2WK0A

Crystal structure of the class a beta-lactamase bs3 inhibited by 6- beta-iodopenicillanate.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
255
structure length
255
Chain Sequence
b'DDFAKLEEQFDAKLGIFALDTGTNRTVTYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNTAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALATSLQAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPEGWEVADKTGAGSYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVVKAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Structural Basis of the Inhibition of Class a Beta-Lactamases and Penicillin-Binding Proteins by 6-Beta-Iodopenicillanate.
pubmed doi rcsb
molecule tags Hydrolase
total genus 89
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2wk0A00
3HUNA 1ONHA 3VP4A 2HDSA 2WADA 2OSUA 3G4PA 2Y2JA 3HLWA 5FI7A 5E2FA 1BULA 4CPKA 3B3XA 1ESUA 3AGDA 3ZNTA 3BLMA 3PBQA 1XX2A 1FR1A 1JWZA 1M40A 1HVBA 4JXGA 2Y2MA 4X69A 1E4DA 3C7UA 4S2PA 5BOHA 5M19A 1CEGA 5D3OA 3S4XA 1KGEA 3IF5A 2ZQAA 1DJCA 2IWBA 3GV9A 1KE4A 1I5QA 3P98A 4L0LA 3S22A 4CJNA 3BFEA 1ES5A 2BLSA 1PZOA 4EUZA 3WS1A 3W4OA 1J9MA 4WEJA 2WKIA 3S1YA 3UDFA 4PM8A 3UE1A 1WYCA 1N9BA 1ERQA 4ZTKA 4ZDXA 3MZEA 4WZ5A 1G68A 1JWPA 4S2JA 1MKIA 5EPHA 3SS3A 1XXMA 3ZGAB 2ZC3B 4IBXA 4RYEA 5AQAA 5U47A 1PWDA 3O3VA 1SHVA 2JCHA 3WRTA 5AQ9A 2EX2A 4M3KA 4S2MA 3OPRA 3A3FA 4R4SA 2HP5A 1LHYA 4FSFA 3ZFZA 3NDEA 5FAPA 2E8IA 4OPYA 2Y2NA 4KZBA 1JWVA 4DKIA 2Y2KA 4BQMA 1L0DA 2Y4AA 3MXSA 4GD6A 3Q81A 1MWUA 3HREA 4DE0A 3NC8A 1BTLA 3NBLA 4HBTA 3N4IA 1W8YA 3BYDA 4R1GA 3Q7ZA 5CGWA 4YINA 3VFFA 1FCMA 3MKEA 3V50A 3IQAA 4KG5A 4N1HA 4JXWA 2V20A 2RL3A 5HW3A 3FV7A 1KGFA 4X53A 1MPLA 1KE3A 4BL3A 4E3MA 2WKEA 1KVLA 3W4PA 3BFDA 3SS4A 3ZHHA 1IYPA 2Y59A 5FQ9A 1ZC2A 1TVFA 3VMAA 3E2LA 4OONA 3UPNA 3TSGA 5GLAA 3IH9A 4GOGA 5TR7A 2PU2A 1FCNA 4WEKA 4PM9A 2WZXA 2PU4A 3ITAA 3IH8A 4FH2A 4LV0A 3M6BA 1E3UD 2EFUA 2ZM2A 5DTKA 3V3SA 3ZG0A 5GLBA 4GNUA 1ZKJA 3G32A 4OP5A 5F83A 1IYQA 5CEDA 3UPOA 4P85A 2OLUA 1NY0A 1RGZA 4P87A 4FD8A 4FH4A 5EUAA 1AXBA 4KZ6A 4Q8IA 3UNWA 1BUEA 2J7VA 4K0WA 1GA0A 4OVDA 4GZBA 4XXRA 1S0WA 4IBRA 4GB7A 3QNBA 1O7EA 2Z2LB 3MKFA 4E3IA 5HFOA 3SS5A 1H8ZA 3CZDA 2X01A 3CJMA 4WBGA 2H0YA 4MNRA 1TDGA 4JF6A 1Q2QA 2ZC5B 3W8KA 2A3UA 4PMAA 1YMXA 3IF6A 4BL2A 2R9WA 3IXDA 2DNSA 3JYIA 4KENB 1ES4A 3IXBA 5DVAA 2XD5A 1LI0A 3IF6C 4S2IA 3OPLA 4R3JA 2WAEA 1EWZA 3ZG7B 1K57C 1BZAA 1NYMA 3PTEA 4K0XA 4DXCA 4U0TA 2EXBA 4KG6A 4KZ9A 5HAIA 3FYZA 2EFXA 1QMFA 3PBTA 4DXBA 4ID4A 4QD4A 2QZ6A 4X68A 4Y0OA 3NI9A 1JTDA 3LY3A 4MBFA 4MBHA 4GDNA 5GHZA 5A90A 4JKTA 1IKGA 5HARA 4S2OA 1K54A 3AGEA 4LV1A 1PYYA 2XQZA 1FOFA 5FATA 2C6WB 2JE5A 2HP9A 3D4FA 2X02A 3WS4A 2DRWA 1DJBA 1LLBA 2JBFA 3Q1FA 3P09A 5CHJA 3G30A 1K54C 2ZM0A 3G31A 4OKPA 4ZJ1A 3ZG8B 2UWXA 3WS2A 1GA9A 1Z6FA 3G2YA 5FAQA 3BLSA 4OPRA 1MXOA 2XF3A 3DTMA 3W4QA 5GLCA 4JLFA 1HZOA 3ZVWA 1L0EA 1M6KA 4RX3A 4U3TA 3NCKA 1K56D 4FCFA 1I2WA 1KDSA 1W79A 4K91A 2A49A 4U0XA 5TFQA 3SH7A 3NY4A 2Y2IA 4IVKA 4A5RA 3HLEA 3PBNA 1NRFA 2WZZA 5FQIA 3ZCZA 1YMSA 5CECA 1PW8A 2JC7A 1KDWA 4S2KA 3E2KA 5TGFA 5HAQA 4RX2A 2Y2QA 1IYOA 4KQOA 5JYOA 4RA7A 4ZJ3A 3UE0A 5GHYA 1K6RA 3V5MA 3VFHA 4DRTA 5KMWA 4WM9A 5DTTA 2IWCA 3OC2A 3OCNA 2VGJA 5FSRA 4IEDA 4WZ5C 4NK3A 1H8YA 1K4EA 4UHUA 4OOLA 1LL5A 2WGWA 3BM6A 3EQVA 4RVAA 2G2WA 2Q9MA 2ZQ8A 3IHBA 5FQQA 1K6SA 3IWQA 4B4ZA 1Y54A 3HLFA 4N1XA 5F1FA 5CRFA 2P74A 4R3BA 3NDGA 4D2OA 4DE2A 4P0MA 3CG5A 1MBLA 1RP5A 3UPPA 1RGYA 1OMEA 1RCJA 4DE3A 4F94A 3G35A 2XFTA 3MZFA 4WELA 3ZVTA 4C75A 4OOYA 1YT4A 2WYXA 1SDNA 2Y2PA 3IF6B 4OLGA 3VOYA 5KSCA 2PBYA 5CERA 5A92A 5CHMA 5CHUA 3RXWA 3FKWA 5M1AA 4C6YA 1XGJA 3VOZA 1L0GA 4Y0TA 5JYPA 2RCXA 1G6AA 1VQQA 4ZJ2A 2XEPA 4KZAA 5AQBA 2C5WB 4WZ4A 1KVMA 1LL9A 4DF6A 4YFMA 1K4FA 2EXAA 4EQIA 1YLPA 3WS5A 3TOIA 3HLDA 4B88A 1LI9A 3QHYA 1BLCA 5IHVA 3PAEA 4KZ3A 3IWOA 1GCEA 3PBSA 3MFDA 3VP3A 3WWXA 4DDSA 4N9KA 4X56A 4QY6A 4IVIA 4LCLA 3PBRA 1CI9A 1XPBA 1HTZA 1KGGA 1PWGA 1K25A 1CI8A 3FZCA 4LENA 4DE1A 1FSWA 1CK3A 4GKUA 1JVJA 2XR0A 3BECA 3A3EA 5CXWA 3A3IA 3G2ZA 1NYYA 2GDNA 1PZPA 4E3LA 3Q07A 5EVIA 2ZQCA 1HD8A 2V2FF 4BD0A 5EOOA 5E2EA 2FFYA 5CGSA 3G34A 2ZM8A 5EVIC 3TG9A 1FSYA 3SOIA 4O7DA 5DTSA 1C3BA 3VSKA 4E3NA 1KE0A 3LO7A 3HL9A 2ZC6B 4N9LA 3MZDA 4WMCA 3ISGA 4OLDA 4ZAMA 3ZG5A 4OQIA 1XGIA 2H0TA 1NXYA 1IYSA 1Q2PA 2ZMAA 4XUZA 4QJGA 4MEZA 2XH9A 2WGVA 4EBLA 5KZHA 1SDEA 1GHMA 5EOEA 1YQSA 3N7WA 1MY8A 2XGNA 1SKFA 4MBKA 3GRJA 1EROA 1WYBA 2X71A 3UY6A 2QPNA 2Y55A 4OPQA 1DY6A 2EX8A 4E6XA 1YLWA 3BEBA 3HBRA 1IEMA 4KZ7A 4BENA 5M18A 2WGWB 4LCMA 1ALQA 1TEMA 3OZHA 5CGXA 2J9PA 1W7FA 1MWSA 4PM5A 5F1GA 2OV5A 5I94A 5A93A 1O07A 4QY5A 4R23A 4WYYA 2HDUA 5DF9A 3V39A 2FFFB 3DWKA 2Q9NA 4KZ8A 4KZ5A 2I72A 3HUOA 2J9OA 1VM1A 3GTCA 3HLGA 3PBOA 4UA9A 5FQKA 3UDXA 2ZQ7A 3VSLA 4NETA 2ZC7A 1XKZA 4QHCA 4Z9QA 3FKVA 1MWTA 3IHAA 1ESIA 5FAOA 2Y2GA 3OPPA 4OQ0A 5A91A 5CTNA 5KSHA 1XA7A 1FCOA 4OH0A 4E3KA 1BT5A 4JF4A 3LCEA 4S2LA 3BFGA 1FR6A 3MBZA 4PM7A 1SCWA 1PI5A 4OQHA 3BRMA 2Y2LA 2ZQDA 3O87A 4KZ4A 5HAPA 4UA6A 2ZLYA 2XD1A 3OPHA 4ZBEA 2CC1A 4JPMA 3C4OA 3SH9A 2WAFA 1E25A 1NJ4A 1YLJA 2XK1A 2Y2OA 3MXRA 3M6HA 3N8LA 3LY4A 4BLMA 1L2SA 2ZQ9A 2V1ZA 4KG2A 3V3RA 3VP0A 4QU3A 3GR2A 3O86A 3ITBA 3IWIA 3M2JA 2OLVA 1K56A 2WK0A 3AGFA 4R4RA 5EVIB 4EBNA 2P9VB 4GDBA 4OPZA 2XLNA 4P6BA 1YM1A 2WKHA 3WS0A 4LV3A 1K55A 5FDHA 1TDLA 2QMIA 1I2SA 1GHIA 4HESA 3I7JA 5GL9A 2HDQA 4E3OA 5DF7A 3RXXA 4EV4A 1K55C 3Q7VA 1IELA 4E3JA 2HDRA 1ERMA 4PM6A 5CEBA 1W8QA 3DW0A 1NZOA 4KQRA 2H5SA 5HX9A 3GQZA 4KQQA 4Y0UA 2XDMA 5CTMA 1QMEA 3M2KA 4JXSA 4HBUA 3ZG9B 4Y7PA 1YLTA 5GHXA 5EVID 5GLDA 2EX6A 3VP2A 2Y2HA 3QNCA 4H8RA 5FASA 4OQGA 3UN7A 2J8YA 2ZD8A 3IT9A 2IWDA 4QB8A 3C5AA 1PI4A 2R9XA 2Y91A 1XP4A 3IXHA 3A3DA 3RJUA 3EQUA 1MWRA 4R0QA 1BLSA 4WMCD 5FI6A 4PPRA 1IKIA 4GD8A 1PWCA 2P9VA 3OCLA 4OOMA 5F82A 1CEFA 2Z2MB 1ES3A 2WUQA 3A3JA 3HVFA 3N8SA 4JF5A 3GVBA 4B4XA 4JXVA 5E2GA 1BLHA 5EE8A 3ZNYA 5EECA 2ZJ9A 4E6WA 4JBFA 3IXGA 2WGIA 1ES2A 1XA1A 3FWLA 5HL1A 3GMWA 2ZC4B 1ONGA 3HLCA 5G18A 1K38A 4X55A 5AQ7A 4EBPA 5E2HA 1YLZA 1FQGA 4XUXA 4OP8A 1PIOA 4UAAA 1E3UA 2H10A 5E43A 3BFFA 3GSGA 5FQJA 3C7VA 1PW1A 1BLPA 3WRZA 2BG1A 4C3QA 4DDYA 1NZUA 3UDIA 2G2UA 1YLYA 3NIAA 4MLLA 3N6IA 5FQMA 1K57A 1BSGA 1L0FA 2EX9A 3VP1A 3ZDJA 2HP6A 4N92A 3CMZA 4LV2A 3HUMA 3Q82A 5FA7A 3HLBA 3LEZA 1GHPA 5DF8A 1JTGA 3PAGA 3UE3A 3UO9A 4BJPA 2DCFA 1H5XA 1ZG6A 5J8XA 1DJAA 4HEFA 5L2FA 4BD1A 1S6RA 2B5RA 2HPBA 2VGKA 4S2NA 3DWZA 4GN2A 3C4PA 4EWFA 1W5DA 1ZG4A 1N4OA 2XFSA 4S2NC 3O88A 3BFCA 4UA7A 1U60A 1WE4A 5FI2A 5EVLA 3N8RA 3Q7VB 3SH8A 1EI5A 4X6TA
chains in the Genus database with same CATH superfamily
