2WK7A

Structure of apo form of vibrio cholerae cqsa
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
386
structure length
386
Chain Sequence
PQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into the Biosynthesis of the Vibrio Cholerae Major Autoinducer Cai-1 from the Crystal Structure of the Plp-Dependent Enzyme Cqsa.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
molecule keywords CAI-1 AUTOINDUCER SYNTHASE
total genus 136
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.3.-.-:
pdb deposition date 2009-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2wk7A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2wk7A01
3FFRA 1AICA 3LVJA 3FQAA 3MAUA 4F5GA 1C9CA 2CH2A 4RKCA 3HT4A 3BS8A 3QM2A 4J5UA 1AAMA 3FDBA 3ZRRA 1O62A 2NMPA 1MDXA 1W7MA 1FG7A 2DR1A 4WBTA 1ZC9A 3FZ8A 3MAFA 3GR9A 2YRIA 2VMOA 1QZ9A 3NX3A 5G4IA 1XEYA 3AOWA 1OXOA 1AY8A 1PMMA 4WYGA 3VOMA 4E1OA 1BJWA 2WK8A 2TPLA 3FTBA 4GE7A 4JF0A 1AJSA 1WYUB 1V2FA 2VI8A 4U1TA 1M0PA 4ZASA 3R4TA 1W3UA 2YRRA 1S09A 3OP7A 3GETA 1B4XA 2AY3A 3TFTA 2VMUA 1I41A 4KYOA 3TQXA 1DTYA 3TATA 2CTZA 1ASAA 4ZDLA 1AMRA 3AEJC 1D7VA 2DKJA 4WYAA 4MY5A 4A0GA 4UHOA 1PG8A 3DXWA 2Z9XA 2BYJA 4MSOA 2Z61A 3E77A 1DFOA 4ZLVA 1P3WA 3GZDA 1I43A 3N5MA 4R5ZA 3CQ6A 1SZKA 5M49A 1XI9A 4RJ0A 5EUNA 2Z1ZA 4LC3A 1AHEA 2W7DA 3JTXA 5E4ZA 5FT8A 1LKCA 1TPLA 3R9AA 1BJNA 1T3IA 2WKAA 1TATA 3EUCA 1YIYA 3NYSA 3DYDA 3QN6A 4WYEA 3E6GA 4UHNA 1AKBA 1QJ3A 3AEMC 1GEXA 2Z1YA 4ZAHA 4CBRA 3MC6C 5EUEA 2OATA 1WYVB 3FKDA 3N75A 4RLGA 4ZSYA 1X2AA 4JEZA 2FNIA 1H0CA 3E2ZA 4WXGA 2ZUKA 2OKJA 4WP0A 2BI9A 3TFUA 4AOAA 1N8PA 1S07A 2C44A 1AKCA 2WK9A 1PFFA 2YKUA 3FZ7A 3KGXA 4BA5A 4ATPA 2WK7A 3VK2A 1ARSA 1V2EA 4RJYA 1DJUA 2BI1A 3PDBA 5BJ3A 1B9HA 7AATA 2F8JA 1BJ4A 1WKGA 3NU7A 2ZP7A 3FRKA 4AO9A 2AY4A 3L44A 3RUYA 4WXBA 3AV7A 3EI7A 1X28A 3EIAA 1W7LA 3B1EA 1YAAA 1AHXA 1ELQA 