2WK0A

Crystal structure of the class a beta-lactamase bs3 inhibited by 6- beta-iodopenicillanate.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
255
structure length
255
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVTYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNTAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALATSLQAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPEGWEVADKTGAGSYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Structural Basis of the Inhibition of Class a Beta-Lactamases and Penicillin-Binding Proteins by 6-Beta-Iodopenicillanate.
pubmed doi rcsb
molecule tags Hydrolase
total genus 89
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2wk0A00
1H8YA 4O7DA 4HBUA 5DTSA 4JPMA 1KGFA 3UE0A 2FFYA 4OLDA 4Z9QA 1ERQA 3ZG9B 1SKFA 5GHYA 4KENB 4HEFA 4KZ8A 2WKHA 2PU4A 2WGIA 2XDMA 4S2NC 5HAQA 4N9LA 4C6YA 5CEBA 3AGDA 1K57A 4UHUA 2A49A 3LY4A 1PW8A 1RGZA 3MZDA 3VP0A 5BOHA 5FDHA 2WADA 4JF6A 2ZM0A 4KZ3A 2ZQAA 3WRTA 3ZHHA 5E2GA 3O88A 1S6RA 3Q7VA 5EUAA 3WRZA 4PM8A 3VP3A 3UY6A 3P09A 1W7FA 4GNUA 1ZC2A 1ES4A 3VMAA 5KSCA 3V3RA 4GZBA 1LLBA 2JC7A 2HP9A 1TVFA 2X71A 4BLMA 1NYYA 1BLHA 5CERA 3V3SA 1TEMA 2C5WB 2QMIA 2VGKA 1K6RA 4N92A 3BM6A 3OC2A 5GHXA 3DWKA 4Y0TA 2B5RA 5FSRA 3IXGA 5TFQA 1PYYA 3IHBA 1NXYA 5HAIA 2ZC5B 5EVIA 3HREA 2X01A 1JTDA 4R3BA 5F82A 3C4PA 4JLFA 3SH9A 3S4XA 1J9MA 1BULA 1DY6A 1PI5A 3JYIA 4U0TA 5EPHA 1SHVA 2ZMAA 3GQZA 3TG9A 5DTTA 3BRMA 4QD4A 3SS3A 3VFFA 1L0FA 3M6HA 1RP5A 3G31A 1YLJA 2Y2LA 1RGYA 2XH9A 3IQAA 4QHCA 3GR2A 4Y0OA 1BLPA 3IF6C 4HBTA 3NY4A 4WELA 5EECA 2R9XA 2Y2MA 3BECA 1TDLA 4GN2A 2VGJA 4KZAA 3ZG7B 5FATA 4ZJ1A 3DWZA 4PPRA 1GHPA 1BZAA 3ZNYA 1Z6FA 2EX2A 1FR1A 3LEZA 3RXXA 1YQSA 1LHYA 4KZ9A 4ZAMA 2H0TA 3Q1FA 5CGSA 3LO7A 3VOYA 4ZTKA 5JYPA 4X69A 4IVIA 1PIOA 1N9BA 1M6KA 2J7VA 3HUNA 3N6IA 1KGEA 3G2YA 4GKUA 3WWXA 2V20A 1K55A 2XQZA 4QU3A 5E43A 4H8RA 4S2IA 5E2FA 5GLAA 1K38A 4DE2A 4IBXA 4K0XA 2RL3A 1K4EA 3Q7ZA 4EQIA 2QPNA 1XGJA 2J8YA 3N8SA 5GLDA 4PM5A 3ZG5A 5AQAA 2H0YA 3HLBA 3Q82A 4EWFA 3GMWA 4OPQA 2CC1A 2J9PA 4PMAA 4KQRA 1BTLA 2ZQ8A 3Q81A 1QMEA 4OVDA 5E2EA 4KQOA 4YINA 3OCNA 1O07A 4P85A 3IF6B 2GDNA 3CJMA 3VOZA 2WKIA 4LV3A 5JYOA 3I7JA 2P74A 4KZ7A 1JWPA 3S1YA 4CJNA 5GHZA 4JXGA 1IKGA 4LV0A 5CGWA 4WM9A 4F94A 4X6TA 3W4QA 4KZ6A 4OQ0A 4LCMA 2Y91A 3BLMA 1PZPA 3FKWA 3UDFA 1BSGA 4GB7A 2ZC7A 5KZHA 2Y2NA 5FAQA 3MFDA 3ZVWA 5FI6A 3OPHA 3MXSA 4ZJ3A 5AQ9A 1BUEA 2EX9A 4OOLA 1LL9A 5TR7A 4DDSA 1KE0A 3UPPA 5FAPA 1PWGA 3SOIA 4KQQA 2G2WA 5DVAA 3HLEA 4DE1A 4NK3A 3ZDJA 3BFGA 3C5AA 3E2LA 5AQ7A 2Y2PA 3ZG0A 2I72A 2H5SA 5EE8A 2ZQCA 3C7VA 4R1GA 1K54A 3SS4A 3NDGA 1NZUA 5FAOA 1SDNA 5U47A 2XFTA 4DRTA 4DKIA 4OPZA 1FR6A 4GOGA 1FCMA 2Y2OA 3VP4A 3WS4A 1DJCA 1ESUA 2XD5A 3IHAA 3PTEA 3S22A 3HLWA 5FQIA 3UO9A 3ZFZA 3UN7A 2WYXA 4KZBA 3G30A 1ES5A 1XP4A 1L0EA 1XX2A 1EWZA 2A3UA 1ESIA 3N4IA 4WZ5C 4GDNA 3W8KA 5DF8A 1ONGA 2V1ZA 2P9VB 2EXAA 2DRWA 1K56A 4R4SA 1H5XA 4DE3A 3N7WA 3LCEA 4R4RA 1MWTA 2ZC6B 3IWOA 1G68A 2EXBA 3WS2A 3O87A 3OPLA 3W4PA 5KMWA 4LV1A 3EQUA 2BLSA 1I2WA 4OH0A 4N1HA 5CHJA 2FFFB 4X53A 1EI5A 1LI9A 3PBNA 4OQIA 1ZG6A 2OLUA 2Y55A 4GD6A 3M2JA 1GA0A 3G2ZA 4S2OA 1XPBA 5CECA 2ZLYA 2XGNA 5EOOA 4E3JA 1GA9A 2Y2JA 1G6AA 3A3JA 1GHMA 5FI2A 4ZDXA 3LY3A 1CEFA 3MKEA 4UAAA 3PBTA 1BT5A 4QB8A 4NETA 3FYZA 1ALQA 4WYYA 2WZZA 3N8RA 4M3KA 3MKFA 3MZFA 2Q9NA 2C6WB 4DXCA 5M19A 3BYDA 3NIAA 1WYBA 3QNBA 3BLSA 4S2MA 1FQGA 4OPYA 4KZ5A 3TOIA 3ZGAB 4B4ZA 5A90A 1LI0A 4FSFA 5F1GA 3VSKA 1KDWA 4IVKA 4KG6A 4PM9A 2Y2IA 3Q07A 3ISGA 5M18A 3GRJA 1FSWA 1RCJA 3G35A 2PU2A 4OP8A 5CXWA 3PBQA 2XD1A 4UA7A 4P0MA 4EV4A 3CZDA 1CK3A 4CPKA 4N1XA 1E4DA 3BEBA 4K0WA 3V5MA 2Y2GA 5HL1A 1KVMA 2Y2QA 4X55A 3IH9A 4B88A 1KVLA 1XXMA 4S2NA 2WUQA 3G32A 4FCFA 5GLCA 3UE1A 4MBKA 4WEKA 1Q2QA 3EQVA 4P6BA 1E3UD 1ES3A 3FV7A 1K57C 3GTCA 1XKZA 5J8XA 5D3OA 3QHYA 3OCLA 1YLZA 2V2FF 3IXBA 3IF5A 4GD8A 4E3OA 2J9OA 1L0GA 3V50A 4S2LA 1E25A 3SH8A 1N4OA 4MBHA 4ZBEA 5CHUA 3UE3A 1JTGA 2ZM8A 3A3EA 4N9KA 5KSHA 3UPNA 3MBZA 3NC8A 5FI7A 3SS5A 5A92A 1JVJA 1ZG4A 1YMSA 1U60A 4UA9A 4Q8IA 2WKEA 4IEDA 4E6WA 2EX6A 5IHVA 4JXWA 1YLPA 4BQMA 1FCOA 1ES2A 5M1AA 3IH8A 1KGGA 1VM1A 1PWDA 2ZC4B 5F83A 3VSLA 4YFMA 3WS1A 2IWBA 3N8LA 1H8ZA 1HZOA 3C7UA 1K25A 3M2KA 1YT4A 4Y7PA 4PM6A 5FQMA 5G18A 4DXBA 3OPPA 3UDIA 4Y0UA 5HAPA 1CI8A 5GLBA 1WYCA 4B4XA 5HX9A 4WMCD 5EVIC 3ZCZA 3ZG8B 1YLWA 2WAEA 5F1FA 5FQQA 1I5QA 1SCWA 4JKTA 4BD1A 4FD8A 3MZEA 3BFEA 5CTMA 3OZHA 3M6BA 1MWSA 3BFDA 2HDQA 1MWRA 3HLGA 4LENA 4PM7A 4FH4A 1FCNA 3IF6A 1FOFA 2OLVA 1MWUA 4OONA 1IKIA 3CG5A 3Q7VB 1L2SA 1CI9A 4K91A 4JXSA 4WEJA 1CEGA 1KDSA 2QZ6A 3C4OA 4OKPA 2EFUA 4U3TA 2Z2LB 2DNSA 4BD0A 4QY5A 4KZ4A 5CRFA 4D2OA 1W5DA 4MLLA 1NZOA 4ZJ2A 2EX8A 3B3XA 1ZKJA 1ERMA 1YLYA 3HVFA 3D4FA 4E3IA 3HLDA 1M40A 4OQGA 4LCLA 4JF4A 1K55C 1KE3A 4X68A 2XR0A 4RYEA 5CEDA 4E3NA 5HFOA 5CGXA 1MPLA 3G34A 3NBLA 5AQBA 5FQKA 1W8QA 5FA7A 2WZXA 4BL3A 4C75A 5EVIB 4EBNA 2Q9MA 4OOYA 2ZC3B 4KG2A 3TSGA 1MXOA 1OMEA 3G4PA 2Y2KA 2HP6A 1DJAA 3GV9A 4BL2A 4LV2A 4QJGA 4L0LA 1XGIA 3HUMA 3V39A 1BLSA 3AGFA 4KG5A 5TGFA 3HLFA 1PWCA 2ZQ7A 3PBOA 4EBPA 5DTKA 4A5RA 3VP2A 1NYMA 1NJ4A 1YMXA 1ONHA 3E2KA 3SH7A 4BJPA 1PI4A 2XLNA 3P98A 2XK1A 4FH2A 3UDXA 3UNWA 1K56D 4JBFA 4MEZA 5HARA 2P9VA 4XXRA 2OV5A 4JXVA 3DW0A 4HESA 4X56A 5A93A 3W4OA 3OPRA 1Y54A 2OSUA 3ITBA 4IBRA 4DDYA 4RVAA 1IYPA 1BLCA 1HVBA 2HDUA 4RX3A 5FASA 3FKVA 1IYQA 1WE4A 3ZNTA 2Z2MB 5CHMA 1SDEA 2ZQDA 4RA7A 3IXHA 3NCKA 5DF9A 3UPOA 4JF5A 5GL9A 1FSYA 4U0XA 1O7EA 2JBFA 5EVID 4BENA 1YM1A 1QMFA 4E3MA 3PBSA 1E3UA 2IWDA 1AXBA 4XUXA 1IYSA 3HBRA 2JE5A 1XA7A 1IYOA 1IELA 1HD8A 1K54C 1DJBA 1EROA 2WGWB 4S2JA 2ZD8A 4C3QA 4UA6A 3PBRA 5EOEA 4EUZA 2JCHA 2ZM2A 2WGVA 3IT9A 1PZOA 3RXWA 3DTMA 2XFSA 4MNRA 4R0QA 3WS0A 4WZ5A 2X02A 2PBYA 3A3IA 3CMZA 1NY0A 2RCXA 3FZCA 2UWXA 1GCEA 4OOMA 3WS5A 4OQHA 4R3JA 1L0DA 4MBFA 5DF7A 1K6SA 4GDBA 1XA1A 2BG1A 3HL9A 2WAFA 3HLCA 2HP5A 3O86A 3NI9A 1MBLA 4WBGA 5FQ9A 2DCFA 1VQQA 3FWLA 4OPRA 4XUZA 1HTZA 4E6XA 2H10A 1W8YA 2HPBA 3RJUA 3GSGA 3MXRA 2HDSA 1MKIA 2Y2HA 3IWIA 4WMCA 5L2FA 1Q2PA 4OLGA 5CTNA 2HDRA 3VP1A 3AGEA 2R9WA 4R23A 2WGWA 3NDEA 5A91A 1JWVA 1IEMA 5E2HA 4E3KA 1NRFA 1C3BA 1MY8A 2EFXA 1TDGA 1GHIA 3IXDA 2Y59A 4E3LA 2G2UA 4DF6A 2IWCA 1W79A 3QNCA 2Y4AA 3ITAA 4WZ4A 2WK0A 4EBLA 3BFCA 1JWZA 1KE4A 3A3FA 3A3DA 3O3VA 4S2KA 4ID4A 4P87A 3VFHA 5EVLA 2XEPA 1PW1A 5FQJA 5I94A 1YLTA 3GVBA 3HUOA 5HW3A 4QY6A 4DE0A 4OP5A 1I2SA 2E8IA 3BFFA 3ZVTA 1K4FA 1S0WA 1LL5A 3PAGA 4S2PA 3PAEA 3IWQA 2ZJ9A 2XF3A 2ZQ9A 4RX2A
chains in the Genus database with same CATH superfamily