4CPKA 2LB5A 3B3XA 1ESUA 3AGDA 4ETXA 3FG8A 3BLMA 4CLCE 3KYZA 3TE8A 3ULFA 4IUHA 5BOHA 3CWFA 5D3OA 2B95A 2VKSA 3S7PA 3P98A 4L0LA 3S22A 4CJNA 3BFEA 3WS1A 3W4OA 1J9MA 3S1YA 1G6OA 3UE1A 3U2AA 4ZTKA 4ZDXA 4O01A 4WZ5A 4I38A 1JWPA 3ZGAB 1PWDA 3O3VA 4L9EA 2EX2A 1TF1A 4S2MA 3OPRA 3LR0A 2AVXA 1LHYA 2E8IA 5I5LA 4DKIA 2Y2KA 4BQMA 4GD6A 3HREA 4P6ZM 1XFNA 3UB5P 4F3LB 4ME4A 4N1HA 1KGFA 1MPLA 1ACFA 2WKEA 1KVLA 1IYPA 2KDKA 3VMAA 2YKHA 2W3DA 5GLAA 3IH9A 1OT9A 1FCNA 4WEKA 3ITAA 5DTKA 3V3SA 4GNUA 5EM0A 4OP5A 1D7EA 3H82B 1AXBA 4Q8IA 4XXRA 4IBRA 3MKFA 4ARZB 1OTIA 3SS5A 1H8ZA 3CZDA 2X01A 4WBGA 2JN7A 4X25A 3F1OA 2H0YA 4MNRA 1TDGA 1Q2QA 2ZC5B 3JYIA 2L1MA 1EWZA 1K57C 4DXCA 3LIFA 4KZ9A 3TW8A 3MSHA 2EFXA 3PBTA 4MDZA 4QD4A 2QZ6A 4X68A 1D06A 1JTDA 4MBFA 4MBHA 4GDNA 5GHZA 1S67L 1SKOA 4LRXC 4LV1A 2JE5A 3D4FA 4BBVA 1DJBA 2W3GA 3G31A 4OKPA 2UWXA 2P7JA 1H3QA 3SH7A 4E04A 4A5RA 4R3AA 1PW8A 3E2KA 4RX2A 1IYOA 3CLOA 4KQOA 4RA7A 2CMNA 3LI9A 2PDRA 4NG2A 3V5MA 5KMWA 5DTTA 5L09A 4WZ5C 1H8YA 1K4EA 3IS2A 2Y79A 2Q9MA 2ZQ8A 4Z1WA 1K6SA 4B4ZA 2V0UA 1CJFA 2VX8A 3NDGA 4P6ZS 4D2OA 3MMHA 3S7QA 2K2NA 3CPTA 1MBLA 1VEUA 4DE3A 1OMEA 2XFTA 3MZFA 3ZVTA 3F1OB 4OOYA 3JPUA 4OLGA 2PBYA 5DJTA 5CHMA 1XGJA 1L0GA 1G6AA 2XEPA 3MFXA 2V8FA 5AQBA 4WZ4A 1LL9A 4EQIA 2MJ6A 1VETA 5EFWA 3HLDA 1Y28A 3QHYA 4R6LA 1BLCA 3BJNA 4QY6A 2KOIA 3DBAA 1HTZA 2IA2A 4WLAA 1CI8A 4LENA 4DE1A 1SKOB 5F69A 3A3EA 2PR6A 2Z6DA 2VV8A 5CGSA 2ZM8A 3SOIA 4O7DA 5DTSA 2QKPA 5F68A 4ZAMA 3ZG5A 4OQIA 1TS0A 1IYSA 2ZMAA 4MEZA 2WGVA 1IFQA 1SDEA 4ZRRA 3GRJA 2O9CA 1NLZA 3OZHA 1W7FA 1S1YA 5F1GA 4G3VA 5I94A 1O07A 4R23A 4EQ1A 3CPTB 5DF9A 1VEUB 3G6OA 3HUOA 2J9OA 4UA9A 3UDXA 2ZC7A 3JVVA 2LB9A 4Z9QA 3IHAA 1T1AA 2XROA 3OPPA 5A91A 1FILA 2GZAA 4S2LA 4DMZA 3T1RA 1VETB 1PI5A 4OQHA 3O87A 1NWZA 4KZ4A 1F5MA 4JPMA 3OPLA 1YLJA 3M6HA 2KX6A 3T50A 4FOFA 5FL3A 1W63Q 1XJ3A 1K56A 2WK0A 3AGFA 4D60A 4WF0A 5GL9A 1GHIA 1K55C 1ERMA 4PM6A 1YAXA 1GSVA 2B02A 3GQZA 3NOUC 3LFVA 4Y0UA 2VJWA 2XDMA 1QMEA 4Y7PA 1YLTA 5EVID 3VP2A 4NXFA 3IT9A 4UEYA 4QB8A 3C5AA 2R9XA 3IXHA 4K08A 1BLSA 2P9VA 1OT6A 1FIKA 1F9IA 2GJ3A 1ES2A 1XA1A 3GMWA 2ZC4B 3HLCA 3EWKA 4GS9A 4Q0HA 5E2HA 2V9AA 1E3UA 3BFFA 4JGQA 5FQJA 3C7VA 2BG1A 4DDYA 1NZUA 2PR5A 3UDIA 1F98A 1YLYA 3N6IA 2EX9A 3ZDJA 3RFBA 1EW0A 3QP4A 3CMZA 2A24B 4LV2A 4B9OA 3HLBA 3UE3A 1H5XA 2J80A 3HJKA 1S6RA 4X1MA 2HPBA 3DWZA 5CX7A 4HI4A 2DMWA 4EWFA 1N4OA 4HHDA 2QHKA 4UA7A 4X6TA 2M7VA 1ONHA 5LBRA 1W63M 2OSUA 3BQAA 3L7HA 4EU0A 1X0OA 4JXGA 1M40A 1HVBA 1G28A 4S2PA 1KGEA 2OWHA 3IF5A 1DJCA 3GV9A 1KE4A 2G7UA 1ES5A 2BLSA 4O0PA 4PM8A 1N9BA 1ERQA 5KIZA 3KSGA 5EPHA 2ZC3B 4IBXA 4KUOA 4G3WA 3KSFA 5HWVA 3A3FA 1YPRA 4R4SA 4FSFA 2PRFA 3NDEA 5FAPA 2V1AA 3K3DA 2Y4AA 5DKLA 3Q81A 5EVEA 1BTLA 5CGWA 2A2LA 3N4IA 1W8YA 3BYDA 3NBLA 4HBTA 4MN5A 4YINA 3VFFA 3T4LA 3MKEA 3IQAA 4HJ4A 2V20A 2RL3A 3FPVA 5HW3A 1KE3A 4BL3A 3ZHHA 2Y59A 5FQ9A 1P97A 3IBRA 2HJEA 2XA7M 3UPNA 3LR3A 4BBTA 5FEFA 1XJ2A 4FH2A 3DTKA 2EFUA 5GLBA 3UPOA 5CEDA 2OLUA 3QP1A 3F1NA 4CLCA 4KZ6A 2J7VA 4K0WA 4OVDA 4GZBA 3QNBA 2OWJA 1O7EA 5DFYA 3OOVA 4F3LA 3B47A 3W8KA 2A3UA 2R9WA 3A0SA 2XD5A 4S2IA 3IF6C 4R3JA 3R7WB 1BZAA 1NYMA 4K0XA 2EXBA 5HAIA 1ODVA 3RTYA 3T12B 3H82A 3H9WA 4HJ6A 1PFLA 1PYYA 2XQZA 5FATA 3DTEA 4ARZA 2X02A 3P09A 3EEAA 1K54C 2ZM0A 1Z6FA 1MXOA 2XF3A 5G4ZA 3W4QA 1HZOA 1XJ4A 4U3TA 1GSXA 5TJJA 1I2WA 3KSHA 4K91A 3ZYTA 3RH8B 4IVKA 3HLEA 2WZZA 5FQIA 3ZCZA 1YMSA 1KDWA 3NOPC 4S2KA 3W2ZA 3UE0A 5HPFA 5GHYA 4QWOA 3VFHA 2IWCA 4IEDA 4NK3A 2WGWA 5FQQA 3F1NB 4RVAA 3IHBA 2ZMFA 4CLCB 5CRFA 1A0KA 4DE2A 3KO6A 3CG5A 3UPPA 4YOFA 1CQAA 3LEQA 3KYEA 1SDNA 3PXPA 5KSCA 3VOYA 1VHMA 3VOLA 3RXWA 5M1AA 1NLYA 5HSQA 4Y0TA 5JYPA 1D1JA 2RCXA 3MF0A 2XA7S 4ZJ2A 1H0MA 1TS6A 4KZAA 2C5WB 4DF6A 1T1CA 4YFMA 2EXAA 1YLPA 2P08A 4BMWA 4KZ3A 3PBSA 3VP3A 4NXGA 4Y15A 5L07A 4N9KA 5F5YA 4IVIA 2EWVA 1CI9A 1AWIA 1K25A 2HGVA 2QJ5A 1SZVA 1JVJA 2XR0A 5HL6A 5CXWA 1NYYA 4CLCC 4HQAA 2GDNA 1PZPA 3Q07A 2ZQCA 2V2FF 1DRMA 2NUTC 3TG9A 3BWLA 1FSYA 3DTIA 3MZDA 2GNXA 4WMCA 3ISGA 4OLDA 2H0TA 5AVFA 1NXYA 4QJGA 5KZHA 2XH9A 1S66L 1GHMA 1YQSA 3N7WA 4I3AA 1MY8A 2XGNA 1SKFA 5L10A 2EX8A 4E6XA 4BENA 5M18A 2WGWB 4G3KA 5CGXA 1GSWA 4PM5A 4GJ4A 4EW7A 5DJUA 3MXQA 3V39A 3DWKA 3CUEA 1P9RA 1VM1A 3GTCA 5FQKA 4NETA 4WL9A 3EGDC 1ESIA 3F1PA 2Y2GA 5CTNA 5KSHA 2V0WA 3NULA 3MBZA 1SCWA 2Y2LA 2ZQDA 1PRQA 3QP5A 2XD1A 3CITA 2UV0E 1XFQA 1MC0A 3SH9A 3C4OA 2XK1A 3MXRA 3D9YA 3LY4A 4BLMA 5HWWA 1ZHHB 4MCWA 3VP0A 4MN6A 3M2JA 2Q0OA 4EBNA 4OPZA 4GDBA 2XLNA 1K55A 3LGOA 1TDLA 3LICA 2QYBA 1I2SA 4HESA 3FC7A 3VE4A 3BQ8A 5DF7A 3RXXA 3Q7VA 3E4OA 4FUWA 4Y3IA 1W8QA 2J3TD 4KQRA 2H5SA 2E8JA 3ZG9B 4JXSA 5J4EA 3EGXC 2XRNA 5GHXA 2EX6A 4OQGA 5HDSA 1PNEA 2J3WA 2IWDA 1XP4A 2KLIA 3RJUA 3A3DA 3EQUA 1Z09A 4R0QA 5FI6A 3LUQA 1IKIA 1Y4OA 4OOMA 2L4RA 3GVBA 4B4XA 1BLHA 5EE8A 3NOTC 3DAVA 3IXGA 3HJIA 3F1PB 2VEAA 3MR0A 5G18A 2HZ5A 4IJGA 1K38A 4EBPA 1YLZA 4OP8A 5E43A 3LR4A 3HCYA 5J7EA 2HJ9C 3T1XA 2WKRA 2GX5A 3VP1A 5K5BA 4EETB 5FA7A 5DF8A 3UO9A 4BJPA 1ZG6A 5J8XA 3OLOA 4GN2A 5F6AA 1ZG4A 3CUEC 4HH2A 1WE4A 5FI2A 1STZA 5EVLA 3Q7VB 4HNBA 4NKPA 3HUNA 3VP4A 2HDSA 2WADA 5FI7A 5E2FA 3BY8A 1XX2A 1FR1A 1JWZA 3FPWA 3NECA 1CEGA 2WKPA 2IWBA 1I5QA 2A24A 5TBMA 3MJQA 4WEJA 3C8CA 4Y17A 1DP6A 5HPIA 1G68A 1XXMA 3IX4A 2H28A 5AQAA 3D3OA 1IOUA 1OTDA 4M3KA 3PR6A 4OPYA 3TRCA 1JWVA 1L0DA 2VLGA 3MXSA 4I5SA 1T19A 4LRYC 4EEPA 1FCMA 4M4XA 4GW9A 4H6JA 3MQOA 2W0NA 1TVFA 3E2LA 3CHWP 3TSGA 4GOGA 4PM9A 1L3LA 2PU4A 1E3UD 2ZM2A 3ZG0A 1ZKJA 3G32A 1IYQA 4P87A 5EUAA 2BASA 2W1TB 3UNWA 2Z2LB 2YKFA 3UMDA 5HFOA 3T4SA 2PD7A 4PMAA 1YMXA 3IF6A 4BL2A 3IXDA 2DNSA 3VV4A 4KENB 1K0KA 4HP4A 3PTEA 1DP9A 5TBMB 1LSXA 4KG6A 4JGPA 3FYZA 1QMFA 4LPZA 3LY3A 3OBFA 2L0WA 2O99A 5A90A 5HARA 1K54A 3LIBA 1FOFA 4DE0A 2C6WB 3WS4A 2DRWA 1LLBA 1TD5A 3G30A 5DFXA 4ZJ1A 1GA9A 1OJGA 1UWPX 3BLSA 3DTMA 3ZVWA 1L0EA 1M6KA 3NCKA 1S1ZA 3ICYA 4U0XA 3R7WA 2ACGA 4H6JB 2QWSA 1YSPA 2W1RA 3PYPA 4DJ3A 2JC7A 2JKRI 3C2WA 2Y2QA 5JYOA 4IUKA 4GCZA 3T4OA 1K6RA 2OAQ1 4HIAA 3EOIA 3OCNA 3LIDA 5IS1A 1LL5A 2ZL1A 5FDSA 3IWQA 1Y54A 3HLFA 4N1XA 4R3BA 3UB7A 4F94A 1RCJA 3H7WA 4EUVA 3G35A 4WELA 3CAXA 4FTXA 3IF6B 1H8MA 3P7NA 5CERA 2W27A 5A92A 5CHUA 3E0YA 4L9GA 3VOZA 5HDCA 4WN5A 3TOIA 5IHVA 3BY9A 3UE6A 3JVUA 3SZTA 4X56A 3UB6A 4Q0JA 4LCLA 2VA0A 3PBRA 1XPBA 1KGGA 3FZCA 3BECA 4EESA 4E3LA 4MN7A 1TS7A 4BD0A 5EOOA 5E2EA 2FFYA 3G34A 3V67A 5EVIC 1UGUA 5HWTA 1KE0A 3HL9A 3MS6A 4GHIB 2PBDP 1XGIA 1V9ZA 1Q2PA 4XUZA 2ZMVA 4EBLA 5EOEA 3KSIA 3UY6A 4OPQA 1YLWA 3B42A 4MMNA 3BEBA 2W3EA 1IEMA 4KZ7A 1JNUA 3K2NA 5HZHA 2ZL1B 4LCMA 1ALQA 4Y2FA 4Q0IA 2J9PA 2OV5A 4R38A 5A93A 2FFFB 2Q9NA 3H7WB 4KZ8A 2I72A 4B93A 3HLGA 4I39A 3PBOA 3VSLA 2V1BA 1XKZA 3FKVA 1MWTA 3MQ0A 3E4PA 1FCOA 2PAVP 4JGOA 2JKTM 2FH5A 4OH0A 1BT5A 3LCEA 3BFGA 1DP8A 3C30A 4BWIA 4PM7A 5MC7A 3BRMA 1OJ5A 5HAPA 4UA6A 3OPHA 4ZBEA 2M7UA 2CC1A 1NJ4A 3N8LA 1LL8A 4KG2A 3V3RA 4QU3A 4LGWA 3IWIA 4LRZE 1J3WA 4R4RA 4I3IA 2O9AA 4P6BA 1YM1A 4LV3A 2QMIA 2HDQA 3UB8A 3SW1A 4DN0A 4R70A 1IELA 3EEHA 2HDRA 3DW0A 1NZOA 3E4QA 1P0ZA 1LSVA 2W3HA 4KQQA 3T4QA 4Y13A 4EERA 4HBUA 5GLDA 2Y2HA 3LI8A 3QNCA 5FASA 2J8YA 2ZD8A 5G4YA 1PI4A 2Y91A 2O9BA 