2FNUA 1ORDA 4A6UA 1O61A 3HL2A 4AO4A 1B5OA 2Z9UA 2HZPA 1ASGA 4EMYA 1WYUA 3CAIA 3FQ7A 1IVRA 2DGMA 2JISA 3BWNC 5FT6A 5LH9A 2C7TA 2VLFA 1KKJA 2G6WA 1M0QA 1SVVA 2BHXA 3ELPA 4DGTA 3PPLA 2OQXA 1MAQA 2VGZA 3DXVA 3KGWA 4W1XA 4XJPA 1AIAA 2W7IA 5M4DA 1WSTA 2FYFA 2OKKA 5F9SA 1C7NA 3AENA 4AZJA 1BT4A 1DKAA 2AATA 3W1HA 2GMUA 3LVLB 3IHJA 8AATA 2EZ1A 1N2TA 1FC4A 2PB2A 2XBNA 2BI2A 4MQRA 4ZWMA 1S06A 1AMQA 4WB0A 3TCMA 1ARIA 1CS1A 2YKXA 2JJEA 3DODA 1IBJA 4F5HA 2E54A 1AHFA 3ZZJA 3PAAA 3BCBA 4N0BA 4CXQA 3NNKA 2ZY2A 2D7ZA 3HQTA 1PMOA 1ZOBA 4XJOA 4ADDA 1JS3A 1TARA 2VIBA 1ARTA 4GDYA 1Z3ZA 4ZDOA 1Z7DA 1QITA 1GBNA 2W8VA 3LWSA 2ZY4A 4Y0IA 3QPGA 4N0WA 3RCHB 4K2BA 2CB1A 3RQ1A 4F5JA 1ZODA 1CQ6A 4MGRA 2VMVA 1S0AA 3AEOA 3BCXA 1WYTA 3BV0A 2W7HA 4TV7A 2YCTA 1EJIA 4XK1A 5EIGA 3ASAA 2VMQA 4OCAA 3I4JA 3B46A 2R5EA 2W7KA 3I5TA 2VMWA 1EG5A 1RV3A 4NOGA 3QBOA 1IX6A 1UKJA 1WKHA 2HUFA 5EAVA 1WYVA 5EAAA 3JZLA 4KXKA 1LC7A 2BIEA 4CBSA 3DR7A 4H51A 4K2IA 4KAMA 2VGSA 4LNMA 3PD6A 3HDOA 2AY6A 3MEBA 2CJGA 2W8WA 3QHXA 2W7MA 1M4NA 3K7YA 4B9BA 5FT4A 2PB0A 1QGNA 3USFA 4UQVA 1GDEA 2QBTA 2X3LA 1OXPA 3K40A 4Y0HA 5J8QA 2ZSMA 1JF9A 3EI6A 3LVKA 2YHKA 3QGUA 4OBVA 2VGVA 1M6SA 1B8GA 1KKPA 1X0MA 5D95A 1JG8A 1TOGA 1IAXA 4EB5A 2E7UA 1FG3A 3FCRA 2Z9WA 1BJOB 2YKYA 2C0RA 1E5EA 3E9KA 4UOYA 4XEWA 4A0RA 1AMSA 1TASA 2AY7A 1MAPA 2W7LA 3HVYA 5DJ1A 4P3MA 2HOZA 4HF8A 3OKSA 2GSAA 3EZSA 4A6TA 4DQ6A 1UU0A 1H1CA 2VLHA 4Q76A 3F0HA 1QISA 4K2MA 3RBLA 1N31A 4CVQA 4LNJA 1MGVA 4ZM3A 2HOXA 1MLZA 4GSAA 2CJHA 3BC8A 1LK9A 3FSLA 4WLJA 1OHVA 3WZFA 1YNUA 3ZRQA 1B9IA 4EFFA 1SPAA 4RAEA 5BJ4A 2BI5A 2AY9A 1IX7A 2W7EA 4EU1A 1M0NA 4RIZA 4LNLA 1CJ0A 2VMZA 4ADBA 1RVUA 1KL1A 1GC0A 2GB3A 3AATA 3G7QA 4JEWA 4ZM4A 1AHYA 1KMJA 2HP2A 5F8VA 3GBXA 5DX5A 2GMSA 3ISLA 4XQ2A 4BHDA 1ASNA 1YOOA 2R2NA 2VI9A 3FDDA 3F9TA 1QJ5A 1J32A 1M7YA 5G2PA 2FN6A 3VK3A 1AJSB 1GEYA 3RBFA 4Y0DA 