWA 4AURA 2IH2A 3COJA 4ZAGA 3V00A 1U6IA 1SG0A 1FNBA 2OTCA 3LKDA 4A6EA 1NFFA 3UXYA 1V5EA 3D0OA 4BC1A 2WAAA 5J4HA 3VSDA 3W7AA 3B9BA 3GVPA 2RGYA 2ZLBA 4CKWB 1AX9A 1N5IA 2BC9A 2CDNA 4TV9B 1RABA 1TT7A 4J0GA 1ZITA 2QNBA 4HADA 4DDUA 2IJGX 2V7PA 2ZVPX 3DOIA 4D0LB 2G4VA 1U2DA 2ZOSA 2HPZA 2W93A 3PEYA 4IDEA 4BO7A 2RC6A 3W4KA 4D9IA 3AK4A 3ND8A 1J25A 3LLMA 3CVJA 1L8QA 4HDMA 4C6SA 4ZDKA 2FRXA 1HPLA 3FKQA 4DHEA 1NT2A 3C8DA 3E2PA 2W6IA 4HGZA 2JLCA 2RHCA 4RJIA 1TUGA 3WNZA 1U3TA 5IC5A 1CEEA 2VK4A 4C04A 3PKJA 1GRQA 1ABFA 3AEKB 4ALJA 3II6X 5DLEA 3TR5A 5AK5A 2XYGA 3ETCA 2HIMA 2HK8A 3G1WA 3CZMA 3R76A 4AJLA 2D5IA 1F38A 3FY4A 1S8AA 5INTA 2F1HA 2XUOA 3PXBA 4CV3A 4AKHA 2H52A 1NSTA 3DAFA 2CDAA 3QKSB 1VFNA 4FSXA 1RJ9B 1XNHA 3ECCA 2PDAA 5CBPA 4UU7A 5ITZB 1E2MA 1W46A 4ZALA 2Q2VA 1BRTA 1NG1A 2GDJA 2I80A 3QE0A 2BUAA 4TLLB 4Z8XA 3O8OA 3MC1A 3U26A 3U09A 1GTSA 2D54A 4JEMA 2P5YA 2NUTA 2JFBA 3JTMA 4N18A 1UKAA 2HDNB 3OM8A 1A8IA 2WTBA 3OOYA 2BR4A 2B7CA 4G1BA 4UVIA 3A6PC 1CZNA 4NAHA 1PHPA 1VLMA 3MWJA 1EXNA 1XCPA 2XMZA 1QTRA 2QLMA 1YHYA 3LPDA 4RHYA 4NL4H 4HAWA 5H83A 4ER3A 1ANKA 1MABA 1ZHFA 4JT4A 3FB4A 2JIPA 4RV9A 4KSBA 5JO9A 4MHTA 4JGGA 2Q8NA 3CZPA 5DK6A 3ADDA 3IELA 1W4BA 1ZRSA 4O02B 3DV9A 4PEVA 3OFND 1KFCB 1NE2A 1WZNA 3A1VA 4AZSA 4GZMA 4P34A 3NHAA 1VZ3A 2JK0A 2Q0HA 4DCUA 1RLUA 2OMEA 2XQVA 1YZFA 2J30A 1V25A 4KGVA 4DLBA 1PV2A 4LHXA 4BE7B 1U80A 3X2FA 3ROTA 5LYJB 4E5MA 1FUYB 1LSSA 1DPFA 2XDQB 3R6DA 2UZ1B 4TMKA 3IT2A 1W1UA 2PRIA 4KOAA 4OGFA 1C41A 3F7MA 4R8RA 1YB7A 2IUSA 2IXGA 1QS0A 4RVCA 4IDGA 3TK1A 1GITA 4QWMA 1X70A 5DYGA 2X3UA 3DQZA 4M0LA 4TXMA 4V3CA 3WGJA 2HEGA 3PQCA 3BQNB 4IIJB 4FZJA 2D3WA 1ABEA 2H0RA 3QI2A 1O95C 3V2IA 1VHJA 4MVJF 1ZO8A 4QPJC 3GJ7A 3F3KA 1P4GA 4DMRA 5D7NA 3IKMB 1OIWA 1E79A 2I67A 3UFXB 3V2HA 4LF5B 3AKDA 2WBLC 5G0UA 4II7A 4GYJA 4AULA 2EQAA 3BMNB 5JCXA 4F2PA 4PX2A 3OOSA 3ZYZA 1HNZB 2R9VA 3L04A 4ZAZA 4HO1X 4NPHA 3EC7A 3K2EA 2VHJA 3TXXA 1JKJB 1M8PA 3RS4A 4AJIA 4YAIA 1KGSA 2C77A 1MAHA 4KYUA 5DTJA 3AFNA 4G9BA 1A9OA 4P93A 4E22A 4CBVA 2B8TA 2FPUA 1Z26A 2Y05A 1OVGA 5JDIC 3D6HA 4M76B 3RVOA 1MG0A 1JHAA 4HCJA 4YB8A 5AM5A 3JQ9A 4JB8A 5EYPB 4BO6A 1XXLA 4BTVA 5EMKA 2BGIA 2FZGA 3C74A 3P0JA 4A10A 5L51A 2RE8A 3PXAA 4CRWB 5IBCA 1G1MA 1SKYB 2O2IA 2B30A 1J23A 4IHQA 4JJ7A 