1MWRA 4WMCD 4HH3A 3S7OA 4GD8A 1PWCA 3OCLA 5F82A 1CEFA 2WUQA 3A3JA 5F1FA 2R78A 3ZNYA 5EECA 3T4TA 2ZJ9A 1VB6A 4KQDA 4E6WA 2WGIA 1UWNX 4X55A 3A0VA 4UAAA 1PIOA 2JHEA 3GSGA 2HF6A 3WRZA 1XJ6A 4C3QA 2G2UA 5FQMA 4X1LA 2HP6A 4N92A 4RQ9A 4HY8A 3HUMA 3KYQA 2JKGA 1BYWA 3LEZA 1GHPA 1JTGA 3PAGA 3NHQA 4HJ3A 3P01A 5L2FA 1W5DA 2XFSA 4S2NC 3O88A 1YSQA 3T1SA 4LLOB 1EI5A 1WA9A 3HLWA 3G4PA 2Y2JA 4II7A 1BULA 5J3WA 3ZNTA 3PBQA 4X69A 2Y2MA 1E4DA 3C7UA 5DKKA 5M19A 3S4XA 3L9KA 2ZQAA 2PHYA 3K3CA 4QPRA 1KOUA 1PZOA 4EUZA 2FZ0A 2WKIA 3UDFA 4HP9A 1WYCA 2Y8HA 3MZEA 1YKDA 4S2JA 1MKIA 3SS3A 2M1CA 4RYEA 5U47A 3U4LP 1SHVA 2JCHA 3WRTA 5AQ9A 3T4JA 2HP5A 3ZFZA 2Y2NA 4KZBA 1LSWA 1MWUA 2INWA 4BBUA 3NC8A 4R1GA 1G5UA 3Q7ZA 3V50A 4KG5A 1OPXA 4JXWA 3FV7A 5EM1A 4X53A 4E3MA 3LYXA 3W4PA 3BFDA 3SS4A 5C5KA 2VGLM 1ZC2A 3BW6A 3D72A 4OONA 4I3JA 4Y5FA 5TR7A 3PHYA 2PU2A 2WZXA 4LV0A 3IH8A 3M6BA 1LT0A 5F83A 4P85A 1NY0A 1RGZA 4FD8A 4FH4A 2ZOIA 1BUEA 1GA0A 4NXEA 1S0WA 4GB7A 4E3IA 3T4KA 3GECA 2WKQA 3CJMA 5FEGA 4JF6A 3NJAA 4UQIM 2P04A 1ES4A 3IXBA 3QP2A 5DVAA 1V9YA 1LI0A 2WAEA 3ZG7B 4U0TA 1S4SA 5HD5A 2W3FA 4DXBA 5L8MA 4ID4A 1TS8A 1CF0A 4Y0OA 4PAUA 3NI9A 4JKTA 1IKGA 4PKYA 4S2OA 3IS2B 2W1TA 3AGEA 2HP9A 2JBFA 5CHJA 2VK3A 3Q1FA 3ZG8B 3WS2A 3G2YA 5FAQA 4OPRA 5GLCA 4JLFA 4RX3A 2ZBBA 1K56D 1N9LA 4FCFA 1KDSA 1W79A 4LFUA 2VV6A 2A49A 5TFQA 3NY4A 2EA9A 2Y2IA 3PBNA 4NEED 1NRFA 3IBJA 5CECA 3C38A 2HV1A 1P9WA 5TGFA 5HAQA 2PYPA 4ZJ3A 3O5YA 1MZUA 4IHQA 4DRTA 2BTFP 4WM9A 3OC2A 2VGJA 5FSRA 4UHUA 4OOLA 3BM6A 3EQVA 2G2WA 2P74A 2PT7A 4P0MA 2EWWA 1RP5A 1RGYA 2JKFA 4C75A 1YT4A 2WYXA 2Y2PA 4WUJA 1ZTUA 3FKWA 4YNRA 4C6YA 2VGLS 3UB9A 1VQQA 1KVMA 1K4FA 3WS5A 4B88A 1LI9A 1T1BA 3ZQ5A 3PAEA 4KUKA 3IWOA 1GCEA 3MFDA 3WWXA 4DDSA 1PWGA 2ZOHA 1FSWA 1CK3A 4NXBA 4GKUA 3A3IA 3G2ZA 5AJGA 2J3TC 2K31A 1HLUP 2O0YA 5EVIA 2QJ7A 1HD8A 1T18A 4UQIS 3E98A 1C3BA 3VSKA 4E3NA 3LO7A 2ZC6B 4N9LA 2I9VA 1OTAA 3LIEA 4MBKA 1EROA 1WYBA 2X71A 2QPNA 2Y55A 1DY6A 2OAP1 3HBRA 1TEMA 4O8GA 3UMEA 1MWSA 4ESPA 4QY5A 4WYYA 2HDUA 1S4RA 4CQHA 4KZ5A 2XSSA 2ZQ7A 1NRJA 4DJ2A 4QHCA 5IU1A 4GHIA 5FAOA 4ETZA 4OQ0A 1XA7A 5EV0A 4E3KA 4JF4A 5HD3A 1FR6A 2K7SA 4XT2A 4L9FA 2OOLA 2VZWA 1MKMA 2ZLYA 3S7NA 2WAFA 1E25A 3B33A 2Y2OA 1L2SA 2ZQ9A 2V1ZA 3VE3A 3GR2A 3O86A 4PHTA 3ITBA 2OLVA 5EVIB 1N9NA 2NUPC 2P9VB 2WKHA 3WS0A 3R4KA 3QP6A 3KX0X 2D02A 5FDHA 4E3OA 3I7JA 2JKRM 1OTEA 4EV4A 5HDDA 3GDIA 2B18A 4E3JA 5CEBA 4CLCD 5HX9A 4GS9B 5CTMA 3M2KA 2PYRA 4H8RA 3UN7A 3CI6A 3IX3A 2VV7A 2Z6CA 3TJZC 4EEUA 4PPRA 4YWZA 5AVEA 4GLQA 2Z2MB 1ES3A 3HVFA 3N8SA 4JF5A 3LR5A 3IX8A 4JXVA 5E2GA 3MQQA 2PD8A 4JBFA 3LIAA 3FWLA 5HL1A 1ONGA 3T1QB 3A0RA 4PKYG 5AQ7A 1FQGA 4XUXA 2H10A 1PW1A 1BLPA 5IT5A 4EXOA 4XT2B 3NIAA 4MLLA 2V8CA 1K57A 1BSGA 1L0FA 1F2KA 3Q82A 4JGRA 2DCFA 1N9OA 2D01A 2JKTI 1DJAA 4HEFA 4BD1A 5A8BA 2B5RA 4S2NA 2VGKA 3QP8A 3C4PA 4HOIA 1OTBA 3BFCA 1U60A 4AFIA 3N8RA 3SH8A
chains in the Genus database with same CATH topology
3HUNA 1ONHA 3VP4A 2HDSA 2WADA 2OSUA 3G4PA 2Y2JA 3HLWA 5FI7A 5E2FA 1BULA 4CPKA 3B3XA 1ESUA 3AGDA 3ZNTA 3BLMA 3PBQA 1XX2A 1FR1A 1JWZA 1M40A 1HVBA 4JXGA 2Y2MA 4X69A 1E4DA 3C7UA 4S2PA 5BOHA 5M19A 1CEGA 5D3OA 3S4XA 1KGEA 3IF5A 2ZQAA 1DJCA 2IWBA 3GV9A 1KE4A 1I5QA 3P98A 4L0LA 3S22A 4CJNA 3BFEA 1ES5A 2BLSA 1PZOA 4EUZA 3WS1A 3W4OA 1J9MA 4WEJA 2WKIA 3S1YA 3UDFA 4PM8A 3UE1A 1WYCA 1N9BA 1ERQA 4ZTKA 4ZDXA 3MZEA 4WZ5A 1G68A 1JWPA 4S2JA 1MKIA 5EPHA 3SS3A 1XXMA 3ZGAB 2ZC3B 4IBXA 4RYEA 5AQAA 5U47A 1PWDA 3O3VA 1SHVA 2JCHA 3WRTA 5AQ9A 2EX2A 4M3KA 4S2MA 3OPRA 3A3FA 4R4SA 2HP5A 1LHYA 4FSFA 3ZFZA 3NDEA 5FAPA 2E8IA 4OPYA 2Y2NA 4KZBA 1JWVA 4DKIA 2Y2KA 4BQMA 1L0DA 2Y4AA 3MXSA 4GD6A 3Q81A 1MWUA 3HREA 4DE0A 3NC8A 1BTLA 3NBLA 4HBTA 3N4IA 1W8YA 3BYDA 4R1GA 3Q7ZA 5CGWA 4YINA 3VFFA 1FCMA 3MKEA 3V50A 3IQAA 4KG5A 4N1HA 4JXWA 2V20A 2RL3A 5HW3A 3FV7A 1KGFA 4X53A 1MPLA 1KE3A 4BL3A 4E3MA 2WKEA 1KVLA 3W4PA 3BFDA 3SS4A 3ZHHA 1IYPA 2Y59A 5FQ9A 1ZC2A 1TVFA 3VMAA 3E2LA 4OONA 3UPNA 3TSGA 5GLAA 3IH9A 4GOGA 5TR7A 2PU2A 1FCNA 4WEKA 4PM9A 2WZXA 2PU4A 3ITAA 3IH8A 4FH2A 4LV0A 3M6BA 1E3UD 2EFUA 2ZM2A 5DTKA 3V3SA 3ZG0A 5GLBA 4GNUA 1ZKJA 3G32A 4OP5A 5F83A 1IYQA 5CEDA 3UPOA 4P85A 2OLUA 1NY0A 1RGZA 4P87A 4FD8A 4FH4A 5EUAA 1AXBA 4KZ6A 4Q8IA 3UNWA 1BUEA 2J7VA 4K0WA 1GA0A 4OVDA 4GZBA 4XXRA 1S0WA 4IBRA 4GB7A 3QNBA 1O7EA 2Z2LB 3MKFA 4E3IA 5HFOA 3SS5A 1H8ZA 3CZDA 2X01A 3CJMA 4WBGA 2H0YA 4MNRA 1TDGA 4JF6A 1Q2QA 2ZC5B 3W8KA 2A3UA 4PMAA 1YMXA 3IF6A 4BL2A 2R9WA 3IXDA 2DNSA 3JYIA 4KENB 1ES4A 3IXBA 5DVAA 2XD5A 1LI0A 3IF6C 4S2IA 3OPLA 4R3JA 2WAEA 1EWZA 3ZG7B 1K57C 1BZAA 1NYMA 3PTEA 4K0XA 4DXCA 4U0TA 2EXBA 4KG6A 4KZ9A 5HAIA 3FYZA 2EFXA 1QMFA 3PBTA 4DXBA 4ID4A 4QD4A 2QZ6A 4X68A 4Y0OA 3NI9A 1JTDA 3LY3A 4MBFA 4MBHA 4GDNA 5GHZA 5A90A 4JKTA 1IKGA 5HARA 4S2OA 1K54A 3AGEA 4LV1A 1PYYA 2XQZA 1FOFA 5FATA 2C6WB 2JE5A 2HP9A 3D4FA 2X02A 3WS4A 2DRWA 1DJBA 1LLBA 2JBFA 3Q1FA 3P09A 5CHJA 3G30A 1K54C 2ZM0A 3G31A 4OKPA 4ZJ1A 3ZG8B 2UWXA 3WS2A 1GA9A 1Z6FA 3G2YA 5FAQA 3BLSA 4OPRA 1MXOA 2XF3A 3DTMA 3W4QA 5GLCA 4JLFA 1HZOA 3ZVWA 1L0EA 1M6KA 4RX3A 4U3TA 3NCKA 1K56D 4FCFA 1I2WA 1KDSA 1W79A 4K91A 2A49A 4U0XA 5TFQA 3SH7A 3NY4A 2Y2IA 4IVKA 4A5RA 3HLEA 3PBNA 1NRFA 2WZZA 5FQIA 3ZCZA 1YMSA 5CECA 1PW8A 2JC7A 1KDWA 4S2KA 3E2KA 5TGFA 5HAQA 4RX2A 2Y2QA 1IYOA 4KQOA 5JYOA 4RA7A 4ZJ3A 3UE0A 5GHYA 1K6RA 3V5MA 3VFHA 4DRTA 5KMWA 4WM9A 5DTTA 2IWCA 3OC2A 3OCNA 2VGJA 5FSRA 4IEDA 4WZ5C 4NK3A 1H8YA 1K4EA 4UHUA 4OOLA 1LL5A 2WGWA 3BM6A 3EQVA 4RVAA 2G2WA 2Q9MA 2ZQ8A 3IHBA 5FQQA 1K6SA 3IWQA 4B4ZA 1Y54A 3HLFA 4N1XA 5F1FA 5CRFA 2P74A 4R3BA 3NDGA 4D2OA 4DE2A 4P0MA 3CG5A 1MBLA 1RP5A 3UPPA 1RGYA 1OMEA 1RCJA 4DE3A 4F94A 3G35A 2XFTA 3MZFA 4WELA 3ZVTA 4C75A 4OOYA 1YT4A 2WYXA 1SDNA 2Y2PA 3IF6B 4OLGA 3VOYA 5KSCA 2PBYA 5CERA 5A92A 5CHMA 5CHUA 3RXWA 3FKWA 5M1AA 4C6YA 1XGJA 3VOZA 1L0GA 4Y0TA 5JYPA 2RCXA 1G6AA 1VQQA 4ZJ2A 2XEPA 4KZAA 5AQBA 2C5WB 4WZ4A 1KVMA 1LL9A 4DF6A 4YFMA 1K4FA 2EXAA 4EQIA 1YLPA 3WS5A 3TOIA 3HLDA 4B88A 1LI9A 3QHYA 1BLCA 5IHVA 3PAEA 4KZ3A 3IWOA 1GCEA 3PBSA 3MFDA 3VP3A 3WWXA 4DDSA 4N9KA 4X56A 4QY6A 4IVIA 4LCLA 3PBRA 1CI9A 1XPBA 1HTZA 1KGGA 1PWGA 1K25A 1CI8A 3FZCA 4LENA 4DE1A 1FSWA 1CK3A 4GKUA 1JVJA 2XR0A 3BECA 3A3EA 5CXWA 3A3IA 3G2ZA 1NYYA 2GDNA 1PZPA 4E3LA 3Q07A 5EVIA 2ZQCA 1HD8A 2V2FF 4BD0A 5EOOA 5E2EA 2FFYA 5CGSA 3G34A 2ZM8A 5EVIC 3TG9A 1FSYA 3SOIA 4O7DA 5DTSA 1C3BA 3VSKA 4E3NA 1KE0A 3LO7A 3HL9A 2ZC6B 4N9LA 3MZDA 4WMCA 3ISGA 4OLDA 4ZAMA 3ZG5A 4OQIA 1XGIA 2H0TA 1NXYA 1IYSA 1Q2PA 2ZMAA 4XUZA 4QJGA 4MEZA 2XH9A 2WGVA 4EBLA 5KZHA 1SDEA 1GHMA 5EOEA 1YQSA 3N7WA 1MY8A 2XGNA 1SKFA 4MBKA 3GRJA 1EROA 1WYBA 2X71A 3UY6A 2QPNA 2Y55A 4OPQA 1DY6A 2EX8A 4E6XA 1YLWA 3BEBA 3HBRA 1IEMA 4KZ7A 4BENA 5M18A 2WGWB 4LCMA 1ALQA 1TEMA 3OZHA 5CGXA 2J9PA 1W7FA 1MWSA 4PM5A 5F1GA 2OV5A 5I94A 5A93A 1O07A 4QY5A 4R23A 4WYYA 2HDUA 5DF9A 3V39A 2FFFB 3DWKA 2Q9NA 4KZ8A 4KZ5A 2I72A 3HUOA 2J9OA 