2WJWA

Crystal structure of the human ionotropic glutamate receptor glur2 atd region at 1.8 a resolution
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
374
structure length
368
Chain Sequence
b'NSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALTYDAVQVMTEAFRNLRKQRIEIGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE RECEPTOR 2
publication title Crystal Structure of the Glur2 Amino-Terminal Domain Provides Insights Into the Architecture and Assembly of Ionotropic Glutamate Receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 122
structure length 368
sequence length 374
ec nomenclature
pdb deposition date 2009-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wjwA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wjwA01
5E3JA 2LPMA 3OO1A 2A9QA 2PL1A 3EAFA 1PHRA 3KHTA 1MVOA 4Z9BA 3FFWA 4LZLA 2AYZA 3GT7A 1M2FA 4RDCA 2FQWA 4F3TA 3LUCA 1BVHA 1A04A 1MB3A 2GBPA 3DBIA 3QLVA 4RZSA 3O21A 4JP1A 4EY3A 2JVKA 4QPJC 4YP9A 1U8TA 3M9WA 3KYJB 2J48A 4H60A 3RQIA 4UHKA 2PL9A 4N47A 3OQOA 3OLVA 5CNMA 4QYWA 2E4WA 4N03A 4MLDA 1JHZA 4Q6WA 5TQJA 4ETNA 4LDZA 3URMA 4EYQA 1ISRA 1JF8A 3ILYA 4G97A 2B4AA 1DC7A 4PE5B 3HXMA 1Z2DA 4DQDA 4MR7B 3OLWA 1EWKA 3IP6A 2FQYA 3QX9A 3B2NA 4RY9A 4YWHA 2L17A 1PEYA 3C3MA 1CEYA 4NCAA 3H5IA 3Q9SA 2WMYA 1ZESA 1URPA 1ZGGA 2MYTA 3HS3A 3OO0A 4JA2A 1DJMA 3ROFA 3HDGA 1U2QA 2LIVA 4RSMA 3ILHA 3RVPA 5HSGA 1APBA 2QR3A 3H1GA 2PKXA 4EGSA 3CNBA 4Z4IA 3G1WA 2YHBA 3NNDA 3DLHA 4IMIB 3LKVA 4KFCA 5PNTA 3CTPA 5F64A 3SNKA 1M2EA 1YK0A 2LUOA 1FFSA 4XLTA 1FFGA 5IC5A 5HQJA 3BILA 3F7NA 3BRQA 2FEPA 4KQCA 4Z4GA 1TLFA 3MYYA 3JY6A 2P4UA 3O1HB 3RVRA 2VUHB 4EVRA 1P6QA 3GWGA 1L5YA 4IILA 3GV0A 3KLNA 3NHMA 3RVQA 1QO0A 3HUTA 4IGAA 4PICA 4MR9A 2V0NA 3KJXA 3QEKA 3C6QA 1OXKB 3HEBA 4RU1A 4WUTA 5JNWA 1BDJA 4G0MA 4MS3B 4LE1A 3K9CA 4Z4EA 3O2QB 5CNKA 1JFSA 1QP7A 3OMWA 3VNAA 3CS3A 2PUDA 2A9OA 2VK2A 4YO7A 5CNIA 5D2CA 1SRRA 5IUNC 3F6PA 4N76A 3RVLA 4Z9AA 1XHEA 5TQ0A 1YVUA 1VLZA 1QPZA 1A2OA 2FN9A 1DBPA 5TQ2B 5EWLA 1AB6A 1C0EA 2CHFA 1HEYA 2OQRA 2R47A 1JLKA 1F51E 3H5TA 4HNRA 4RK7A 4GPAA 1NXTA 4KREA 1RXEA 2FLKA 2E4ZA 5JNSA 4KNYA 5JS2A 3HCWA 1Z15A 1DG9A 4RV5A 1GCAA 2JB9A 4KK4A 5KQGA 6CHYA 4CBVA 3OMXA 3N6VA 2FLWA 3KSMA 3EQZA 3TB6A 4RY8A 2ZAYA 3HM9A 1ABFA 4KVFA 2B1JA 5TPZA 1ZN2A 2FTKE 1RPJA 4PEVA 1JFTA 3EODA 2JCGA 4MQEB 2X7XA 4Z4CA 3LUFA 4G0YA 2VYCA 1A0OA 3MQ4A 5BQ3A 3H5WA 4RKRA 3NNSA 1J56A 2GX6A 4EYOA 1NY5A 2ID9A 1JBEA 4IF4A 1BA2A 4Z4HA 1DCMA 4ZJPA 1NXPA 4MGEA 2W42A 4E7PA 1WETA 3BBLA 3RVMA 2HPHA 4MQEA 4XXHA 4N0PA 9ABPA 2ID7A 1K68A 1D1QA 4W5OA 3GRCA 5FWYA 4OLBA 1AB5A 2NZVG 2JRLA 1LJLA 2QXYA 3JPYA 4NICA 1KRXA 1JX6A 2AYXA 1XHFA 1P8AA 4O5AA 4ZYLA 2BGGA 1GUBA 2WJAA 3A0UA 1PNRA 3JVDA 1ZAYA 2M1ZA 3O75A 1D1PA 1Z17A 3CZCA 3K4HA 4MS1B 3IP7A 1RXIA 5BRJA 1JDNA 1GUDA 1YMUA 5IBQA 1E6KA 3JPWA 4Z4FA 4MRMB 4W5RA 3F73A 2NT3A 3FDFA 3E3MA 1USKA 4YGXB 3O2SB 3HZHA 4MQFB 1C4WA 4H3HB 1Z13A 3EDCA 2HQOA 2F8TA 3O1IC 5BRAA 3I5AA 4H3KB 1ZHHA 5TPWB 2PAFA 5ED4A 1YMVA 1ZGZA 4IRXA 4MR8B 3QLTA 5C5CA 3P9YA 5EWJB 5IEBA 3KS9A 1S8NA 1ZVVA 4HYEA 1QQBA 5FBHA 1QNLA 3HV2A 3CFYA 4G0ZA 4KRFA 5FBKA 3LUDA 4N0QA 1ABEA 4YRZA 3HO1A 1IIBA 2IPMA 1EWVA 4MR7A 4GNRA 3LUJA 1DC8A 1EWTA 4L85A 1SXIA 4LE0A 3N53A 2PUBA 3A3KA 1MB0A 3LKBA 4FE7A 5DLEA 2FMFA 1W25A 3LUHA 1ZITA 2FVYA 4S04A 2PE5A 4JAVC 4JB0A 2MSKA 1NXVA 4KMRA 4LX8A 3OM0A 3SQNA 1DBQA 2H0AA 6ABPA 3F6CA 3KG2A 2M98A 3GBPA 4G0XA 2MSLA 4ZMSA 5KQLA 1GCGA 1M5TA 1F4VA 4WZZA 2PUAA 1LJUA 3QLUC 3CG0A 2QSJA 3KKEA 1RZRA 3GL9A 4M88A 4TMYA 3UK0A 1CYEA 1SXGA 3FFTA 2A9PA 3M9XA 1DCKA 2CWDA 2FSPA 3D02A 3RVOA 5B3JA 2O20A 4RK5A 2YHAA 1ISSA 4OATA 2KYRA 4DADA 1NXOA 3M6MD 3C3WA 3H5LA 3I42A 3L49A 1QO0D 2FKAA 3H5VA 4FE4A 5FWXB 2NZUG 4QICA 1FSPA 5EWMB 4HNSA 1TJYA 3KTOA 3NHZA 4MS3A 2FW0A 3JS5A 4D74A 4NCBA 3T6KA 2R48A 1T34A 1Z26A 1LBIA 3FMVA 4Q7EA 2LBPA 4P98A 4PYRA 3N0XA 5KQPA 1MAVA 1TM2A 2FEWB 3O1JC 4Q6BA 1KGSA 2JVIA 3TMYA 2ZWMA 2MYNA 1VKRA 3NBMA 2JBAB 2L19A 1OXBB 1SXHA 5EWMA 2F8SA 3QELB 4OBBA 5TQ2A 4W5TA 3SM9A 3TD9A 3EJWA 1B00A 1XWWA 2FXIA 3H1EA 3I45A 5HM6A 4KQ9A 3S99A 5JNTA 4TLMB 3D8UA 4G86A 4YCSA 3LOPA 4S05A 3SY8A 3QEMB 4F12A 1NXWA 2FMKA 2QV0A 3MF4A 4RK4A 3FGZA 4LE2A 4O1IA 3H5OA 2HQBA 5B3JC 5TPZD 2L2QA 1EAYA 1W9HA 3DGFC 4EVQA 1LK0A 2Q5CA 5CNJA 4W5QA 1DP4A 1YTUA 2XDYA 5IX8A 1BAPA 4MLCA 4MS4B 2PLNA 5JNRA 2HQRA 2LP4Y 3DZDA 3RVNA 4EYKA 4XARA 1PUXA 1QP4A 2FMIA 1USGA 4WXEA 4WXMA 4QYMA 1U0SY 4F11A 1NXXA 4F8JA 3JVIA 4ZPJA 3H75A 2TMYA 3OM1A 1P2FA 1L5ZA 4D6YA 1K66A 4EUKA 1BDIA 4NQRA 2JVJA 1JL3A 4YV7A 3E61A 3BRSA 5JNVA 4LRQA 5IEJA 1DRKA 4WT7A 1Y1LA 4PZ0A 3IDOA 3OLYA 2MYUA 3NNNA 2IYNA 2QVCA 3N0WA 3QLUA 5I4CA 3HVRA 4Z0NA 3OLXA 1YIOA 3H1FA 1YK1A 3IP9A 4G0OA 5IUKC 1KRWA 4OTZA 2E4XA 2GI4A 4KZKA 3C97A 4MS1A 4XFKA 2QU7A 3SAJA 5DKFA 2HJ9A 1ZH2A 4MAAA 5IULC 3H6GA 4MRMA 4EYGA 3Q7TA 4ML3A 3MMNA 2QZJA 3EULA 3N8IA 2IPLA 4TLLB 3HJFA 2MYPA 2FN8A 2JK1A 2FMHA 4P1ZA 3MA0A 4MQFA 2N9UA 2E4VA 1UDRA 4JASB 4Y9TA 5IUJC 4OLAA 1RNLA 3Q7RA 3N75A 3JTEA 1FQWA 4G0QA 3I09A 2QVGA 3KCNA 3H6HA 5TPWA 4ZMRA 1Z12A 1Z2EA 3QK7A 4RK0A 2VUIB 1JDPA 3EGCA 