1O58A 1Z4MA 3GJ0A 4TTPA 2HQOA 5EJ6A 1V6AA 3WKEA 4D79A 3RU7A 3O7MA 5DCUA 5J40A 1YQGA 2WJVA 3H2BA 1V96A 4QEDA 1WVGA 1M8KA 2IPMA 3A1WA 3H4TA 3MLBA 5AVYA 5HP4A 4W7SA 1N78A 1H8HD 1W93A 3WWYA 1UDWA 3L0PA 1DC3A 3H6HA 1HQKA 1ZJ6A 2BMWA 4KX3A 2VBFA 3HR4A 5KHAA 4JI5B 4BX3A 5K0TA 2ZB3A 3EC2A 4HTFB 4FKZA 2XWJI 3HO6A 4BU0A 3IVMA 4CLOA 5B5SA 4FI3F 4NYMQ 1ZD4A 3P0IA 4C21A 4QJ4A 2PJRA 4D26A 1L6IA 1FTGA 3R75A 2J59A 3AEXA 3RPEA 2R751 3G88A 3KJIA 3AGPA 3OZFA 5LYYA 3U4AA 2VHVA 2WWIA 4AUKA 3MTGA 2Z5GA 1Z6XA 4S1TA 4EABA 1M2VA 2QW1A 4HNVA 3LE8A 1R8YA 5CM8B 2PKWA 2QMYA 1RWVA 3ESYA 5SY4A 4ZXFA 1U0FA 2LV8A 2AOTA 1BGVA 3DLTA 4XWAA 1JEAA 1G8HA 5LQSA 1FPMA 3F47A 3EFOB 1EFCA 3PPVA 5D7BA 4GKAA 1B1CA 2DH6A 3HXKA 2IU6A 1GUBA 4OSEA 3L7LA 1O1YA 1IQUA 4PPGA 2AQKA 4GU5A 3HCCA 5L40A 2J41A 2QE7A 3QKTA 4KTVE 5K2OA 2OGTA 3U3OA 4QWWA 5EWLB 1HT0A 3WO1A 2BBTA 4YI5A 3L01A 3ND7A 3HUUA 4ZHSA 3VTKA 2J0SA 4XRGA 4QIHA 4TWIA 1HQCA 3FPGA 2QI9F 1MX1A 4CYMA 3VPBA 1E4YA 1KK2A 2A59A 4PTZA 4DSTA 4K26A 1GV1A 2FN3A 3G2LA 1Z88A 1F1BA 2C9DA 3ELBA 2DRIA 4YJ3A 2I65A 2C5HA 4EATA 3QLVC 1S2IA 1WX1A 3BZWA 1F9EA 5GONB 1YL6A 4DA7A 4MUBA 3MMXA 4P1ZA 4DNXA 5C81A 4FILA 1M34E 3QPCA 4HEA1 4IZ6A 5AW2A 1JAIA 2KWIA 4A8PA 5IT0A 2WPDA 2FRDC 3FJ1A 2ZM5A 1OTYA 5B4UA 1D1PA 2VP2A 1YZ3A 2CKMA 2VXYA 1WSDA 3JYNA 4OFZA 2A0YA 2B78A 4RH1A 4RGVA 3I05A 5E9WA 1NZFA 3IS3A 3TO5A 2HF7A 2V0NA 4AO6A 2XB9A 1Z6AA 4F4JA 5KTRA 5CX4A 5CYOA 5FV4A 4ML3A 3M70A 2X6TA 4JASB 5E9JA 4IJMA 3GZJA 1VLZA 4YONB 4FHZA 1EFAA 5D3ZA 5GJVC 3HY3A 2O2EA 3VAZA 1O6FA 1X8LA 5FKJA 4DW8A 4G0WA 3A9SA 1ZCJA 2P6UA 1TUIA 4IG9A 3ZBPA 3A05A 1ZMRA 2C3UA 3PJRA 2DBVO 3P0HA 1OLSB 3GJTA 2VS1A 4FNAA 1Z0SA 2A1TR 2AQHA 4OGGA 3RIMA 4A8JA 4HOYA 3K6SB 4UU0A 1ZRMA 2ZWPA 3T7CA 3EYAA 2NPFA 3LWZA 1AK1A 1GA6A 1GT6A 4W4TA 2ZYWX 4AP5A 4N41A 4RH0A 5EG5A 4KQJA 5TQ2A 2BJVA 4LSGA 3O47A 4WXEA 1JIKA 4DEXA 3JZAA 1SUCA 1RHJA 3K9WA 5LOVF 4Z4EA 4REMA 1DWPA 1FX0B 2NZ8A 3R3VA 3OEHD 3A6LA 5DIZA 5FI5A 3VNAA 4BZWA 3DPIA 3P27A 3FMIA 5DNCA 5JYBA 4B3BA 1W19A 4D9CA 4M88A 3NTOA 4QSHA 1TUEA 1LWOA 4X93A 5L3VA 4CEJB 1FMCA 3KYJB 3HKDB 4KUHA 4NK5A 1ZAKA 1T9ZA 2R8YA 4HAUA 3GHHA 5LBTA 5JWRA 5K0FA 1HMPA 1SUPA 2GAOA 4QELA 4BV9A 1FTYA 1OGJA 1W7AA 5AR1A 3ADPA 5FP0A 1KEWA 1KDOA 4RA6A 3X1JA 2XYQA 4KR6A 3N8HA 