1VM1A 3GTCA 3HLGA 3PBOA 4UA9A 5FQKA 3UDXA 2ZQ7A 3VSLA 4NETA 2ZC7A 1XKZA 4QHCA 4Z9QA 3FKVA 1MWTA 3IHAA 1ESIA 5FAOA 2Y2GA 3OPPA 4OQ0A 5A91A 5CTNA 5KSHA 1XA7A 1FCOA 4OH0A 4E3KA 1BT5A 4JF4A 3LCEA 4S2LA 3BFGA 1FR6A 3MBZA 4PM7A 1SCWA 1PI5A 4OQHA 3BRMA 2Y2LA 2ZQDA 3O87A 4KZ4A 5HAPA 4UA6A 2ZLYA 2XD1A 3OPHA 4ZBEA 2CC1A 4JPMA 3C4OA 3SH9A 2WAFA 1E25A 1NJ4A 1YLJA 2XK1A 2Y2OA 3MXRA 3M6HA 3N8LA 3LY4A 4BLMA 1L2SA 2ZQ9A 2V1ZA 4KG2A 3V3RA 3VP0A 4QU3A 3GR2A 3O86A 3ITBA 3IWIA 3M2JA 2OLVA 1K56A 2WK0A 3AGFA 4R4RA 5EVIB 4EBNA 2P9VB 4GDBA 4OPZA 2XLNA 4P6BA 1YM1A 2WKHA 3WS0A 4LV3A 1K55A 5FDHA 1TDLA 2QMIA 1I2SA 1GHIA 4HESA 3I7JA 5GL9A 2HDQA 4E3OA 5DF7A 3RXXA 4EV4A 1K55C 3Q7VA 1IELA 4E3JA 2HDRA 1ERMA 4PM6A 5CEBA 1W8QA 3DW0A 1NZOA 4KQRA 2H5SA 5HX9A 3GQZA 4KQQA 4Y0UA 2XDMA 5CTMA 1QMEA 3M2KA 4JXSA 4HBUA 3ZG9B 4Y7PA 1YLTA 5GHXA 5EVID 5GLDA 2EX6A 3VP2A 2Y2HA 3QNCA 4H8RA 5FASA 4OQGA 3UN7A 2J8YA 2ZD8A 3IT9A 2IWDA 4QB8A 3C5AA 1PI4A 2R9XA 2Y91A 1XP4A 3IXHA 3A3DA 3RJUA 3EQUA 1MWRA 4R0QA 1BLSA 4WMCD 5FI6A 4PPRA 1IKIA 4GD8A 1PWCA 2P9VA 3OCLA 4OOMA 5F82A 1CEFA 2Z2MB 1ES3A 2WUQA 3A3JA 3HVFA 3N8SA 4JF5A 3GVBA 4B4XA 4JXVA 5E2GA 1BLHA 5EE8A 3ZNYA 5EECA 2ZJ9A 4E6WA 4JBFA 3IXGA 2WGIA 1ES2A 1XA1A 3FWLA 5HL1A 3GMWA 2ZC4B 1ONGA 3HLCA 5G18A 1K38A 4X55A 5AQ7A 4EBPA 5E2HA 1YLZA 1FQGA 4XUXA 4OP8A 1PIOA 4UAAA 1E3UA 2H10A 5E43A 3BFFA 3GSGA 5FQJA 3C7VA 1PW1A 1BLPA 3WRZA 2BG1A 4C3QA 4DDYA 1NZUA 3UDIA 2G2UA 1YLYA 3NIAA 4MLLA 3N6IA 5FQMA 1K57A 1BSGA 1L0FA 2EX9A 3VP1A 3ZDJA 2HP6A 4N92A 3CMZA 4LV2A 3HUMA 3Q82A 5FA7A 3HLBA 3LEZA 1GHPA 5DF8A 1JTGA 3PAGA 3UE3A 3UO9A 4BJPA 2DCFA 1H5XA 1ZG6A 5J8XA 1DJAA 4HEFA 5L2FA 4BD1A 1S6RA 2B5RA 2HPBA 2VGKA 4S2NA 3DWZA 4GN2A 3C4PA 4EWFA 1W5DA 1ZG4A 1N4OA 2XFSA 4S2NC 3O88A 3BFCA 4UA7A 1U60A 1WE4A 5FI2A 5EVLA 3N8RA 3Q7VB 3SH8A 1EI5A 4X6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUN A;  1ONH A;  3VP4 A;  2HDS A;  2WAD A;  2OSU A;  3G4P A;  2Y2J A;  3HLW A;  5FI7 A;  5E2F A;  1BUL A;  4CPK A;  3B3X A;  1ESU A;  3AGD A;  3ZNT A;  3BLM A;  3PBQ A;  1XX2 A;  1FR1 A;  1JWZ A;  1M40 A;  1HVB A;  4JXG A;  2Y2M A;  4X69 A;  1E4D A;  3C7U A;  4S2P A;  5BOH A;  5M19 A;  1CEG A;  5D3O A;  3S4X A;  1KGE A;  3IF5 A;  2ZQA A;  1DJC A;  2IWB A;  3GV9 A;  1KE4 A;  1I5Q A;  3P98 A;  4L0L A;  3S22 A;  4CJN A;  3BFE A;  1ES5 A;  2BLS A;  1PZO A;  4EUZ A;  3WS1 A;  3W4O A;  1J9M A;  4WEJ A;  2WKI A;  3S1Y A;  3UDF A;  4PM8 A;  3UE1 A;  1WYC A;  1N9B A;  1ERQ A;  4ZTK A;  4ZDX A;  3MZE A;  4WZ5 A;  1G68 A;  1JWP A;  4S2J A;  1MKI A;  5EPH A;  3SS3 A;  1XXM A;  3ZGA B;  2ZC3 B;  4IBX A;  4RYE A;  5AQA A;  5U47 A;  1PWD A;  3O3V A;  1SHV A;  2JCH A;  3WRT A;  5AQ9 A;  2EX2 A;  4M3K A;  4S2M A;  3OPR A;  3A3F A;  4R4S A;  2HP5 A;  1LHY A;  4FSF A;  3ZFZ A;  3NDE A;  5FAP A;  2E8I A;  4OPY A;  2Y2N A;  4KZB A;  1JWV A;  4DKI A;  2Y2K A;  4BQM A;  1L0D A;  2Y4A A;  3MXS A;  4GD6 A;  3Q81 A;  1MWU A;  3HRE A;  4DE0 A;  3NC8 A;  1BTL A;  3NBL A;  4HBT A;  3N4I A;  1W8Y A;  3BYD A;  4R1G A;  3Q7Z A;  5CGW A;  4YIN A;  3VFF A;  1FCM A;  3MKE A;  3V50 A;  3IQA A;  4KG5 A;  4N1H A;  4JXW A;  2V20 A;  2RL3 A;  5HW3 A;  3FV7 A;  1KGF A;  4X53 A;  1MPL A;  1KE3 A;  4BL3 A;  4E3M A;  2WKE A;  1KVL A;  3W4P A;  3BFD A;  3SS4 A;  3ZHH A;  1IYP A;  2Y59 A;  5FQ9 A;  1ZC2 A;  1TVF A;  3VMA A;  3E2L A;  4OON A;  3UPN A;  3TSG A;  5GLA A;  3IH9 A;  4GOG A;  5TR7 A;  2PU2 A;  1FCN A;  4WEK A;  4PM9 A;  2WZX A;  2PU4 A;  3ITA A;  3IH8 A;  4FH2 A;  4LV0 A;  3M6B A;  1E3U D;  2EFU A;  2ZM2 A;  5DTK A;  3V3S A;  3ZG0 A;  5GLB A;  4GNU A;  1ZKJ A;  3G32 A;  4OP5 A;  5F83 A;  1IYQ A;  5CED A;  3UPO A;  4P85 A;  2OLU A;  1NY0 A;  1RGZ A;  4P87 A;  4FD8 A;  4FH4 A;  5EUA A;  1AXB A;  4KZ6 A;  4Q8I A;  3UNW A;  1BUE A;  2J7V A;  4K0W A;  1GA0 A;  4OVD A;  4GZB A;  4XXR A;  1S0W A;  4IBR A;  4GB7 A;  3QNB A;  1O7E A;  2Z2L B;  3MKF A;  4E3I A;  5HFO A;  3SS5 A;  1H8Z A;  3CZD A;  2X01 A;  3CJM A;  4WBG A;  2H0Y A;  4MNR A;  1TDG A;  4JF6 A;  1Q2Q A;  2ZC5 B;  3W8K A;  2A3U A;  4PMA A;  1YMX A;  3IF6 A;  4BL2 A;  2R9W A;  3IXD A;  2DNS A;  3JYI A;  4KEN B;  1ES4 A;  3IXB A;  5DVA A;  2XD5 A;  1LI0 A;  3IF6 C;  4S2I A;  3OPL A;  4R3J A;  2WAE A;  1EWZ A;  3ZG7 B;  1K57 C;  1BZA A;  1NYM A;  3PTE A;  4K0X A;  4DXC A;  4U0T A;  2EXB A;  4KG6 A;  4KZ9 A;  5HAI A;  3FYZ A;  2EFX A;  1QMF A;  3PBT A;  4DXB A;  4ID4 A;  4QD4 A;  2QZ6 A;  4X68 A;  4Y0O A;  3NI9 A;  1JTD A;  3LY3 A;  4MBF A;  4MBH A;  4GDN A;  5GHZ A;  5A90 A;  4JKT A;  1IKG A;  5HAR A;  4S2O A;  1K54 A;  3AGE A;  4LV1 A;  1PYY A;  2XQZ A;  1FOF A;  5FAT A;  2C6W B;  2JE5 A;  2HP9 A;  3D4F A;  2X02 A;  3WS4 A;  2DRW A;  1DJB A;  1LLB A;  2JBF A;  3Q1F A;  3P09 A;  5CHJ A;  3G30 A;  1K54 C;  2ZM0 A;  3G31 A;  4OKP A;  4ZJ1 A;  3ZG8 B;  2UWX A;  3WS2 A;  1GA9 A;  1Z6F A;  3G2Y A;  5FAQ A;  3BLS A;  4OPR A;  1MXO A;  2XF3 A;  3DTM A;  3W4Q A;  5GLC A;  4JLF A;  1HZO A;  3ZVW A;  1L0E A;  1M6K A;  4RX3 A;  4U3T A;  3NCK A;  1K56 D;  4FCF A;  1I2W A;  1KDS A;  1W79 A;  4K91 A;  2A49 A;  4U0X A;  5TFQ A;  3SH7 A;  3NY4 A;  2Y2I A;  4IVK A;  4A5R A;  3HLE A;  3PBN A;  1NRF A;  2WZZ A;  5FQI A;  3ZCZ A;  1YMS A;  5CEC A;  1PW8 A;  2JC7 A;  1KDW A;  4S2K A;  3E2K A;  5TGF A;  5HAQ A;  4RX2 A;  2Y2Q A;  1IYO A;  4KQO A;  5JYO A;  4RA7 A;  4ZJ3 A;  3UE0 A;  5GHY A;  1K6R A;  3V5M A;  3VFH A;  4DRT A;  5KMW A;  4WM9 A;  5DTT A;  2IWC A;  3OC2 A;  3OCN A;  2VGJ A;  5FSR A;  4IED A;  4WZ5 C;  4NK3 A;  1H8Y A;  1K4E A;  4UHU A;  4OOL A;  1LL5 A;  2WGW A;  3BM6 A;  3EQV A;  4RVA A;  2G2W A;  2Q9M A;  2ZQ8 A;  3IHB A;  5FQQ A;  1K6S A;  3IWQ A;  4B4Z A;  1Y54 A;  3HLF A;  4N1X A;  5F1F A;  5CRF A;  2P74 A;  4R3B A;  3NDG A;  4D2O A;  4DE2 A;  4P0M A;  3CG5 A;  1MBL A;  1RP5 A;  3UPP A;  1RGY A;  1OME A;  1RCJ A;  4DE3 A;  4F94 A;  3G35 A;  2XFT A;  3MZF A;  4WEL A;  3ZVT A;  4C75 A;  4OOY A;  1YT4 A;  2WYX A;  1SDN A;  2Y2P A;  3IF6 B;  4OLG A;  3VOY A;  5KSC A;  2PBY A;  5CER A;  5A92 A;  5CHM A;  5CHU A;  3RXW A;  3FKW A;  5M1A A;  4C6Y A;  1XGJ A;  3VOZ A;  1L0G A;  4Y0T A;  5JYP A;  2RCX A;  1G6A A;  1VQQ A;  4ZJ2 A;  2XEP A;  4KZA A;  5AQB A;  2C5W B;  4WZ4 A;  1KVM A;  1LL9 A;  4DF6 A;  4YFM A;  1K4F A;  2EXA A;  4EQI A;  1YLP A;  3WS5 A;  3TOI A;  3HLD A;  4B88 A;  1LI9 A;  3QHY A;  1BLC A;  5IHV A;  3PAE A;  4KZ3 A;  3IWO A;  1GCE A;  3PBS A;  3MFD A;  3VP3 A;  3WWX A;  4DDS A;  4N9K A;  4X56 A;  4QY6 A;  4IVI A;  4LCL A;  3PBR A;  1CI9 A;  1XPB A;  1HTZ A;  1KGG A;  1PWG A;  1K25 A;  1CI8 A;  3FZC A;  4LEN A;  4DE1 A;  1FSW A;  1CK3 A;  4GKU A;  1JVJ A;  2XR0 A;  3BEC A;  3A3E A;  5CXW A;  3A3I A;  3G2Z A;  1NYY A;  2GDN A;  1PZP A;  4E3L A;  3Q07 A;  5EVI A;  2ZQC A;  1HD8 A;  2V2F F;  4BD0 A;  5EOO A;  5E2E A;  