3EQ2A 1LBHA 4MR8A 3RH0A 3HK2A 1USIA 2IKSA 5EWJA 4B09A 3QX8A 1JH9A 3R0JA 1D4ZA 4RS3A 1YS7A 3DGEC 7ABPA 3O74A 5HKOA 5KWSA 3CG4A 3Q7SA 1JFVA 2E4YA 1SD5A 1TVMA 4RK1A 1D2AA 2QW1A 4N41A 4KPYA 1E2BA 1FFWA 1JYFA 4XAQA 4RWEA 4YR7A 3CLKA 2E4UA 5DGCA 3GYBA 1JWLA 5KQMA 5T7BA 1EFAA 3FFXA 2WY2D 2PMCA 1DZ3A 1NTRA 1Z16A 2OENG 2A9RA 3N0RA 5JS1A 3LUGA 1YS6A 2RDMA 4ETIA 5KC8A 1PEAA 4MR9B 3CZ5A 1NXSA 4O1HA 3ROTA 3UUGA 2MSWA 3CU5A 5BR1A 5KC9A 1H9CA 2IPAB 4JB2A 2R4QA 3QLVC 2PUFA 4WWHA 4E7OA 3RVKA 3OQNA 2I6FA 1E6MA 3HUUA 1RZRD 3IPCA 3OLZA 2PUCA 1DBWA 4G0PA 5GOTA 1VPWA 4W5NA 4MPTA 2DRIA 2IOYA 2R25B 3MIZA 3O2JA 4L4UA 3RVSA 1BDHA 2IDMA 3KLOA 1ZY2A 2CD7A 5JNUA 4RKQA 1DRJA 1ZDMA 1VRVA 5TQ0B 3GBVA 1R8JA 4YLEA 3T38A 3C3KA 2NT4A 4RY0A 4Z99A 1EHCA 2WB4A 3KYIB 3L6UA 2RJOA 3Q15C 5EWLB 3T95A 1QQAA 1QKKA 3DLBA 1U04A 2RGYA 4RK6A 1I3CA 5FWXA 3TO5A 4ETMA 2IPNA 2PUEA 3IPAA 4EVSA 3UKJA 1JYEA 8ABPA 2GWRA 4RXMA 1P6UA 3CKMA 5ABPA 1Z25A 3LTEA 1GLGA 3LFTA 3A10A 1DCFA 1QMPA 3CHYA 3MM4A 1QP0A 1M5UA 3Q41A 4DN6A 2RJNA 2JBAA 2P9HA 1PNTA 1Z18A 3QELA 4RXUA 4IMJB 5TE9A 4NV3A 2PUGA 4RXTA 3VNBA 3G85A 4KK3A 4UHJA 5CHYA 3LUAA 4MYRA 4XASA 5GQSA 3A0RB 3CRNA 5KI6A 1CHNA 1U2PA 3HDVA 4F06A 2NUBA 2L18A 2GKGA 3QEMA 3GA5A 5C5EA 1MIHA 4KV7A 1KMIY 4JOQA 4FB4A 5DTEA 3LMKA 5FWYB 2WWVD 5DCLA 4OG2A 2FEKA 1TMYA 4YS6A 3OQMA 3IP5A 1D5WA 1E6LA 4LDAA 4TN5A 3HSYA 4MS4A 2H3HA 1ZH4A 4HNQA 3BREA 2HSGA 3LUKA 3TX6A 2WRZA 3RVJA 2WJWA 3SG0A 5T3YA 1NATA 2CHEA 3T8YA 3W9SA 2PJUA 4D6XA 2FQXA
chains in the Genus database with same CATH superfamily
1OFGA 4AJ1A 2WKPA 2PUVA 1RPAA 1Y80A 1YQWA 1PHRA 3KKPA 1ML3A 4M0CA 3KHTA 4MIKA 7YASA 2D7DA 4CKXA 3ADBA 2VZLA 1ZM7A 4HC4A 1FP4A 1SD1A 1VJDA 1ZJYA 3H9QA 2AF3C 2UZAA 1C81A 4CDRA 3OCJA 1A04A 1VLHA 3HLYA 4QNRA 4ENSA 3OJFA 1KU6A 3FUVA 2JANA 4MMYB 1GV1A 1UBGA 3R0ZA 4H1UA 3UGQA 4OJKA 4JL8A 4BGEA 2NUAA 2ZRLA 1Y8RB 1GYRA 4FFPA 5F3WB 4KDCA 1RM0A 2X5XA 3NJ4A 1YR2A 2Z9BA 2DHCA 5A3VA 4MLDA 3VPDA 3URMA 5IWAB 1E0JA 2P91A 4HX9A 5AHRA 2CLHB 2XUFA 3QKIA 4KN8A 4JX8A 2J4FA 1UMDA 3BTOA 4DJFC 2QLJA 3OJOA 4MR7B 4EF6A 4Z7OB 5AW6A 3R5FA 2XNCA 4ZT6A 4DLRA 3JQBC 2Z4TA 4BU0A 1IG0A 3MMPA 3G2JA 5MGBA 4M1YA 1UPBA 1YJAA 1T8RA 3LD9A 4QO8A 4U8GA 4IIBA 4C78A 2O8VA 3C5HA 1B8PA 2P6OA 1GZDA 1IUPA 2VHZA 4JYPA 5EKSA 1V6SA 2D5AA 4M1ZA 3H1GA 5M34A 2X2FA 3X1YA 3CNBA 2O3UA 4Q18A 2NU7A 2C3YA 2YHBA 2FA9A 2XMPA 3N05A 4US0R 1EGQA 1HYGA 1E3MA 2K4MA 3NYIA 2J31A 1SKYE 1NYTA 2K87A 4YAOA 4I3HA 4AO7A 3W2TA 4CL8A 2EGUA 3IR5A 3UM9A 3OX1A 2GN9A 3QIVA 5M3BA 2XUHA 1FFGA 4EJSA 5JECA 2RB5A 4Y7CA 2I4RA 2XKBA 2HV9A 3K9NA 4Z4GA 3K6SB 4YJ3A 4B7AA 3PI6A 3DC2A 1G98A 1AUQA 1QRAA 1XJWA 3KEMA 2M32A 4RMGA 4ZOLB 1TJNA 4BQNA 2I66A 3K8ZA 4X95A 1P1HA 5CLLA 5GONB 4P92A 3B52X 1Z73A 5KMGA 4KV9A 2Q29A 2R8OA 1W87A 3QBDA 1JQLB 3C6QA 3DL7A 1OXKB 1C7IA 1EGMB 1XTZA 4X8OA 1U28C 1WUIS 4MS3B 2BGMA 2QT9A 2R8RA 2R8XA 4UUNA 1JFSA 2XA9A 3NOVA 1TEVA 2HK9A 1MPXA 1PLJA 4HDOB 4MKFA 1YQTA 4DQKA 4AJ2A 3NHBA 1C2YA 4BO5A 1DC3A 1GIAA 4ZAFA 3RSLA 4DMHA 1I0LA 4Z9AA 2W43A 3TW6A 4BNYA 4D98A 1JDVA 3BE8A 2FN9A 3B1JA 3GNTA 3RSZA 2PXAA 3IR7A 5EWLA 4K28A 4B4VA 3WRXA 4QX6A 1OLOA 3ZTWA 1BYIA 1PDWA 1SRQA 2G3YA 2Q3MA 2VNAA 3BD8A 3I2JA 5CA0A 4GR9A 3IH5A 3O73A 1XA0A 3B20A 3F5DA 3MCWA 3PIRA 3V2IA 1YJXA 1T0IA 1KARA 2OESA 3AETB 5FTWA 4L4YA 4C4TA 2BCGY 3DWIA 2WMOB 5EP2A 3K9WA 4J0QA 3TGWA 1O9BA 1H65A 3NX4A 3OZDA 4HEJA 3OLQA 1RJFA 2XEDA 3AZQA 2VK8A 4IIVA 4MA0A 4N9WA 1COWD 1L5NA 2EBFX 2B1GA 3SX2A 2V54A 1PR6A 1KS2A 1UBUS 1RHRA 3GEEA 3OKAA 1AQJA 1MGPA 2CSXA 5EJ6A 1K8ZB 1XN4A 2VJPA 1OREA 4PEVA 3QXGA 1UBMS 3T3GA 4BRUA 3IO3A 1KEZA 2OV2A 3LUFA 4G0YA 1SVUA 4BO7A 4JIGA 1BXKA 4WACA 2DFTA 5HPYB 2GR9A 4IF4A 5A3RA 1Q6YA 2QYHA 4IIJF 4FGKA 4JZKA 4D9BA 3Q5DA 3PD1A 1OX4B 1YUBA 4J0EA 3RO7A 4ZWNA 1ZH8A 2GFHA 1MP0A 4I99A 1P1FA 2FRXA 3PC8A 2P9CA 4NAVA 5B3AA 2X23A 5JOQA 4B2IA 1YE8A 5AHOA 4YI5A 4J0HA 1BWRA 3OPYI 4FW8A 3C7DB 3SJCA 1RTKA 2PS1A 3BWMA 3DG9A 4F72A 1K6XA 2B5OA 4KGDA 1Y5RA 2VHXA 3G17A 4ZC8A 1GGNA 5A4FS 4YRIA 5A3QA 1MJGA 1HZJA 2H52A 3AOEC 3NTUA 3IE0A 3W7BA 3NHYA 1SXQA 1VBNA 5I8WA 4J16A 1EUZA 1J0EA 1UK8A 4IJ5A 5DHPA 1WL8A 3G0DA 1T0JB 3HMKA 4NV1A 3R7BA 1XZHA 3NP9A 3O75A 1M9NA 3CZCA 1ORHA 1S8AA 4PGMA 2J9FB 2F55A 4ERNA 5J3JA 3MTQA 2BE7A 4HMQA 1M67A 1MX5A 2IL1A 1EJ0A 2O2DA 3TOVA 5JBQA 5LQAA 3U3MA 3I01A 4DUGD 4GZMA 1SQ6A 3CLUD 3K0FB 4QU5A 3FJYA 5BNZA 3UPTA 1Q7TA 1QH8B 2FSSA 1BG6A 2JLVA 1NX6A 2J5KA 1LWOA 3I9JA 1E7QA 2GEUA 4Z9XA 2Y93A 1CY7A 3UTDA 5IT4A 2PAFA 5IXYA 3OZXA 3LQ4A 4HTAA 3SVZA 3WIUA 2ORVA 4BO4A 4B7XA 2Y9PB 2CK3D 4BU1A 4JQSA 4LZZA 1JS1X 2DHDA 3KQTA 4OGFA 4MH0R 5H1YA 2C57A 3FVVA 5JYBA 3PFGA 3MTAA 4QFDA 4ASUA 4G0ZA 1H85A 3AUXA 4IRUB 5EQFA 3UAVA 1EDBA 3UWDA 1ABEA 4K6CA 3ZWCA 3ANLA 1ORRA 1NLFA 3TCKA 5AM0A 1L1EA 3U4CA 1L8XA 5AK4A 1OI4A 2PWAA 4L9AA 1JEEA 1JG4A 1SXIA 3KKOA 4YUXA 2ACWA 3D0KA 5I9LA 1ADYA 1I33A 3RC8A 2FMFA 2Q2VA 1DC4A 1LBEA 1ZITA 3HB0A 3MVEA 3V3KA 4PV7A 4YJ3F 2R2AA 2PE5A 3K4PA 2MT9A 1NXVA 2OPHA 1JDZA 3G9TA 3JAWB 4KPFC 2GCOA 1XRRA 4QHTA 4ZFNA 3Q1LA 3O8CA 1S2MA 2AN9A 1P0CA 2XD9A 4HCJA 1PD1A 2Y4NA 4HQNA 3F6CA 4P35A 4B76A 5BXYA 