2FFYA 4HEFA 4KZ8A 1VHMA 2WKHA 2WGIA 3T4KA 5CEBA 2A49A 4MCWA 2WADA 2ZM0A 1KOUA 4KZ3A 2ZQAA 2GZAA 3O88A 1S6RA 3LR5A 3WRZA 1XJ4A 1ES4A 2H28A 2X71A 3C38A 2K7SA 4QPRA 1DP9A 1HLUP 3UB5P 2VGKA 3BM6A 2LB5A 3DWKA 5AVEA 2HZ5A 1OJGA 1PYYA 3GECA 1T1BA 2VX8A 3C4PA 1S1YA 3SH9A 1UGUA 1DY6A 4U0TA 3JYIA 2WKPA 5EPHA 3SS3A 3BRMA 1N9NA 3F1NA 3GR2A 3IF6C 3NY4A 2Y2MA 3ZG7B 4ZJ1A 3ZNYA 1Z6FA 2B95A 2EX2A 1FR1A 3LEZA 1YQSA 3EOIA 2PR6A 3MR0A 4ZTKA 5JYPA 1VEUA 2KDKA 1PIOA 1N9BA 3HUNA 3N6IA 1KGEA 3G2YA 3WWXA 2JKFA 2XQZA 4QU3A 5E2FA 4S2IA 4K0XA 3H82A 5L07A 3C30A 1XGJA 3KYEA 4PM5A 1NLZA 4OPQA 4PMAA 1BTLA 5MC7A 4LLOB 5E2EA 4ARZA 2P04A 2BASA 3HJKA 1O07A 4P85A 2GDNA 4LV3A 2P74A 4CJNA 4X6TA 3UMDA 3W4QA 4LCMA 3MFXA 3FKWA 3UDFA 4P6ZS 3T4SA 4I39A 5KZHA 2Y2NA 3BQ8A 3A0SA 3MXSA 5AQ9A 1BUEA 1LL9A 3TJZC 5TR7A 1KE0A 2W3GA 1PWGA 4NXEA 1FILA 1OTBA 3ZDJA 2I72A 1UWNX 2ZQCA 3C7VA 3T4JA 2XFTA 4DRTA 1FR6A 1FCMA 1DJCA 2XD5A 5FQIA 1P0ZA 3NECA 2VGLS 1XP4A 1W63Q 4Y17A 2A3UA 1ESIA 2PAVP 3N4IA 4GDNA 1ZHHB 4LFUA 2UV0E 3O87A 4LV1A 2HGVA 4OH0A 2WKQA 4N1HA 2FFFB 4X53A 1EI5A 1LI9A 3PBNA 4OQIA 1ODVA 1LT0A 5EOOA 4ZDXA 1GHMA 4DJ3A 4EESA 2W3HA 3PBTA 4WN5A 3G6OA 1XJ2A 3MKFA 2Q9NA 4DXCA 5AJGA 5DJUA 4MMNA 4OPYA 2DMWA 4KZ5A 3TOIA 4B4ZA 1KDWA 4KG6A 4GS9B 1FSWA 2PU2A 4OP8A 5CXWA 5EM0A 3MSHA 3JPUA 1D1JA 4F3LA 3CZDA 4CPKA 4N1XA 3L9KA 3TE8A 2Y2QA 3LR3A 4S2NA 4HP9A 3ICYA 4ETXA 1Q2QA 3EQVA 1ES3A 1XKZA 5J8XA 3OCLA 3IF5A 1L0GA 1SZVA 1E25A 3SH8A 4MBHA 4CLCE 5FEGA 2ZM8A 4N9KA 2Z6CA 1JVJA 1ZG4A 4JGQA 4IEDA 5IHVA 1ES2A 2J3TC 3WS1A 4I3IA 3M2KA 1YT4A 1CI8A 5GLBA 4B4XA 4YWZA 5HX9A 3NOTC 1YLWA 2PR5A 2XA7M 5FQQA 4BD1A 4FD8A 1F5MA 3OZHA 1MWRA 1TS0A 1FOFA 2OLVA 4NXBA 3CG5A 1L2SA 5F69A 4M4XA 1KDSA 3F1OB 4OKPA 2EFUA 2DNSA 4BD0A 4D2OA 5K5BA 4GLQA 1W5DA 1ERMA 2VV8A 1YLYA 5DFYA 4I3JA 4OQGA 4LCLA 2JKGA 4B9OA 4RYEA 4IUHA 3G34A 4C75A 1W8QA 4BL3A 2B02A 1OMEA 1A0KA 2HP6A 2A24A 3GV9A 3PR6A 3HUMA 1LSWA 3CHWP 2W1RA 4KG5A 3IS2B 3HLFA 3W2ZA 3PBOA 3KSFA 4A5RA 3JVVA 3E2KA 1PI4A 3UNWA 4FUWA 3VOLA 4QWOA 3MJQA 1S67L 2GJ3A 4HESA 3W4OA 4HIAA 4RVAA 3LI9A 2ZBBA 1BLCA 4RX3A 5DKLA 1SKOA 1T1AA 3FKVA 1IYQA 2Y8HA 1SDEA 2ZQDA 3NCKA 1H3QA 3UPOA 5GL9A 3U2AA 1O7EA 4B93A 5EVID 2IWDA 1AXBA 5EV0A 2R78A 1HD8A 1K54C 1CF0A 2WGWB 2Q0OA 1TD5A 5EOEA 2JCHA 4HH2A 2X02A 1NY0A 2RCXA 1PNEA 4NXFA 3WS5A 4HHDA 4R3JA 3LYXA 4GDBA 3R7WA 3HLCA 1YSPA 3O86A 1DP8A 3FWLA 4GHIB 4XUZA 1LL8A 3P01A 1HTZA 4HI4A 2H10A 1W8YA 3VV4A 3MXRA 4CQHA 1GSVA 2Y2HA 5L2FA 2R9WA 5F68A 3V67A 1JWVA 1IEMA 5E2HA 1MY8A 2EFXA 2ACGA 3CLOA 4L9GA 2G2UA 3A0RA 4FOFA 4WZ4A 3T4OA 3OBFA 1PFLA 3KO6A 4EBLA 1JWZA 4CLCD 1KE4A 2JHEA 2ZL1B 4HY8A 5FQJA 1YLTA 5J7EA 5HW3A 3UB9A 3ZVTA 1K4FA 3PAEA 2ZJ9A 4RX2A 1H8YA 4JPMA 4OLDA 4Z9QA 3ZG9B 4O0PA 1SKFA 4KENB 1OT6A 5HAQA 3C2WA 1K57A 4I5SA 5BOHA 5FDHA 2XROA 3P09A 4GNUA 5IT5A 1ZC2A 3VMAA 2HF6A 1V9ZA 2JC7A 1TVFA 1F2KA 4NKPA 5CERA 3V3SA 2QMIA 2M1CA 5GHXA 4Y0TA 1T1CA 5FSRA 5HDDA 1NXYA 5HAIA 5EVIA 3HREA 2PDRA 4JLFA 1J9MA 1PI5A 1SHVA 2ZMAA 3GQZA 2M7UA 3TG9A 3M6HA 1RP5A 3G31A 2Y2LA 1RGYA 4ETZA 3S7NA 5EECA 3BECA 1TDLA 4GN2A 4KZAA 4PPRA 1GHPA 1LHYA 4LRZE 4ZAMA 3Q1FA 4X69A 4IVIA 1M6KA 2J7VA 4GKUA 5AVFA 1K55A 5E43A 4H8RA 1K38A 1D06A 2QJ7A 4EERA 1G6OA 5GLDA 3ZG5A 3Q82A 2W3EA 3GMWA 2J9PA 3UB6A 2ZQ8A 3H7WB 1QMEA 3L7HA 5I5LA 3OCNA 3T1XA 3VOZA 5JYOA 3I7JA 3O5YA 4KZ7A 3S1YA 4CLCA 3H9WA 4JXGA 2VKSA 2NUPC 4KZ6A 4Y13A 1PZPA 1NWZA 3MFDA 2VA0A 3QP6A 4EETB 3LIFA 2O9BA 3RTYA 2EX9A 3UE6A 3UPPA 5FAPA 1P9WA 3SOIA 2G2WA 5DVAA 3IBJA 4NK3A 3E2LA 3E4OA 2NUTC 1AWIA 5EE8A 4R1GA 5U47A 3S7OA 5EFWA 2Y2OA 5HDCA 1ESUA 3IHAA 3F1PA 3QP8A 1H0MA 2IA2A 2XSSA 5FL3A 1L0EA 1EWZA 4WZ5C 5L09A 4YNRA 1TS8A 2P9VB 1K56A 2INWA 2KLIA 3LI8A 1H5XA 1OJ5A 4H6JB 2Y79A 4R4RA 3T4LA 1DP6A 3OPLA 3MS6A 1I2WA 1Y28A 5CHJA 4GJ4A 1STZA 1P97A 4Y15A 4DJ2A 4UAAA 4K08A 1BT5A 4NETA 3CITA 3KSIA 2PT7A 1CJFA 3LIEA 3FC7A 5M19A 1WYBA 3QNBA 3BLSA 4S2MA 1FQGA 1LI0A 3VSKA 2V1AA 3LUQA 4IVKA 4PM9A 2Y2IA 2LB9A 2HJEA 3G35A 2HJ9C 3PBQA 3UB8A 3P7NA 4EV4A 1CK3A 1E4DA 3BEBA 1KVMA 4X55A 2XA7S 5HWVA 4FCFA 4MBKA 3SZTA 1E3UD 3CPTA 3GTCA 4XT2A 1YLZA 2V2FF 3IXBA 2J9OA 3DTKA 4MN7A 3UPNA 5F6AA 3NC8A 5FI7A 1TS7A 5A92A 3FG8A 4UA9A 4Q8IA 1U60A 5F5YA 1YPRA 2WKEA 4E6WA 5KIZA 1PWDA 2ZC4B 2O9AA 4YFMA 2IWBA 1HZOA 3C7UA 1K25A 4PM6A 5G18A 4DXBA 4ESPA 3OPPA 3UDIA 3VE4A 5HAPA 1WYCA 2P7JA 4WMCD 3E98A 3ZG8B 5F1FA 3FPVA 3QP2A 5TBMA 1SCWA 1G5UA 3MZEA 3OLOA 3M6BA 1MWSA 3HLGA 4PM7A 5HPIA 4FH4A 1FCNA 3IF6A 5C5KA 3LGOA 1IKIA 1J3WA 4K91A 4JXSA 2V8FA 3MF0A 2QZ6A 3C4OA 4U3TA 2Z2LB 4QY5A 3CWFA 3EGDC 4KZ4A 1NZOA 4ZJ2A 3B3XA 5IS1A 3HVFA 1M40A 3E4PA 4JF4A 1KE3A 2XR0A 2W1TA 4E3NA 2PYRA 1MPLA 5CGXA 4EU0A 3NBLA 2Q9MA 4OOYA 3TSGA 1MXOA 4L9EA 1XGIA 4L9FA 1BLSA 3AGFA 3F1NB 2PHYA 1PWCA 4EBPA 2GNXA 3A0VA 3HJIA 1NJ4A 1YMXA 3BQAA 4FH2A 3UDXA 2EWWA 5DJTA 4ZRRA 2OV5A 1VEUB 2L4RA 4JXVA 3DW0A 4X56A 2VV6A 2OSUA 4IBRA 1MZUA 3MQ0A 4DDYA 2J3TD 1IYPA 4GW9A 1HVBA 3T50A 3H82B 1WE4A 5CHMA 3DTIA 3IXHA 4U0XA 2JBFA 4E3MA 1QMFA 1E3UA 1IYSA 1XA7A 1IYOA 4ARZB 1DJBA 1PZOA 3DTMA 2XFSA 4R0QA 3FZCA 3A3IA 3CMZA 3K3DA 3LFVA 4OQHA 4MBFA 5DFXA 5HWTA 3U4LP 3HL9A 2BG1A 3E0YA 4KUKA 1MBLA 1XFQA 2L0WA 5FQ9A 5G4YA 3T12B 1VQQA 4Z1WA 5HWWA 1MKIA 3IWIA 4WMCA 3D72A 3DTEA 5CTNA 3VP1A 2WGWA 3NDEA 5A91A 3BY9A 2JN7A 4E3KA 1NRFA 1L3LA 3IXDA 2Y59A 4DF6A 3QNCA 2V1BA 2Y4AA 3ITAA 2WK0A 3A3FA 4HJ3A 3O3VA 2XEPA 1PW1A 4MN6A 3HUOA 3CUEC 4QY6A 4BWIA 4OP5A 2VEAA 2QWSA 2W27A 1OTAA 2XF3A 1KGFA 3UE0A 1ERQA 1OTIA 2GX5A 4EW7A 2PU4A 4LRXC 2XDMA 4C6YA 1VETA 1RGZA 3VP0A 1UWPX 3ZHHA 5E2GA 4HJ6A 2AVXA 3Q7VA 5EUAA 4PM8A 3VP3A 3UY6A 4BBVA 5KSCA 4E04A 3V3RA 2V9AA 2V8CA 1BLHA 4DMZA 2C5WB 1K6RA 2K2NA 3OC2A 2B5RA 4F3LB 4LRYC 2V0UA 3PHYA 2ZC5B 3LEQA 2X01A 3EEAA 2PD7A 3S4XA 1BULA 4QD4A 3VFFA 1L0FA 4QHCA 4UQIS 1YLJA 2B18A 4HBTA 4WELA 2VGJA 3E4QA 3NOPC 1BZAA 4HOIA 4DN0A 4KZ9A 2H0TA 3LO7A 3VOYA 2V20A 3IX4A 3DBAA 4IBXA 2RL3A 1K4EA 4EQIA 2QPNA 2PRFA 2CMNA 2EWVA 4KQRA 5FEFA 3T1RA 3KYZA 2L1MA 5GHZA 4R3AA 3KX0X 1IKGA 4LV0A 1N9LA 5CGWA 3NHQA 4F94A 3KYQA 2Y91A 1BSGA 2W3FA 4GB7A 2ZC7A 5FAQA 3ZVWA 4ZJ3A 2ZOHA 4DDSA 4KQQA 4DE1A 2OWHA 3HLEA 3C5AA 5AQ7A 2Y2PA 3ZG0A 5CX7A 2A24B 1K54A 3S7QA 3SS4A 3NDGA 1W63M 1NZUA 5FAOA 1S66L 4OPZA 4GOGA 3WS4A 3S22A 4WF0A 3HLWA 4HQAA 1K0KA 3UB7A 4KZBA 1ES5A 3LIDA 3W8KA 4BBUA 5DF8A 2V1ZA 2EXAA 2DRWA 4DE3A 2FH5A 3N7WA 3LCEA 2ZC6B 3WS2A 2EXBA 3S7PA 1SKOB 2BLSA 4X25A 3LIBA 1V9YA 4Q0IA 2OLUA 1BYWA 3T1SA 3M2JA 3EWKA 1GA0A 1XPBA 2ZLYA 2XGNA 1GA9A 2Y2JA 1G6AA 3LY3A 3MKEA 4WYYA 4QB8A 3FYZA 1ALQA 2WZZA 3N8RA 3MZFA 3B33A 3BYDA 3PYPA 1XJ6A 5A90A 3ZGAB 4FSFA 3K3CA 5F1GA 3QP5A 1ZTUA 3R7WB 3ISGA 5M18A 3GRJA 1RCJA 1S4RA 2I9VA 3BY8A 4UA7A 4P0MA 3B47A 2Y2GA 5IU1A 4YOFA 3IH9A 1KVLA 4WL9A 3RH8B 2WUQA 5GLCA 2PBDP 4P6BA 3BW6A 3ULFA 2EA9A 3V50A 5HD5A 3UE3A 1JTGA 2KX6A 5KSHA 3MBZA 3TW8A 4UQIM 3LIAA 2ZMVA 1GSWA 3TRCA 2PYPA 2W3DA 2EX6A 4JXWA 4BQMA 1S1ZA 5M1AA 3IH8A 1KGGA 3NJAA 3VSLA 3N8LA 4Y7PA 1MC0A 4Y0UA 5A8BA 3ZCZA 1ACFA 3T4QA 1JNUA 4JKTA 5CTMA 3BFDA 2HDQA 2VJWA 4OONA 1NLYA 4O01A 1CI9A 4WEJA 1CEGA 5CRFA 3RFBA 1P9RA 3SW1A 4R38A 1OT9A 4E3IA 3D4FA 3LICA 5CEDA 5HFOA 4Y5FA 5AQBA 5FA7A 2WZXA 5EVIB 3GDIA 4AFIA 4EBNA 4KG2A 