5E6UA 2SCUA 4QUIA 1U3GA 1W49A 1YO6A 2Q8PA 2YHIA 3DF7A 4L4RA 4XGKA 4XJSA 4DB4A 4AQYB 3V4LA 2FFRA 1T2DA 2I7CA 2VUHB 4LBZA 1EK2A 4RACA 4ZWNA 5FUQA 5LNK1 1IUOA 4FDUA 5AHRA 3N1UA 1E9FA 1HYQA 1IHOA 1PUXA 2ZUUA 1W8IA 1ZD3A 3W8EA 3WB0A 1FFSA 2E21A 1BN6A 2X3FA 2NTJA 2W6ID 4BFWA 4X7RA 3ON5A 3A6GA 1JR3E 3PE3A 2OO7A 4JJFA 4AQDA 4DPMA 4HNAB 1K9SA 1WLYA 2RGGA 2XA2A 4HGRA 3B51X 4UATA 4B75A 3UMVA 4DTIA 1U8YA 2ARKA 2R87A 5L3ZA 2DPMA 1J9ZA 1NQOA 3H2YA 1DHTA 3MTBA 1JQEA 2HTFA 3D7LA 4BLOA 1C9DB 5GJWC 1YBFA 2IT1A 2WYUA 4Y6RA 1I3MA 1MO2A 2HMVA 1QFJA 3QV2A 1UJ4A 1M0SA 2AG0A 4O2BB 5AUQA 2HDWA 3KSZO 4LBYA 1PV4A 1PT6A 1SXJE 1XYGA 1EDEA 4ND8B 4IUDS 4TLEA 4C2UA 4N0QA 2R1VB 1FTNA 3GJ8A 1KOFA 2B69A 4QQKA 3WLAA 2JFOA 2NXCA 2WYVA 2IFTA 4QFCA 5ICGA 1ISMA 2YZ2A 3SYKA 1XNGA 3V42A 2ZGVA 1U3VA 2QXTA 5AW6A 3WDKA 4UTZA 4PC6A 1N6IA 3C3EA 1IUNA 1FFHA 3RVKA 2IS2A 2VP9A 1TAUA 3NVAA 1GKYA 2YMLA 1ZN7A 1M34B 5FRDA 3O8DA 5AOVA 4ND8A 3EGVA 1FSZA 3C1UA 3AEZA 1SR8A 4M98A 1KIMA 1V48A 3M5CA 3CE9A 4FFOA 3SS9X 2C5FA 5K01A 3FVVA 2XGJA 3I58A 1JKIA 3GA5A 4U5QA 5G1PA 2GOYA 1JTVA 1E7YA 2ODNA 3PQEA 3UF0A 4BKMA 1GZSA 4CN8A 2Q1YA 4ZVOA 1PUJA 1Q1NA 2WZDA 4OOFA 1O9GA 1WZIA 4DM7A 2IOYA 4WN9B 3FUCA 2EFJA 3CVOA 1CERA 4GI5A 2GARA 3ENWA 4KYTA 5DTQA 2NXWA 2V0CA 4DXDA 2R85A 2QF7A 2YRWA 3LP6A 4NBKA 4YRTA 1TVEA 4CMJA 2XT9A 5TIIA 2GN1A 4ZV4A 3KQHA 1DTWB 2VHUA 5D5PA 1D9XA 2VWQA 4BQSA 3GR6A 2RGXA 4C1NA 1FOEB 2F59A 3JWIA 3D5TA 4INPA 2HMWA 3LPNA 4M2LA 4NMMA 3H4IA 4AY3A 3AF6A 5HIAA 3RWOA 4KPUB 2ZBFA 1PT8A 1MBZA 3LXMA 4TZ0A 3M2PA 3H5WA 3TVTA 3V1TC 2B2XA 1LU9A 5GJBA 1ADJA 3HZRA 4FNOA 1S3IA 2BHRA 3DBLB 3EXHB 4R68A 5F7OA 3CY6A 3VM6A 1W76A 2AD1A 3VTAA 5JRJA 2B82A 3MHPA 2WSMA 4TMYA 4U7PB 4DE5A 2WJ6A 5EXTA 2WJ3A 2Z0MA 4LJAA 4PNZA 3EULA 4XSGA 4E5PA 3B1KA 2Z6AA 1SH7A 1NIJA 3MS4A 2H1IA 3E2MA 3Q9SA 3A27A 5K03A 4MGZR 4KPUA 3JALB 2JGAA 3IAHA 5TMBA 2WM8A 3IAXA 1TQ6A 4UBJA 4C07A 4WL0A 2O8CA 1VJ0A 3PLRA 3AKCA 1YJAA 2IPOA 1H93A 2YRXA 4DM4A 4DLAA 3QMMA 1G0OA 1CF2O 4ZCIA 1TM5E 4WNYA 1K6XA 2R6ZA 1EFRD 2JJ1D 3C15C 2AW3A 3BTOA 2I6GA 2OHFA 2P4UA 3B3QA 1QRTA 1UPCA 2P2GA 5KYGA 4E2WA 1E7WA 2NVWA 3Q9LA 2EIHA 1HYGA 1KAMA 3WTBA 4X3CA 3M5PA 5KSWB 2HN9A 4KE9A 4HFJA 2G67A 3PQ2A 5BW6B 4RF4A 3UN1A 2YOHA 5J1SB 1OFUA 3RIEA 4IHAA 2DOKA 