2FFY A;  5CGS A;  3G34 A;  2ZM8 A;  5EVI C;  3TG9 A;  1FSY A;  3SOI A;  4O7D A;  5DTS A;  1C3B A;  3VSK A;  4E3N A;  1KE0 A;  3LO7 A;  3HL9 A;  2ZC6 B;  4N9L A;  3MZD A;  4WMC A;  3ISG A;  4OLD A;  4ZAM A;  3ZG5 A;  4OQI A;  1XGI A;  2H0T A;  1NXY A;  1IYS A;  1Q2P A;  2ZMA A;  4XUZ A;  4QJG A;  4MEZ A;  2XH9 A;  2WGV A;  4EBL A;  5KZH A;  1SDE A;  1GHM A;  5EOE A;  1YQS A;  3N7W A;  1MY8 A;  2XGN A;  1SKF A;  4MBK A;  3GRJ A;  1ERO A;  1WYB A;  2X71 A;  3UY6 A;  2QPN A;  2Y55 A;  4OPQ A;  1DY6 A;  2EX8 A;  4E6X A;  1YLW A;  3BEB A;  3HBR A;  1IEM A;  4KZ7 A;  4BEN A;  5M18 A;  2WGW B;  4LCM A;  1ALQ A;  1TEM A;  3OZH A;  5CGX A;  2J9P A;  1W7F A;  1MWS A;  4PM5 A;  5F1G A;  2OV5 A;  5I94 A;  5A93 A;  1O07 A;  4QY5 A;  4R23 A;  4WYY A;  2HDU A;  5DF9 A;  3V39 A;  2FFF B;  3DWK A;  2Q9N A;  4KZ8 A;  4KZ5 A;  2I72 A;  3HUO A;  2J9O A;  1VM1 A;  3GTC A;  3HLG A;  3PBO A;  4UA9 A;  5FQK A;  3UDX A;  2ZQ7 A;  3VSL A;  4NET A;  2ZC7 A;  1XKZ A;  4QHC A;  4Z9Q A;  3FKV A;  1MWT A;  3IHA A;  1ESI A;  5FAO A;  2Y2G A;  3OPP A;  4OQ0 A;  5A91 A;  5CTN A;  5KSH A;  1XA7 A;  1FCO A;  4OH0 A;  4E3K A;  1BT5 A;  4JF4 A;  3LCE A;  4S2L A;  3BFG A;  1FR6 A;  3MBZ A;  4PM7 A;  1SCW A;  1PI5 A;  4OQH A;  3BRM A;  2Y2L A;  2ZQD A;  3O87 A;  4KZ4 A;  5HAP A;  4UA6 A;  2ZLY A;  2XD1 A;  3OPH A;  4ZBE A;  2CC1 A;  4JPM A;  3C4O A;  3SH9 A;  2WAF A;  1E25 A;  1NJ4 A;  1YLJ A;  2XK1 A;  2Y2O A;  3MXR A;  3M6H A;  3N8L A;  3LY4 A;  4BLM A;  1L2S A;  2ZQ9 A;  2V1Z A;  4KG2 A;  3V3R A;  3VP0 A;  4QU3 A;  3GR2 A;  3O86 A;  3ITB A;  3IWI A;  3M2J A;  2OLV A;  1K56 A;  2WK0 A;  3AGF A;  4R4R A;  5EVI B;  4EBN A;  2P9V B;  4GDB A;  4OPZ A;  2XLN A;  4P6B A;  1YM1 A;  2WKH A;  3WS0 A;  4LV3 A;  1K55 A;  5FDH A;  1TDL A;  2QMI A;  1I2S A;  1GHI A;  4HES A;  3I7J A;  5GL9 A;  2HDQ A;  4E3O A;  5DF7 A;  3RXX A;  4EV4 A;  1K55 C;  3Q7V A;  1IEL A;  4E3J A;  2HDR A;  1ERM A;  4PM6 A;  5CEB A;  1W8Q A;  3DW0 A;  1NZO A;  4KQR A;  2H5S A;  5HX9 A;  3GQZ A;  4KQQ A;  4Y0U A;  2XDM A;  5CTM A;  1QME A;  3M2K A;  4JXS A;  4HBU A;  3ZG9 B;  4Y7P A;  1YLT A;  5GHX A;  5EVI D;  5GLD A;  2EX6 A;  3VP2 A;  2Y2H A;  3QNC A;  4H8R A;  5FAS A;  4OQG A;  3UN7 A;  2J8Y A;  2ZD8 A;  3IT9 A;  2IWD A;  4QB8 A;  3C5A A;  1PI4 A;  2R9X A;  2Y91 A;  1XP4 A;  3IXH A;  3A3D A;  3RJU A;  3EQU A;  1MWR A;  4R0Q A;  1BLS A;  4WMC D;  5FI6 A;  4PPR A;  1IKI A;  4GD8 A;  1PWC A;  2P9V A;  3OCL A;  4OOM A;  5F82 A;  1CEF A;  2Z2M B;  1ES3 A;  2WUQ A;  3A3J A;  3HVF A;  3N8S A;  4JF5 A;  3GVB A;  4B4X A;  4JXV A;  5E2G A;  1BLH A;  5EE8 A;  3ZNY A;  5EEC A;  2ZJ9 A;  4E6W A;  4JBF A;  3IXG A;  2WGI A;  1ES2 A;  1XA1 A;  3FWL A;  5HL1 A;  3GMW A;  2ZC4 B;  1ONG A;  3HLC A;  5G18 A;  1K38 A;  4X55 A;  5AQ7 A;  4EBP A;  5E2H A;  1YLZ A;  1FQG A;  4XUX A;  4OP8 A;  1PIO A;  4UAA A;  1E3U A;  2H10 A;  5E43 A;  3BFF A;  3GSG A;  5FQJ A;  3C7V A;  1PW1 A;  1BLP A;  3WRZ A;  2BG1 A;  4C3Q A;  4DDY A;  1NZU A;  3UDI A;  2G2U A;  1YLY A;  3NIA A;  4MLL A;  3N6I A;  5FQM A;  1K57 A;  1BSG A;  1L0F A;  2EX9 A;  3VP1 A;  3ZDJ A;  2HP6 A;  4N92 A;  3CMZ A;  4LV2 A;  3HUM A;  3Q82 A;  5FA7 A;  3HLB A;  3LEZ A;  1GHP A;  5DF8 A;  1JTG A;  3PAG A;  3UE3 A;  3UO9 A;  4BJP A;  2DCF A;  1H5X A;  1ZG6 A;  5J8X A;  1DJA A;  4HEF A;  5L2F A;  4BD1 A;  1S6R A;  2B5R A;  2HPB A;  2VGK A;  4S2N A;  3DWZ A;  4GN2 A;  3C4P A;  4EWF A;  1W5D A;  1ZG4 A;  1N4O A;  2XFS A;  4S2N C;  3O88 A;  3BFC A;  4UA7 A;  1U60 A;  1WE4 A;  5FI2 A;  5EVL A;  3N8R A;  3Q7V B;  3SH8 A;  1EI5 A;  4X6T A; 
#chains in the Genus database with same CATH topology
 4CPK A;  2LB5 A;  3B3X A;  1ESU A;  3AGD A;  4ETX A;  3FG8 A;  3BLM A;  4CLC E;  3KYZ A;  3TE8 A;  3ULF A;  4IUH A;  5BOH A;  3CWF A;  5D3O A;  2B95 A;  2VKS A;  3S7P A;  3P98 A;  4L0L A;  3S22 A;  4CJN A;  3BFE A;  3WS1 A;  3W4O A;  1J9M A;  3S1Y A;  1G6O A;  3UE1 A;  3U2A A;  4ZTK A;  4ZDX A;  4O01 A;  4WZ5 A;  4I38 A;  1JWP A;  3ZGA B;  1PWD A;  3O3V A;  4L9E A;  2EX2 A;  1TF1 A;  4S2M A;  3OPR A;  3LR0 A;  2AVX A;  1LHY A;  2E8I A;  5I5L A;  4DKI A;  2Y2K A;  4BQM A;  4GD6 A;  3HRE A;  4P6Z M;  1XFN A;  3UB5 P;  4F3L B;  4ME4 A;  4N1H A;  1KGF A;  1MPL A;  1ACF A;  2WKE A;  1KVL A;  1IYP A;  2KDK A;  3VMA A;  2YKH A;  2W3D A;  5GLA A;  3IH9 A;  1OT9 A;  1FCN A;  4WEK A;  3ITA A;  5DTK A;  3V3S A;  4GNU A;  5EM0 A;  4OP5 A;  1D7E A;  3H82 B;  1AXB A;  4Q8I A;  4XXR A;  4IBR A;  3MKF A;  4ARZ B;  1OTI A;  3SS5 A;  1H8Z A;  3CZD A;  2X01 A;  4WBG A;  2JN7 A;  4X25 A;  3F1O A;  2H0Y A;  4MNR A;  1TDG A;  1Q2Q A;  2ZC5 B;  3JYI A;  2L1M A;  1EWZ A;  1K57 C;  4DXC A;  3LIF A;  4KZ9 A;  3TW8 A;  3MSH A;  2EFX A;  3PBT A;  4MDZ A;  4QD4 A;  2QZ6 A;  4X68 A;  1D06 A;  1JTD A;  4MBF A;  4MBH A;  4GDN A;  5GHZ A;  1S67 L;  1SKO A;  4LRX C;  4LV1 A;  2JE5 A;  3D4F A;  4BBV A;  1DJB A;  2W3G A;  3G31 A;  4OKP A;  2UWX A;  2P7J A;  1H3Q A;  3SH7 A;  4E04 A;  4A5R A;  4R3A A;  1PW8 A;  3E2K A;  4RX2 A;  1IYO A;  3CLO A;  4KQO A;  4RA7 A;  2CMN A;  3LI9 A;  2PDR A;  4NG2 A;  3V5M A;  5KMW A;  5DTT A;  5L09 A;  4WZ5 C;  1H8Y A;  1K4E A;  3IS2 A;  2Y79 A;  2Q9M A;  2ZQ8 A;  4Z1W A;  1K6S A;  4B4Z A;  2V0U A;  1CJF A;  2VX8 A;  3NDG A;  4P6Z S;  4D2O A;  3MMH A;  3S7Q A;  2K2N A;  3CPT A;  1MBL A;  1VEU A;  4DE3 A;  1OME A;  2XFT A;  3MZF A;  3ZVT A;  3F1O B;  4OOY A;  3JPU A;  4OLG A;  2PBY A;  5DJT A;  5CHM A;  1XGJ A;  1L0G A;  1G6A A;  2XEP A;  3MFX A;  2V8F A;  5AQB A;  4WZ4 A;  1LL9 A;  4EQI A;  2MJ6 A;  1VET A;  5EFW A;  3HLD A;  1Y28 A;  3QHY A;  4R6L A;  1BLC A;  3BJN A;  4QY6 A;  2KOI A;  3DBA A;  1HTZ A;  2IA2 A;  4WLA A;  1CI8 A;  4LEN A;  4DE1 A;  1SKO B;  5F69 A;  3A3E A;  2PR6 A;  2Z6D A;  2VV8 A;  5CGS A;  2ZM8 A;  3SOI A;  4O7D A;  5DTS A;  2QKP A;  5F68 A;  4ZAM A;  3ZG5 A;  4OQI A;  1TS0 A;  1IYS A;  2ZMA A;  4MEZ A;  2WGV A;  1IFQ A;  1SDE A;  4ZRR A;  3GRJ A;  2O9C A;  1NLZ A;  3OZH A;  1W7F A;  1S1Y A;  5F1G A;  4G3V A;  5I94 A;  1O07 A;  4R23 A;  4EQ1 A;  3CPT B;  5DF9 A;  1VEU B;  3G6O A;  3HUO A;  2J9O A;  4UA9 A;  3UDX A;  2ZC7 A;  3JVV A;  2LB9 A;  4Z9Q A;  3IHA A;  1T1A A;  2XRO A;  3OPP A;  5A91 A;  1FIL A;  2GZA A;  4S2L A;  4DMZ A;  3T1R A;  1VET B;  1PI5 A;  4OQH A;  3O87 A;  1NWZ A;  4KZ4 A;  1F5M A;  4JPM A;  3OPL A;  1YLJ A;  3M6H A;  2KX6 A;  3T50 A;  4FOF A;  5FL3 A;  1W63 Q;  1XJ3 A;  1K56 A;  2WK0 A;  3AGF A;  4D60 A;  4WF0 A;  5GL9 A;  1GHI A;  1K55 C;  1ERM A;  4PM6 A;  1YAX A;  1GSV A;  2B02 A;  3GQZ A;  3NOU C;  3LFV A;  4Y0U A;  2VJW A;  2XDM A;  1QME A;  4Y7P A;  1YLT A;  5EVI D;  3VP2 A;  4NXF A;  3IT9 A;  4UEY A;  4QB8 A;  3C5A A;  2R9X A;  3IXH A;  4K08 A;  1BLS A;  2P9V A;  1OT6 A;  1FIK A;  1F9I A;  2GJ3 A;  1ES2 A;  