3KKKA 4A0FA 5ED0A 4IFEA 3MELA 1M5TA 1UKZA 4WZZA 1CQZA 4PANA 4DQVA 1YJBA 2BFAA 2JLCA 1L5FA 2P8SA 3RFVA 2WSSA 2PS3A 2YNMA 3DM5A 3PNKA 3UPUA 1U0FA 1XYGA 3H18A 4PAOA 4ARIA 3F4BA 3KFVA 1NW6A 2C20A 2FFRA 4HPWA 1A71A 4JP8A 1LBSA 5GJBA 2PWBA 3JD0A 1OKKD 2VNHA 4NOMA 1XB2A 1M1NB 3KLMX 2XQIA 4AUNA 4BFTA 2YC4C 1U6KA 4CV0A 1J0CA 5I9NA 5EJAA 3AO0B 3P8ZA 3AUAA 3UJBA 1JNXX 5CA0F 3W7VA 1YDWA 3DH0A 1SQFA 2YQ4A 2G71A 1IAVA 4V0ME 4TSFD 4FX2A 1MQAA 4WUVA 2VJBA 3JVUA 4A6XA 4OI1A 3PHHA 1YBAA 3D4NA 3FCCA 2C04A 2ZXFA 5K03A 3HRHA 1Q44A 2PQ0A 3P9CA 1WMDA 4RQAA 5KQPA 3LCMA 3NEYA 1FYEA 5TY0A 1Y8ZA 3CX8A 2XVAA 3DL4A 2HT6A 4AY6A 1WKCA 3OJEA 2H06A 2EFDB 3GMIA 1NN0A 5FP0A 5C8ZA 4WOBA 2XDQB 1V9LA 2OCPA 2WMNB 1LSUA 3DXYA 3OOWA 5IJAA 4YO8A 4J0JA 4MQ4A 4D4JA 4EG5A 3LCUA 4IWNA 1RRCA 3IP8A 2JA1A 3JAKB 4HWRA 8AT1A 1ABBA 2YHUA 1P2DA 1UM9B 2I6XA 3NC4A 4DBZA 1O6CA 1XKTA 2IXFA 4V2UA 2C5FA 1NQ5A 4FUTA 2XXAB 3LT0A 4LXQA 4OUDA 3EXFB 3Q85A 2QVXX 5B3JC 3LW7A 3JQAA 1XOIA 5CNJA 1PT9A 4OXXA 3BXEA 3KT8A 4YAKA 2OZLB 2QR5A 2V6JA 4LWOA 4H17A 4ODIA 3V7WA 4HQOA 1Z29A 1E79D 1LUAA 4MUBA 1WMEA 4MINA 2Q6TA 1MHPA 5DH9A 3TN7A 1VE5A 4N39A 3ER8A 1Q22A 2C54A 3PLRA 4Y2UA 2X0NA 1MENA 3H75A 4MNTA 4EHAA 1P2FA 2GGSA 2H9AA 2PSSA 1JMKC 1XLUA 2XVXA 4U3JB 3A6LA 1KAQA 4IOMA 3VU9A 3DD5A 1W96A 3WJAA 5F7JA 3ONVA 1T36B 4FDMA 4S1PA 2J9ZB 2DM6A 4R2KA 2C4UA 4JOSA 1MORA 1QXSA 5J4YA 2FFQA 4RYDA 3VDMA 1FP2A 5JMWA 3EA4A 1TTTA 1IIRA 2CEKA 4MV7A 3UWOA 2H31A 5EHZA 5LIRA 1DKQA 4H35A 1NBMD 3SXUB 4DUZB 5E6UA 1TT5A 5EJMA 3BGDA 3KOXA 4MB6A 4OEHA 4D3ZA 1U2RA 1X0VA 1EK6A 2VP2A 3L0DA 4BGIA 4KZKA 2O2XA 5GGYA 3MLEA 2QM0A 1HH4A 1WDLA 2HJ9A 3QEJA 4HOYA 5A7GA 3SAJA 5U9CA 3EA5A 3WMFA 3ZHXA 2QENA 1EX6A 5B2ZA 1Q0LA 5AR1A 4D96A 3HADA 1O94C 2EW8A 3GP8A 1ZISA 5AW1A 2FMHA 4JEUA 4XJXA 2CUNA 4YGYA 2C2OA 5DYGA 2R6GA 3WYDA 5G2OA 3ASUA 3OZ7A 2QJTA 4H7IA 2AEFA 2WTNA 2H4FA 1SMKA 4B79A 1KYVA 2NYAA 3DKPA 1B7GO 2QVGA 4LBVA 5C8XA 5LR6A 2IRWA 1NVTA 1YU6A 3A9RA 3B38A 4OXIA 5DXJA 4QARA 5D5HA 3A26A 2VJQA 3AUTA 4R2MA 221PA 5EE3A 2XUOA 1D4ZA 2BM9A 4BP1A 4EEXA 5IM5A 3COSA 2O0JA 2ATEA 1PKEA 2VDJA 3DGEC 3EEFA 3VPBA 1JEYA 4QDTA 1KL7A 2F00A 4NBLA 2QRKA 4RCYA 5EE9A 3TIVA 2B4QA 5DSXA 5BVGB 1KZYC 3C8UA 1YS4A 4H1VA 3WJ1A 5B4VA 1J9EA 2QW1A 3C5EA 3HKDA 3TG8A 4F91B 3L0OA 5BNFA 1EVKA 4YR7A 1HG1A 2XCTB 4KOEC 1PG5A 2WTEA 1L7NA 4Q7JB 4GEGA 4JL5A 5K3FA 1QHFA 5ICFA 4ZXFA 3P32A 2BH2A 1AKYA 1AQ6A 1Q7RA 2OY0A 3DFZA 1J97A 2HRRA 1VA5A 2QL6A 3A7EA 3IAM1 3I39X 4G1BA 1R5BA 3LUGA 3WL3A 1KDPA 5A4KA 3K09C 1NXSA 1TQHA 3ZBQA 4JGGA 4B7ZA 5KJCA 3L7DA 3WRYA 5MN5A 1DEHA 4MCIA 1R0YA 4KSCA 4EG0A 3ZJTA 3EW7A 2I22A 4QRDA 2OB1A 5TV2A 1OW3B 1SK9A 1I0ZA 1K27A 2BEWB 1DBWA 2J33A 2VAXA 2X9NA 3FB4A 4UATA 4WZAE 4AU1A 4D8UA 5HDBB 2HFJA 2Q8PA 2XXBA 4L4UA 1AK1A 2O57A 4G25A 4KXWA 1P2SA 2H2AA 3EASA 2WEKA 2UVDA 3BHJA 4RY0A 1Z2CA 1X7XB 4IGKA 4BCDA 2QNBA 3O8QB 1JQAA 1VIAA 4OJQA 4P36A 2HGZA 1EK1A 3TZBA 2QM3A 1E9FA 1AOXA 1FYVA 5AKKA 5ALIA 3W4IA 1VSVA 1XD2A 2RGYA 1I3CA 2WWRA 3NKFA 1GRCA 1Z4JA 4XTCS 5B53A 4XQ9A 1I2MA 3PCXA 2IZ0A 4RA6A 3G2MA 5I5EA 8ABPA 2VC2B 3L93A 4IF6A 4M1WA 5K2MA 1K63A 3P2EA 1ZRMA 1YCDA 4BTLA 1BNCA 4DIEA 2I4TA 3CHYA 3MWJA 1NMXA 1RI3A 3AJ9A 4ZQIA 4OU4A 1T2CA 3EA0A 4GLJA 3SHFA 2OB2A 3MJSA 3ZY6A 3KETA 5J2TA 2YMMA 1OLUB 4DLKA 4A9AA 1O54A 4KN5A 1L3IA 5FBWB 4DLVA 3AK4A 5BSMA 1OFUA 3SFTA 3D8RA 3H17A 1V37A 3O1LA 4IMJB 5IH3A 3QEBZ 1EKXA 3M5CA 4KQEA 4FD3A 1D07A 2D1QA 1OX6A 2YV4A 4JBHA 4OQ4A 4ZYXA 4FNOA 1FNSA 2QMHA 1JNYA 1CR6A 4LDNA 1GPMA 1K8QA 3FSRA 1R4ZA 2UAGA 1H1DA 3HDVA 2WVHA 3SFVA 4DA6A 5LNK1 4IIJB 4JYAB 1B8NA 2OO3A 3D0RA 2R4UA 1NQUA 2SECE 4KV7A 2YXLA 5AKGA 3ACCA 1OOEA 4R0MA 4H6VA 3PWSA 4GWLA 2WILA 5ENVA 4QL3A 1Q14A 1SXJC 4V02A 4WESA 1QSGA 3L8ZA 1TMYA 1U0TA 1U7HA 3WLTA 4Z51A 2WP8J 3R1IA 1QP8A 1OV4A 1EFRA 4MQMA 4N7BA 5ER9A 2AXPA 4B5LA 1I32A 5D51S 1NW9B 3A9VA 5CIQA 2ZYWX 2YUIA 5T67A 3LUKA 1VKJA 4WFKA 1MUUA 2VTVA 2X9VA 4UNNA 2CZCA 1L5VA 4YT8A 2I2DA 1OH7A 2JPDA 1GQSA 3OLCX 4UD2A 5KQSA 4DIDA 2I2BA 4GDMA 1NNLA 3PEEA 2ZB2A 5CW2A 1FTQA 2NU6A 3FFBA 1M1ZA 2AYZA 3P97A 4ZTUB 4F1KA 3ICEA 4C3UA 1Y3BE 5HQ3B 2YRWA 2ERCA 2Q3HA 2M6LA 3ICWA 1CG6A 4C5AA 1Q16A 3O84A 4H3SA 2NU9A 4JP1A 3DT9A 5JJ5A 1UMDB 3VSDA 3QX3A 1KK1A 2FUG6 2RK3A 1Z75A 3ND7A 4KMMA 5KU7A 3H9UA 1Z2AA 4UDOA 3HKCB 3OQOA 3J81A 3BSSA 4ZJPA 1JQDA 4J90A 2V7QD 3PXUA 2JDID 4G97A 4EB8A 5CCEA 5JSQA 3C7KA 3DUFB 4H31A 4PC7A 3UHPA 5JQGA 4MIEA 1J2RA 1RC8A 3RRNA 4ALLA 2GDJA 1G2PA 2QQEA 4AMVA 5FX2A 1P77A 2C7VA 3EMKA 1R7RA 2RB4A 1IBRA 1QAMA 1RRKA 2JCXA 1X19A 3IQXA 3U31A 1K92A 3VYUB 3IEXA 2OQ2A 4MJXA 4R9VA 3DTVA 4KODA 3F78A 3GFFA 3NHFA 3WLEA 4EJSB 2BTEA 4M8SA 4QQ8A 4EHJA 5H4HA 1KO1A 1HE8B 1AHHA 1U4SA 2IBMA 4YJ3B 2DPXA 4EGSA 3IESA 3LF2A 5B3LA 3LBAA 2JS7A 4JD5A 2FPIB 2NNWB 2SBTA 1PBTA 2F9MA 4Y9RA 3DLHA 4KFCA 4OLFA 1YRHA 4BMPB 2Q6IA 2JAUA 2IA5A 3ZYCA 1CUYA 3L0ZA 4OB6A 4RIEA 4X45A 2GAAA 2X8LA 3QKWA 2HHAA 3BILA 4EKEA 1CEQA 5HJEA 2XBMA 3D4OA 4ZEVA 1QYIA 2RGNA 4G1EB 2AG8A 3B3QA 5K6RA 3WQBA 1EZ4A 2P3QA 3IO5A 2VTKA 4DM7A 3EZYA 3H9JA 1I9GA 2E7ZA 4JKIA 2WNHA 4IMPA 3TOXA 4A2CA 3WQSB 1QS0B 4L78A 3Q98A 2YFQA 