2ZB2A 3FKJA 3GGJA 4IDOA 3V80A 2Y0DA 5JJ5A 5AI8A 1L5GB 4IL5A 4J75A 3ZKAA 1G3IA 1GEEA 1QYWA 1NXQA 3IAM6 3QUTA 4YN3A 4UAVA 3VSBA 1GQSA 3EXEB 3HN6A 1BWPA 4P2BA 5DHFA 1AE1A 5IJZA 1O54A 4DIBA 2O0HA 3SYNA 1C0EA 2WFZA 4CG0A 1LQ2A 2JBAA 3MBKA 2G8NA 2HX1A 3JASB 3SD7A 3O0TA 5ES4B 4DA4A 2WR8A 4H3SA 4MWDA 1R6TA 2QYOA 4DRYA 3ESXA 4XIJA 3R7SA 2VT7A 4HR7A 1UJ2A 2M98A 3AERA 1U0HC 4JU9A 3SR4A 1MO5A 5A5FA 2CK3D 4RJJA 2ABWA 3LGSA 4PPYA 2YOGA 4ER6A 1WOYA 1J21A 3ROGA 1II8A 5ANRB 4D3SA 3R3UA 5DXFA 1TM4E 4URWR 3AF3A 1AGPA 3KKLA 2GERA 2XAAA 1FFGA 2ZIZA 5KOJA 1ZKMA 2O7SA 3ELYA 3O92A 3KOUA 3QVTA 4S1OA 5EXPA 1ZD5A 3E5RA 1HQDA 4WCFC 2WRZA 2ZJ8A 1D2RA 3TIFA 5CCXA 3E1SA 3LC7O 4UUAA 1PWEA 1CY2A 3G89A 2YFHA 4RW0A 2CV0A 1LDGA 3SAJA 5K3BA 4E32A 2XF2A 1FMJA 4FX2A 4JMLA 3P71T 2PMBA 3I23A 2PZAA 4B85A 3OIYA 2PLAA 1JEYA 3DD1A 2ST1A 4TX1A 3PQ5A 1VSUA 3RW9A 3CURA 5KVVA 3PGA1 4LJ6A 4JZKA 4EHDA 1N7JA 1I36A 3E3LA 5HCNA 4URFA 4M9QA 2ZXFA 5KTNA 2QN6A 3FVQA 4IOKA 3KJQA 2HCTA 2I1LA 4L4SA 1CVLA 1DFHA 4UQOA 5LQNA 4K88A 1KPIA 4ZTBA 2HU8A 2BGJA 1XX6A 4NBVA 4BDTA 1F5SA 3NNDA 3PC3A 2KHZA 2OOKA 2R5NA 4I50A 3TOCA 3A04A 4JOBA 2PU5A 2C8KA 1CT9A 2AFIE 3QLUC 4EUSA 5BNTA 4H15A 5JPDA 1AN0A 5F7XA 3GHYA 4F91B 1E3SA 5C0OE 4Z49A 1R0XA 3WQSB 1C7RA 1EFLA 1I2CA 2Z43A 2XHZA 3TLJA 1TW3A 4KACA 1PAUA 2ZROA 4EZBA 2WIFA 5GTDA 1ZXXA 1LSOA 4HUQB 4PBRA 4R1UA 1HFWA 5K8UA 4YP9A 2C9CA 2WLSA 4D81A 4Z4GA 3BFXA 3JYPA 2YUIA 1PGJA 1UXKA 1M6YA 2BHTA 3PSHA 2B9VA 3VBCA 5KX5F 4Q7LA 4YDHB 4LC1A 3MHTA 4JZYA 1RD4A 2BTQA 3A6ZA 4LPKA 2J31A 2NTVA 3U0VA 4CQLA 3JD2A 4D0NA 2YNMA 2YX1A 4DABA 3IAUA 4ER7A 1YCHA 5J5VA 4AI6A 1Z4KA 3H9BA 4WBNF 3ENQA 1K8QA 4UUPA 2PGJA 3FUTA 1VIMA 4EYOA 4BVHA 2W2LA 1EH5A 4BAGA 2H5LA 5KTPA 4MA0A 1NZJA 5HEKA 3IE0A 3KUCA 2XT6A 1DQPA 2CFOA 2Q27A 5B2EA 1U81A 2BJHA 4G2NA 3JYLA 4FOTA 2D2XA 4C03A 4F86A 2O5RA 4H9GA 4HKTA 4TYYA 1K5HA 1UBJS 5B55A 3EQZA 3C7DB 3WK8A 4K0KB 2OHOA 5AM2A 4ABTA 1WULS 1PV1A 3BGIA 2Z5LA 1JLSA 1NR7A 4IYJA 2X22A 5D87A 5JY1A 5LQUA 3BGOS 5DOVA 4RE6A 2Z1NA 1CEQA 5GGYA 3I8SA 3PTZA 4MDFA 2MHCA 1AM4D 1R6DA 4LGYA 1SVKA 4CIDA 1VDMA 1TM3E 3UK6A 4FMCF 2FGKA 2NYVA 1G6OA 2ECFA 3C3DA 4E14A 2PGNA 1AH2A 1C3EA 4UE2A 1KBZA 3C6KA 2Q2OA 4H35A 1QZZA 3DCIA 1MV8A 2QENA 4ZOLA 1GYPA 4Q15A 1PYOA 5DV9A 3M2TA 4L5IA 