3G4PA 4I38A 4BL2A 4LV2A 2BTFP 4QJGA 3K2NA 3V39A 3QP1A 4EQ1A 4IJGA 2VLGA 2ZOIA 1NYMA 1ONHA 3SH7A 4BJPA 2XLNA 2XK1A 1F98A 5LBRA 2XRNA 4Q0HA 4MEZA 5HARA 4X1LA 3OPRA 3ITBA 3EGXC 3ZNTA 3PXPA 4RA7A 5DF9A 4JF5A 1FSYA 3PBSA 4NEED 2JE5A 5HL6A 1EROA 4Y2FA 1TS6A 2QJ5A 4S2JA 2ZD8A 4C3QA 4UA6A 3PBRA 3IX3A 2D01A 4CLCB 3IT9A 4MNRA 2YKHA 4WLAA 4WZ5A 1GCEA 4OOMA 1NRJA 2OOLA 1L0DA 1K6SA 4GS9A 2WAFA 3NI9A 5L10A 4X1MA 4OPRA 2HPBA 4JGPA 1XFNA 4MN5A 2HDSA 1X0OA 5G4ZA 5HZHA 1Q2PA 3IX8A 2HDRA 4R23A 4Q0JA 4O8GA 1C3BA 1GHIA 4E3LA 2IWCA 4G3VA 4G3KA 3F1PB 3BFCA 3LR0A 4S2KA 3UMEA 2O9CA 4ID4A 1IOUA 3VFHA 5EVLA 3CAXA 4DE0A 1LSVA 4II7A 3BFFA 1LL5A 1T18A 3PAGA 4S2PA 3ZYTA 2OAQ1 3ZQ5A 4I3AA 2ZQ9A 1S4SA 4O7DA 4HBUA 5DTSA 5TJJA 1VB6A 5GHYA 4WUJA 4S2NC 3T4TA 4N9LA 4PKYA 3AGDA 4UHUA 1FIKA 3LY4A 1PW8A 3MZDA 4JF6A 4JGRA 4PAUA 3WRTA 2V0WA 1WA9A 1OPXA 5HD3A 3F1OA 5DKKA 2VZWA 1W7FA 4GZBA 1LLBA 2HP9A 4BLMA 1NYYA 1TEMA 3NULA 4N92A 4IUKA 1OTEA 3IXGA 5TFQA 3IHBA 2OWJA 1JTDA 4R3BA 5F82A 3MQQA 2YKFA 3CPTB 4XT2B 5DTTA 4E3OA 3IQAA 4KUOA 2XH9A 4HP4A 4Y0OA 3IS2A 1BLPA 2R9XA 5FATA 3MMHA 2G7UA 3DWZA 2E8JA 3RXXA 5CGSA 4EXOA 3B42A 5GLAA 4DE2A 5EVEA 3Q7ZA 4G3WA 2J8YA 3N8SA 5AQAA 2H0YA 3HLBA 4EWFA 2CC1A 1YKDA 3Q81A 5TBMB 4OVDA 2JKTM 4KQOA 4YINA 4GCZA 3D9YA 3IF6B 3CJMA 2WKIA 2WKRA 4LPZA 1JWPA 2MJ6A 4WM9A 5HSQA 4OQ0A 3BLMA 4HH3A 5FI6A 3OPHA 2KOIA 4GHIA 1LSXA 3DAVA 2W1TB 4OOLA 3BFGA 3BJNA 3BWLA 1Z09A 2H5SA 3MQOA 5HDSA 5J4EA 1SDNA 3VE3A 4DKIA 3JVUA 3VP4A 3PTEA 2P08A 3UO9A 3ZFZA 2ZL1A 3UN7A 2WYXA 3G30A 1XX2A 2VK3A 4EEPA 2JKRM 1ONGA 4NXGA 4R4SA 1TF1A 4P6ZM 1MWTA 3IWOA 5KMWA 1G68A 3W4PA 3EQUA 3IBRA 1ZG6A 2Y55A 1F9IA 4GD6A 3G2ZA 4S2OA 5CECA 4E3JA 3A3JA 5FI2A 1IFQA 2VV7A 4UEYA 2JKTI 1CEFA 4EUVA 1H8MA 1Y4OA 1D7EA 3R4KA 4M3KA 2C6WB 3NIAA 4IHQA 2K31A 1T19A 3CUEA 2VGLM 4HNBA 4NG2A 3Q07A 1N9OA 2PD8A 2XD1A 4MDZA 4K0WA 3V5MA 5HL1A 4B88A 4LGWA 1XXMA 3G32A 5L8MA 3UE1A 4WEKA 3FV7A 1K57C 5D3OA 3QHYA 4GD8A 4S2LA 1N4OA 4BMWA 2ZMFA 3HCYA 5CHUA 4ZBEA 3A3EA 3MXQA 3SS5A 1YMSA 4Y3IA 2A2LA 1YLPA 2JKRI 1FCOA 1VM1A 5HPFA 5F83A 1H8ZA 4JGOA 5FQMA 4EEUA 5EM1A 2QYBA 5EVIC 2OAP1 2WAEA 1VETB 1CQAA 3H7WA 1I5QA 3BFEA 4LENA 1GSXA 1MWUA 3Q7VB 3D3OA 2D02A 3LR4A 4MLLA 2EX8A 3C8CA 4BBTA 1ZKJA 3HLDA 1K55C 2W0NA 4X68A 2FZ0A 4KQDA 1G28A 5FQKA 5A93A 1YAXA 2ZC3B 3CI6A 2Y2KA 1DJAA 1EW0A 4L0LA 1YSQA 5TGFA 4D60A 2ZQ7A 5DTKA 3VP2A 4CLCC 3P98A 1K56D 4JBFA 2P9VA 4HJ4A 4XXRA 3NOUC 1Y54A 4H6JA 3FPWA 2HDUA 5FASA 1DRMA 2Z6DA 1PRQA 2QKPA 2Z2MB 4BENA 1YM1A 4XUXA 3QP4A 3HBRA 5J3WA 1IELA 4RQ9A 2J3WA 4EUZA 2ZM2A 2WGVA 3RXWA 3WS0A 2PBYA 2UWXA 4ME4A 2QHKA 5DF7A 1XA1A 4PKYG 2HP5A 2O0YA 3T1QB 4WBGA 2DCFA 1OTDA 4E6XA 3RJUA 3GSGA 4FTXA 4R70A 4OLGA 3EEHA 3KSGA 3AGEA 1XJ3A 3OOVA 2HV1A 4PHTA 1TDGA 2J80A 1MKMA 1W79A 3KSHA 3A3DA 4P87A 5I94A 3GVBA 1I2SA 2E8IA 1S0WA 2O99A 2M7VA 3IWQA 4R6LA 5FDSA
chains in the Genus database with same CATH topology
1H8YA 4O7DA 4HBUA 5DTSA 4JPMA 1KGFA 3UE0A 2FFYA 4OLDA 4Z9QA 1ERQA 3ZG9B 1SKFA 5GHYA 4KENB 4HEFA 4KZ8A 2WKHA 2PU4A 2WGIA 2XDMA 4S2NC 5HAQA 4N9LA 4C6YA 5CEBA 3AGDA 1K57A 4UHUA 2A49A 3LY4A 1PW8A 1RGZA 3MZDA 3VP0A 5BOHA 5FDHA 2WADA 4JF6A 2ZM0A 4KZ3A 2ZQAA 3WRTA 3ZHHA 5E2GA 3O88A 1S6RA 3Q7VA 5EUAA 3WRZA 4PM8A 3VP3A 3UY6A 3P09A 1W7FA 4GNUA 1ZC2A 1ES4A 3VMAA 5KSCA 3V3RA 4GZBA 1LLBA 2JC7A 2HP9A 1TVFA 2X71A 4BLMA 1NYYA 1BLHA 5CERA 3V3SA 1TEMA 2C5WB 2QMIA 2VGKA 1K6RA 4N92A 3BM6A 3OC2A 5GHXA 3DWKA 4Y0TA 2B5RA 5FSRA 3IXGA 5TFQA 1PYYA 3IHBA 1NXYA 5HAIA 2ZC5B 5EVIA 3HREA 2X01A 1JTDA 4R3BA 5F82A 3C4PA 4JLFA 3SH9A 3S4XA 1J9MA 1BULA 1DY6A 1PI5A 3JYIA 4U0TA 5EPHA 1SHVA 2ZMAA 3GQZA 3TG9A 5DTTA 3BRMA 4QD4A 3SS3A 3VFFA 1L0FA 3M6HA 1RP5A 3G31A 1YLJA 2Y2LA 1RGYA 2XH9A 3IQAA 4QHCA 3GR2A 4Y0OA 1BLPA 3IF6C 4HBTA 3NY4A 4WELA 5EECA 2R9XA 2Y2MA 3BECA 1TDLA 4GN2A 2VGJA 4KZAA 3ZG7B 5FATA 4ZJ1A 3DWZA 4PPRA 1GHPA 1BZAA 3ZNYA 1Z6FA 2EX2A 1FR1A 3LEZA 3RXXA 1YQSA 1LHYA 4KZ9A 4ZAMA 2H0TA 3Q1FA 5CGSA 3LO7A 3VOYA 4ZTKA 5JYPA 4X69A 4IVIA 1PIOA 1N9BA 1M6KA 2J7VA 3HUNA 3N6IA 1KGEA 3G2YA 4GKUA 3WWXA 2V20A 1K55A 2XQZA 4QU3A 5E43A 4H8RA 4S2IA 5E2FA 5GLAA 1K38A 4DE2A 4IBXA 4K0XA 2RL3A 1K4EA 3Q7ZA 4EQIA 2QPNA 1XGJA 2J8YA 3N8SA 5GLDA 4PM5A 3ZG5A 5AQAA 2H0YA 3HLBA 3Q82A 4EWFA 3GMWA 4OPQA 2CC1A 2J9PA 4PMAA 4KQRA 1BTLA 2ZQ8A 3Q81A 1QMEA 4OVDA 5E2EA 4KQOA 4YINA 3OCNA 1O07A 4P85A 3IF6B 2GDNA 3CJMA 3VOZA 2WKIA 4LV3A 5JYOA 3I7JA 2P74A 4KZ7A 1JWPA 3S1YA 4CJNA 5GHZA 4JXGA 1IKGA 4LV0A 5CGWA 4WM9A 4F94A 4X6TA 3W4QA 4KZ6A 4OQ0A 4LCMA 2Y91A 3BLMA 1PZPA 3FKWA 3UDFA 1BSGA 4GB7A 2ZC7A 5KZHA 2Y2NA 5FAQA 3MFDA 3ZVWA 5FI6A 3OPHA 3MXSA 4ZJ3A 5AQ9A 1BUEA 2EX9A 4OOLA 1LL9A 5TR7A 4DDSA 1KE0A 3UPPA 5FAPA 1PWGA 3SOIA 4KQQA 2G2WA 5DVAA 3HLEA 4DE1A 4NK3A 3ZDJA 3BFGA 3C5AA 3E2LA 5AQ7A 2Y2PA 3ZG0A 2I72A 2H5SA 5EE8A 2ZQCA 3C7VA 4R1GA 1K54A 3SS4A 3NDGA 1NZUA 5FAOA 1SDNA 5U47A 2XFTA 4DRTA 4DKIA 4OPZA 1FR6A 4GOGA 1FCMA 2Y2OA 3VP4A 3WS4A 1DJCA 1ESUA 2XD5A 3IHAA 3PTEA 3S22A 3HLWA 5FQIA 3UO9A 3ZFZA 3UN7A 2WYXA 4KZBA 3G30A 1ES5A 1XP4A 1L0EA 1XX2A 1EWZA 2A3UA 1ESIA 3N4IA 4WZ5C 4GDNA 3W8KA 5DF8A 1ONGA 2V1ZA 2P9VB 2EXAA 2DRWA 1K56A 4R4SA 1H5XA 4DE3A 3N7WA 3LCEA 4R4RA 1MWTA 2ZC6B 3IWOA 1G68A 2EXBA 3WS2A 3O87A 3OPLA 3W4PA 5KMWA 4LV1A 3EQUA 2BLSA 1I2WA 4OH0A 4N1HA 5CHJA 2FFFB 4X53A 1EI5A 1LI9A 3PBNA 4OQIA 1ZG6A 2OLUA 2Y55A 4GD6A 3M2JA 1GA0A 3G2ZA 4S2OA 1XPBA 5CECA 2ZLYA 2XGNA 5EOOA 4E3JA 1GA9A 2Y2JA 1G6AA 3A3JA 1GHMA 5FI2A 4ZDXA 3LY3A 1CEFA 3MKEA 4UAAA 3PBTA 1BT5A 4QB8A 4NETA 3FYZA 1ALQA 4WYYA 2WZZA 3N8RA 4M3KA 3MKFA 3MZFA 2Q9NA 2C6WB 4DXCA 5M19A 3BYDA 3NIAA 1WYBA 3QNBA 3BLSA 4S2MA 1FQGA 4OPYA 4KZ5A 3TOIA 3ZGAB 4B4ZA 5A90A 1LI0A 4FSFA 5F1GA 3VSKA 1KDWA 4IVKA 4KG6A 4PM9A 2Y2IA 3Q07A 3ISGA 5M18A 3GRJA 1FSWA 1RCJA 3G35A 2PU2A 4OP8A 5CXWA 3PBQA 2XD1A 4UA7A 4P0MA 4EV4A 3CZDA 1CK3A 4CPKA 4N1XA 1E4DA 3BEBA 4K0WA 3V5MA 2Y2GA 5HL1A 1KVMA 2Y2QA 4X55A 3IH9A 4B88A 1KVLA 1XXMA 4S2NA 2WUQA 3G32A 4FCFA 5GLCA 3UE1A 4MBKA 4WEKA 1Q2QA 3EQVA 4P6BA 1E3UD 1ES3A 3FV7A 1K57C 3GTCA 1XKZA 5J8XA 5D3OA 3QHYA 3OCLA 1YLZA 2V2FF 3IXBA 3IF5A 4GD8A 4E3OA 2J9OA 1L0GA 3V50A 4S2LA 1E25A 3SH8A 1N4OA 4MBHA 4ZBEA 5CHUA 3UE3A 1JTGA 2ZM8A 3A3EA 4N9KA 5KSHA 3UPNA 3MBZA 3NC8A 5FI7A 3SS5A 5A92A 1JVJA 1ZG4A 1YMSA 1U60A 4UA9A 4Q8IA 2WKEA 4IEDA 4E6WA 2EX6A 5IHVA 4JXWA 1YLPA 4BQMA 1FCOA 1ES2A 5M1AA 3IH8A 1KGGA 1VM1A 1PWDA 2ZC4B 5F83A 3VSLA 4YFMA 3WS1A 2IWBA 3N8LA 1H8ZA 1HZOA 3C7UA 1K25A 3M2KA 1YT4A 4Y7PA 4PM6A 5FQMA 5G18A 4DXBA 3OPPA 3UDIA 4Y0UA 5HAPA 1CI8A 5GLBA 1WYCA 4B4XA 5HX9A 4WMCD 5EVIC 3ZCZA 3ZG8B 1YLWA 2WAEA 5F1FA 5FQQA 1I5QA 1SCWA 4JKTA 4BD1A 4FD8A 3MZEA 3BFEA 5CTMA 3OZHA 3M6BA 1MWSA 3BFDA 2HDQA 1MWRA 3HLGA 4LENA 4PM7A 4FH4A 1FCNA 3IF6A 1FOFA 2OLVA 1MWUA 4OONA 1IKIA 3CG5A 3Q7VB 1L2SA 1CI9A 4K91A 4JXSA 4WEJA 1CEGA 1KDSA 2QZ6A 3C4OA 4OKPA 2EFUA 4U3TA 2Z2LB 2DNSA 4BD0A 4QY5A 4KZ4A 5CRFA 4D2OA 1W5DA 4MLLA 