4JJ8A 1TEXA 5AJHA 1HPLA 1T1SA 3B3AA 5CT4A 4ETWA 4ITUA 2H2WA 3S4YA 4B31A 1V1RA 3M5DA 1ZD5A 2BBWA 4IKOA 4WX2B 4EJMA 1L1RA 4N1AA 4ENPA 4RU1A 3HCFA 3Q9LA 5A71A 2R96A 2X14A 1JPJA 3AU8A 4RIFA 2J5BA 3INRA 3TL3A 4HQ6A 5CA0B 2QT0A 2ZKLA 4CLRA 1QP7A 1X80B 3PITA 1N7HA 4DMLA 1Y98A 2VK2A 3GVPA 3WO0A 2IELA 4WE3A 4ZVVA 1EDEA 1FW8A 3CM0A 5AW2A 5AKHA 4WCVA 1TNDA 3TBHA 3JW8A 5G40A 1QIEA 2GN6A 1J0BA 1TO1E 4DJDC 3QA9A 3GGGA 5IP5A 4CLXA 1N7GA 1ODKA 2JKZA 2WWIA 5J2TF 2CHFA 2EL7A 4QGBA 3ZU5A 1HEYA 1IZZA 1LQ2A 4EBFA 5IAEA 1JLKA 2FU5C 4UZEA 4LSGA 2ZE6A 3MCAA 5E8JA 4CE6A 1H2BA 2V9PA 2VXOA 4ME6A 1ZJZA 4XYMA 3HA2A 4PLWA 2P78A 3ZWPA 4RTQA 1ZHOA 1M75A 2B8JA 5C53B 4ILKA 3WYGA 1OZHA 2YQZA 2R62A 4MMZB 4KRXA 5HS6A 3T1QA 4B44A 1JLMA 2HQ1A 4M46A 2XOKD 5F5LA 3FSGD 2OBNA 5LXTF 4R8MA 1DEXA 4N5MA 3ZR4B 4G81A 4XOUA 1ORVA 4NAHA 3MAJA 4RY8A 3TOSA 5LA6B 3E5MA 4D0LB 4WCFA 2HMYB 2FTKE 1N1EA 1YGYA 3DEHA 3KPVA 5DCYA 1YZQA 4MV6A 2HX1A 5EPUA 5HJ2A 5B58T 3GZNA 4WHMA 1UQUA 1LDNA 2IW1A 3GFTA 1R6XA 4EFMA 1EVZA 1CEEA 3CVXA 3WGIA 1O94D 3NOXA 4ZT4A 4JUAA 5K0LA 5BQ3A 3PWZA 1U9IC 5DCWA 1Y1RA 2GD6A 1FZTA 4MW9A 5G1PA 3KC2A 1XZKA 5K3OA 3O26A 3IAXA 1PJ8A 3AM1A 2IZOA 2FSVC 3G7UA 5J58A 4HGOA 3FZNA 4ZKEA 1A96A 3V4FA 3BK1A 4OL0A 1Q7BA 1MABB 4X6LA 1EDOA 2FN4A 1REQA 3DBLA 4JS0A 4XJVA 1K68A 4DT1A 1UOEA 3MOSA 4O4LA 1E3IA 3GLFE 4ENUA 4HXGA 1XZDA 1Q95A 4NICA 4QDJA 1YZFA 1U5CA 4FK8A 4ZO4A 5GGXA 1PR0A 4W1QA 3BIOA 3VGJA 5AW3A 1VJTA 3EIUA 2ZJZA 4ZP1A 3V8PA 3RS0A 1TJ5A 3ZCRA 4B3BA 2F90A 1U3WA 3GPBA 5K01A 1NJGA 1GN8A 2O7NA 4JP2A 5IM4A 3G8YA 3RT1A 1PWEA 1EAMA 5JQGF 2VUTA 4MUNA 1DAKA 1UDCA 1ZP6A 4G65A 3ST7A 4V1CI 2ARKA 3O7WA 3WOVA 1RYFA 4Q4AB 2JGLA 5FPQA 1JVSA 5BRAA 4FGLA 2QGZA 2DUMA 3CH7A 1NE7A 4K9LA 2PRJA 3PSAA 4C2TA 5EHIA 4BFSA 2X9QA 2Z9DA 3LWNA 4YFVA 5DNDA 5AM1A 5EXTA 3TZQA 1FFHA 3OIYA 1FYFA 1GA6A 3GLHA 3HL4A 2I4MA 4L5BA 3TRKA 4GYYA 3VTZA 4TKVA 2HQSA 3DT8A 5AVXA 3R3YA 5J40A 1VBFA 5JWOA 1QNLA 1FFBA 2CVPA 2ZSKA 2YY6A 3PQ2A 3TZEA 4WTOA 1JFLA 4Y0AA 3A04A 3QYFA 2OCLA 3CPEA 3WZLA 3B6KA 4K3VA 3FMFA 2C2XA 4HGYA 3UMYA 5JI3E 2P7HA 1U0BB 3KYDB 3W04A 2EJBA 1O97C 1KEKA 4L0DA 4LA4A 5TJ9A 2BI8A 4RVHA 4L5YA 2FKNA 4CFSA 3AVXA 4P4SA 3VKUA 4GF5A 1OH8A 2TMKA 5EPEA 3R6WA 1W0JD 4TXMA 5FTMA 3BCHA 1MB9A 1W1IA 2NM0A 4XB6B 4O6VA 4C5CA 1YA6A 4JYBA 3FHCB 4OOFA 4G0XA 3PD7A 3S1AB 3ZXSA 1EK5A 3RVDA 4TTJA 2C82A 3EPJA 1O9HA 3I2FA 1XKXA 3VR4H 3IXQA 4JITA 5BV0A 1X1QA 1SXGA 3MHTA 4BNXA 1WOMA 1W4BA 2QUHA 5DHQA 2ZXEA 2CDNA 3PYLA 4ABYA 2ZU0C 5FEUA 1FBTA 3PPIA 2AK3A 2Q0XA 2GA8A 5B1DA 2A2ZA 4AYTA 1G2IA 2QPOA 1KZ7B 3O8OB 2XZOA 2V55B 3K0SA 5CEJA 2Y27A 4DJJA 3FKSA 4FIZA 4QICA 3F3MA 4E5DA 1IPFA 5HRAA 1SXJD 1FSPA 3F90A 1AX9A 5AW7A 3KTOA 5KINB 3C6MA 4CMKA 4PM4A 4C87A 4IRMA 2GCGA 2H85A 5CX1A 1V4NA 1XTIA 4TTRA 1M10A 1PZEA 1ES9A 1ZK0A 2OC4A 3CJRA 5HR5A 1DIAA 1EP2B 1GQYA 1KJIA 1NSFA 3KM0A 4P3PA 2PL5A 5TMPA 5L6MB 2YWEA 2FWJA 1KBOA 4O2BA 2P68A 1WMBA 2ECPA 1OXBB 3GFRA 1FRQA 1XLWA 1I6LA 3QELB 1GTVA 4F5ZA 5C4GB 1UIRA 1U0OC 4JLMA 5B5SA 2IHUA 4DZRA 3OFVA 1BD4A 1WDTA 3S99A 1L4LA 3PGMA 2WHPB 4WA7A 1JAZA 1D2RA 2DHEA 1L5LA 2Q5QA 4KI0A 1DINA 3LOPA 1N5LA 1UMCB 1Y7PA 1V8OA 4M0FA 1M2JA 4UOZA 2WTUA 4Q47A 3NU1A 1JR4A 4QECA 4E2FA 4PLFA 1EFDN 3DHNA 1L7XA 4BWYA 1YFZA 2GF0A 4RSGA 4KJZA 4PSCA 3H04A 4KKXB 5DNAA 2CBGA 1K8YB 1Y81A 4B6EA 4FYWA 4NL4H 3GLGA 5ELXA 1CZUA 4O4LF 4YWJA 3EYAA 3ZS8A 1SCJA 4GP7A 1ACLA 1LF0A 3N8GA 1Q7GA 2X4DA 2Z5GA 3GGPA 4UCXA 1KDRA 1E3JA 4EA7A 1NXXA 2W6ID 3NPAA 3EPHA 2AD1A 1I30A 1IDOA 1R0RE 1RM4A 2Q4OA 4KZPA 5REQB 3P4XA 5E6UB 4D6YA 4UOEA 3L2OB 5I48A 5GIPE 2WHYA 1SAYA 4IZIA 5LDHA 3HB5X 4BLUA 1KIFA 3GUCA 2ZE5A 4UMDA 5BR4A 3FBGA 3U44A 3BRSA 1HLPA 5IM4F 5CDFE 3GB9A 2CLEB 4WT7A 2PTGA 4DMCA 2IS6A 4INOA 1YQEA 1KFJB 1GZVA 3SYMA 1FX1A 3DLAA 1OVGA 2AQHA 3FPSA 4J9UE 4PYNA 4C6TA 3SZ3A 1P0FA 1QV9A 2D4AA 2I34A 5E4JA 4V0OA 4CIDA 4IH4A 1UKYA 5LYJA 2JEOA 3NTOA 3BGIA 4PG4A 5DN9A 5E4FA 3RLIA 1XJ5A 4M21A 4PG5A 5C31A 5B1IA 4XDGA 3N8NA 1AA6A 4PXAA 1X42A 1M2KA 3C3BA 3LX4A 4I7EA 4MKIA 4R6WA 3MINA 5CXUA 5FPPA 2XV1A 4K0KB 1QIMA 1ECCA 4GBED 2QZJA 2JGDA 3X1KA 3SP1A 1Z5UA 4F93B 1NQAO 1E7YA 3LSYA 1Q1BA 2XTJA 1JYSA 3OFKA 3R5XA 3D2LA 4ZVRA 5KYYB 4J0IA 1JEYB 2WPNA 2EW1A 5K45A 3P45A 2NQ2C 3K1ZA 3TJMA 3RHTA 1P61B 3R8CA 4D6PA 4OQFA 2QBYB 3KJNA 3EGCA 4TLBA 1IM5A 2FVXA 3W8FA 3P2JA 3ETJA 4FEGA 3PC4A 2AFHB 4YUYA 1U2SA 5B58C 4R1MA 4TTAA 1UXOA 3R0VA 2VJDA 3HH8A 3CNHA 3AONB 3CR3C 3VDNB 1T9ZA 1GQQA 3WIBA 1A7KA 1Z47A 2IYSA 2QY6A 1B8VA 4OMFG 4Q9NA 2R1TA 1TAUA 4KPYA 2W6CX 4MSUA 1RACA 3FDJA 4U2DA 3CUVA 2CLDX 1L7MA 1L5GB 1H2RS 3GHHA 3Q87B 3MJHA 3GYBA 4LCBA 1EX9A 2W8ZA 3FNHA 2QLLA 2WW8A 1LBQA 1GZ4A 1M54A 2IZ1A 2XKJE 4NK4A 4BDSA 3K1JA 4LWZA 1OFHA 4NP6A 3PC2A 1LU9A 4M3NA 4Q19A 5KNCA 1K3FA 1RYEA 1YJQA 4FVTA 4ZO7A 1MX3A 3PNSA 1UC8A 4LJ4A 4H1HA 3OHPA 3TZKA 1LV8A 1I2CA 3LNTA 3GVCA 2B98A 4CFZA 3RAEC 4DLUA 1N5DA 4C22A 3SHVA 1NBME 3PR1A 4JSYA 4EFNA 1XDSA 2FQ1A 1FMJA 1W4LA 1GRRA 5AVQA 3PNYA 4HF7A 4N4AA 2DBYA 3MIZA 3OPNA 4UHCA 2A88A 2ZRCA 2IDMA 3ZHOA 4WKNA 5ANRB 4EK9A 1XU4A 1O6GA 1T0HB 1ZDMA 2A57A 2Q4RA 3W5HA 4PZUA 3WLFA 1E0SA 4XVCA 2JIMA 