4GZLA 3OHSX 2W42A 3W3AH 3PJDA 3WISA 4KRFA 1TECE 1QU2A 4F0JA 1PTKA 1N8NA 3K0CC 2Q3HA 5KEIA 3TQSA 4UUQA 1BKSB 2F48A 2IYYA 3H1AA 3IO5A 3A6KA 3WL4A 1RLTA 1WVMA 2WWTA 3NJRA 4F72A 2CEAA 4ZU6X 1EA7A 3ZNOA 5BSVA 1PI3A 1UBTS 1VGQA 1PR2A 4KQGA 4R1PA 1YR3A 2VCYA 5DMXA 1K6JA 4OF4A 4PHGA 4RM3A 4BE9A 4HXEB 3TRHA 3OOHA 2C88A 3AUXA 3Q87B 2ATEA 1Q7CA 1E98A 1Z0IA 3P9RA 4ZOLB 5FOUA 3GPIA 3S99A 1KEZA 1LLQA 4ESOA 1QQBA 5I3ZA 5LIPA 4TTIA 4QYIA 2C7GA 4PFQA 2WC1A 4PAWA 3PEFA 4G1VA 5B7PA 2FMFA 3FWZA 4I4TA 2XECA 1QYIA 1VA4A 4U8HA 5B2FA 4Q93A 3Q10A 2DFNA 3CLHA 4NZOA 2AEFA 2D3TA 2PS3A 2AJBA 3FN4A 5G40A 2O2GA 2I4NA 1T3ZA 2V3WA 4MV5A 3PLAE 1GIAA 1ZGJA 2QUIA 2VRCD 4YP5A 2R11A 3A4LA 4ZARA 5GV8A 3U6BA 3QENA 5K0ZA 4ZK6A 3C0KA 1MD9A 4DANA 3JX9A 4RVGA 1REQB 3M4YA 3PR1A 4I1IA 4DQDA 5L6LB 1XA3A 1VHWA 2PN1A 4U0JA 1U0TA 3UAXA 2DLNA 4LRSB 4AG6A 1NXSA 4HH4A 3DQPA 3L4JA 1PBNA 3KX2A 3MSXA 5ICCA 3I9KA 1YE3A 3F1KA 2FUEA 4J0DA 1HLGA 2EWMA 3NTVA 3JQCA 2V7QA 4L4YA 4FKMA 3W8RA 3ZX5A 4YY3B 2QNRA 1XTBA 5I7WA 2I6TA 3BB3A 3JQGA 4M0UA 5KYYB 3CEHA 3H5IA 1VSVA 4WK6A 1YI8A 3VZPA 3EFEA 3T5PA 2Z83A 5KSYA 3RTCA 4MI3A 1J00A 2E55A 1EAYA 4EGCB 2G6TA 1VPVA 1C1DB 2G06A 2W8BA 3OJEA 1VL8A 3PCRB 3ZDBA 1M7HA 4RUKA 1E0DA 3AHGA 4WLNA 1YBMA 1W96A 1NXVA 2WU8A 3MCTA 4BO2A 3BRQA 5EWJA 2DFKB 1QS0B 1UCFA 5GGXA 2REQB 3OZEA 4JJIA 3ZWDA 2O2ZA 1EJBA 2VJBA 3DE0X 3QUBA 1RT9A 1I3CA 2DXIA 4XCVA 4S0ZA 4ZZ1A 2JJ2A 3VHRA 5A4FS 2HA4A 4D0GA 2A0FA 4AW9A 4RTMA 1X9IA 1YB1A 3BN3A 4R8VA 2AUMA 2H2WA 3OFSA 3VMMA 3CTMA 1XMIA 3TD6A 1KJJA 3V9PA 4F5DA 3L46A 1QIDA 4BU1A 5L3QB 2ZI3A 4GZ6A 3RT1A 1DIOB 3CTPA 4U2DA 2FR1A 3SR0A 4ZI3A 1B14A 1QK5A 2QGFA 1CZHA 2OSBA 4FB5A 2IODA 3WIBA 2CFSA 1SB8A 1DINA 3HP4A 1BEUB 3KTOA 3OQJA 2C7PA 3GFGA 2IUTA 3KL2A 2XW6A 1GRCA 1JALA 1I7LA 1L1EA 2D1FA 4R54A 2V5AA 3PGKA 1JDVA 4XWYA 3VZSA 2J9YB 5CCDA 1GUYA 2BW0A 2QUBA 3N0RA 4JEIA 4E7PA 1ZVJA 4KXUA 2D1TA 1XEWX 5T8KC 3ONWA 2J8ZA 1GNQA 2XA1A 5IDWA 5JI2E 3FBGA 2BZGA 5FTJA 3JAWB 3ECAA 1UMDA 2BCJQ 1V5FA 3LGAA 2K87A 3R5FA 3NVDA 5IU6A 2IHTA 4PX3A 2UXDB 3SX4A 1VRVA 1G18A 1IB6A 4GOND 1BA2A 3AIIA 3JQBC 2AMYA 4O8ZA 2HH9A 2HSWA 3DBLA 2OHXA 5DNVA 5AJTA 1CS0A 4KXYA 3HRKA 1R0LA 3A70A 3C8MA 4L8LA 4OK6A 1L4UA 4R84A 5AK4A 1M2EA 3S2IA 3MTAA 5CVTA 1PVOA 2CZQA 1ZUHA 4GF5A 