1NZOA 4ZJ2A 2EX8A 3B3XA 1ZKJA 1ERMA 1YLYA 3HVFA 3D4FA 4E3IA 3HLDA 1M40A 4OQGA 4LCLA 4JF4A 1K55C 1KE3A 4X68A 2XR0A 4RYEA 5CEDA 4E3NA 5HFOA 5CGXA 1MPLA 3G34A 3NBLA 5AQBA 5FQKA 1W8QA 5FA7A 2WZXA 4BL3A 4C75A 5EVIB 4EBNA 2Q9MA 4OOYA 2ZC3B 4KG2A 3TSGA 1MXOA 1OMEA 3G4PA 2Y2KA 2HP6A 1DJAA 3GV9A 4BL2A 4LV2A 4QJGA 4L0LA 1XGIA 3HUMA 3V39A 1BLSA 3AGFA 4KG5A 5TGFA 3HLFA 1PWCA 2ZQ7A 3PBOA 4EBPA 5DTKA 4A5RA 3VP2A 1NYMA 1NJ4A 1YMXA 1ONHA 3E2KA 3SH7A 4BJPA 1PI4A 2XLNA 3P98A 2XK1A 4FH2A 3UDXA 3UNWA 1K56D 4JBFA 4MEZA 5HARA 2P9VA 4XXRA 2OV5A 4JXVA 3DW0A 4HESA 4X56A 5A93A 3W4OA 3OPRA 1Y54A 2OSUA 3ITBA 4IBRA 4DDYA 4RVAA 1IYPA 1BLCA 1HVBA 2HDUA 4RX3A 5FASA 3FKVA 1IYQA 1WE4A 3ZNTA 2Z2MB 5CHMA 1SDEA 2ZQDA 4RA7A 3IXHA 3NCKA 5DF9A 3UPOA 4JF5A 5GL9A 1FSYA 4U0XA 1O7EA 2JBFA 5EVID 4BENA 1YM1A 1QMFA 4E3MA 3PBSA 1E3UA 2IWDA 1AXBA 4XUXA 1IYSA 3HBRA 2JE5A 1XA7A 1IYOA 1IELA 1HD8A 1K54C 1DJBA 1EROA 2WGWB 4S2JA 2ZD8A 4C3QA 4UA6A 3PBRA 5EOEA 4EUZA 2JCHA 2ZM2A 2WGVA 3IT9A 1PZOA 3RXWA 3DTMA 2XFSA 4MNRA 4R0QA 3WS0A 4WZ5A 2X02A 2PBYA 3A3IA 3CMZA 1NY0A 2RCXA 3FZCA 2UWXA 1GCEA 4OOMA 3WS5A 4OQHA 4R3JA 1L0DA 4MBFA 5DF7A 1K6SA 4GDBA 1XA1A 2BG1A 3HL9A 2WAFA 3HLCA 2HP5A 3O86A 3NI9A 1MBLA 4WBGA 5FQ9A 2DCFA 1VQQA 3FWLA 4OPRA 4XUZA 1HTZA 4E6XA 2H10A 1W8YA 2HPBA 3RJUA 3GSGA 3MXRA 2HDSA 1MKIA 2Y2HA 3IWIA 4WMCA 5L2FA 1Q2PA 4OLGA 5CTNA 2HDRA 3VP1A 3AGEA 2R9WA 4R23A 2WGWA 3NDEA 5A91A 1JWVA 1IEMA 5E2HA 4E3KA 1NRFA 1C3BA 1MY8A 2EFXA 1TDGA 1GHIA 3IXDA 2Y59A 4E3LA 2G2UA 4DF6A 2IWCA 1W79A 3QNCA 2Y4AA 3ITAA 4WZ4A 2WK0A 4EBLA 3BFCA 1JWZA 1KE4A 3A3FA 3A3DA 3O3VA 4S2KA 4ID4A 4P87A 3VFHA 5EVLA 2XEPA 1PW1A 5FQJA 5I94A 1YLTA 3GVBA 3HUOA 5HW3A 4QY6A 4DE0A 4OP5A 1I2SA 2E8IA 3BFFA 3ZVTA 1K4FA 1S0WA 1LL5A 3PAGA 4S2PA 3PAEA 3IWQA 2ZJ9A 2XF3A 2ZQ9A 4RX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H8Y A;  4O7D A;  4HBU A;  5DTS A;  4JPM A;  1KGF A;  3UE0 A;  2FFY A;  4OLD A;  4Z9Q A;  1ERQ A;  3ZG9 B;  1SKF A;  5GHY A;  4KEN B;  4HEF A;  4KZ8 A;  2WKH A;  2PU4 A;  2WGI A;  2XDM A;  4S2N C;  5HAQ A;  4N9L A;  4C6Y A;  5CEB A;  3AGD A;  1K57 A;  4UHU A;  2A49 A;  3LY4 A;  1PW8 A;  1RGZ A;  3MZD A;  3VP0 A;  5BOH A;  5FDH A;  2WAD A;  4JF6 A;  2ZM0 A;  4KZ3 A;  2ZQA A;  3WRT A;  3ZHH A;  5E2G A;  3O88 A;  1S6R A;  3Q7V A;  5EUA A;  3WRZ A;  4PM8 A;  3VP3 A;  3UY6 A;  3P09 A;  1W7F A;  4GNU A;  1ZC2 A;  1ES4 A;  3VMA A;  5KSC A;  3V3R A;  4GZB A;  1LLB A;  2JC7 A;  2HP9 A;  1TVF A;  2X71 A;  4BLM A;  1NYY A;  1BLH A;  5CER A;  3V3S A;  1TEM A;  2C5W B;  2QMI A;  2VGK A;  1K6R A;  4N92 A;  3BM6 A;  3OC2 A;  5GHX A;  3DWK A;  4Y0T A;  2B5R A;  5FSR A;  3IXG A;  5TFQ A;  1PYY A;  3IHB A;  1NXY A;  5HAI A;  2ZC5 B;  5EVI A;  3HRE A;  2X01 A;  1JTD A;  4R3B A;  5F82 A;  3C4P A;  4JLF A;  3SH9 A;  3S4X A;  1J9M A;  1BUL A;  1DY6 A;  1PI5 A;  3JYI A;  4U0T A;  5EPH A;  1SHV A;  2ZMA A;  3GQZ A;  3TG9 A;  5DTT A;  3BRM A;  4QD4 A;  3SS3 A;  3VFF A;  1L0F A;  3M6H A;  1RP5 A;  3G31 A;  1YLJ A;  2Y2L A;  1RGY A;  2XH9 A;  3IQA A;  4QHC A;  3GR2 A;  4Y0O A;  1BLP A;  3IF6 C;  4HBT A;  3NY4 A;  4WEL A;  5EEC A;  2R9X A;  2Y2M A;  3BEC A;  1TDL A;  4GN2 A;  2VGJ A;  4KZA A;  3ZG7 B;  5FAT A;  4ZJ1 A;  3DWZ A;  4PPR A;  1GHP A;  1BZA A;  3ZNY A;  1Z6F A;  2EX2 A;  1FR1 A;  3LEZ A;  3RXX A;  1YQS A;  1LHY A;  4KZ9 A;  4ZAM A;  2H0T A;  3Q1F A;  5CGS A;  3LO7 A;  3VOY A;  4ZTK A;  5JYP A;  4X69 A;  4IVI A;  1PIO A;  1N9B A;  1M6K A;  2J7V A;  3HUN A;  3N6I A;  1KGE A;  3G2Y A;  4GKU A;  3WWX A;  2V20 A;  1K55 A;  2XQZ A;  4QU3 A;  5E43 A;  4H8R A;  4S2I A;  5E2F A;  5GLA A;  1K38 A;  4DE2 A;  4IBX A;  4K0X A;  2RL3 A;  1K4E A;  3Q7Z A;  4EQI A;  2QPN A;  1XGJ A;  2J8Y A;  3N8S A;  5GLD A;  4PM5 A;  3ZG5 A;  5AQA A;  2H0Y A;  3HLB A;  3Q82 A;  4EWF A;  3GMW A;  4OPQ A;  2CC1 A;  2J9P A;  4PMA A;  4KQR A;  1BTL A;  2ZQ8 A;  3Q81 A;  1QME A;  4OVD A;  5E2E A;  4KQO A;  4YIN A;  3OCN A;  1O07 A;  4P85 A;  3IF6 B;  2GDN A;  3CJM A;  3VOZ A;  2WKI A;  4LV3 A;  5JYO A;  3I7J A;  2P74 A;  4KZ7 A;  1JWP A;  3S1Y A;  4CJN A;  5GHZ A;  4JXG A;  1IKG A;  4LV0 A;  5CGW A;  4WM9 A;  4F94 A;  4X6T A;  3W4Q A;  4KZ6 A;  4OQ0 A;  4LCM A;  2Y91 A;  3BLM A;  1PZP A;  3FKW A;  3UDF A;  1BSG A;  4GB7 A;  2ZC7 A;  5KZH A;  2Y2N A;  5FAQ A;  3MFD A;  3ZVW A;  5FI6 A;  3OPH A;  3MXS A;  4ZJ3 A;  5AQ9 A;  1BUE A;  2EX9 A;  4OOL A;  1LL9 A;  5TR7 A;  4DDS A;  1KE0 A;  3UPP A;  5FAP A;  1PWG A;  3SOI A;  4KQQ A;  2G2W A;  5DVA A;  3HLE A;  4DE1 A;  4NK3 A;  3ZDJ A;  3BFG A;  3C5A A;  3E2L A;  5AQ7 A;  2Y2P A;  3ZG0 A;  2I72 A;  2H5S A;  5EE8 A;  2ZQC A;  3C7V A;  4R1G A;  1K54 A;  3SS4 A;  3NDG A;  1NZU A;  5FAO A;  1SDN A;  5U47 A;  2XFT A;  4DRT A;  4DKI A;  4OPZ A;  1FR6 A;  4GOG A;  1FCM A;  2Y2O A;  3VP4 A;  3WS4 A;  1DJC A;  1ESU A;  2XD5 A;  3IHA A;  3PTE A;  3S22 A;  3HLW A;  5FQI A;  3UO9 A;  3ZFZ A;  3UN7 A;  2WYX A;  4KZB A;  3G30 A;  1ES5 A;  1XP4 A;  1L0E A;  1XX2 A;  1EWZ A;  2A3U A;  1ESI A;  3N4I A;  4WZ5 C;  4GDN A;  3W8K A;  5DF8 A;  1ONG A;  2V1Z A;  2P9V B;  2EXA A;  2DRW A;  1K56 A;  4R4S A;  1H5X A;  4DE3 A;  3N7W A;  3LCE A;  4R4R A;  1MWT A;  2ZC6 B;  3IWO A;  1G68 A;  2EXB A;  3WS2 A;  3O87 A;  3OPL A;  3W4P A;  5KMW A;  4LV1 A;  3EQU A;  2BLS A;  1I2W A;  4OH0 A;  4N1H A;  5CHJ A;  2FFF B;  4X53 A;  1EI5 A;  1LI9 A;  3PBN A;  4OQI A;  1ZG6 A;  2OLU A;  2Y55 A;  4GD6 A;  3M2J A;  1GA0 A;  3G2Z A;  4S2O A;  1XPB A;  5CEC A;  2ZLY A;  2XGN A;  5EOO A;  4E3J A;  1GA9 A;  2Y2J A;  1G6A A;  3A3J A;  1GHM A;  5FI2 A;  4ZDX A;  3LY3 A;  1CEF A;  3MKE A;  4UAA A;  3PBT A;  1BT5 A;  4QB8 A;  4NET A;  3FYZ A;  1ALQ A;  4WYY A;  2WZZ A;  3N8R A;  4M3K A;  3MKF A;  3MZF A;  2Q9N A;  2C6W B;  4DXC A;  5M19 A;  3BYD A;  3NIA A;  1WYB A;  3QNB A;  3BLS A;  4S2M A;  1FQG A;  4OPY A;  4KZ5 A;  3TOI A;  3ZGA B;  4B4Z A;  5A90 A;  1LI0 A;  4FSF A;  5F1G A;  3VSK A;  1KDW A;  4IVK A;  4KG6 A;  4PM9 A;  2Y2I A;  3Q07 A;  3ISG A;  5M18 A;  3GRJ A;  1FSW A;  1RCJ A;  3G35 A;  2PU2 A;  4OP8 A;  5CXW A;  3PBQ A;  2XD1 A;  4UA7 A;  4P0M A;  4EV4 A;  3CZD A;  1CK3 A;  4CPK A;  4N1X A;  1E4D A;  3BEB A;  4K0W A;  3V5M A;  2Y2G A;  5HL1 A;  1KVM A;  2Y2Q A;  4X55 A;  3IH9 A;  4B88 A;  1KVL A;  1XXM A;  4S2N A;  2WUQ A;  3G32 A;  4FCF A;  5GLC A;  3UE1 A;  4MBK A;  4WEK A;  1Q2Q A;  3EQV A;  4P6B A;  1E3U D;  1ES3 A;  3FV7 A;  1K57 C;  3GTC A;  1XKZ A;  5J8X A;  5D3O A;  3QHY A;  3OCL A;  1YLZ A;  2V2F F;  3IXB A;  3IF5 A;  4GD8 A;  4E3O A;  2J9O A;  1L0G A;  3V50 A;  4S2L A;  1E25 A;  3SH8 A;  1N4O A;  4MBH A;  4ZBE A;  5CHU A;  3UE3 A;  1JTG A;  2ZM8 A;  3A3E A;  4N9K A;  5KSH A;  3UPN A;  3MBZ A;  3NC8 A;  5FI7 A;  3SS5 A;  5A92 A;  1JVJ A;  1ZG4 A;  1YMS A;  1U60 A;  4UA9 A;  4Q8I A;  2WKE A;  4IED A;  