3KEFA 4P31A 1YZ3A 3T9EA 2D1TA 1WZ2A 3KYIB 2N42A 1Z6YA 4O2BF 3AYXB 3V00A 1UDWA 1K97A 1V3QE 2BGIA 3HMQA 2FSFA 4AJ9A 5LFAA 1KYIA 4JFRA 3BMXA 3PUZA 4MO2A 4EA9A 3CLTC 2IE0A 3O47A 3PDIA 3UKJA 1J25A 1GPDG 5F7XA 2DUNA 1RLJA 3H1BA 3O4IA 1E59A 5DI9A 2M6RA 2PH1A 2IUSA 4N54A 3ZVRA 5IXSA 3MRSA 1PTJC 3UHFA 3S7ZA 5AHXA 1U63A 1UKAA 1ECPA 1QMPA 4NRDA 1KJ9A 3HNRA 1CFJA 3BXHA 3E7WA 3AVOA 3Q5EA 1M5UA 1OIWA 2E0IA 2J0EA 1E1KA 3ORRA 4LNAA 5JMTA 5BUZA 1CU1A 1CJBA 4Y18A 3NIGB 1M2VA 3PNLA 2XUZA 5H5JA 4PN7A 1M1XB 4WKPA 4CNQA 5JTUA 2ORED 8LDHA 2VYND 1AZSC 3GAFA 4FYVA 1SKMA 3ERCA 4RXTA 1U8XX 3UMSA 4BP8A 3E7XA 3BMCB 3M6LA 4LYAA 1CNMA 4HRYA 5LQUA 1KMCA 4P8RA 4UHJA 1HE5A 5AKYA 4NF2A 1U2PA 3BGSA 3RYFA 5ALGA 1I6WA 4AG3A 3WGVA 3A8TA 2PA0A 5BYBA 3OE5A 5SZHB 2BHLA 4B2YA 5FA8A 3ISTA 1D4AA 1DAHA 1EZ1A 1WCIA 3NHSA 1H3FA 5IBRA 2IHBA 3GLQA 5JS8A 1QHSA 1GNPA 3V8EA 4X20A 1Z4LA 2Q3DA 2ZQYA 4HGNA 1OSNA 4B73A 2XMBA 2IXTA 3WAGA 2NTJA 2NU6B 1NLYA 2ASVA 1ZYUA 4ZVLA 4Y1GA 3KT3A 4JVSB 4FMBB 4D2IA 3RC1A 1BCRB 3DBOB 3UCXA 3IQWA 1O97D 3N8DA 4MX8A 1W5AA 5LYJF 1QBKC 3BG5A 1VG9B 3BICA 3EVFA 4WECA 2AQKA 1H94A 1YQUA 1QPGA 4MJ3A 1VQ1A 4NH0A 2BFOA 3VDRA 4FNMA 5KWIA 4BO3A 3NH6A 1IHYA 2ZIZA 4PY2A 3R44A 4RHEA 3TSAA 3FWHA 1ANKA 1ADGA 4BKQA 4EPXA 3KT6A 4LUCA 2H4JA 1S9DA 2YICA 4OO3A 3GVHA 5JAUA 5AESA 2FZLA 4K3UA 5CM2Z 3UHOA 5JAQA 2WQ7A 2ATVA 4U7WA 1HE3A 4FHFA 3COWA 3GDWA 1MR3F 3U7RA 2YXPX 3M6XA 2FLVA 2CXTA 3UWPA 5FHRA 4OPMA 4G24A 1UP4A 2IODA 3LP8A 1QAOA 2QY9A 3FCXA 4N82A 1MMFB 3HJTA 1JF8A 2GZAA 1FSFA 4EL0A 5LMNB 4Z54A 4LZAA 4WKCA 3BD7A 1Z2DA 4WADA 2IX9A 1ESEA 2X2PA 1TU4A 4WZBB 1X2EA 2H5JA 3EG9A 4U0JA 4X60A 4YRAA 3I61A 1DAPA 1AQIA 1CETA 4PO1A 1PS8A 3H5IA 3OVMA 3BA1A 5KYTA 2PM8A 3VSEA 1A8UA 1ZESA 5CRIA 2K7ZA 3OIWA 2G9RA 1QHEA 1YE3A 3C24A 1DIGA 5LPNA 1SBYA 1APBA 3RUCA 3MBIA 1XMIA 4RTKA 1S96A 4Q3KA 3ZHZA 3TI9A 1EHYA 1G55A 1IHPA 1Z3IX 3FFAA 3OP4A 2F4NA 2OWEA 1XG5A 2DHRA 3JR7A 5CCBA 3B7PA 5I3ZA 1CRLA 1J7JA 2AXQA 2PKQP 2J67A 2Z6VA 3G7SA 3KOYA 3QV1A 4W7SA 5HIMA 1VLQA 3T0GA 3WLAA 1AV6A 1CZOA 1JG2A 4JLJA 4L2IA 4MWEA 4IS3A 3MFQA 1V1RB 2DLDA 5DI3B 3U7EB 4DNXA 2C4MA 2PHZA 3WLIA 1LBTA 3LH5A 5IXJA 2ZCUA 4ZQCB 3CLRC 2AYYA 2F3QA 3IA7A 4NI5A 4NOKA 4P53A 5CDHA 2C4TA 1KYZA 1T2DA 4EMTA 2ID4A 4AZ3A 1F8YA 1E3DA 4V0QA 4EO9A 5H3CA 2X1HA 1WSDA 3HUTA 4BKOA 1X3SA 2WKRA 1CP2A 2HADA 4D3XA 1C1DA 3A6EA 3HYNA 4S0ZA 3RADC 3CT6A 3UF0A 1OHHA 3DVLA 4K6GA 2CCKA 2IK8A 2WPDD 4XWGA 5AXDA 1UBTS 4EFLA 2RGCA 3IILA 1JECA 3AV3A 4Q3DA 1UBCA 4RM3A 1CV2A 2I3BA 3WYFA 1Z06A 2YOHA 1YZGA 3NWJA 4HWTA 4PWZA 3N86A 1KETA 4R1OA 1J20A 3U7JA 4XVRA 3P2KA 1R8YA 3F6PA 4DA4A 3L0BA 3K30A 3N76A 3ET4A 3KSBC 3CUSA 1VJ0A 4LI3X 3GF4A 1Z0KA 3HXTA 4AZSA 1HR0B 1YUNA 4IQFA 4C7VA 4WCFB 3SIRA 2BJHA 1C0KA 1V3TA 4LBYA 3GZNB 3D7KA 4KIUA 1FS5A 4X8MA 5CEEA 2WU4A 4WEQA 1JV2B 2BI4A 3AF5A 3CUKA 3WLLA 4EJSC 1V5EA 5J9FA 1HE4A 3SDBA 4KVFA 5EIAA 1RLTA 4LGVA 3U3DA 3S5UA 2ZYSA 5B64A 4QU0A 1Z4MA 5E7MA 1FDWA 4JR2A 3LC0A 1HEUA 3DZBA 3SVTA 1ZLYA 4Q39A 3A27A 1SFRA 3F1KA 3I5XA 2GCIA 4A0HA 1XDWA 3SS7X 3ZJUA 1Y9JA 1REQB 2AVNA 2X4LA 1Y4UA 3BSWA 3HM2A 1LRJA 3CUTA 3HFRA 3OZAA 4WK0B 1PZXA 3UT0A 1I5EA 1EFVB 4Y6LA 4ZICA 1SUIA 1GRVA 3LIIA 3S29A 5JYEA 1E3WA 5E9AA 1BA2A 1ZXBA 2R7KA 2ZAOA 3O92A 1PJLA 4PO3X 3B6IA 2C5HA 3HN6A 1OIVA 3PS9A 1W93A 4MGEA 4QJ4A 4HDRA 4HXYA 3S8MA 4N3GA 3KBOA 1WETA 4QGHA 1Q83A 2II6A 2GUWA 3WBBA 2ZWAA 2HMAA 5KTTA 2GHTA 1IPHA 1MV5A 4BE7B 3IMGA 2EFEB 4D3YA 4CM7A 3GRCA 2I65A 2X5OA 3CEPB 1NAIA 4TUYA 3WMXA 4P2BA 4OLBA 1G5PA 2DZDA 5HE9A 4F3RA 3L8MA 3GNLA 2XCSB 1XDBA 4O5AA 2Y1OA 3OEHA 3W6ZA 3DV2A 2BGGA 2CCJA 1G5FA 1TIBA 2ZJ3A 3LDUA 2XF2A 2EEZA 3D6JA 4MLPA 4P0PB 4RVFA 1WZUA 1I1OA 2AUTA 3CPSA 5BUCA 1QTRA 4MS1B 3D3JA 1PJCA 4EI8A 1UAGA 2IYPA 2KBFA 4PWYA 3K70B 1DUSA 3AFGA 4AS3A 4TKVB 4ESEA 3AKZA 4QULA 1J42A 1L5MA 4XUDA 3KDSE 4QVIA 4XJSA 1T6ZA 2ZIGA 1P33A 1ZMTA 4JIMA 3WQRA 4QM6A 3N28A 2B61A 3BK7A 3CLHA 3I5AA 4FEEA 2R79A 1TRKA 1DKLA 2HRZA 1VMIA 4LY9A 3RW9A 4DPKA 1RPZA 1QX4A 2CLOB 1YMVA 4RZXA 1CEXA 1EFLA 4L57A 5GZ1A 1FNMA 1HDIA 2NPFA 1KR5A 1MDFA 2DWPA 2G76A 3I9NA 1SCUA 3L7MA 4W6QA 4BKPA 2HMVA 5JSKA 1ZVVA 1E7RA 4ZVOA 1ND6A 1QE0A 4BGVA 1FDOA 2HSJA 5H68A 5B4UA 4DR2B 2C03A 1QQBA 1W34A 3HV2A 1PDVA 3HHEA 2BEUB 4RJLA 1TD1A 5DX1A 1PL8A 1J5PA 2R7AA 3HVIA 2OC9A 4Q01A 1FJGB 3ZWWA 4UBJA 3TCNA 1L4FA 2KPOA 4DLNA 3FN4A 2QMYA 1AHPA 3RS9A 2A5FA 3CLTD 4W9MC 1M1YA 5DBIA 5JI2E 3DDSA 3AF2A 2CV2A 3H4MA 5JFOA 4BBJA 4IJMA 4S0XA 3RAGA 2EFJA 2FVYA 4Q05A 3SOPA 1E1QA 3RU9A 1DKOA 1JXQA 1NVXQ 2OCGA 2ZANA 4WBNA 4QPZA 4MA5A 1H9BA 3LXRA 5BY2A 4YASA 2HSWA 1N6NA 2BM0A 1N2CE 4UJ3A 4YA6A 1SJ9A 2M1XA 1ZCBA 4M1TA 4Q93A 2WUEA 4ZMSA 2BJVA 4RZHA 1HO3A 1OFTA 1YT5A 1XQ1A 2BE9A 2F1HA 2WMDA 2HUNA 3AINA 4FU0A 4KFRA 4M9SA 1HTWA 1HTBA 1KORA 2DTXA 1AXRA 4Y6GB 5FNVA 2AOWA 2IYVA 2ATCA 1B16A 1BKDR 1MQ8B 1DJPA 3M9XA 5TS2A 4JHLA 4FOSA 1KAGA 2XCLA 3ZE1B 1QLJA 2EL9A 2B8EA 4X00A 1OWPA 1SG6A 2REBA 2YHAA 3B1YA 3K1AB 3R3JA 1FDUA 3P96A 3VYRB 4U2EA 5YASA 3RSSA 2PQ2A 5SZKB 1KRWA 4FZRA 4U9HS 2ZIEA 3KP1A 1EFPA 2FUCA 3B9BA 3EZ7A 4JLDA 3SQDA 4C76A 1GTSA 4NEGA 5JD3A 2QL9A 3G7NA 2ZR9A 