5CDUA 1Y1TA 2G40A 3G02A 3KU4A 4XLLA 1BVHA 4PG4A 1T2EA 1ML3A 5B64A 5F23A 3RVSA 4CDRA 4A15A 1VE1A 1BXGB 1LY1A 1D0VA 3WLKX 1QVZA 2ZDQA 4JDUA 1TCVA 2J3HA 3T3DA 1B0UA 1A9TA 4M1SA 4MP8A 3DTTA 2LPMA 2PKQP 2YV2A 5EXXA 2H31A 4R98A 1LLDA 1P4SA 2PMCA 3VAYA 2W2MA 1OFHA 2PGLA 3K0FA 4U39A 5TT1A 1M33A 3LUHA 2BFEA 5BNWA 2PL5A 4JXZA 1V11A 2IYTA 2O8FB 4YPFA 2DPGA 5AW5A 3ASVA 4YV7A 3CCBA 4E4TA 4D2IA 3U39A 4CL2A 1SMKA 3IQWA 3PVZA 1QV7A 3K1ZA 3TB6A 1U8UA 2X5NA 5KX5A 1BZYA 2X9NA 1DEOA 2YC2C 3T3OA 4AIIA 2ZRNA 3AEUA 3DCJA 4C05A 4WCVA 3U1TA 1KJZA 3B60A 4MYCA 1RXCA 2Q3EA 3AFOA 5KQGA 5DNAA 4O2LA 2HPAA 1YRBA 1Y63A 1XDDA 1QHHB 1US8A 1G291 3KOZA 5E1OA 3W1EA 1FQJA 3NI2A 1YDEA 4UD6A 3ZYCA 1P0PA 1QDUA 1VG0B 2Q6KA 3ER9A 1KSHA 2F9LA 3NFYA 3A06A 3HYLA 4ENPA 1UFOA 3EPLA 3S2EA 5ILOA 3AR8A 2FMHA 1W94A 1Z0FA 2FA9A 2QJTA 4MQFA 3Q6IA 4NENB 4Z99A 4G4SP 4YPVA 1MMFB 3CT6A 2IYZA 2IDKA 1JHRA 4CR7A 1UBEA 4LTDA 3FRHA 1K4KA 4KW7A 4YGXB 3UPUA 1XQVA 4B40A 2FE1A 4JV5B 3KG2A 2DUMA 3G9TA 2PX3A 2ZKLA 3NEYA 4RFLA 4U7GA 3VR1A 3SGLA 3X43A 3IILA 5HA5A 4TKUB 2WNIA 4CU2A 2VJPA 3NJ8A 4Q1DA 1W34A 3VISA 5AVJA 1TO2E 1JE0A 2EX0A 1P0MA 4WFIA 4Q4JB 4H7DA 1Z25A 3I0ZA 4MTCA 5CM2Z 5AM3A 3SFZA 4BZXA 3FPLA 5AJVB 4I4LA 4S04A 1T5OA 3HWX1 2B3DA 4K8OA 3OTWA 5IVDA 3TR0A 1OX5A 1ZI6A 5A0VA 3EMVA 3CCCA 3MB8A 1ESCA 4JGIA 3B8HA 3U7QA 5ELXA 3B48A 3BD7A 4G5FA 1FX0A 1SO8A 4YC7A 2CFCA 3SICE 2GPBA 2I1QA 1OXXK 3SJAA 3ZD9A 5LOVB 3B20A 4RS4A 5GPBA 4QU5A 4XQ0A 4J3NA 4PLCA 5H1YA 1RWMA 2AOTB 1FYXA 4NF2A 3R77A 4CM9D 4DSUA 1JFFB 1VL2A 3TNDA 2WINI 2IZZA 1R4ZA 5TY0A 2Y27A 4G0PA 5JLAA 3WWOA 1O03A 2ZBQA 3IODA 5TLSA 3C1TA 1V39A 1CR0A 3COSA 1JG4A 4IUYA 5DJ5A 2ZJ5A 1OUMA 3W9SA 1N8SA 3V6LA 3D3NA 1Z73A 3ETHA 4B44A 1XZFA 4CQMA 1ODIA 1L7NA 2I6UA 4IIVA 3BYZA 1Q0TA 1YB6A 4TKMA 1ZJYA 2JGDB 3DGFC 5BO5A 3S29A 3S2YA 3EQ7A 3TVDA 1G6Q1 3UXHA 4JBGA 4OP2A 4B79A 5L3SA 3TKAA 3VR2D 4S2EA 3WLNA 4I55F 1Q3TA 3U31A 2DPXA 3IAM1 2Q9BA 1F20A 1JHQA 1X77A 1R66A 2WA2A 4NBRA 5KVCA 1E3WA 2E49A 2MT9A 2OAEA 3EG9B 1RAIA 1XA4A 5WRFA 1PG0A 1U2TA 2AOXA 2DCUA 5BN4B 2IHNA 4CKBA 4BWGA 2ZZNA 3V7NA 3WL7A 1YTUA 1TCAA 1UK7A 3DKKA 1WXFA 2QLJA 1U4NA 3G0CA 2ZAIA 3KNZA 2WIDA 1WBJB 1GILA 2Y9MB 3M7IA 1EG2A 2H8GA 3VO8A 2LKDA 4BFSA 3VSAA 3GUCA 2WP8J 4OX9B 3X0DA 1TKRA 4C4SA 2VPPA 