4E6W A;  2EX6 A;  5IHV A;  4JXW A;  1YLP A;  4BQM A;  1FCO A;  1ES2 A;  5M1A A;  3IH8 A;  1KGG A;  1VM1 A;  1PWD A;  2ZC4 B;  5F83 A;  3VSL A;  4YFM A;  3WS1 A;  2IWB A;  3N8L A;  1H8Z A;  1HZO A;  3C7U A;  1K25 A;  3M2K A;  1YT4 A;  4Y7P A;  4PM6 A;  5FQM A;  5G18 A;  4DXB A;  3OPP A;  3UDI A;  4Y0U A;  5HAP A;  1CI8 A;  5GLB A;  1WYC A;  4B4X A;  5HX9 A;  4WMC D;  5EVI C;  3ZCZ A;  3ZG8 B;  1YLW A;  2WAE A;  5F1F A;  5FQQ A;  1I5Q A;  1SCW A;  4JKT A;  4BD1 A;  4FD8 A;  3MZE A;  3BFE A;  5CTM A;  3OZH A;  3M6B A;  1MWS A;  3BFD A;  2HDQ A;  1MWR A;  3HLG A;  4LEN A;  4PM7 A;  4FH4 A;  1FCN A;  3IF6 A;  1FOF A;  2OLV A;  1MWU A;  4OON A;  1IKI A;  3CG5 A;  3Q7V B;  1L2S A;  1CI9 A;  4K91 A;  4JXS A;  4WEJ A;  1CEG A;  1KDS A;  2QZ6 A;  3C4O A;  4OKP A;  2EFU A;  4U3T A;  2Z2L B;  2DNS A;  4BD0 A;  4QY5 A;  4KZ4 A;  5CRF A;  4D2O A;  1W5D A;  4MLL A;  1NZO A;  4ZJ2 A;  2EX8 A;  3B3X A;  1ZKJ A;  1ERM A;  1YLY A;  3HVF A;  3D4F A;  4E3I A;  3HLD A;  1M40 A;  4OQG A;  4LCL A;  4JF4 A;  1K55 C;  1KE3 A;  4X68 A;  2XR0 A;  4RYE A;  5CED A;  4E3N A;  5HFO A;  5CGX A;  1MPL A;  3G34 A;  3NBL A;  5AQB A;  5FQK A;  1W8Q A;  5FA7 A;  2WZX A;  4BL3 A;  4C75 A;  5EVI B;  4EBN A;  2Q9M A;  4OOY A;  2ZC3 B;  4KG2 A;  3TSG A;  1MXO A;  1OME A;  3G4P A;  2Y2K A;  2HP6 A;  1DJA A;  3GV9 A;  4BL2 A;  4LV2 A;  4QJG A;  4L0L A;  1XGI A;  3HUM A;  3V39 A;  1BLS A;  3AGF A;  4KG5 A;  5TGF A;  3HLF A;  1PWC A;  2ZQ7 A;  3PBO A;  4EBP A;  5DTK A;  4A5R A;  3VP2 A;  1NYM A;  1NJ4 A;  1YMX A;  1ONH A;  3E2K A;  3SH7 A;  4BJP A;  1PI4 A;  2XLN A;  3P98 A;  2XK1 A;  4FH2 A;  3UDX A;  3UNW A;  1K56 D;  4JBF A;  4MEZ A;  5HAR A;  2P9V A;  4XXR A;  2OV5 A;  4JXV A;  3DW0 A;  4HES A;  4X56 A;  5A93 A;  3W4O A;  3OPR A;  1Y54 A;  2OSU A;  3ITB A;  4IBR A;  4DDY A;  4RVA A;  1IYP A;  1BLC A;  1HVB A;  2HDU A;  4RX3 A;  5FAS A;  3FKV A;  1IYQ A;  1WE4 A;  3ZNT A;  2Z2M B;  5CHM A;  1SDE A;  2ZQD A;  4RA7 A;  3IXH A;  3NCK A;  5DF9 A;  3UPO A;  4JF5 A;  5GL9 A;  1FSY A;  4U0X A;  1O7E A;  2JBF A;  5EVI D;  4BEN A;  1YM1 A;  1QMF A;  4E3M A;  3PBS A;  1E3U A;  2IWD A;  1AXB A;  4XUX A;  1IYS A;  3HBR A;  2JE5 A;  1XA7 A;  1IYO A;  1IEL A;  1HD8 A;  1K54 C;  1DJB A;  1ERO A;  2WGW B;  4S2J A;  2ZD8 A;  4C3Q A;  4UA6 A;  3PBR A;  5EOE A;  4EUZ A;  2JCH A;  2ZM2 A;  2WGV A;  3IT9 A;  1PZO A;  3RXW A;  3DTM A;  2XFS A;  4MNR A;  4R0Q A;  3WS0 A;  4WZ5 A;  2X02 A;  2PBY A;  3A3I A;  3CMZ A;  1NY0 A;  2RCX A;  3FZC A;  2UWX A;  1GCE A;  4OOM A;  3WS5 A;  4OQH A;  4R3J A;  1L0D A;  4MBF A;  5DF7 A;  1K6S A;  4GDB A;  1XA1 A;  2BG1 A;  3HL9 A;  2WAF A;  3HLC A;  2HP5 A;  3O86 A;  3NI9 A;  1MBL A;  4WBG A;  5FQ9 A;  2DCF A;  1VQQ A;  3FWL A;  4OPR A;  4XUZ A;  1HTZ A;  4E6X A;  2H10 A;  1W8Y A;  2HPB A;  3RJU A;  3GSG A;  3MXR A;  2HDS A;  1MKI A;  2Y2H A;  3IWI A;  4WMC A;  5L2F A;  1Q2P A;  4OLG A;  5CTN A;  2HDR A;  3VP1 A;  3AGE A;  2R9W A;  4R23 A;  2WGW A;  3NDE A;  5A91 A;  1JWV A;  1IEM A;  5E2H A;  4E3K A;  1NRF A;  1C3B A;  1MY8 A;  2EFX A;  1TDG A;  1GHI A;  3IXD A;  2Y59 A;  4E3L A;  2G2U A;  4DF6 A;  2IWC A;  1W79 A;  3QNC A;  2Y4A A;  3ITA A;  4WZ4 A;  2WK0 A;  4EBL A;  3BFC A;  1JWZ A;  1KE4 A;  3A3F A;  3A3D A;  3O3V A;  4S2K A;  4ID4 A;  4P87 A;  3VFH A;  5EVL A;  2XEP A;  1PW1 A;  5FQJ A;  5I94 A;  1YLT A;  3GVB A;  3HUO A;  5HW3 A;  4QY6 A;  4DE0 A;  4OP5 A;  1I2S A;  2E8I A;  3BFF A;  3ZVT A;  1K4F A;  1S0W A;  1LL5 A;  3PAG A;  4S2P A;  3PAE A;  3IWQ A;  2ZJ9 A;  2XF3 A;  2ZQ9 A;  4RX2 A; 
#chains in the Genus database with same CATH topology
 2FFY A;  4HEF A;  4KZ8 A;  1VHM A;  2WKH A;  2WGI A;  3T4K A;  5CEB A;  2A49 A;  4MCW A;  2WAD A;  2ZM0 A;  1KOU A;  4KZ3 A;  2ZQA A;  2GZA A;  3O88 A;  1S6R A;  3LR5 A;  3WRZ A;  1XJ4 A;  1ES4 A;  2H28 A;  2X71 A;  3C38 A;  2K7S A;  4QPR A;  1DP9 A;  1HLU P;  3UB5 P;  2VGK A;  3BM6 A;  2LB5 A;  3DWK A;  5AVE A;  2HZ5 A;  1OJG A;  1PYY A;  3GEC A;  1T1B A;  2VX8 A;  3C4P A;  1S1Y A;  3SH9 A;  1UGU A;  1DY6 A;  4U0T A;  3JYI A;  2WKP A;  5EPH A;  3SS3 A;  3BRM A;  1N9N A;  3F1N A;  3GR2 A;  3IF6 C;  3NY4 A;  2Y2M A;  3ZG7 B;  4ZJ1 A;  3ZNY A;  1Z6F A;  2B95 A;  2EX2 A;  1FR1 A;  3LEZ A;  1YQS A;  3EOI A;  2PR6 A;  3MR0 A;  4ZTK A;  5JYP A;  1VEU A;  2KDK A;  1PIO A;  1N9B A;  3HUN A;  3N6I A;  1KGE A;  3G2Y A;  3WWX A;  2JKF A;  2XQZ A;  4QU3 A;  5E2F A;  4S2I A;  4K0X A;  3H82 A;  5L07 A;  3C30 A;  1XGJ A;  3KYE A;  4PM5 A;  1NLZ A;  4OPQ A;  4PMA A;  1BTL A;  5MC7 A;  4LLO B;  5E2E A;  4ARZ A;  2P04 A;  2BAS A;  3HJK A;  1O07 A;  4P85 A;  2GDN A;  4LV3 A;  2P74 A;  4CJN A;  4X6T A;  3UMD A;  3W4Q A;  4LCM A;  3MFX A;  3FKW A;  3UDF A;  4P6Z S;  3T4S A;  4I39 A;  5KZH A;  2Y2N A;  3BQ8 A;  3A0S A;  3MXS A;  5AQ9 A;  1BUE A;  1LL9 A;  3TJZ C;  5TR7 A;  1KE0 A;  2W3G A;  1PWG A;  4NXE A;  1FIL A;  1OTB A;  3ZDJ A;  2I72 A;  1UWN X;  2ZQC A;  3C7V A;  3T4J A;  2XFT A;  4DRT A;  1FR6 A;  1FCM A;  1DJC A;  2XD5 A;  5FQI A;  1P0Z A;  3NEC A;  2VGL S;  1XP4 A;  1W63 Q;  4Y17 A;  2A3U A;  1ESI A;  2PAV P;  3N4I A;  4GDN A;  1ZHH B;  4LFU A;  2UV0 E;  3O87 A;  4LV1 A;  2HGV A;  4OH0 A;  2WKQ A;  4N1H A;  2FFF B;  4X53 A;  1EI5 A;  1LI9 A;  3PBN A;  4OQI A;  1ODV A;  1LT0 A;  5EOO A;  4ZDX A;  1GHM A;  4DJ3 A;  4EES A;  2W3H A;  3PBT A;  4WN5 A;  3G6O A;  1XJ2 A;  3MKF A;  2Q9N A;  4DXC A;  5AJG A;  5DJU A;  4MMN A;  4OPY A;  2DMW A;  4KZ5 A;  3TOI A;  4B4Z A;  1KDW A;  4KG6 A;  4GS9 B;  1FSW A;  2PU2 A;  4OP8 A;  5CXW A;  5EM0 A;  3MSH A;  3JPU A;  1D1J A;  4F3L A;  3CZD A;  4CPK A;  4N1X A;  3L9K A;  3TE8 A;  2Y2Q A;  3LR3 A;  4S2N A;  4HP9 A;  3ICY A;  4ETX A;  1Q2Q A;  3EQV A;  1ES3 A;  1XKZ A;  5J8X A;  3OCL A;  3IF5 A;  1L0G A;  1SZV A;  1E25 A;  3SH8 A;  4MBH A;  4CLC E;  5FEG A;  2ZM8 A;  4N9K A;  2Z6C A;  1JVJ A;  1ZG4 A;  4JGQ A;  4IED A;  5IHV A;  1ES2 A;  2J3T C;  3WS1 A;  4I3I A;  3M2K A;  1YT4 A;  1CI8 A;  5GLB A;  4B4X A;  4YWZ A;  5HX9 A;  3NOT C;  1YLW A;  2PR5 A;  2XA7 M;  5FQQ A;  4BD1 A;  4FD8 A;  1F5M A;  3OZH A;  1MWR A;  1TS0 A;  1FOF A;  2OLV A;  4NXB A;  3CG5 A;  1L2S A;  5F69 A;  4M4X A;  1KDS A;  3F1O B;  4OKP A;  2EFU A;  2DNS A;  4BD0 A;  4D2O A;  5K5B A;  4GLQ A;  1W5D A;  1ERM A;  2VV8 A;  1YLY A;  5DFY A;  4I3J A;  4OQG A;  4LCL A;  2JKG A;  4B9O A;  4RYE A;  4IUH A;  3G34 A;  4C75 A;  1W8Q A;  4BL3 A;  2B02 A;  1OME A;  1A0K A;  2HP6 A;  2A24 A;  3GV9 A;  3PR6 A;  3HUM A;  1LSW A;  3CHW P;  2W1R A;  4KG5 A;  3IS2 B;  3HLF A;  3W2Z A;  3PBO A;  3KSF A;  4A5R A;  3JVV A;  3E2K A;  1PI4 A;  3UNW A;  4FUW A;  3VOL A;  4QWO A;  3MJQ A;  1S67 L;  2GJ3 A;  4HES A;  3W4O A;  4HIA A;  4RVA A;  3LI9 A;  2ZBB A;  1BLC A;  4RX3 A;  5DKL A;  1SKO A;  1T1A A;  