1XA1 A;  3GMW A;  2ZC4 B;  3HLC A;  3EWK A;  4GS9 A;  4Q0H A;  5E2H A;  2V9A A;  1E3U A;  3BFF A;  4JGQ A;  5FQJ A;  3C7V A;  2BG1 A;  4DDY A;  1NZU A;  2PR5 A;  3UDI A;  1F98 A;  1YLY A;  3N6I A;  2EX9 A;  3ZDJ A;  3RFB A;  1EW0 A;  3QP4 A;  3CMZ A;  2A24 B;  4LV2 A;  4B9O A;  3HLB A;  3UE3 A;  1H5X A;  2J80 A;  3HJK A;  1S6R A;  4X1M A;  2HPB A;  3DWZ A;  5CX7 A;  4HI4 A;  2DMW A;  4EWF A;  1N4O A;  4HHD A;  2QHK A;  4UA7 A;  4X6T A;  2M7V A;  1ONH A;  5LBR A;  1W63 M;  2OSU A;  3BQA A;  3L7H A;  4EU0 A;  1X0O A;  4JXG A;  1M40 A;  1HVB A;  1G28 A;  4S2P A;  1KGE A;  2OWH A;  3IF5 A;  1DJC A;  3GV9 A;  1KE4 A;  2G7U A;  1ES5 A;  2BLS A;  4O0P A;  4PM8 A;  1N9B A;  1ERQ A;  5KIZ A;  3KSG A;  5EPH A;  2ZC3 B;  4IBX A;  4KUO A;  4G3W A;  3KSF A;  5HWV A;  3A3F A;  1YPR A;  4R4S A;  4FSF A;  2PRF A;  3NDE A;  5FAP A;  2V1A A;  3K3D A;  2Y4A A;  5DKL A;  3Q81 A;  5EVE A;  1BTL A;  5CGW A;  2A2L A;  3N4I A;  1W8Y A;  3BYD A;  3NBL A;  4HBT A;  4MN5 A;  4YIN A;  3VFF A;  3T4L A;  3MKE A;  3IQA A;  4HJ4 A;  2V20 A;  2RL3 A;  3FPV A;  5HW3 A;  1KE3 A;  4BL3 A;  3ZHH A;  2Y59 A;  5FQ9 A;  1P97 A;  3IBR A;  2HJE A;  2XA7 M;  3UPN A;  3LR3 A;  4BBT A;  5FEF A;  1XJ2 A;  4FH2 A;  3DTK A;  2EFU A;  5GLB A;  3UPO A;  5CED A;  2OLU A;  3QP1 A;  3F1N A;  4CLC A;  4KZ6 A;  2J7V A;  4K0W A;  4OVD A;  4GZB A;  3QNB A;  2OWJ A;  1O7E A;  5DFY A;  3OOV A;  4F3L A;  3B47 A;  3W8K A;  2A3U A;  2R9W A;  3A0S A;  2XD5 A;  4S2I A;  3IF6 C;  4R3J A;  3R7W B;  1BZA A;  1NYM A;  4K0X A;  2EXB A;  5HAI A;  1ODV A;  3RTY A;  3T12 B;  3H82 A;  3H9W A;  4HJ6 A;  1PFL A;  1PYY A;  2XQZ A;  5FAT A;  3DTE A;  4ARZ A;  2X02 A;  3P09 A;  3EEA A;  1K54 C;  2ZM0 A;  1Z6F A;  1MXO A;  2XF3 A;  5G4Z A;  3W4Q A;  1HZO A;  1XJ4 A;  4U3T A;  1GSX A;  5TJJ A;  1I2W A;  3KSH A;  4K91 A;  3ZYT A;  3RH8 B;  4IVK A;  3HLE A;  2WZZ A;  5FQI A;  3ZCZ A;  1YMS A;  1KDW A;  3NOP C;  4S2K A;  3W2Z A;  3UE0 A;  5HPF A;  5GHY A;  4QWO A;  3VFH A;  2IWC A;  4IED A;  4NK3 A;  2WGW A;  5FQQ A;  3F1N B;  4RVA A;  3IHB A;  2ZMF A;  4CLC B;  5CRF A;  1A0K A;  4DE2 A;  3KO6 A;  3CG5 A;  3UPP A;  4YOF A;  1CQA A;  3LEQ A;  3KYE A;  1SDN A;  3PXP A;  5KSC A;  3VOY A;  1VHM A;  3VOL A;  3RXW A;  5M1A A;  1NLY A;  5HSQ A;  4Y0T A;  5JYP A;  1D1J A;  2RCX A;  3MF0 A;  2XA7 S;  4ZJ2 A;  1H0M A;  1TS6 A;  4KZA A;  2C5W B;  4DF6 A;  1T1C A;  4YFM A;  2EXA A;  1YLP A;  2P08 A;  4BMW A;  4KZ3 A;  3PBS A;  3VP3 A;  4NXG A;  4Y15 A;  5L07 A;  4N9K A;  5F5Y A;  4IVI A;  2EWV A;  1CI9 A;  1AWI A;  1K25 A;  2HGV A;  2QJ5 A;  1SZV A;  1JVJ A;  2XR0 A;  5HL6 A;  5CXW A;  1NYY A;  4CLC C;  4HQA A;  2GDN A;  1PZP A;  3Q07 A;  2ZQC A;  2V2F F;  1DRM A;  2NUT C;  3TG9 A;  3BWL A;  1FSY A;  3DTI A;  3MZD A;  2GNX A;  4WMC A;  3ISG A;  4OLD A;  2H0T A;  5AVF A;  1NXY A;  4QJG A;  5KZH A;  2XH9 A;  1S66 L;  1GHM A;  1YQS A;  3N7W A;  4I3A A;  1MY8 A;  2XGN A;  1SKF A;  5L10 A;  2EX8 A;  4E6X A;  4BEN A;  5M18 A;  2WGW B;  4G3K A;  5CGX A;  1GSW A;  4PM5 A;  4GJ4 A;  4EW7 A;  5DJU A;  3MXQ A;  3V39 A;  3DWK A;  3CUE A;  1P9R A;  1VM1 A;  3GTC A;  5FQK A;  4NET A;  4WL9 A;  3EGD C;  1ESI A;  3F1P A;  2Y2G A;  5CTN A;  5KSH A;  2V0W A;  3NUL A;  3MBZ A;  1SCW A;  2Y2L A;  2ZQD A;  1PRQ A;  3QP5 A;  2XD1 A;  3CIT A;  2UV0 E;  1XFQ A;  1MC0 A;  3SH9 A;  3C4O A;  2XK1 A;  3MXR A;  3D9Y A;  3LY4 A;  4BLM A;  5HWW A;  1ZHH B;  4MCW A;  3VP0 A;  4MN6 A;  3M2J A;  2Q0O A;  4EBN A;  4OPZ A;  4GDB A;  2XLN A;  1K55 A;  3LGO A;  1TDL A;  3LIC A;  2QYB A;  1I2S A;  4HES A;  3FC7 A;  3VE4 A;  3BQ8 A;  5DF7 A;  3RXX A;  3Q7V A;  3E4O A;  4FUW A;  4Y3I A;  1W8Q A;  2J3T D;  4KQR A;  2H5S A;  2E8J A;  3ZG9 B;  4JXS A;  5J4E A;  3EGX C;  2XRN A;  5GHX A;  2EX6 A;  4OQG A;  5HDS A;  1PNE A;  2J3W A;  2IWD A;  1XP4 A;  2KLI A;  3RJU A;  3A3D A;  3EQU A;  1Z09 A;  4R0Q A;  5FI6 A;  3LUQ A;  1IKI A;  1Y4O A;  4OOM A;  2L4R A;  3GVB A;  4B4X A;  1BLH A;  5EE8 A;  3NOT C;  3DAV A;  3IXG A;  3HJI A;  3F1P B;  2VEA A;  3MR0 A;  5G18 A;  2HZ5 A;  4IJG A;  1K38 A;  4EBP A;  1YLZ A;  4OP8 A;  5E43 A;  3LR4 A;  3HCY A;  5J7E A;  2HJ9 C;  3T1X A;  2WKR A;  2GX5 A;  3VP1 A;  5K5B A;  4EET B;  5FA7 A;  5DF8 A;  3UO9 A;  4BJP A;  1ZG6 A;  5J8X A;  3OLO A;  4GN2 A;  5F6A A;  1ZG4 A;  3CUE C;  4HH2 A;  1WE4 A;  5FI2 A;  1STZ A;  5EVL A;  3Q7V B;  4HNB A;  4NKP A;  3HUN A;  3VP4 A;  2HDS A;  2WAD A;  5FI7 A;  5E2F A;  3BY8 A;  1XX2 A;  1FR1 A;  1JWZ A;  3FPW A;  3NEC A;  1CEG A;  2WKP A;  2IWB A;  1I5Q A;  2A24 A;  5TBM A;  3MJQ A;  4WEJ A;  3C8C A;  4Y17 A;  1DP6 A;  5HPI A;  1G68 A;  1XXM A;  3IX4 A;  2H28 A;  5AQA A;  3D3O A;  1IOU A;  1OTD A;  4M3K A;  3PR6 A;  4OPY A;  3TRC A;  1JWV A;  1L0D A;  2VLG A;  3MXS A;  4I5S A;  1T19 A;  4LRY C;  4EEP A;  1FCM A;  4M4X A;  4GW9 A;  4H6J A;  3MQO A;  2W0N A;  1TVF A;  3E2L A;  3CHW P;  3TSG A;  4GOG A;  4PM9 A;  1L3L A;  2PU4 A;  1E3U D;  2ZM2 A;  3ZG0 A;  1ZKJ A;  3G32 A;  1IYQ A;  4P87 A;  5EUA A;  2BAS A;  2W1T B;  3UNW A;  2Z2L B;  2YKF A;  3UMD A;  5HFO A;  3T4S A;  2PD7 A;  4PMA A;  1YMX A;  3IF6 A;  4BL2 A;  3IXD A;  2DNS A;  3VV4 A;  4KEN B;  1K0K A;  4HP4 A;  3PTE A;  1DP9 A;  5TBM B;  1LSX A;  4KG6 A;  4JGP A;  3FYZ A;  1QMF A;  4LPZ A;  3LY3 A;  3OBF A;  2L0W A;  2O99 A;  5A90 A;  5HAR A;  1K54 A;  3LIB A;  1FOF A;  4DE0 A;  2C6W B;  3WS4 A;  2DRW A;  1LLB A;  1TD5 A;  3G30 A;  5DFX A;  4ZJ1 A;  1GA9 A;  1OJG A;  1UWP X;  3BLS A;  3DTM A;  3ZVW A;  1L0E A;  1M6K A;  3NCK A;  1S1Z A;  3ICY A;  4U0X A;  3R7W A;  2ACG A;  4H6J B;  2QWS A;  1YSP A;  2W1R A;  3PYP A;  4DJ3 A;  2JC7 A;  2JKR I;  3C2W A;  2Y2Q A;  5JYO A;  4IUK A;  4GCZ A;  3T4O A;  1K6R A;  2OAQ 1;  4HIA A;  3EOI A;  3OCN A;  3LID A;  5IS1 A;  1LL5 A;  2ZL1 A;  5FDS A;  3IWQ A;  1Y54 A;  3HLF A;  4N1X A;  4R3B A;  3UB7 A;  4F94 A;  1RCJ A;  3H7W A;  4EUV A;  3G35 A;  4WEL A;  3CAX A;  4FTX A;  3IF6 B;  1H8M A;  3P7N A;  5CER A;  2W27 A;  5A92 A;  5CHU A;  3E0Y A;  4L9G A;  3VOZ A;  5HDC A;  4WN5 A;  3TOI A;  5IHV A;  3BY9 A;  3UE6 A;  3JVU A;  3SZT A;  4X56 A;  3UB6 A;  4Q0J A;  4LCL A;  2VA0 A;  3PBR A;  1XPB A;  1KGG A;  3FZC A;  3BEC A;  4EES A;  4E3L A;  4MN7 A;  1TS7 A;  4BD0 A;  5EOO A;  5E2E A;  2FFY A;  3G34 A;  3V67 A;  5EVI C;  1UGU A;  5HWT A;  1KE0 A;  3HL9 A;  3MS6 A;  4GHI B;  2PBD P;  1XGI A;  1V9Z A;  1Q2P A;  4XUZ A;  2ZMV A;  4EBL A;  5EOE A;  3KSI A;  3UY6 A;  4OPQ A;  1YLW A;  3B42 A;  4MMN A;  3BEB A;  2W3E A;  1IEM A;  4KZ7 A;  1JNU A;  3K2N A;  5HZH A;  2ZL1 B;  4LCM A;  1ALQ A;  4Y2F A;  4Q0I A;  2J9P A;  2OV5 A;  4R38 A;  5A93 A;  2FFF B;  2Q9N A;  3H7W B;  4KZ8 A;  2I72 A;  4B93 A;  3HLG A;  4I39 A;  3PBO A;  3VSL A;  2V1B A;  1XKZ A;  3FKV A;  1MWT A;  3MQ0 A;  3E4P A;  