4NC9A 4O2BB 2QTNA 2PBLA 1L5KA 1AQLA 1FPMA 5JS7A 4HNSA 4MROA 4HWOA 3QUTA 4IOKA 1KK0A 2ONZA 2RGWA 1I6KA 4I9UA 4KOAA 3LVFO 3ZD9A 5BSWA 4IDNA 421PA 2OGUA 4WINA 2F3SA 3ED1A 5HKLA 3T6KA 2GTIA 3SNHA 3C6KA 5FF9A 1M34A 4EDHA 4BYMA 5SY9A 5B55A 1POWA 4MYSA 2PANA 1CS4C 4HLUA 2CUZA 2TMGA 1FNNA 2NP7A 4CKCA 3OICA 1KMNA 5EMLA 2L19A 1IYZA 1CFZA 4RZ2A 4EM6A 2G9UA 4ZEMA 4W5TA 1T24A 2C88A 4ZO6A 3TRDA 1X1RA 5BUSA 4PFSA 4Q4JB 5C8DA 4XUEA 1GCUA 1U5BB 4JVOA 3I45A 2AK2A 5AVYA 4L4ZA 3DZIA 1L4KA 3GLGB 3KBBA 3WLQA 4PO8A 3LLCA 5KNDA 1BX1A 2VNJA 1TM3E 4QDKA 2VYQA 4G4GA 1UKCA 2W6OA 4XQ0A 3TEMA 5IMSA 1SBCA 3R3XA 4XSVA 2XBLA 3V7YA 4MGIR 3VPAA 4BMOB 1QFJA 2D2IA 3NVKI 4X85A 3E2PA 4N5IX 4Y30A 3W5UA 4DLTA 3IJRA 4OM8A 1WZCA 1USUA 4GZ3A 2BJWA 2JLWA 4TUYF 3UJAA 3D4LA 2QVYX 2VPTA 5ESXA 4L4RA 2OILA 2R84A 2PGXA 2QQ0A 4DM4A 3SR0A 1SVSA 5JCXA 3ZGZA 4C6TB 1V7QA 2WJ3A 2I6UA 2DU8A 3JQPA 4NG4A 4RF5A 1CUWA 2NZ2A 3ESBA 4E3WA 1NI3A 3FOAA 3WGOA 5C1PA 1ZCZA 2QRMA 3I2IA 1JE1A 3TTUA 1KEEB 2CMHA 1UP6A 4MICA 2G4LA 3E61A 4GKAA 4LY6A 3V2HA 1GJRA 1MAWA 1SXJE 4RF3A 1XZPA 3HI6A 4IX1A 1DRKA 3P26A 3ZKWB 1A95A 3RCBA 3G79A 3KR2A 5B1HA 1X7DA 2EJVA 5H70A 4IPTA 5TEWA 4H1WA 4CZ2A 2OCAA 1ZWLA 1LWNA 1WY5A 3CLRD 2F3PA 1JP7A 1SUFA 2D8MA 2XAUA 3GLRA 2FUNB 2JBWA 4IIHA 3H6KA 1C9JA 1VSQA 4MDYA 1HWYA 4M1EA 4PYMA 2F59A 4X6XA 2GAOA 2J7KA 3JWIA 5ADUS 3HNPA 4L5IA 1FNBA 3EULA 4LWPA 1MIOB 2A8YA 3NXKA 4X61A 5DXAA 3WRVA 2UZ1A 4BQSA 2YFYA 5FCDA 2NX2A 4P1ZA 3UK6A 4MQFA 5LQKA 4DABA 2H08A 4JJKA 4CIWA 3PXEA 3AJAA 3N75A 2P69A 5IDVA 3KZMA 2G0NA 1WCXA 4XPIB 3IQEA 5T8KA 2NO0A 1B1CA 5JO9A 3X1DA 5DYNA 3SLRA 4WBNF 4UOQA 3L8DA 3MXTA 4ZRNA 2W2PA 5K5EA 3GNQA 3R0JA 3U4QB 1C0LA 2J41A 1XAIA 2D0DA 1YS7A 4EARA 1GFIA 3EY9A 4JI5B 2PUEA 1QQ7A 4CQMD 1Z62A 4O4JA 4MQ6A 5NULA 3I1JA 3L04A 2YY5A 7AT1A 2H2HA 2RGRA 2BFBA 4KR9A 4ZCRA 2HR1A 3BCRA 5FNVF 4G84A 2NVWA 2I6TA 1BRMA 2QUBA 3BTUA 1N9GA 4RHFA 1IZ8A 2XWJI 3GARA 3E0XA 3IIEA 4HS9A 5FLEX 4B3IA 3CX4A 1P9LA 4ILEA 1GG2A 1NTRA 5JS1A 4EW2A 4B2LA 1YD7A 2CL0X 3C5CA 3L46A 1SC3A 7MHTA 1PJBA 3G0IA 3UUGA 3GAAA 2MSWA 2VDQB 3CU5A 2XB8A 2XQGA 4CKWB 1X7HA 1EBUA 1YZLA 3KJZA 4R2IA 1R3UA 1VKZA 3CEHA 2E37A 4E7OA 1EP9A 1AM4D 1FTNA 2NQ8A 3N8KA 2G36A 5EIOA 3EOAI 3VR6A 4F3NA 3S2EA 2QX7A 1QNFA 2B7BA 2V5AA 1QRUA 1V0JA 1O95D 1UOQA 4MPTA 1BH6A 4E07A 3IYLW 2RD2A 2I2FA 3KB6A 2EF1A 2I33A 2EV9A 3ICQB 4RA9B 4YLEA 3N59A 1PN3A 4J1TA 1F14A 2PH7A 3HCNA 1UBOS 1XAHA 1SHZA 2B4YA 3HCOA 4NZZA 3I83A 3W5JA 1QU3A 4TXNA 2BTOA 2VHJA 4Z1MA 2QRJA 2W0MA 4RH0A 2QMQA 1J24A 1O08A 1P6UA 1VCHA 2F3RA 2QA5A 3OZGA 3UZUA 1CUAA 4UTPA 2AKYA 2QM7A 3FAZA 2D5CA 4C4ZA 4ID3A 3NWEA 2Q0SA 3ONWA 5C80A 1RWVA 3UGJA 3B3FA 2RI0A 1OV6A 3RYFB 2AC7A 2OV6A 2PZAA 4GW3A 5FQOA 3I64A 4DCVA 3JARA 4YRGA 1FZQA 1MD9A 3ETLA 3CGWA 2I1LA 4RJIA 5THKA 3TMKA 1SPXA 2FE4A 5KNBD 5LQMA 4X24A 2XWSA 4HQRA 4BMSA 2QXTA 4LF4B 1L4EA 1KZ4A 2UZ3A 2B92A 4HH0A 4QUHA 4CCYB 2VF5X 3NUZA 4I4TB 2X86A 4X6UA 4XWAA 5BR7A 1JQEA 1L7VC 5GONA 3W5DA 4FFVA 5FR1A 3CPJB 4QJ3A 1CHNA 3IQDB 5FBLB 3W4JA 4F06A 2NUBA 3GEMA 1HZZC 2IYWA 1DKMA 1A50B 3E7DA 3WP1B 5CDUA 1KF0A 2VWGA 3FLAA 4XR4A 1IPEA 1UPCA 3SJAA 2DBQA 4GOOD 1D2EA 5EKXA 1QBGA 2ADMA 2ZIXB 1NW5A 3FF4A 2WWVD 2INGX 3I1YA 3HXPA 1Y37A 4MCJA 4M0MA 4F9GA 3KXPA 1CQXA 5TMEA 1D5WA 1AKWA 3WSWA 3BT7A 2J8ZA 5C34B 1T5SA 2ONCA 4MS4A 2QEQA 1JT2A 3BEDA 1ZH4A 2BSXA 2V97A 2DUUA 3BWBA 1GNSA 3IIKA 1GNVA 4RBNA 2WJWA 5T3YA 5CFQA 1P6XA 1PS0A 4IHKA 3RRJA 4L3VA 4A8JB 1ZN9A 5GV8A 4M7OA 1T3GA 2GJAA 3N2KB 2VUSA 2B2NA 1JSXA 5BUQA 3TUJC 3NB0A 1SO8A 4G85A 2PRIA 4XI9A 3JASB 1P91A 4WOJA 1UBLS 4POOA 2OFXA 4ALMA 1E8DA 1MB4A 1MN6A 3HY3A 1ZOSA 2IHYA 1R8QA 4IJUA 4WLVA 5HTOA 2YWBA 4KLNA 4B43A 4I5DA 4PPYA 1GTG1 5EAIA 5EJ2A 4AC9A 3I1IA 1TUEA 2QE7D 1WEHA 4YAJA 4ZVKA 3KAJA 4FFMA 4BTVA 3JYLA 4IOJA 3QVGA 4KFTA 4ZAVA 1NW3A 3GFVA 3JZAA 4N47A 4KIWA 4R1UA 5LQJA 1TAGA 2X41A 3LBNA 2CNOA 3TDKA 1ADFA 1DBSA 3NANA 4EYQA 4X91A 3EHEA 1OTXA 1NHGA 3HXMA 4E13A 1FCJA 1I10A 3QWFA 4TS3A 4UU1A 1JKXA 2Q1TA 2VJYA 4DQDA 2P2GA 4MPRA 4BEBA 2AI2A 2BMEA 2VI5A 1C8VB 4HP8A 1LK7A 4YIKA 1OPRA 1BEUB 1GPNA 2BHNA 1PIWA 1UK7A 2G67A 3HS3A 5I5GA 3SMVA 3ILSA 1T9GR 1GPBA 3AB8A 3ZIAD 4PNZA 1JZTA 4B83A 3BVPA 4H7HA 4JI4B 4Z4IA 1LRLA 1FPQA 4H6WA 2OG1A 4IH1A 4YRSA 4AZ3B 4RV4A 4LOAA 4KH0A 1KI1A 5KDLA 4FKZA 1RWPA 4W5HA 3VUEA 4AUEA 5BV2P 5IFLA 1KE1A 2ZBGA 1WTCA 5M2QA 5IRCD 4OKIA 1C1DB 3GFSA 4JI3B 2NNLD 3OZVA 4WMLA 5CYOA 3FD8A 3ESXA 5A02A 2WF8A 3K4QA 4LOHA 1GCIA 2ZWVA 5JH7A 1KAHA 3ETDA 4JROA 1UJCA 1QHXA 2BF4A 2VOJA 1PK8A 2PFSA 2X8BA 4R8VA 2C2MA 1L5YA 4IILA 3RBAA 3ZGXA 3KLNA 1NXQA 2RG1A 1TFUA 5E1BA 4G67A 1SGWA 3TRFA 3SC2A 5IC6A 4H18A 2QLNA 5F9FA 3AZOA 1V7ZA 2RK4A 3A1WA 3DVAB 3ZQKA 1WVGA 2Q21A 1OPXA 4KBGA 1PQUA 1BW9A 4QVGA 4BN4A 1NJ5A 4V0LA 2V0GA 3WLKX 2LRHA 1KI3A 1KFBB 2BELA 2POCA 2R2GA 1FJXA 2B9EA 1KQOA 4Q3EA 1TQDA 3BWYA 2WK1A 1DC6A 1XVVA 4QVKA 2KMLA 4UM7A 2FN7A 4BEWA 3PT9A 3O8DA 3P5SA 1C3JA 1A76A 1KXZA 4DIKA 4RZQA 3H5TA 1I7QB 5DOVA 4GSLA 5ALZA 3L43A 1BH2A 1Y9AA 4OIMA 1KSHA 2PR7A 2G17A 4C0XA 4CL2A 4E5PA 1VI2A 4ZK2A 4RULA 4BNVA 2UVPA 1C7QA 4N5NA 4F2HA 5ITZA 1PGNA 3STVA 3THSA 3SDSA 