3FKV A;  1IYQ A;  2Y8H A;  1SDE A;  2ZQD A;  3NCK A;  1H3Q A;  3UPO A;  5GL9 A;  3U2A A;  1O7E A;  4B93 A;  5EVI D;  2IWD A;  1AXB A;  5EV0 A;  2R78 A;  1HD8 A;  1K54 C;  1CF0 A;  2WGW B;  2Q0O A;  1TD5 A;  5EOE A;  2JCH A;  4HH2 A;  2X02 A;  1NY0 A;  2RCX A;  1PNE A;  4NXF A;  3WS5 A;  4HHD A;  4R3J A;  3LYX A;  4GDB A;  3R7W A;  3HLC A;  1YSP A;  3O86 A;  1DP8 A;  3FWL A;  4GHI B;  4XUZ A;  1LL8 A;  3P01 A;  1HTZ A;  4HI4 A;  2H10 A;  1W8Y A;  3VV4 A;  3MXR A;  4CQH A;  1GSV A;  2Y2H A;  5L2F A;  2R9W A;  5F68 A;  3V67 A;  1JWV A;  1IEM A;  5E2H A;  1MY8 A;  2EFX A;  2ACG A;  3CLO A;  4L9G A;  2G2U A;  3A0R A;  4FOF A;  4WZ4 A;  3T4O A;  3OBF A;  1PFL A;  3KO6 A;  4EBL A;  1JWZ A;  4CLC D;  1KE4 A;  2JHE A;  2ZL1 B;  4HY8 A;  5FQJ A;  1YLT A;  5J7E A;  5HW3 A;  3UB9 A;  3ZVT A;  1K4F A;  3PAE A;  2ZJ9 A;  4RX2 A;  1H8Y A;  4JPM A;  4OLD A;  4Z9Q A;  3ZG9 B;  4O0P A;  1SKF A;  4KEN B;  1OT6 A;  5HAQ A;  3C2W A;  1K57 A;  4I5S A;  5BOH A;  5FDH A;  2XRO A;  3P09 A;  4GNU A;  5IT5 A;  1ZC2 A;  3VMA A;  2HF6 A;  1V9Z A;  2JC7 A;  1TVF A;  1F2K A;  4NKP A;  5CER A;  3V3S A;  2QMI A;  2M1C A;  5GHX A;  4Y0T A;  1T1C A;  5FSR A;  5HDD A;  1NXY A;  5HAI A;  5EVI A;  3HRE A;  2PDR A;  4JLF A;  1J9M A;  1PI5 A;  1SHV A;  2ZMA A;  3GQZ A;  2M7U A;  3TG9 A;  3M6H A;  1RP5 A;  3G31 A;  2Y2L A;  1RGY A;  4ETZ A;  3S7N A;  5EEC A;  3BEC A;  1TDL A;  4GN2 A;  4KZA A;  4PPR A;  1GHP A;  1LHY A;  4LRZ E;  4ZAM A;  3Q1F A;  4X69 A;  4IVI A;  1M6K A;  2J7V A;  4GKU A;  5AVF A;  1K55 A;  5E43 A;  4H8R A;  1K38 A;  1D06 A;  2QJ7 A;  4EER A;  1G6O A;  5GLD A;  3ZG5 A;  3Q82 A;  2W3E A;  3GMW A;  2J9P A;  3UB6 A;  2ZQ8 A;  3H7W B;  1QME A;  3L7H A;  5I5L A;  3OCN A;  3T1X A;  3VOZ A;  5JYO A;  3I7J A;  3O5Y A;  4KZ7 A;  3S1Y A;  4CLC A;  3H9W A;  4JXG A;  2VKS A;  2NUP C;  4KZ6 A;  4Y13 A;  1PZP A;  1NWZ A;  3MFD A;  2VA0 A;  3QP6 A;  4EET B;  3LIF A;  2O9B A;  3RTY A;  2EX9 A;  3UE6 A;  3UPP A;  5FAP A;  1P9W A;  3SOI A;  2G2W A;  5DVA A;  3IBJ A;  4NK3 A;  3E2L A;  3E4O A;  2NUT C;  1AWI A;  5EE8 A;  4R1G A;  5U47 A;  3S7O A;  5EFW A;  2Y2O A;  5HDC A;  1ESU A;  3IHA A;  3F1P A;  3QP8 A;  1H0M A;  2IA2 A;  2XSS A;  5FL3 A;  1L0E A;  1EWZ A;  4WZ5 C;  5L09 A;  4YNR A;  1TS8 A;  2P9V B;  1K56 A;  2INW A;  2KLI A;  3LI8 A;  1H5X A;  1OJ5 A;  4H6J B;  2Y79 A;  4R4R A;  3T4L A;  1DP6 A;  3OPL A;  3MS6 A;  1I2W A;  1Y28 A;  5CHJ A;  4GJ4 A;  1STZ A;  1P97 A;  4Y15 A;  4DJ2 A;  4UAA A;  4K08 A;  1BT5 A;  4NET A;  3CIT A;  3KSI A;  2PT7 A;  1CJF A;  3LIE A;  3FC7 A;  5M19 A;  1WYB A;  3QNB A;  3BLS A;  4S2M A;  1FQG A;  1LI0 A;  3VSK A;  2V1A A;  3LUQ A;  4IVK A;  4PM9 A;  2Y2I A;  2LB9 A;  2HJE A;  3G35 A;  2HJ9 C;  3PBQ A;  3UB8 A;  3P7N A;  4EV4 A;  1CK3 A;  1E4D A;  3BEB A;  1KVM A;  4X55 A;  2XA7 S;  5HWV A;  4FCF A;  4MBK A;  3SZT A;  1E3U D;  3CPT A;  3GTC A;  4XT2 A;  1YLZ A;  2V2F F;  3IXB A;  2J9O A;  3DTK A;  4MN7 A;  3UPN A;  5F6A A;  3NC8 A;  5FI7 A;  1TS7 A;  5A92 A;  3FG8 A;  4UA9 A;  4Q8I A;  1U60 A;  5F5Y A;  1YPR A;  2WKE A;  4E6W A;  5KIZ A;  1PWD A;  2ZC4 B;  2O9A A;  4YFM A;  2IWB A;  1HZO A;  3C7U A;  1K25 A;  4PM6 A;  5G18 A;  4DXB A;  4ESP A;  3OPP A;  3UDI A;  3VE4 A;  5HAP A;  1WYC A;  2P7J A;  4WMC D;  3E98 A;  3ZG8 B;  5F1F A;  3FPV A;  3QP2 A;  5TBM A;  1SCW A;  1G5U A;  3MZE A;  3OLO A;  3M6B A;  1MWS A;  3HLG A;  4PM7 A;  5HPI A;  4FH4 A;  1FCN A;  3IF6 A;  5C5K A;  3LGO A;  1IKI A;  1J3W A;  4K91 A;  4JXS A;  2V8F A;  3MF0 A;  2QZ6 A;  3C4O A;  4U3T A;  2Z2L B;  4QY5 A;  3CWF A;  3EGD C;  4KZ4 A;  1NZO A;  4ZJ2 A;  3B3X A;  5IS1 A;  3HVF A;  1M40 A;  3E4P A;  4JF4 A;  1KE3 A;  2XR0 A;  2W1T A;  4E3N A;  2PYR A;  1MPL A;  5CGX A;  4EU0 A;  3NBL A;  2Q9M A;  4OOY A;  3TSG A;  1MXO A;  4L9E A;  1XGI A;  4L9F A;  1BLS A;  3AGF A;  3F1N B;  2PHY A;  1PWC A;  4EBP A;  2GNX A;  3A0V A;  3HJI A;  1NJ4 A;  1YMX A;  3BQA A;  4FH2 A;  3UDX A;  2EWW A;  5DJT A;  4ZRR A;  2OV5 A;  1VEU B;  2L4R A;  4JXV A;  3DW0 A;  4X56 A;  2VV6 A;  2OSU A;  4IBR A;  1MZU A;  3MQ0 A;  4DDY A;  2J3T D;  1IYP A;  4GW9 A;  1HVB A;  3T50 A;  3H82 B;  1WE4 A;  5CHM A;  3DTI A;  3IXH A;  4U0X A;  2JBF A;  4E3M A;  1QMF A;  1E3U A;  1IYS A;  1XA7 A;  1IYO A;  4ARZ B;  1DJB A;  1PZO A;  3DTM A;  2XFS A;  4R0Q A;  3FZC A;  3A3I A;  3CMZ A;  3K3D A;  3LFV A;  4OQH A;  4MBF A;  5DFX A;  5HWT A;  3U4L P;  3HL9 A;  2BG1 A;  3E0Y A;  4KUK A;  1MBL A;  1XFQ A;  2L0W A;  5FQ9 A;  5G4Y A;  3T12 B;  1VQQ A;  4Z1W A;  5HWW A;  1MKI A;  3IWI A;  4WMC A;  3D72 A;  3DTE A;  5CTN A;  3VP1 A;  2WGW A;  3NDE A;  5A91 A;  3BY9 A;  2JN7 A;  4E3K A;  1NRF A;  1L3L A;  3IXD A;  2Y59 A;  4DF6 A;  3QNC A;  2V1B A;  2Y4A A;  3ITA A;  2WK0 A;  3A3F A;  4HJ3 A;  3O3V A;  2XEP A;  1PW1 A;  4MN6 A;  3HUO A;  3CUE C;  4QY6 A;  4BWI A;  4OP5 A;  2VEA A;  2QWS A;  2W27 A;  1OTA A;  2XF3 A;  1KGF A;  3UE0 A;  1ERQ A;  1OTI A;  2GX5 A;  4EW7 A;  2PU4 A;  4LRX C;  2XDM A;  4C6Y A;  1VET A;  1RGZ A;  3VP0 A;  1UWP X;  3ZHH A;  5E2G A;  4HJ6 A;  2AVX A;  3Q7V A;  5EUA A;  4PM8 A;  3VP3 A;  3UY6 A;  4BBV A;  5KSC A;  4E04 A;  3V3R A;  2V9A A;  2V8C A;  1BLH A;  4DMZ A;  2C5W B;  1K6R A;  2K2N A;  3OC2 A;  2B5R A;  4F3L B;  4LRY C;  2V0U A;  3PHY A;  2ZC5 B;  3LEQ A;  2X01 A;  3EEA A;  2PD7 A;  3S4X A;  1BUL A;  4QD4 A;  3VFF A;  1L0F A;  4QHC A;  4UQI S;  1YLJ A;  2B18 A;  4HBT A;  4WEL A;  2VGJ A;  3E4Q A;  3NOP C;  1BZA A;  4HOI A;  4DN0 A;  4KZ9 A;  2H0T A;  3LO7 A;  3VOY A;  2V20 A;  3IX4 A;  3DBA A;  4IBX A;  2RL3 A;  1K4E A;  4EQI A;  2QPN A;  2PRF A;  2CMN A;  2EWV A;  4KQR A;  5FEF A;  3T1R A;  3KYZ A;  2L1M A;  5GHZ A;  4R3A A;  3KX0 X;  1IKG A;  4LV0 A;  1N9L A;  5CGW A;  3NHQ A;  4F94 A;  3KYQ A;  2Y91 A;  1BSG A;  2W3F A;  4GB7 A;  2ZC7 A;  5FAQ A;  3ZVW A;  4ZJ3 A;  2ZOH A;  4DDS A;  4KQQ A;  4DE1 A;  2OWH A;  3HLE A;  3C5A A;  5AQ7 A;  2Y2P A;  3ZG0 A;  5CX7 A;  2A24 B;  1K54 A;  3S7Q A;  3SS4 A;  3NDG A;  1W63 M;  1NZU A;  5FAO A;  1S66 L;  4OPZ A;  4GOG A;  3WS4 A;  3S22 A;  4WF0 A;  3HLW A;  4HQA A;  1K0K A;  3UB7 A;  4KZB A;  1ES5 A;  3LID A;  3W8K A;  4BBU A;  5DF8 A;  2V1Z A;  2EXA A;  2DRW A;  4DE3 A;  2FH5 A;  3N7W A;  3LCE A;  2ZC6 B;  3WS2 A;  2EXB A;  3S7P A;  1SKO B;  2BLS A;  4X25 A;  3LIB A;  1V9Y A;  4Q0I A;  2OLU A;  1BYW A;  3T1S A;  3M2J A;  3EWK A;  1GA0 A;  1XPB A;  2ZLY A;  2XGN A;  1GA9 A;  2Y2J A;  1G6A A;  3LY3 A;  3MKE A;  4WYY A;  4QB8 A;  3FYZ A;  1ALQ A;  2WZZ A;  3N8R A;  3MZF A;  3B33 A;  3BYD A;  3PYP A;  1XJ6 A;  5A90 A;  3ZGA B;  4FSF A;  3K3C A;  5F1G A;  3QP5 A;  1ZTU A;  3R7W B;  3ISG A;  5M18 A;  3GRJ A;  1RCJ A;  1S4R A;  2I9V A;  3BY8 A;  4UA7 A;  4P0M A;  3B47 A;  2Y2G A;  5IU1 A;  4YOF A;  3IH9 A;  