4FGUA 1CUXA 1BA3A 1P2VA 1X3SA 2ZIUB 5E7MA 4ZU3A 2ZBEA 4BFZA 1W48A 1QZTA 1S8OA 1K8XB 2XITA 2QUZA 2YICA 1X0VA 5CGQB 1FDVA 1R5NA 1E1MA 5D6OA 5DLPA 5EEHA 4B46A 4RK1A 4BP9A 5E2BA 2WTEA 5A3QA 2ZBUA 2OGSA 1BOFA 1FNNA 1RCTE 2D1RA 1MQSA 1A2BA 2KSQA 2HLNA 2HK6A 4IY1A 3LUDA 5DBGA 3RS3A 1EXWA 5BYAA 3EK2A 3FZNA 3EWNA 3KLMX 2QUJA 3INTA 3DE7X 3DF9A 4P7KA 1BDHA 3NWJA 4KODA 2AR9A 3EH1A 4N01A 2FETA 1JJIA 2PZGA 3G8DA 4QHSA 1EWTA 5T67A 4L85A 3V1LA 3DW1X 3M9LA 1IY8A 1L4GA 2PS9A 2QJOA 5DN6A 5AVZA 3I5MA 4TYNA 4GKBA 2H17A 1TCBA 3OA2A 4MZXA 1FYDA 5EZSA 4CHTA 4FM9A 1N9KA 4PHTA 4BBPA 4EZEA 3KPYA 3RK1A 5KQRA 5JH7A 1YA6A 5G2OA 2XKJE 2VL7A 5ALOA 1NHGA 4MROA 5ERXA 5LDHA 5K0NA 2SBTA 3FNIA 4GMKA 4QBGB 4DVGA 1MV5A 4DLTA 1I9GA 1XAHA 4FN4A 4FYKA 1E5VA 4UNPA 3GUVA 1XTZA 3PXXA 4JSRA 3VPFA 3LZCA 5MGBA 3GAAA 1BH6A 5KB3A 4N6GA 4KXNA 2HIAA 1PL6A 3PTLA 3MWDB 1J5PA 1QO9A 3KHKA 4EB3A 2LCQA 1DKPA 3KLPX 2QM3A 4JA0A 3UMJA 4OMCA 3WQQA 1P1HA 1QQ5A 3E53A 4ZPJA 1WAMA 3D7MA 4QYSA 4YUYA 3F73A 2Q7OE 2ZUFA 3QU5A 3MW8A 2X6QA 3CVVA 2VQFB 2XE4A 3RKSA 4GKVA 3U7FB 2Y6VA 3GGSA 4LZAA 4YRPA 3IXLA 1G8SA 2G36A 5CIYA 2WUEA 1LC0A 3O8LA 1GLNA 1A3CA 2DFDA 3RD5A 3WBBA 2GZHA 2J3IA 1J8FA 4BFTA 1FY2A 4HDRA 4UREA 1MIOB 4LMBA 3WLJA 4U2FA 1PD1A 2JKYA 4YCJA 4YALA 5K6TA 4HLUC 3IUEA 1TCCA 4DIFA 3B5EA 3JR7A 3SJCA 5AD1A 5IKEA 2O5CA 1I14A 2Z57A 3DT8A 5IAKA 5BV2P 4N03A 1QE5A 1CJCA 2P6OA 2EJVA 3CLVA 4UM5A 4BFCA 4C5CA 1J7KA 1RMQA 2FZLA 5B6IA 2JFPA 1IHDA 5IYZF 2AA3A 4JLOA 3ZDDA 4C3VA 1SXGA 2GNPA 5EKXA 4JC8A 4W9NA 1P39A 3H9UA 3U3ZA 3VPCA 5KMGB 3P5BA 2IXEA 2Q7XA 3KIPA 1GV0A 3GAMA 2AI2A 2P4QA 4HBZA 4S05A 1QZUA 2HA0A 4RABA 3DVAA 4DCOA 4BIMA 3OU6A 1ZCZA 1M54A 5LYJA 4AS3A 3ODGA 4AYTA 5FEUA 2ZJ2A 4ID3A 5EWJB 2YHSA 4WNCA 4F2DA 4TGLA 4EFLA 3FI9A 1GA1A 2BELA 5AM4A 1NUUA 3IP5A 2BONA 2SKCA 2QTVB 1X7XA 1IPEA 2XNKA 3N05A 1Z6YA 3OPYB 4HGOA 4WOBA 2W2KB 2DF8A 3GEMA 5K8JB 1X1QA 3IXMA 2O0LA 5EMJA 5CA0F 4K9SA 3QQ5A 3DWGA 5J4KA 4OHYA 3HG7A 2JH3A 1NQTA 1ZA2A 3PEVA 3NUGA 4KE6A 1Z5NA 4E15A 3QVJA 3WGKA 1R74A 5IP5A 1BS1A 1DKMA 3SZOA 3DL2A 4RHTA 4FX5A 1J20A 4JVLA 2MSCB 4GBED 3EZLA 5C9ZA 1X1RA 3SKXA 1CRQA 1AKRA 4QXPA 4TYPA 3MMPA 4EBFA 5IKXA 1KMQA 3FGNA 1YJCA 2ZBDA 4NDAA 2I2XB 1WABA 2DPLA 2I8AA 2B3TA 4HRVA 4XVCA 4PLZA 2VDQB 1KRWA 1YKSA 