1C3OB 4H3VA 2ZI5A 2REOA 5JPDA 1UBJS 4KO3S 3SIWA 2HPAA 3M3PA 1WA5A 1E3WB 1OXTA 3DEKA 1PYGA 4JX9A 5ES3A 5L4NA 5TEVA 3PHIA 2YJNA 4INAA 3CSUA 3TQRA 4XPZA 2C99A 3TXYA 4AJHA 4EW1A 5AJYA 4DJEC 2GYYA 3R9KA 5LM3A 3GW8A 2PKWA 4GVLA 4TUYB 2ZBUA 3BMQA 4PLYA 4OHZA 1EUQA 3B7GA 4NEQA 4ZTZB 1UBKS 4DIBA 2V7TA 3L4BA 4BZZA 3BRWD 2Q2WA 1NVBA 4RL6A 5A05A 1G9TA 1VSUA 1IQPA 4G07A 5H0IA 2GXQA 1U7DA 2X58A 4TV8B 4BLSA 2PD6A 3GDHA 4L4XA 2HL6A 5EPOA 4AYXA 1AF4A 3FA2A 3WA6A 1QH0A 5EJ8A 1EM6A 2ID7A 1HFWA 2O2HA 1BE1A 1SHJA 3A1VA 2RHOA 3K3PA 2O3SA 4TMTA 5AVOA 4IEEA 4XCXA 5AOBA 3GJTA 4EB6A 2EP7A 3VTFA 4I14A 5I7EA 2VDUE 3T1VA 4S3MA 4C01A 4UNIA 2CT8A 1OH5A 5H7XA 2GARA 1NUAA 1BGWA 4IHJA 1HKUA 3F2VA 1SCKA 4BASA 4JVMA 1HEIA 3K4HA 3PC7A 3CE6A 3B3GA 4BO9A 4U5QA 5K0FA 3I6YA 1VE9A 1QHHB 2I8CA 4QUDA 4UXIA 4FXPA 1DWOA 1L5SA 1XTUA 5MN6A 5IN5A 4XUGB 1UFRA 3HN7A 4K6KA 4W5RA 4OQXA 5HRCA 4WCFC 2E82A 3EXIA 4KSBA 3VR5A 4A10A 1NOJA 1C4WA 4RJKA 1V43A 3AJEA 2XA2A 2XUJA 3H19A 1X92A 3FPCA 3FIUA 3PXBA 4PLPA 4W63A 2F8TA 5F77A 3UC9A 5CFOA 1CD5A 2PX3A 1Z4IA 3KQVA 3NKLA 3B13B 4KC0A 4F45A 3QLTA 2DQZA 3WX0A 1N6KA 4HQLA 4E5YA 2HBQA 4LMPA 1KH2A 3NM5A 2X2EA 3F3KA 4LBWA 1RKXA 2FEXA 4GYKA 2JIZD 5K8VA 4B74A 1PAUA 3E22A 3NFRA 2XYQA 5C32A 4J91A 4BVLA 5IK2A 5ALHA 1IY0A 2L0XA 3PTAA 1TO6A 5K4HA 4TWZA 3ZXYA 1J5XA 5D3MA 3WAKA 4MVJA 4TVOA 3PNVA 1JKFA 3VR3D 4BMYA 1EWTA 1YNOA 4QDUA 2ZTLA 1M2OB 1TM7E 2OTCA 2WSLA 3WGHA 4XCQA 4V38A 5FNVB 1PE0A 4DV6B 3HJBA 2B94A 3LQYA 5LL6P 2D3TA 4FI3F 4NMLA 4KN9S 5D87A 3MJVA 4HB4A 4AULA 3GEPA 5JH7F 2RG7A 3AW8A 3TH5A 4BV2A 3X1XA 3PEFA 4A0QA 3FGOA 1W46A 3QU4A 5CCXA 1DHTA 2JFOA 1R3DA 5ADWA 1SUCA 2JLRA 1WP9A 3AP3A 1WUHS 4C30A 2TSYB 3HJNA 1UEJA 4FLEA 1NUQA 1SURA 2ZLBA 2G88A 4FOLA 4ER5A 2QZPA 2FF7A 3AEUA 1UEXC 2QSJA 3ZH9B 3GL9A 4NOLA 3STHA 1YNSA 3V6LA 2QSZA 1E5DA 1W6RA 4M88A 1J1UA 2FSUA 2JHFA 3VPFA 1W2HA 2H7CA 1IXRC 3WIDA 1G5QA 3ZDEA 3W05A 1LDMA 4E5NA 4OSOA 1G3MA 1W59A 3OSZA 3WNCA 4RK5A 1YR3A 3M5PA 1M34B 3K70C 2C3UA 3EFEA 3JYPA 5EZSA 2H4ZA 1KEVA 3M6MD 5KWJA 2L82A 2XDAA 1K5DA 3FF1A 3AXSA 3JWJA 1SUWA 1ZJ6A 4GVPA 1ZRHA 5HGXA 2YJTD 2H1WA 4C4PA 1C7FA 3H5VA 3LDGA 4NE7A 4CKCB 1GILA 3AVWA 5E8RA 3DULA 3EW9A 1H2HA 3JR3A 4UHBA 2P90A 2YWXA 3BGOS 3NHZA 4KDFA 3VZQA 1JB9A 2JD1A 3JS5A 3OE7A 4KW7A 1W5FA 1M8KA 1DBVO 2XGSA 1Z7GA 4NPHA 4FKBA 3RI3A 4YB8A 2VJMA 1EJBA 1N32B 1E2LA 2BMVA 3EZ2A 5AW4A 1VYUA 2BFDA 1G8SA 2J6IA 3FCYA 4JU9A 3ROQA 1G7SA 2ZYAA 2HCFA 4YJHA 1XZAA 2G5TA 1O9GA 2OAP1 4LV6A 3KFXA 1BVYF 5JSYA 4BNKA 2GPWA 4YJKA 7ADHA 2IY7A 1B00A 1XWWA 2AE1A 1FE8A 2XADA 3A14A 3CVOA 3EF0A 3EJWA 3NHRA 1H2WA 3QRWA 4ZGWA 4R40A 5FPTA 3GDFA 1RLMA 4E08A 2PYZA 1YBMA 3T3MB 4BJ5A 3I72A 1FX0A 2C78A 2H1SA 2JJ8A 2ST1A 3CB2A 3EFBA 1VSBA 1ISIA 1RYMA 3A1UA 2GHQA 3O31A 1YQQA 3IHTA 5JPIA 1UWCA 3KU4A 1W9HA 3V5NA 1XCBA 2H3EA 4OK3A 1RTTA 4AUKA 2GYUA 3EG5A 4NDZA 1T0BA 1QR2A 1R64A 1BAPA 4GWGA 5EMJA 2ZB4A 2V7VA 2GDZA 3EYWA 5JNRA 1RWKA 1CF9A 3AR9A 3DZDA 4CM9A 5BMVB 1E4YA 1XA3A 2D0PB 4XARA 3S2YA 1KZHA 1WEKA 1G8GA 2LDXA 3D8HA 2KI5A 4Y0NA 3E8MA 3PQCA 4IHJF 4JC0A 3WIEA 3CW8X 3INNA 3ZHYA 5CT8A 2Y92A 3DOJA 3ONEA 4KSYA 1KY4A 3UK2A 3K0HA 5DK4A 1EQUA 3PWTA 1SC1A 2Z5VA 1KSJA 4JSRA 3TZLA 4EP1A 1JL3A 2XY4A 5TX7A 3TQIA 3VZDA 2JFWA 2HWKA 4KXNA 1FSSA 4LRQA 3IE2A 2DBZA 1MC4A 4OH1A 4WOCA 1AUPA 4GO1A 4PZ0A 4QJBA 1QCCA 1O2DA 1SUEA 4V0KA 2MYUA 2O3QA 4G1FA 2D5IA 3MJEA 3RJZA 3SQLA 4MWZA 2G4CA 2UZ1B 5LDDC 4DV1B 3O8NA 1PT5A 4CF6A 1EA5A 1YULA 2OXCA 4OYHA 2RIPA 2GM5A 3BL6A 4G0OA 3V7UA 2Y8EA 1V8DA 4H0NA 4BNMA 1NRIA 2WUFA 4QYIA 1HXHA 5KYYA 2O50A 2BGJA 2RGAA 3AL2A 3K9GA 1COZA 4JUBA 2VTEA 3GFPA 4WD3A 3EXEA 1X1TA 2HJVA 4K9NA 5J4HA 1G8KA 1FDTA 4BX2A 3HJFA 1NIJA 4MW7A 1ZGJA 2O06A 2EOAA 1OZGA 2X0JA 4JASB 4HZUB 3R7SA 5IUJC 4MVJF 3GXOA 4RFSA 1BROA 1T29A 3U37A 5EIBC 2JF0A 4C3VA 2BFBB 3QVUA 4GKBA 1L1QA 5FV4A 1N4AA 4A8TA 3ES9A 1JSCA 1SUPA 2VUIB 2VXBA 1IJFA 3EVZA 4OXQA 4D5EA 1H66A 4UU7A 2AKEA 1XJQA 1T2FA 4O59O 4UFPA 1LFDB 1P2TA 2XQVA 3FCAA 4BO0A 5CGQB 1IMJA 2QTWB 1EG2A 3RK4A 3B6JA 4GAEA 1G18A 1Z7EA 4KJXA 3WJ7A 4P22A 3A2NA 5K8LA 1RZUA 3CONA 3ZWVA 2O5CA 1SOMA 3DLPX 3CUYA 5FEMA 4RWEA 4MUYA 4F56A 2Z95A 2I2CA 3SDZA 2C7PA 3EIHA 3CCCA 3CLKA 1JWLA 2O14A 2ZJFA 3H86A 3SBDA 2FOXA 5LP1A 3NEJA 3OZEA 3B60A 3KSRA 5H80A 2QTBA 2OENG 1XL1A 2VAWA 2A9RA 2ZWIA 3GH3A 3GJ6A 4JL6A 4MUEA 5H59A 4DLLA 5KYWB 2O8CA 5T3UA 4J4TA 3PCTA 4MUKA 3O3NB 4O1HA 4K9OA 5C3UA 3TTVA 4DLBA 3SU8A 2GPAA 2CBXA 1N8TA 2IPAB 1W5EA 4EA8A 3VOTA 1JHQA 3V97A 2I6FA 1MAUA 3LRTA 3TBKA 1GKYA 3AKEA 2VCHA 2XDWA 3QPBA 3HUDA 3MWFA 1IG3A 1A4IA 3CGGA 1L7PA 4IGFA 3KHSA 4J2HA 5FTNA 3IXMA 3O2JA 1YMQA 2HLHA 3RFXA 1JXAA 4OJTA 5KYXB 1K0FA 3L5KA 5K6AA 1PSZA 2NT4A 1H5UA 2O0KA 1PO7A 1N78A 2H1HA 4GIBA 1O96A 4NU6A 4ALKA 2P5SA 3E05A 3BE5A 5DYTA 3MQFA 2ODWA 3GFOA 2XI4A 2D2VA 2WE8A 2ZRNA 1YHNA 1MJFA 1SIBE 1ZM2A 4P0TA 3L7OA 2ZJOA 2FFHA 1SA0B 4K6MA 2GWRA 4CF4A 4P3YA 4LGYA 4BAGA 2X1LA 4F3CA 2I29A 2VLIA 3WDLA 3VHQA 4Q1DA 3UV6A 5DYWA 3CINA 5FWNA 2E49A 4BX8A 2VF2A 4WJKB 2GNAA 3PUIA 4EUHA 3H4IA 3RS3A 4DC0A 4I19A 1RRPA 2GBFA 3O3OB 3W6UA 1N3YA 4HVTA 3ENNA 4NU5A 3V34A 1I6MA 3BFXA 