1KVL A;  4WL9 A;  3RH8 B;  2WUQ A;  5GLC A;  2PBD P;  4P6B A;  3BW6 A;  3ULF A;  2EA9 A;  3V50 A;  5HD5 A;  3UE3 A;  1JTG A;  2KX6 A;  5KSH A;  3MBZ A;  3TW8 A;  4UQI M;  3LIA A;  2ZMV A;  1GSW A;  3TRC A;  2PYP A;  2W3D A;  2EX6 A;  4JXW A;  4BQM A;  1S1Z A;  5M1A A;  3IH8 A;  1KGG A;  3NJA A;  3VSL A;  3N8L A;  4Y7P A;  1MC0 A;  4Y0U A;  5A8B A;  3ZCZ A;  1ACF A;  3T4Q A;  1JNU A;  4JKT A;  5CTM A;  3BFD A;  2HDQ A;  2VJW A;  4OON A;  1NLY A;  4O01 A;  1CI9 A;  4WEJ A;  1CEG A;  5CRF A;  3RFB A;  1P9R A;  3SW1 A;  4R38 A;  1OT9 A;  4E3I A;  3D4F A;  3LIC A;  5CED A;  5HFO A;  4Y5F A;  5AQB A;  5FA7 A;  2WZX A;  5EVI B;  3GDI A;  4AFI A;  4EBN A;  4KG2 A;  3G4P A;  4I38 A;  4BL2 A;  4LV2 A;  2BTF P;  4QJG A;  3K2N A;  3V39 A;  3QP1 A;  4EQ1 A;  4IJG A;  2VLG A;  2ZOI A;  1NYM A;  1ONH A;  3SH7 A;  4BJP A;  2XLN A;  2XK1 A;  1F98 A;  5LBR A;  2XRN A;  4Q0H A;  4MEZ A;  5HAR A;  4X1L A;  3OPR A;  3ITB A;  3EGX C;  3ZNT A;  3PXP A;  4RA7 A;  5DF9 A;  4JF5 A;  1FSY A;  3PBS A;  4NEE D;  2JE5 A;  5HL6 A;  1ERO A;  4Y2F A;  1TS6 A;  2QJ5 A;  4S2J A;  2ZD8 A;  4C3Q A;  4UA6 A;  3PBR A;  3IX3 A;  2D01 A;  4CLC B;  3IT9 A;  4MNR A;  2YKH A;  4WLA A;  4WZ5 A;  1GCE A;  4OOM A;  1NRJ A;  2OOL A;  1L0D A;  1K6S A;  4GS9 A;  2WAF A;  3NI9 A;  5L10 A;  4X1M A;  4OPR A;  2HPB A;  4JGP A;  1XFN A;  4MN5 A;  2HDS A;  1X0O A;  5G4Z A;  5HZH A;  1Q2P A;  3IX8 A;  2HDR A;  4R23 A;  4Q0J A;  4O8G A;  1C3B A;  1GHI A;  4E3L A;  2IWC A;  4G3V A;  4G3K A;  3F1P B;  3BFC A;  3LR0 A;  4S2K A;  3UME A;  2O9C A;  4ID4 A;  1IOU A;  3VFH A;  5EVL A;  3CAX A;  4DE0 A;  1LSV A;  4II7 A;  3BFF A;  1LL5 A;  1T18 A;  3PAG A;  4S2P A;  3ZYT A;  2OAQ 1;  3ZQ5 A;  4I3A A;  2ZQ9 A;  1S4S A;  4O7D A;  4HBU A;  5DTS A;  5TJJ A;  1VB6 A;  5GHY A;  4WUJ A;  4S2N C;  3T4T A;  4N9L A;  4PKY A;  3AGD A;  4UHU A;  1FIK A;  3LY4 A;  1PW8 A;  3MZD A;  4JF6 A;  4JGR A;  4PAU A;  3WRT A;  2V0W A;  1WA9 A;  1OPX A;  5HD3 A;  3F1O A;  5DKK A;  2VZW A;  1W7F A;  4GZB A;  1LLB A;  2HP9 A;  4BLM A;  1NYY A;  1TEM A;  3NUL A;  4N92 A;  4IUK A;  1OTE A;  3IXG A;  5TFQ A;  3IHB A;  2OWJ A;  1JTD A;  4R3B A;  5F82 A;  3MQQ A;  2YKF A;  3CPT B;  4XT2 B;  5DTT A;  4E3O A;  3IQA A;  4KUO A;  2XH9 A;  4HP4 A;  4Y0O A;  3IS2 A;  1BLP A;  2R9X A;  5FAT A;  3MMH A;  2G7U A;  3DWZ A;  2E8J A;  3RXX A;  5CGS A;  4EXO A;  3B42 A;  5GLA A;  4DE2 A;  5EVE A;  3Q7Z A;  4G3W A;  2J8Y A;  3N8S A;  5AQA A;  2H0Y A;  3HLB A;  4EWF A;  2CC1 A;  1YKD A;  3Q81 A;  5TBM B;  4OVD A;  2JKT M;  4KQO A;  4YIN A;  4GCZ A;  3D9Y A;  3IF6 B;  3CJM A;  2WKI A;  2WKR A;  4LPZ A;  1JWP A;  2MJ6 A;  4WM9 A;  5HSQ A;  4OQ0 A;  3BLM A;  4HH3 A;  5FI6 A;  3OPH A;  2KOI A;  4GHI A;  1LSX A;  3DAV A;  2W1T B;  4OOL A;  3BFG A;  3BJN A;  3BWL A;  1Z09 A;  2H5S A;  3MQO A;  5HDS A;  5J4E A;  1SDN A;  3VE3 A;  4DKI A;  3JVU A;  3VP4 A;  3PTE A;  2P08 A;  3UO9 A;  3ZFZ A;  2ZL1 A;  3UN7 A;  2WYX A;  3G30 A;  1XX2 A;  2VK3 A;  4EEP A;  2JKR M;  1ONG A;  4NXG A;  4R4S A;  1TF1 A;  4P6Z M;  1MWT A;  3IWO A;  5KMW A;  1G68 A;  3W4P A;  3EQU A;  3IBR A;  1ZG6 A;  2Y55 A;  1F9I A;  4GD6 A;  3G2Z A;  4S2O A;  5CEC A;  4E3J A;  3A3J A;  5FI2 A;  1IFQ A;  2VV7 A;  4UEY A;  2JKT I;  1CEF A;  4EUV A;  1H8M A;  1Y4O A;  1D7E A;  3R4K A;  4M3K A;  2C6W B;  3NIA A;  4IHQ A;  2K31 A;  1T19 A;  3CUE A;  2VGL M;  4HNB A;  4NG2 A;  3Q07 A;  1N9O A;  2PD8 A;  2XD1 A;  4MDZ A;  4K0W A;  3V5M A;  5HL1 A;  4B88 A;  4LGW A;  1XXM A;  3G32 A;  5L8M A;  3UE1 A;  4WEK A;  3FV7 A;  1K57 C;  5D3O A;  3QHY A;  4GD8 A;  4S2L A;  1N4O A;  4BMW A;  2ZMF A;  3HCY A;  5CHU A;  4ZBE A;  3A3E A;  3MXQ A;  3SS5 A;  1YMS A;  4Y3I A;  2A2L A;  1YLP A;  2JKR I;  1FCO A;  1VM1 A;  5HPF A;  5F83 A;  1H8Z A;  4JGO A;  5FQM A;  4EEU A;  5EM1 A;  2QYB A;  5EVI C;  2OAP 1;  2WAE A;  1VET B;  1CQA A;  3H7W A;  1I5Q A;  3BFE A;  4LEN A;  1GSX A;  1MWU A;  3Q7V B;  3D3O A;  2D02 A;  3LR4 A;  4MLL A;  2EX8 A;  3C8C A;  4BBT A;  1ZKJ A;  3HLD A;  1K55 C;  2W0N A;  4X68 A;  2FZ0 A;  4KQD A;  1G28 A;  5FQK A;  5A93 A;  1YAX A;  2ZC3 B;  3CI6 A;  2Y2K A;  1DJA A;  1EW0 A;  4L0L A;  1YSQ A;  5TGF A;  4D60 A;  2ZQ7 A;  5DTK A;  3VP2 A;  4CLC C;  3P98 A;  1K56 D;  4JBF A;  2P9V A;  4HJ4 A;  4XXR A;  3NOU C;  1Y54 A;  4H6J A;  3FPW A;  2HDU A;  5FAS A;  1DRM A;  2Z6D A;  1PRQ A;  2QKP A;  2Z2M B;  4BEN A;  1YM1 A;  4XUX A;  3QP4 A;  3HBR A;  5J3W A;  1IEL A;  4RQ9 A;  2J3W A;  4EUZ A;  2ZM2 A;  2WGV A;  3RXW A;  3WS0 A;  2PBY A;  2UWX A;  4ME4 A;  2QHK A;  5DF7 A;  1XA1 A;  4PKY G;  2HP5 A;  2O0Y A;  3T1Q B;  4WBG A;  2DCF A;  1OTD A;  4E6X A;  3RJU A;  3GSG A;  4FTX A;  4R70 A;  4OLG A;  3EEH A;  3KSG A;  3AGE A;  1XJ3 A;  3OOV A;  2HV1 A;  4PHT A;  1TDG A;  2J80 A;  1MKM A;  1W79 A;  3KSH A;  3A3D A;  4P87 A;  5I94 A;  3GVB A;  1I2S A;  2E8I A;  1S0W A;  2O99 A;  2M7V A;  3IWQ A;  4R6L A;  5FDS A; 
#chains in the Genus database with same CATH homology
 1H8Y A;  4O7D A;  4HBU A;  5DTS A;  4JPM A;  1KGF A;  3UE0 A;  2FFY A;  4OLD A;  4Z9Q A;  1ERQ A;  3ZG9 B;  1SKF A;  5GHY A;  4KEN B;  4HEF A;  4KZ8 A;  2WKH A;  2PU4 A;  2WGI A;  2XDM A;  4S2N C;  5HAQ A;  4N9L A;  4C6Y A;  5CEB A;  3AGD A;  1K57 A;  4UHU A;  2A49 A;  3LY4 A;  1PW8 A;  1RGZ A;  3MZD A;  3VP0 A;  5BOH A;  5FDH A;  2WAD A;  4JF6 A;  2ZM0 A;  4KZ3 A;  2ZQA A;  3WRT A;  3ZHH A;  5E2G A;  3O88 A;  1S6R A;  3Q7V A;  5EUA A;  3WRZ A;  4PM8 A;  3VP3 A;  3UY6 A;  3P09 A;  1W7F A;  4GNU A;  1ZC2 A;  1ES4 A;  3VMA A;  5KSC A;  3V3R A;  4GZB A;  1LLB A;  2JC7 A;  2HP9 A;  1TVF A;  2X71 A;  4BLM A;  1NYY A;  1BLH A;  5CER A;  3V3S A;  1TEM A;  2C5W B;  2QMI A;  2VGK A;  1K6R A;  4N92 A;  3BM6 A;  3OC2 A;  5GHX A;  3DWK A;  4Y0T A;  2B5R A;  5FSR A;  3IXG A;  5TFQ A;  1PYY A;  3IHB A;  1NXY A;  5HAI A;  2ZC5 B;  5EVI A;  3HRE A;  2X01 A;  1JTD A;  4R3B A;  5F82 A;  3C4P A;  4JLF A;  3SH9 A;  3S4X A;  1J9M A;  1BUL A;  1DY6 A;  1PI5 A;  3JYI A;  4U0T A;  5EPH A;  1SHV A;  2ZMA A;  3GQZ A;  3TG9 A;  5DTT A;  3BRM A;  4QD4 A;  3SS3 A;  3VFF A;  1L0F A;  3M6H A;  1RP5 A;  3G31 A;  1YLJ A;  2Y2L A;  1RGY A;  2XH9 A;  3IQA A;  4QHC A;  3GR2 A;  4Y0O A;  1BLP A;  3IF6 C;  4HBT A;  3NY4 A;  4WEL A;  5EEC A;  2R9X A;  2Y2M A;  3BEC A;  1TDL A;  4GN2 A;  2VGJ A;  4KZA A;  3ZG7 B;  5FAT A;  4ZJ1 A;  3DWZ A;  4PPR A;  1GHP A;  1BZA A;  3ZNY A;  1Z6F A;  2EX2 A;  1FR1 A;  3LEZ A;  3RXX A;  1YQS A;  1LHY A;  4KZ9 A;  4ZAM A;  2H0T A;  3Q1F A;  5CGS A;  3LO7 A;  3VOY A;  4ZTK A;  5JYP A;  4X69 A;  4IVI A;  1PIO A;  1N9B A;  1M6K A;  2J7V A;  3HUN A;  3N6I A;  1KGE A;  3G2Y A;  4GKU A;  3WWX A;  2V20 A;  1K55 A;  2XQZ A;  4QU3 A;  5E43 A;  4H8R A;  4S2I A;  5E2F A;  5GLA A;  1K38 A;  4DE2 A;  4IBX A;  4K0X