1FCO A;  2PAV P;  4JGO A;  2JKT M;  2FH5 A;  4OH0 A;  1BT5 A;  3LCE A;  3BFG A;  1DP8 A;  3C30 A;  4BWI A;  4PM7 A;  5MC7 A;  3BRM A;  1OJ5 A;  5HAP A;  4UA6 A;  3OPH A;  4ZBE A;  2M7U A;  2CC1 A;  1NJ4 A;  3N8L A;  1LL8 A;  4KG2 A;  3V3R A;  4QU3 A;  4LGW A;  3IWI A;  4LRZ E;  1J3W A;  4R4R A;  4I3I A;  2O9A A;  4P6B A;  1YM1 A;  4LV3 A;  2QMI A;  2HDQ A;  3UB8 A;  3SW1 A;  4DN0 A;  4R70 A;  1IEL A;  3EEH A;  2HDR A;  3DW0 A;  1NZO A;  3E4Q A;  1P0Z A;  1LSV A;  2W3H A;  4KQQ A;  3T4Q A;  4Y13 A;  4EER A;  4HBU A;  5GLD A;  2Y2H A;  3LI8 A;  3QNC A;  5FAS A;  2J8Y A;  2ZD8 A;  5G4Y A;  1PI4 A;  2Y91 A;  2O9B A;  1MWR A;  4WMC D;  4HH3 A;  3S7O A;  4GD8 A;  1PWC A;  3OCL A;  5F82 A;  1CEF A;  2WUQ A;  3A3J A;  5F1F A;  2R78 A;  3ZNY A;  5EEC A;  3T4T A;  2ZJ9 A;  1VB6 A;  4KQD A;  4E6W A;  2WGI A;  1UWN X;  4X55 A;  3A0V A;  4UAA A;  1PIO A;  2JHE A;  3GSG A;  2HF6 A;  3WRZ A;  1XJ6 A;  4C3Q A;  2G2U A;  5FQM A;  4X1L A;  2HP6 A;  4N92 A;  4RQ9 A;  4HY8 A;  3HUM A;  3KYQ A;  2JKG A;  1BYW A;  3LEZ A;  1GHP A;  1JTG A;  3PAG A;  3NHQ A;  4HJ3 A;  3P01 A;  5L2F A;  1W5D A;  2XFS A;  4S2N C;  3O88 A;  1YSQ A;  3T1S A;  4LLO B;  1EI5 A;  1WA9 A;  3HLW A;  3G4P A;  2Y2J A;  4II7 A;  1BUL A;  5J3W A;  3ZNT A;  3PBQ A;  4X69 A;  2Y2M A;  1E4D A;  3C7U A;  5DKK A;  5M19 A;  3S4X A;  3L9K A;  2ZQA A;  2PHY A;  3K3C A;  4QPR A;  1KOU A;  1PZO A;  4EUZ A;  2FZ0 A;  2WKI A;  3UDF A;  4HP9 A;  1WYC A;  2Y8H A;  3MZE A;  1YKD A;  4S2J A;  1MKI A;  3SS3 A;  2M1C A;  4RYE A;  5U47 A;  3U4L P;  1SHV A;  2JCH A;  3WRT A;  5AQ9 A;  3T4J A;  2HP5 A;  3ZFZ A;  2Y2N A;  4KZB A;  1LSW A;  1MWU A;  2INW A;  4BBU A;  3NC8 A;  4R1G A;  1G5U A;  3Q7Z A;  3V50 A;  4KG5 A;  1OPX A;  4JXW A;  3FV7 A;  5EM1 A;  4X53 A;  4E3M A;  3LYX A;  3W4P A;  3BFD A;  3SS4 A;  5C5K A;  2VGL M;  1ZC2 A;  3BW6 A;  3D72 A;  4OON A;  4I3J A;  4Y5F A;  5TR7 A;  3PHY A;  2PU2 A;  2WZX A;  4LV0 A;  3IH8 A;  3M6B A;  1LT0 A;  5F83 A;  4P85 A;  1NY0 A;  1RGZ A;  4FD8 A;  4FH4 A;  2ZOI A;  1BUE A;  1GA0 A;  4NXE A;  1S0W A;  4GB7 A;  4E3I A;  3T4K A;  3GEC A;  2WKQ A;  3CJM A;  5FEG A;  4JF6 A;  3NJA A;  4UQI M;  2P04 A;  1ES4 A;  3IXB A;  3QP2 A;  5DVA A;  1V9Y A;  1LI0 A;  2WAE A;  3ZG7 B;  4U0T A;  1S4S A;  5HD5 A;  2W3F A;  4DXB A;  5L8M A;  4ID4 A;  1TS8 A;  1CF0 A;  4Y0O A;  4PAU A;  3NI9 A;  4JKT A;  1IKG A;  4PKY A;  4S2O A;  3IS2 B;  2W1T A;  3AGE A;  2HP9 A;  2JBF A;  5CHJ A;  2VK3 A;  3Q1F A;  3ZG8 B;  3WS2 A;  3G2Y A;  5FAQ A;  4OPR A;  5GLC A;  4JLF A;  4RX3 A;  2ZBB A;  1K56 D;  1N9L A;  4FCF A;  1KDS A;  1W79 A;  4LFU A;  2VV6 A;  2A49 A;  5TFQ A;  3NY4 A;  2EA9 A;  2Y2I A;  3PBN A;  4NEE D;  1NRF A;  3IBJ A;  5CEC A;  3C38 A;  2HV1 A;  1P9W A;  5TGF A;  5HAQ A;  2PYP A;  4ZJ3 A;  3O5Y A;  1MZU A;  4IHQ A;  4DRT A;  2BTF P;  4WM9 A;  3OC2 A;  2VGJ A;  5FSR A;  4UHU A;  4OOL A;  3BM6 A;  3EQV A;  2G2W A;  2P74 A;  2PT7 A;  4P0M A;  2EWW A;  1RP5 A;  1RGY A;  2JKF A;  4C75 A;  1YT4 A;  2WYX A;  2Y2P A;  4WUJ A;  1ZTU A;  3FKW A;  4YNR A;  4C6Y A;  2VGL S;  3UB9 A;  1VQQ A;  1KVM A;  1K4F A;  3WS5 A;  4B88 A;  1LI9 A;  1T1B A;  3ZQ5 A;  3PAE A;  4KUK A;  3IWO A;  1GCE A;  3MFD A;  3WWX A;  4DDS A;  1PWG A;  2ZOH A;  1FSW A;  1CK3 A;  4NXB A;  4GKU A;  3A3I A;  3G2Z A;  5AJG A;  2J3T C;  2K31 A;  1HLU P;  2O0Y A;  5EVI A;  2QJ7 A;  1HD8 A;  1T18 A;  4UQI S;  3E98 A;  1C3B A;  3VSK A;  4E3N A;  3LO7 A;  2ZC6 B;  4N9L A;  2I9V A;  1OTA A;  3LIE A;  4MBK A;  1ERO A;  1WYB A;  2X71 A;  2QPN A;  2Y55 A;  1DY6 A;  2OAP 1;  3HBR A;  1TEM A;  4O8G A;  3UME A;  1MWS A;  4ESP A;  4QY5 A;  4WYY A;  2HDU A;  1S4R A;  4CQH A;  4KZ5 A;  2XSS A;  2ZQ7 A;  1NRJ A;  4DJ2 A;  4QHC A;  5IU1 A;  4GHI A;  5FAO A;  4ETZ A;  4OQ0 A;  1XA7 A;  5EV0 A;  4E3K A;  4JF4 A;  5HD3 A;  1FR6 A;  2K7S A;  4XT2 A;  4L9F A;  2OOL A;  2VZW A;  1MKM A;  2ZLY A;  3S7N A;  2WAF A;  1E25 A;  3B33 A;  2Y2O A;  1L2S A;  2ZQ9 A;  2V1Z A;  3VE3 A;  3GR2 A;  3O86 A;  4PHT A;  3ITB A;  2OLV A;  5EVI B;  1N9N A;  2NUP C;  2P9V B;  2WKH A;  3WS0 A;  3R4K A;  3QP6 A;  3KX0 X;  2D02 A;  5FDH A;  4E3O A;  3I7J A;  2JKR M;  1OTE A;  4EV4 A;  5HDD A;  3GDI A;  2B18 A;  4E3J A;  5CEB A;  4CLC D;  5HX9 A;  4GS9 B;  5CTM A;  3M2K A;  2PYR A;  4H8R A;  3UN7 A;  3CI6 A;  3IX3 A;  2VV7 A;  2Z6C A;  3TJZ C;  4EEU A;  4PPR A;  4YWZ A;  5AVE A;  4GLQ A;  2Z2M B;  1ES3 A;  3HVF A;  3N8S A;  4JF5 A;  3LR5 A;  3IX8 A;  4JXV A;  5E2G A;  3MQQ A;  2PD8 A;  4JBF A;  3LIA A;  3FWL A;  5HL1 A;  1ONG A;  3T1Q B;  3A0R A;  4PKY G;  5AQ7 A;  1FQG A;  4XUX A;  2H10 A;  1PW1 A;  1BLP A;  5IT5 A;  4EXO A;  4XT2 B;  3NIA A;  4MLL A;  2V8C A;  1K57 A;  1BSG A;  1L0F A;  1F2K A;  3Q82 A;  4JGR A;  2DCF A;  1N9O A;  2D01 A;  2JKT I;  1DJA A;  4HEF A;  4BD1 A;  5A8B A;  2B5R A;  4S2N A;  2VGK A;  3QP8 A;  3C4P A;  4HOI A;  1OTB A;  3BFC A;  1U60 A;  4AFI A;  3N8R A;  3SH8 A; 
#chains in the Genus database with same CATH homology
 3HUN A;  1ONH A;  3VP4 A;  2HDS A;  2WAD A;  2OSU A;  3G4P A;  2Y2J A;  3HLW A;  5FI7 A;  5E2F A;  1BUL A;  4CPK A;  3B3X A;  1ESU A;  3AGD A;  3ZNT A;  3BLM A;  3PBQ A;  1XX2 A;  1FR1 A;  1JWZ A;  1M40 A;  1HVB A;  4JXG A;  2Y2M A;  4X69 A;  1E4D A;  3C7U A;  4S2P A;  5BOH A;  5M19 A;  1CEG A;  5D3O A;  3S4X A;  1KGE A;  3IF5 A;  2ZQA A;  1DJC A;  2IWB A;  3GV9 A;  1KE4 A;  1I5Q A;  3P98 A;  4L0L A;  3S22 A;  4CJN A;  3BFE A;  1ES5 A;  2BLS A;  1PZO A;  4EUZ A;  3WS1 A;  3W4O A;  1J9M A;  4WEJ A;  2WKI A;  3S1Y A;  3UDF A;  4PM8 A;  3UE1 A;  1WYC A;  1N9B A;  1ERQ A;  4ZTK A;  4ZDX A;  3MZE A;  4WZ5 A;  1G68 A;  1JWP A;  4S2J A;  1MKI A;  5EPH A;  3SS3 A;  1XXM A;  3ZGA B;  2ZC3 B;  4IBX A;  4RYE A;  5AQA A;  5U47 A;  1PWD A;  3O3V A;  1SHV A;  2JCH A;  3WRT A;  5AQ9 A;  2EX2 A;  4M3K A;  4S2M A;  3OPR A;  3A3F A;  4R4S A;  2HP5 A;  1LHY A;  4FSF A;  3ZFZ A;  3NDE A;  5FAP A;  2E8I A;  4OPY A;  2Y2N A;  4KZB A;  1JWV A;  4DKI A;  2Y2K A;  4BQM A;  1L0D A;  2Y4A A;  3MXS A;  4GD6 A;  3Q81 A;  1MWU A;  3HRE A;  4DE0 A;  3NC8 A;  1BTL A;  3NBL A;  4HBT A;  3N4I A;  1W8Y A;  3BYD A;  4R1G A;  3Q7Z A;  5CGW A;  4YIN A;  3VFF A;  1FCM A;  3MKE A;  3V50 A;  3IQA A;  4KG5 A;  4N1H A;  4JXW A;  2V20 A;  2RL3 A;  5HW3 A;  3FV7 A;  1KGF A;  4X53 A;  1MPL A;  1KE3 A;  4BL3 A;  4E3M A;  2WKE A;  1KVL A;  3W4P A;  3BFD A;  3SS4 A;  3ZHH A;  1IYP A;  2Y59 A;  5FQ9 A;  1ZC2 A;  1TVF A;  3VMA A;  3E2L A;  4OON A;  3UPN A;  3TSG A;  5GLA A;  3IH9 A;  4GOG A;  5TR7 A;  2PU2 A;  1FCN A;  4WEK A;  4PM9 A;  2WZX A;  2PU4 A;  3ITA A;  3IH8 A;  4FH2 A;  4LV0 A;  3M6B A;  1E3U D;  2EFU A;  2ZM2 A;  5DTK A;  3V3S A;  3ZG0 A;  5GLB A;  4GNU A;  1ZKJ A;  3G32 A;  4OP5 A;  5F83 A;  1IYQ A;  5CED A;  3UPO A;  4P85 