2Y99A 3QYFA 4L0QA 1AA9A 3OPMA 4UMEA 4US0R 3UYKA 4X91A 3GUHA 2XRFA 5E8RA 4UASA 5TR9A 4HUQA 4Q3NA 3EY4A 1W85A 1YVEI 2BYTA 1P6XA 2GBCA 4GUAA 1NULA 1G8KA 3PWZA 5DTIA 5ENDA 5F9HA 4ILKA 1V43A 4TKVA 2JS7A 2ZE7A 2SECE 4UJ3A 4AO8A 4QXAA 7YASA 5K4GA 2JCGA 3BWMA 4JQCA 4C2AA 4ECEA 1QJCA 1H0KA 1OPXA 1DRJA 2OHVA 2FG6C 4JJ6A 1SKBA 4X9XA 1L4EA 1XAIA 3VKFA 3RVDA 1DX6A 2GN2A 2EW2A 3VO2A 3P97A 2FNAA 3GDGA 3U3KA 4A6PA 4ARSA 2O8DB 2OL4A 4LS3A 1ZP6A 4A4DA 4O33A 2QN1A 3LW8A 5G4LA 4Y30A 3VO9A 4BP1A 2HWKA 5CITA 2GBLC 4P08A 2IZ5A 5E2AA 4Z1MD 3BXPA 3EWIA 5DBHX 5EIOA 2Q4TA 2HK7A 1U1IA 4C30A 3R7FA 3V32A 1SBNE 5G0WA 3SLRA 3EVGA 2P9ZA 4PQRA 2VP0A 5HCUA 4N5DA 2ZXUA 2C1EA 3GEHA 3N2GA 3HXLA 4L74A 3NS7A 4P4TA 4OOEA 1K2WA 1X8JA 1Y6QA 2NZ2A 2RGNA 2AFHB 5BNIA 4Q1FA 4FDVA 3LX5A 4C0QC 4XJTA 4GGOA 3RRBA 1GAEO 1UXJA 1MENA 4FZ3A 3HU3A 5T6MA 5JLJA 4MLDA 1BS9A 5J2TB 3NDBB 3I6QA 4GP7A 3ZBTA 4K87A 1C9YA 2WJGA 5F78A 3I6IA 2FUNB 3KEMA 3NATA 2A5JA 1OTXA 1M6VB 1H4QA 5JVDF 2YWXA 3ZPXA 4BV2A 1ZK2A 4C87A 2HOQA 3OSZA 4ZRNA 4DZTA 1GD1O 1H6CA 3JZIA 1Z4QA 3PRYA 4MCIA 1HH4A 4FGJA 3GJZA 4RA9A 4JH0A 3RC7A 5DYIA 4YO7A 3H0EA 1H1TA 3PR3A 3GLHE 2P9JA 3OCXA 5TT0A 4G23A 1E59A 2W2XA 3RU2A 2D5LA 1D4AA 3RJ9A 1VFPA 5IARA 3KC2A 1QR2A 2VJYA 2YYAA 3ZHVA 5JAIA 3QSYA 1V16B 5FOSA 3UAYA 1M1NB 2AN3A 4FMDF 4NCKA 3MYYA 4NFSA 5A7FA 3F90A 1MFZA 3AZOA 3TLXA 4DMHA 3N58A 5CFZA 1I7DA 2CW5A 4YJ3B 1QPGA 3VR6D 4CGYA 1JEOA 2W00A 3H5TA 2O8FA 5TPWB 2I7TA 3CVWA 5JWHA 1PJTA 2KMLA 1SC3A 2A9PA 3E1KA 3M0EA 4KQKA 5HM8A 4JFAA 1EVZA 5BR7A 4V1CB 2IPNA 3CSUA 3PV0A 4YRKA 1QRSA 2Q1SA 2QGZA 2JCYA 4L76A 3KKMA 3NYIA 4J9UE 5JJCA 1BH2A 4F97A 5KYTA 1LX7A 2TMGA 4N5HX 4AJ1A 4YAEA 2P6RA 1DWUA 1H1DA 2ORIA 6CHYA 3HDVA 3KYDA 5JSQA 1TTQB 2EJWA 3RC8A 5M34A 4W8GA 3HJRA 4FGLA 2Q4EA 3VI3B 4OJQA 1QIKA 3OFKA 1DJPA 2CUZA 3DUFB 3JARA 2P65A 4QNNA 5IPFA 3R4VA 4G8JA 1FIUA 2OM2A 3QEKA 4PYKA 3GDFA 1YE5A 2F1IA 5HMMA 3VDRA 2IYWA 4I4IA 5CEEA 5DT2A 2NWQA 5EZYA 1EVJA 2P0YA 4M8NE 1P3JA 1MVOA 2J7KA 2IDJA 2XCOA 4OHOA 3G5LA 4TN1A 4B32A 1F6BA 5FI1B 1ULSA 3RFTA 4GE3A 4ND3A 1PSWA 1MP0A 5T4BA 1G5TA 1J8MF 1NW8A 4KWIA 4JUIA 4TT8A 4BOYA 2M6KA 5IXYA 5KOIA 1UEJA 3D1JA 2EXXA 2MWMA 2NVBA 5IHPA 1XPRA 1U6JA 1Q16A 3FCOA 4LYAA 2GS9A 1SEVA 5KCMA 1Z33A 2VOJA 5B30A 1WJGA 5JRDS 5LZ2A