A;  2RL3 A;  1K4E A;  3Q7Z A;  4EQI A;  2QPN A;  1XGJ A;  2J8Y A;  3N8S A;  5GLD A;  4PM5 A;  3ZG5 A;  5AQA A;  2H0Y A;  3HLB A;  3Q82 A;  4EWF A;  3GMW A;  4OPQ A;  2CC1 A;  2J9P A;  4PMA A;  4KQR A;  1BTL A;  2ZQ8 A;  3Q81 A;  1QME A;  4OVD A;  5E2E A;  4KQO A;  4YIN A;  3OCN A;  1O07 A;  4P85 A;  3IF6 B;  2GDN A;  3CJM A;  3VOZ A;  2WKI A;  4LV3 A;  5JYO A;  3I7J A;  2P74 A;  4KZ7 A;  1JWP A;  3S1Y A;  4CJN A;  5GHZ A;  4JXG A;  1IKG A;  4LV0 A;  5CGW A;  4WM9 A;  4F94 A;  4X6T A;  3W4Q A;  4KZ6 A;  4OQ0 A;  4LCM A;  2Y91 A;  3BLM A;  1PZP A;  3FKW A;  3UDF A;  1BSG A;  4GB7 A;  2ZC7 A;  5KZH A;  2Y2N A;  5FAQ A;  3MFD A;  3ZVW A;  5FI6 A;  3OPH A;  3MXS A;  4ZJ3 A;  5AQ9 A;  1BUE A;  2EX9 A;  4OOL A;  1LL9 A;  5TR7 A;  4DDS A;  1KE0 A;  3UPP A;  5FAP A;  1PWG A;  3SOI A;  4KQQ A;  2G2W A;  5DVA A;  3HLE A;  4DE1 A;  4NK3 A;  3ZDJ A;  3BFG A;  3C5A A;  3E2L A;  5AQ7 A;  2Y2P A;  3ZG0 A;  2I72 A;  2H5S A;  5EE8 A;  2ZQC A;  3C7V A;  4R1G A;  1K54 A;  3SS4 A;  3NDG A;  1NZU A;  5FAO A;  1SDN A;  5U47 A;  2XFT A;  4DRT A;  4DKI A;  4OPZ A;  1FR6 A;  4GOG A;  1FCM A;  2Y2O A;  3VP4 A;  3WS4 A;  1DJC A;  1ESU A;  2XD5 A;  3IHA A;  3PTE A;  3S22 A;  3HLW A;  5FQI A;  3UO9 A;  3ZFZ A;  3UN7 A;  2WYX A;  4KZB A;  3G30 A;  1ES5 A;  1XP4 A;  1L0E A;  1XX2 A;  1EWZ A;  2A3U A;  1ESI A;  3N4I A;  4WZ5 C;  4GDN A;  3W8K A;  5DF8 A;  1ONG A;  2V1Z A;  2P9V B;  2EXA A;  2DRW A;  1K56 A;  4R4S A;  1H5X A;  4DE3 A;  3N7W A;  3LCE A;  4R4R A;  1MWT A;  2ZC6 B;  3IWO A;  1G68 A;  2EXB A;  3WS2 A;  3O87 A;  3OPL A;  3W4P A;  5KMW A;  4LV1 A;  3EQU A;  2BLS A;  1I2W A;  4OH0 A;  4N1H A;  5CHJ A;  2FFF B;  4X53 A;  1EI5 A;  1LI9 A;  3PBN A;  4OQI A;  1ZG6 A;  2OLU A;  2Y55 A;  4GD6 A;  3M2J A;  1GA0 A;  3G2Z A;  4S2O A;  1XPB A;  5CEC A;  2ZLY A;  2XGN A;  5EOO A;  4E3J A;  1GA9 A;  2Y2J A;  1G6A A;  3A3J A;  1GHM A;  5FI2 A;  4ZDX A;  3LY3 A;  1CEF A;  3MKE A;  4UAA A;  3PBT A;  1BT5 A;  4QB8 A;  4NET A;  3FYZ A;  1ALQ A;  4WYY A;  2WZZ A;  3N8R A;  4M3K A;  3MKF A;  3MZF A;  2Q9N A;  2C6W B;  4DXC A;  5M19 A;  3BYD A;  3NIA A;  1WYB A;  3QNB A;  3BLS A;  4S2M A;  1FQG A;  4OPY A;  4KZ5 A;  3TOI A;  3ZGA B;  4B4Z A;  5A90 A;  1LI0 A;  4FSF A;  5F1G A;  3VSK A;  1KDW A;  4IVK A;  4KG6 A;  4PM9 A;  2Y2I A;  3Q07 A;  3ISG A;  5M18 A;  3GRJ A;  1FSW A;  1RCJ A;  3G35 A;  2PU2 A;  4OP8 A;  5CXW A;  3PBQ A;  2XD1 A;  4UA7 A;  4P0M A;  4EV4 A;  3CZD A;  1CK3 A;  4CPK A;  4N1X A;  1E4D A;  3BEB A;  4K0W A;  3V5M A;  2Y2G A;  5HL1 A;  1KVM A;  2Y2Q A;  4X55 A;  3IH9 A;  4B88 A;  1KVL A;  1XXM A;  4S2N A;  2WUQ A;  3G32 A;  4FCF A;  5GLC A;  3UE1 A;  4MBK A;  4WEK A;  1Q2Q A;  3EQV A;  4P6B A;  1E3U D;  1ES3 A;  3FV7 A;  1K57 C;  3GTC A;  1XKZ A;  5J8X A;  5D3O A;  3QHY A;  3OCL A;  1YLZ A;  2V2F F;  3IXB A;  3IF5 A;  4GD8 A;  4E3O A;  2J9O A;  1L0G A;  3V50 A;  4S2L A;  1E25 A;  3SH8 A;  1N4O A;  4MBH A;  4ZBE A;  5CHU A;  3UE3 A;  1JTG A;  2ZM8 A;  3A3E A;  4N9K A;  5KSH A;  3UPN A;  3MBZ A;  3NC8 A;  5FI7 A;  3SS5 A;  5A92 A;  1JVJ A;  1ZG4 A;  1YMS A;  1U60 A;  4UA9 A;  4Q8I A;  2WKE A;  4IED A;  4E6W A;  2EX6 A;  5IHV A;  4JXW A;  1YLP A;  4BQM A;  1FCO A;  1ES2 A;  5M1A A;  3IH8 A;  1KGG A;  1VM1 A;  1PWD A;  2ZC4 B;  5F83 A;  3VSL A;  4YFM A;  3WS1 A;  2IWB A;  3N8L A;  1H8Z A;  1HZO A;  3C7U A;  1K25 A;  3M2K A;  1YT4 A;  4Y7P A;  4PM6 A;  5FQM A;  5G18 A;  4DXB A;  3OPP A;  3UDI A;  4Y0U A;  5HAP A;  1CI8 A;  5GLB A;  1WYC A;  4B4X A;  5HX9 A;  4WMC D;  5EVI C;  3ZCZ A;  3ZG8 B;  1YLW A;  2WAE A;  5F1F A;  5FQQ A;  1I5Q A;  1SCW A;  4JKT A;  4BD1 A;  4FD8 A;  3MZE A;  3BFE A;  5CTM A;  3OZH A;  3M6B A;  1MWS A;  3BFD A;  2HDQ A;  1MWR A;  3HLG A;  4LEN A;  4PM7 A;  4FH4 A;  1FCN A;  3IF6 A;  1FOF A;  2OLV A;  1MWU A;  4OON A;  1IKI A;  3CG5 A;  3Q7V B;  1L2S A;  1CI9 A;  4K91 A;  4JXS A;  4WEJ A;  1CEG A;  1KDS A;  2QZ6 A;  3C4O A;  4OKP A;  2EFU A;  4U3T A;  2Z2L B;  2DNS A;  4BD0 A;  4QY5 A;  4KZ4 A;  5CRF A;  4D2O A;  1W5D A;  4MLL A;  1NZO A;  4ZJ2 A;  2EX8 A;  3B3X A;  1ZKJ A;  1ERM A;  1YLY A;  3HVF A;  3D4F A;  4E3I A;  3HLD A;  1M40 A;  4OQG A;  4LCL A;  4JF4 A;  1K55 C;  1KE3 A;  4X68 A;  2XR0 A;  4RYE A;  5CED A;  4E3N A;  5HFO A;  5CGX A;  1MPL A;  3G34 A;  3NBL A;  5AQB A;  5FQK A;  1W8Q A;  5FA7 A;  2WZX A;  4BL3 A;  4C75 A;  5EVI B;  4EBN A;  2Q9M A;  4OOY A;  2ZC3 B;  4KG2 A;  3TSG A;  1MXO A;  1OME A;  3G4P A;  2Y2K A;  2HP6 A;  1DJA A;  3GV9 A;  4BL2 A;  4LV2 A;  4QJG A;  4L0L A;  1XGI A;  3HUM A;  3V39 A;  1BLS A;  3AGF A;  4KG5 A;  5TGF A;  3HLF A;  1PWC A;  2ZQ7 A;  3PBO A;  4EBP A;  5DTK A;  4A5R A;  3VP2 A;  1NYM A;  1NJ4 A;  1YMX A;  1ONH A;  3E2K A;  3SH7 A;  4BJP A;  1PI4 A;  2XLN A;  3P98 A;  2XK1 A;  4FH2 A;  3UDX A;  3UNW A;  1K56 D;  4JBF A;  4MEZ A;  5HAR A;  2P9V A;  4XXR A;  2OV5 A;  4JXV A;  3DW0 A;  4HES A;  4X56 A;  5A93 A;  3W4O A;  3OPR A;  1Y54 A;  2OSU A;  3ITB A;  4IBR A;  4DDY A;  4RVA A;  1IYP A;  1BLC A;  1HVB A;  2HDU A;  4RX3 A;  5FAS A;  3FKV A;  1IYQ A;  1WE4 A;  3ZNT A;  2Z2M B;  5CHM A;  1SDE A;  2ZQD A;  4RA7 A;  3IXH A;  3NCK A;  5DF9 A;  3UPO A;  4JF5 A;  5GL9 A;  1FSY A;  4U0X A;  1O7E A;  2JBF A;  5EVI D;  4BEN A;  1YM1 A;  1QMF A;  4E3M A;  3PBS A;  1E3U A;  2IWD A;  1AXB A;  4XUX A;  1IYS A;  3HBR A;  2JE5 A;  1XA7 A;  1IYO A;  1IEL A;  1HD8 A;  1K54 C;  1DJB A;  1ERO A;  2WGW B;  4S2J A;  2ZD8 A;  4C3Q A;  4UA6 A;  3PBR A;  5EOE A;  4EUZ A;  2JCH A;  2ZM2 A;  2WGV A;  3IT9 A;  1PZO A;  3RXW A;  3DTM A;  2XFS A;  4MNR A;  4R0Q A;  3WS0 A;  4WZ5 A;  2X02 A;  2PBY A;  3A3I A;  3CMZ A;  1NY0 A;  2RCX A;  3FZC A;  2UWX A;  1GCE A;  4OOM A;  3WS5 A;  4OQH A;  4R3J A;  1L0D A;  4MBF A;  5DF7 A;  1K6S A;  4GDB A;  1XA1 A;  2BG1 A;  3HL9 A;  2WAF A;  3HLC A;  2HP5 A;  3O86 A;  3NI9 A;  1MBL A;  4WBG A;  5FQ9 A;  2DCF A;  1VQQ A;  3FWL A;  4OPR A;  4XUZ A;  1HTZ A;  4E6X A;  2H10 A;  1W8Y A;  2HPB A;  3RJU A;  3GSG A;  3MXR A;  2HDS A;  1MKI A;  2Y2H A;  3IWI A;  4WMC A;  5L2F A;  1Q2P A;  4OLG A;  5CTN A;  2HDR A;  3VP1 A;  3AGE A;  2R9W A;  4R23 A;  2WGW A;  3NDE A;  5A91 A;  1JWV A;  1IEM A;  5E2H A;  4E3K A;  1NRF A;  1C3B A;  1MY8 A;  2EFX A;  1TDG A;  1GHI A;  3IXD A;  2Y59 A;  4E3L A;  2G2U A;  4DF6 A;  2IWC A;  1W79 A;  3QNC A;  2Y4A A;  3ITA A;  4WZ4 A;  2WK0 A;  4EBL A;  3BFC A;  1JWZ A;  1KE4 A;  3A3F A;  3A3D A;  3O3V A;  4S2K A;  4ID4 A;  4P87 A;  3VFH A;  5EVL A;  2XEP A;  1PW1 A;  5FQJ A;  5I94 A;  1YLT A;  3GVB A;  3HUO A;  5HW3 A;  4QY6 A;  4DE0 A;  4OP5 A;  1I2S A;  2E8I A;  3BFF A;  3ZVT A;  1K4F A;  1S0W A;  1LL5 A;  3PAG A;  4S2P A;  3PAE A;  3IWQ A;  2ZJ9 A;  2XF3 A;  2ZQ9 A;  4RX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...