A;  2OLU A;  1NY0 A;  1RGZ A;  4P87 A;  4FD8 A;  4FH4 A;  5EUA A;  1AXB A;  4KZ6 A;  4Q8I A;  3UNW A;  1BUE A;  2J7V A;  4K0W A;  1GA0 A;  4OVD A;  4GZB A;  4XXR A;  1S0W A;  4IBR A;  4GB7 A;  3QNB A;  1O7E A;  2Z2L B;  3MKF A;  4E3I A;  5HFO A;  3SS5 A;  1H8Z A;  3CZD A;  2X01 A;  3CJM A;  4WBG A;  2H0Y A;  4MNR A;  1TDG A;  4JF6 A;  1Q2Q A;  2ZC5 B;  3W8K A;  2A3U A;  4PMA A;  1YMX A;  3IF6 A;  4BL2 A;  2R9W A;  3IXD A;  2DNS A;  3JYI A;  4KEN B;  1ES4 A;  3IXB A;  5DVA A;  2XD5 A;  1LI0 A;  3IF6 C;  4S2I A;  3OPL A;  4R3J A;  2WAE A;  1EWZ A;  3ZG7 B;  1K57 C;  1BZA A;  1NYM A;  3PTE A;  4K0X A;  4DXC A;  4U0T A;  2EXB A;  4KG6 A;  4KZ9 A;  5HAI A;  3FYZ A;  2EFX A;  1QMF A;  3PBT A;  4DXB A;  4ID4 A;  4QD4 A;  2QZ6 A;  4X68 A;  4Y0O A;  3NI9 A;  1JTD A;  3LY3 A;  4MBF A;  4MBH A;  4GDN A;  5GHZ A;  5A90 A;  4JKT A;  1IKG A;  5HAR A;  4S2O A;  1K54 A;  3AGE A;  4LV1 A;  1PYY A;  2XQZ A;  1FOF A;  5FAT A;  2C6W B;  2JE5 A;  2HP9 A;  3D4F A;  2X02 A;  3WS4 A;  2DRW A;  1DJB A;  1LLB A;  2JBF A;  3Q1F A;  3P09 A;  5CHJ A;  3G30 A;  1K54 C;  2ZM0 A;  3G31 A;  4OKP A;  4ZJ1 A;  3ZG8 B;  2UWX A;  3WS2 A;  1GA9 A;  1Z6F A;  3G2Y A;  5FAQ A;  3BLS A;  4OPR A;  1MXO A;  2XF3 A;  3DTM A;  3W4Q A;  5GLC A;  4JLF A;  1HZO A;  3ZVW A;  1L0E A;  1M6K A;  4RX3 A;  4U3T A;  3NCK A;  1K56 D;  4FCF A;  1I2W A;  1KDS A;  1W79 A;  4K91 A;  2A49 A;  4U0X A;  5TFQ A;  3SH7 A;  3NY4 A;  2Y2I A;  4IVK A;  4A5R A;  3HLE A;  3PBN A;  1NRF A;  2WZZ A;  5FQI A;  3ZCZ A;  1YMS A;  5CEC A;  1PW8 A;  2JC7 A;  1KDW A;  4S2K A;  3E2K A;  5TGF A;  5HAQ A;  4RX2 A;  2Y2Q A;  1IYO A;  4KQO A;  5JYO A;  4RA7 A;  4ZJ3 A;  3UE0 A;  5GHY A;  1K6R A;  3V5M A;  3VFH A;  4DRT A;  5KMW A;  4WM9 A;  5DTT A;  2IWC A;  3OC2 A;  3OCN A;  2VGJ A;  5FSR A;  4IED A;  4WZ5 C;  4NK3 A;  1H8Y A;  1K4E A;  4UHU A;  4OOL A;  1LL5 A;  2WGW A;  3BM6 A;  3EQV A;  4RVA A;  2G2W A;  2Q9M A;  2ZQ8 A;  3IHB A;  5FQQ A;  1K6S A;  3IWQ A;  4B4Z A;  1Y54 A;  3HLF A;  4N1X A;  5F1F A;  5CRF A;  2P74 A;  4R3B A;  3NDG A;  4D2O A;  4DE2 A;  4P0M A;  3CG5 A;  1MBL A;  1RP5 A;  3UPP A;  1RGY A;  1OME A;  1RCJ A;  4DE3 A;  4F94 A;  3G35 A;  2XFT A;  3MZF A;  4WEL A;  3ZVT A;  4C75 A;  4OOY A;  1YT4 A;  2WYX A;  1SDN A;  2Y2P A;  3IF6 B;  4OLG A;  3VOY A;  5KSC A;  2PBY A;  5CER A;  5A92 A;  5CHM A;  5CHU A;  3RXW A;  3FKW A;  5M1A A;  4C6Y A;  1XGJ A;  3VOZ A;  1L0G A;  4Y0T A;  5JYP A;  2RCX A;  1G6A A;  1VQQ A;  4ZJ2 A;  2XEP A;  4KZA A;  5AQB A;  2C5W B;  4WZ4 A;  1KVM A;  1LL9 A;  4DF6 A;  4YFM A;  1K4F A;  2EXA A;  4EQI A;  1YLP A;  3WS5 A;  3TOI A;  3HLD A;  4B88 A;  1LI9 A;  3QHY A;  1BLC A;  5IHV A;  3PAE A;  4KZ3 A;  3IWO A;  1GCE A;  3PBS A;  3MFD A;  3VP3 A;  3WWX A;  4DDS A;  4N9K A;  4X56 A;  4QY6 A;  4IVI A;  4LCL A;  3PBR A;  1CI9 A;  1XPB A;  1HTZ A;  1KGG A;  1PWG A;  1K25 A;  1CI8 A;  3FZC A;  4LEN A;  4DE1 A;  1FSW A;  1CK3 A;  4GKU A;  1JVJ A;  2XR0 A;  3BEC A;  3A3E A;  5CXW A;  3A3I A;  3G2Z A;  1NYY A;  2GDN A;  1PZP A;  4E3L A;  3Q07 A;  5EVI A;  2ZQC A;  1HD8 A;  2V2F F;  4BD0 A;  5EOO A;  5E2E A;  2FFY A;  5CGS A;  3G34 A;  2ZM8 A;  5EVI C;  3TG9 A;  1FSY A;  3SOI A;  4O7D A;  5DTS A;  1C3B A;  3VSK A;  4E3N A;  1KE0 A;  3LO7 A;  3HL9 A;  2ZC6 B;  4N9L A;  3MZD A;  4WMC A;  3ISG A;  4OLD A;  4ZAM A;  3ZG5 A;  4OQI A;  1XGI A;  2H0T A;  1NXY A;  1IYS A;  1Q2P A;  2ZMA A;  4XUZ A;  4QJG A;  4MEZ A;  2XH9 A;  2WGV A;  4EBL A;  5KZH A;  1SDE A;  1GHM A;  5EOE A;  1YQS A;  3N7W A;  1MY8 A;  2XGN A;  1SKF A;  4MBK A;  3GRJ A;  1ERO A;  1WYB A;  2X71 A;  3UY6 A;  2QPN A;  2Y55 A;  4OPQ A;  1DY6 A;  2EX8 A;  4E6X A;  1YLW A;  3BEB A;  3HBR A;  1IEM A;  4KZ7 A;  4BEN A;  5M18 A;  2WGW B;  4LCM A;  1ALQ A;  1TEM A;  3OZH A;  5CGX A;  2J9P A;  1W7F A;  1MWS A;  4PM5 A;  5F1G A;  2OV5 A;  5I94 A;  5A93 A;  1O07 A;  4QY5 A;  4R23 A;  4WYY A;  2HDU A;  5DF9 A;  3V39 A;  2FFF B;  3DWK A;  2Q9N A;  4KZ8 A;  4KZ5 A;  2I72 A;  3HUO A;  2J9O A;  1VM1 A;  3GTC A;  3HLG A;  3PBO A;  4UA9 A;  5FQK A;  3UDX A;  2ZQ7 A;  3VSL A;  4NET A;  2ZC7 A;  1XKZ A;  4QHC A;  4Z9Q A;  3FKV A;  1MWT A;  3IHA A;  1ESI A;  5FAO A;  2Y2G A;  3OPP A;  4OQ0 A;  5A91 A;  5CTN A;  5KSH A;  1XA7 A;  1FCO A;  4OH0 A;  4E3K A;  1BT5 A;  4JF4 A;  3LCE A;  4S2L A;  3BFG A;  1FR6 A;  3MBZ A;  4PM7 A;  1SCW A;  1PI5 A;  4OQH A;  3BRM A;  2Y2L A;  2ZQD A;  3O87 A;  4KZ4 A;  5HAP A;  4UA6 A;  2ZLY A;  2XD1 A;  3OPH A;  4ZBE A;  2CC1 A;  4JPM A;  3C4O A;  3SH9 A;  2WAF A;  1E25 A;  1NJ4 A;  1YLJ A;  2XK1 A;  2Y2O A;  3MXR A;  3M6H A;  3N8L A;  3LY4 A;  4BLM A;  1L2S A;  2ZQ9 A;  2V1Z A;  4KG2 A;  3V3R A;  3VP0 A;  4QU3 A;  3GR2 A;  3O86 A;  3ITB A;  3IWI A;  3M2J A;  2OLV A;  1K56 A;  2WK0 A;  3AGF A;  4R4R A;  5EVI B;  4EBN A;  2P9V B;  4GDB A;  4OPZ A;  2XLN A;  4P6B A;  1YM1 A;  2WKH A;  3WS0 A;  4LV3 A;  1K55 A;  5FDH A;  1TDL A;  2QMI A;  1I2S A;  1GHI A;  4HES A;  3I7J A;  5GL9 A;  2HDQ A;  4E3O A;  5DF7 A;  3RXX A;  4EV4 A;  1K55 C;  3Q7V A;  1IEL A;  4E3J A;  2HDR A;  1ERM A;  4PM6 A;  5CEB A;  1W8Q A;  3DW0 A;  1NZO A;  4KQR A;  2H5S A;  5HX9 A;  3GQZ A;  4KQQ A;  4Y0U A;  2XDM A;  5CTM A;  1QME A;  3M2K A;  4JXS A;  4HBU A;  3ZG9 B;  4Y7P A;  1YLT A;  5GHX A;  5EVI D;  5GLD A;  2EX6 A;  3VP2 A;  2Y2H A;  3QNC A;  4H8R A;  5FAS A;  4OQG A;  3UN7 A;  2J8Y A;  2ZD8 A;  3IT9 A;  2IWD A;  4QB8 A;  3C5A A;  1PI4 A;  2R9X A;  2Y91 A;  1XP4 A;  3IXH A;  3A3D A;  3RJU A;  3EQU A;  1MWR A;  4R0Q A;  1BLS A;  4WMC D;  5FI6 A;  4PPR A;  1IKI A;  4GD8 A;  1PWC A;  2P9V A;  3OCL A;  4OOM A;  5F82 A;  1CEF A;  2Z2M B;  1ES3 A;  2WUQ A;  3A3J A;  3HVF A;  3N8S A;  4JF5 A;  3GVB A;  4B4X A;  4JXV A;  5E2G A;  1BLH A;  5EE8 A;  3ZNY A;  5EEC A;  2ZJ9 A;  4E6W A;  4JBF A;  3IXG A;  2WGI A;  1ES2 A;  1XA1 A;  3FWL A;  5HL1 A;  3GMW A;  2ZC4 B;  1ONG A;  3HLC A;  5G18 A;  1K38 A;  4X55 A;  5AQ7 A;  4EBP A;  5E2H A;  1YLZ A;  1FQG A;  4XUX A;  4OP8 A;  1PIO A;  4UAA A;  1E3U A;  2H10 A;  5E43 A;  3BFF A;  3GSG A;  5FQJ A;  3C7V A;  1PW1 A;  1BLP A;  3WRZ A;  2BG1 A;  4C3Q A;  4DDY A;  1NZU A;  3UDI A;  2G2U A;  1YLY A;  3NIA A;  4MLL A;  3N6I A;  5FQM A;  1K57 A;  1BSG A;  1L0F A;  2EX9 A;  3VP1 A;  3ZDJ A;  2HP6 A;  4N92 A;  3CMZ A;  4LV2 A;  3HUM A;  3Q82 A;  5FA7 A;  3HLB A;  3LEZ A;  1GHP A;  5DF8 A;  1JTG A;  3PAG A;  3UE3 A;  3UO9 A;  4BJP A;  2DCF A;  1H5X A;  1ZG6 A;  5J8X A;  1DJA A;  4HEF A;  5L2F A;  4BD1 A;  1S6R A;  2B5R A;  2HPB A;  2VGK A;  4S2N A;  3DWZ A;  4GN2 A;  3C4P A;  4EWF A;  1W5D A;  1ZG4 A;  1N4O A;  2XFS A;  4S2N C;  3O88 A;  3BFC A;  4UA7 A;  1U60 A;  1WE4 A;  5FI2 A;  5EVL A;  3N8R A;  3Q7V B;  3SH8 A;  1EI5 A;  4X6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...