4IV5A 2P9HA 4DA0A 4UTVA 5JHHB 3IUJA 3V7NA 3NCHA 5K0EA 4PPNA 3IEVA 1EFHA 5JAIA 3LT2A 3PXCX 4KWEA 1PF7E 2VSXA 5DHRA 5ICCA 3HCDA 5LQNA 1VI6A 3I05A 5KQRA 2BP7A 4C4AA 3DYVA 1IEQA 4PNPA 3WA7A 1E2UA 4U8HA 2C00A 3T35A 1ILWA 3NUQA 3IE1A 2Z6AA 2CDBA 3FPEA 2XQKA 3KD2A 3OQHA 1D6MA 5K7SA 3C3DA 1BKYA 3L9XA 2Y2UA 4IGEA 1HDGO 1O1YA 4ZI5A 1NUUA 2BISA 3AHFA 4KUHA 5FWAA 4I36A 1E0KA 3WB2A 2YIJA 3JALB 3STWA 2P9JA 2FEKA 3MMSA 3T7CA 4TRMA 1FP7A 4DR4B 1VJRA 4LKOA 2R8ZA 1F2UA 4BEJA 2W71A 4NIMA 2RAPA 3U17A 4QFCA 2VQSA 3COPA 4BXOB 3B82A 3A11A 4PLVA 2C3MA 2JKVA 3BH6A 3Q1KA 1EIZA 1OBVA 2O2CA 3QVMA 4RMJA 5CH8A 4QGAA 4DILA 4ZZ0A 1MCZA 1HDXA 3PNOA 3W9SA 1NLZA 2PJUA 3CVJA 4G2NA 3BMNB 5DRTA 2IQIA 4HDQB 5BOSA 3HEAA 3B2QA 1IN5A 1RBMA 3DVQX 3EIOA 4Z1OA 1S2LA 3O2NA 1Z0AA 5GOZA 3JAMA 1EE9A 4MVWA 3CN7A 2I80A 4DLPA 3BKXA 1L4NA 3OU6A 1ADJA 5CDGA 4L73A 3EVEA 3KAKA 4TMFA 3O03A 4IDAA 1BVHA 3HZOA 3PFNA 1MO4A 1YOBA 4G36A 4J43A 4JP3A 4JOCA 2HF7A 5CK4A 4ZTBA 2PLRA 4F8EA 2FSHA 5SICE 1PFWA 4YP9A 5IYZB 3C7TA 2ZT8A 2V4ZA 2BKVA 3KYJB 3MGGA 1IZ0A 3BXZA 2C9BA 4UBOA 5FUVA 1XO1A 4HVCA 1ZD8A 4U39A 5ICMA 4US1R 3ZDCA 3TFWA 2Z08A 2DP4E 3OLVA 3HPQA 2AN5A 5LDGA 3GT4A 3U0VA 3UN1A 5BQXA 2JFUA 4OFXA 3C3YA 1JEQA 3NBZC 4FJ0A 3BOSA 3VAAA 2BBTA 3K70D 1FEZA 5KKAA 1A2KC 2HSZA 1RYBA 2AA3A 4N5DA 2ZBFA 5ALEA 5T4FA 3T3HA 3TLGB 4QDXA 3OOSA 4XFDA 5AYVA 5BPHA 3NCTA 1IONA 2RHCA 1P5FA 1Q0QA 2ZR8A 3BS4A 4ID9A 3ZX5A 2QJFA 1I7SB 3BB3A 3SBOA 2HU2A 4FT2A 1TF7A 2C83A 5AW0A 4E6PA 3DV0A 1P3Y1 1ORIA 3BEOA 3FSJX 5ALNA 1EXNA 4DUPA 2KJQA 4OQDA 1G1MA 4RY2A 1CF2O 1RC1A 4DTCA 3KVNA 5BSHA 5C2JB 2F43A 3AEKB 3HDGA 3TQCA 5C7YA 2B8WA 1E58A 3FPGA 1O57A 2ZUBA 5F23A 4P84A 3L6RA 4NZPA 3WKBA 4MWBA 3RG8A 4YCMA 1G21B 2AWNA 4BLWA 5JH7B 3X2SA 2WAMA 5I7SA 2Q5HA 3UH1A 1UOOA 3THYA 2Z9CA 1SPBS 2IYRA 4Q4HB 3CTPA 3FOCA 5F64A 5CBKA 3RUDA 3BBPA 3HU3A 4QOFA 1G7TA 1ODJA 1T6YA 3DAPA 2FP3A 4XLTA 2UU9B 3OWXA 1EEXB 1FXUA 4B3GA 1YCFA 3WMEA 4KQCA 4DHWA 2WUWE 3ON5A 4NQZA 4A8JC 2CXXA 3OPQA 3L5OA 4JB3A 4D9IA 1GFSA 4XTRA 4BY9E 1N0HA 3VX4A 4PHCA 4A4DA 3BAZA 1U2GC 3GV0A 5M04A 3FOEC 2O1XA 3E8XA 4MTCA 5KTMA 2CMGA 2HF9A 5KHLB 4JU8A 2I2AA 3OT1B 4LYFA 5TT0A 4D79A 2O7VA 4YACA 1Y89A 3HEBA 3IB3A 4XD7A 2OEPA 4MEBA 3PJFA 1G20A 4F38A 5A5GA 1NLMA 4GOLD 1Z63A 1QIDA 1JLRA 1L8QA 1Z68A 2FRDA 3O2QB 4WEOA 2W9XA 3NASA 1OLXB 5KEIA 2O5VA 2O3TA 3IAHA 3Q3CA 3KIPA 5LIPA 4WN9B 1OGIA 3G2LA 2UVPB 1BHQ1 2Q9BA 5ITZB 4HUQB 1XRLA 3UC5A 2QDXA 3ZBTA 5IJZA 4G5SA 1VCIA 2QWXA 4AQDA 1DBPA 4CIBA 2ZATA 1AB6A 3DE1X 3W1WA 3W6PA 4KRGA 3MJFA 2C4WA 1GRQA 1Z2OX 4G9GA 2KWIA 4PBSA 5BQ5A 1FDVA 1CYDA 4J7UA 3KQQA 3WG9A 1ECLA 2WABA 5B6PA 4KNYA 1JDJA 3ZTYA 3P94A 4YIHA 4YECA 3D1JA 1GFZA 1RQXA 3DEZA 3L40A 1PNVA 1FS4A 1N34B 4QREA 3NJRA 1VYTA 2OV4A 4NESA 3Q9UA 5HDQA 3LX5A 2IV2X 4A1OA 2FETA 4LXHA 1LPPA 3RIMA 3W79A 4D4LA 3OWHA 2B1QA 3FYSA 1TW3A 4DEYA 5TVKA 4F21A 3LWZA 2JGKA 1PK7A 3CRVA 3FRJA 1S2DA 5FYDA 4ACAA 1SELA 2DH5A 4TVBA 1DAFA 2NO1A 3N2GA 3H65A 5BSVA 2ZBQA 2FXVA 3KPUA 1YDGA 1WHSB 2YMPA 3S68A 1FLVA 4EY5A 2DY1A 1A98A 1DCMA 3S40A 4H7FA 1CY6A 3PJEA 4ZPXA 2A7XA 4Q3BA 3U39A 2ILTA 4AM8A 3DLTA 3HUEA 4X1YB 2EX4A 4JUFA 1CUHA 4FFSA 4KQJA 4O3FA 3VMMA 3OQVA 4INPA 4WW0A 1KZGB 2RHDA 2EBUA 3TUIC 1FRNA 3MT0A 3ZV7A 4JEHA 3TOCA 1OC2A 2VTDA 1KP9A 3EQ7A 4U6QA 5DHUA 5FTJA 4EATA 2CFIA 2VSNA 1TK3A 1S2NA 1Z0JA 2FYTA 2P5YA 2YYSA 3EGIA 3F46A 3JZFA 3EXIB 4QBTA 4YDHB 5AT1A 3V4RA 5KYUA 3ZEAA 5FLKA 3TPCA 3O95A 2JBHA 3ZCPA 2RHJA 4KPGA 3NHWA 1O77A 3NHLA 6PFKA 2PAAA 2XNHA 5KNLA 1P5HA 3V42A 1XTJA 4WLOA 1DOAA 1Y5NA 3K92A 3ADOA 5FA5A 4Q7MB 5F9HA 4Z4FA 3ETGA 3UB3A 5EC8A 1GAJA 5HFJA 4B47A 1KYWA 1QZZA 3QWBA 3UA3A 3E22B 3H11B 4WDRA 1IH8A 1P18A 3AFNA 4HT3B 3EDRA 4CMHA 3JRNA 1SCQA 3TLZA 5LWHA 4F84A 4AJJA 1T9HA 4U7FA 4PFJA 2VDVE 2PEYA 4L8VA 1KI6B 5ELLA 5D3MB 2IXDA 1MPTA 4MR8B 1FNCA 2I62A 2WYWA 3LUPA 3SEZA 2WSBA 4HWGA 1OBCA 1YACA 3ENQA 3HJUA 1E96A 5A6SA 5KSYA 5K3BA 1OXSC 4AJOA 2IXGA 5L3QB 1MNQA 4LFBB 3LT4A 2RH4A 3OJWA 4FLMA 4IL5A 4LJYA 1XXHB 3ANXA 3JD4A 3U60B 2RGBA 3GEDA 4C2UA 5P21A 1E3EA 2GD1O 2BR5A 1EPUA 3EUAA 2CBZA 2IPMA 3UJ9A 3ZDXB 1X1SA 3N0TA 5IBPA 2OSBA 4HJXA 4PVDA 5SYMA 1GDHA 3PNBA 4H1TA 3ZWXA 4FE7A 2CJFA 2AW5A 2YVUA 1SBTA 2ODTX 5IAJA 3BSFA 3TX2A 2XF8A 3JQDA 4AY5A 1Z56C 4D0NA 1GHTA 4P0QB 1DTWA 4JB0A 4FYHA 3X43A 5ALXA 3W0LB 3GCDA 2QMZA 1HDRA 3WK4A 1XZFA 4DR6B 5AXAA 1DBQA 1EG7A 3PA8A 1WRBA 3KG2A 1V71A 3L1JA 1VG0B 3QEAZ 2GAFA 2MSLA 1GCGA 5B6IA 3AHHA 1NBWB 2GYWA 4FGSA 4FFBA 4DUYB 3MIIA 1PFVA 3C8MA 1PEKE 3FFTA 4Q7KA 2Y1LA 3L4KA 6Q21A 3T1HB 2BGUA 2DBRA 4QA9A 4RNCA 4AP5A 1DCKA 4ZAYA 4DG8A 1TL7C 1XD8A 3HVHA 4CV2A 2D1YA 2XODA 2LWIA 4WJLA 1SB9A 4HX2A 4IEIA 1TM4E 1ISSA 1T9DA 4XEUA 3T4EA 2ZUTA 5CJ2A 1I2DA 1UF9A 1N8SA 4YP1A 1YZYA 3DHYA 4F6RA 4NBVA 3WFJA 1QYWA 4YJHB 4WI1A 2PH3A 4TV9B 2IHKA 2Y67A 3JYNA 3JQ6A 4MRSA 5CHEA 4BNDA 1JMYA 5HIKA 4QSMA 4POAA 3IPLA 2GFIA 3K16A 1M6VA 1MJGM 1E4VA 1ZOPA 1FFXB 4H0FA 3QNWA 3ZE6A 2WZDA 3FMVA 4ZN6A 3ZDAA 2EX0A 2PT6A 3INYA 3KUKA 3PXDA 3Q88A 3CRQA 3KR9A 1Z5VA 3NDJA 4JLPA 4DHEA 5J2UA 3OFNA 4URZR 4ZQGA 3L6BA 1XLTC 4BUZA 2JBAB 4A92A 1JIIA 1Z2PX 1OB5A 1D0SA