1BS0A 1D2FA 2JJFA 4JEXA 2HOYA 2O0RA 2X8UA 3ASBA 3B1CA 4WYFA 4TMRA 4R2NA 5EFSA 3W1IA 4PVFA 3MAFB 2VMYA 3WGCA 3CQ4A 2Z9VA 3EI8A 2VMTA 3ELEA 2R5CB 5TF5A 3ZZKA 2HUUA 3FVSA 3FD0A 1AJRA 4QGRA 1W23A 4F4EA 3GZDC 2QMAA 4P7YA 1KMKA 4WYCA 2AEUA 3NYTA 4BA4A 1G4VA 2W8JA 2HUIA 2QB3A 3HLMA 4ATQA 2AY8A 1TOIA 2QLRA 3HMUA 3LV2A 2CH1A 2W8UA 4GE9A 9AATA 3FZ6A 1GC4A 2D66A 5M4BA 3RCHA 2ZJGA 4A00A 4BMKA 1IX8A 2FM1A 3LVMA 3N0LA 2DOUA 4IX8A 3ATHA 4W91A 1OHYA 4PIWA 2DKBA 3VAXA 5M46A 1ARGA 4FL0A 4F5KA 2JJGA 1ASFA 2V0YA 4O6ZA 2V1PA 1I29A 4EB7A 1AHGA 1M32A 3FVUA 5DJ9A 1V72A 3BB8A 3WLXA 4ZWVA 4W5KA 1GC2A 4BQ0A 5G4JA 1C7OA 3AEJA 3A2BA 2YOBA 4WB0B 3WX9A 3JW9A 4WYDA 1KL2A 1VEFA 4XJLA 4I8AA 4ITGA 2AY5A 4LW4A 4GE4A 4PFFA 4F5IA 2BWOA 1C0NA 5JAYA 3G0TA 1C4KA 1OATA 2R5CA 3A8UX 1CZCA 2CFBA 3EZ1A 3NYUA 3MBBA 4M2MA 1V2DA 1BQAA 5DB5A 2CJDA 1I48A 3CQ5A 4PFNA 3E2FA 4RKDA 4E3QA 5I92A 4XJMA 1SZUA 4J8LA 4L0OA 5FT5A 3F6TA 3B8XA 2X5FA 1CZEA 1TOEA 3BWNA 3AELA 4DBCA 3WGBA 2VGUA 3LY1A 3AEMA 4OMAA 2CY8A 2BYLA 5G0AA 5G09A 1AX4A 5E5IA 1ASLA 4OTLA 1G4XA 1EQBA 3MC6A 3WCNA 1LC5A 3GZCA 1ECXA 4IY7A 1SFFA 2JGTA 3GWPA 3DRDA 4W1WA 3B1DA 1YJYA 3PDBB 4IYOB 4M2JA 5IWQA 2QB2A 3EI5A 5G2QA 1ASEA 2EZ2A 4RM1A 3DZZA 4JEVA 2EH6A 3BCAA 4CXRA 3II0A 3AEPA 1S08A 3VP6A 4E3RA 3EI9A 2W8TA 4A72A 3COGA 2EPJA 1DJEA 2VMRA 1LW5A 2D65A 3E2ZB 1SZSA 2ZSLA 4IXZA 5EQCA 3UE8A 2D61A 2D7YA 4ITXA 1UU1A 2CANA 1AAWA 3P1TA 3G8MA 3PD6B 1CQ8A 2Z67A 3RI6A 4B98A 1DGEA 4XAUA 2YKVA 5LHAA 3GSBA 4OC9A 3M5UA 1SF2A 2BIAA 2RFVA 2W7FA 3WKRA 3P6KA 4MQPA 2QA3A 3IF2A 4JE5A 3QI6A 2OGAA 2EO5A 2VGWA 2Q7WA 2VMSA 1BQDA 1MLYA 2D63A 4IW7A 4U2HA 1W7NA 3FQ8A 3PIUA 5EIGB 4UHMA 1AY5A 2HORA 4JEYA 3D6KA 3A9XA 4Q6RA 1WYTB 3VK4A 2ORDA 4Q31A 1BJOA 1IUGA 1MDOA 2BI3A 2BIGA 5HXXA 2Z20A 1QIRA 1RV4A 2FQ6A 2W7GA 3DR4A 4E77A 1X29A 4ADCA 1UU2A 2YCNA 1AY4A 3PGYA 3KE3A 3MADA 4Q75A 4R8DA 1B5PA 3H14A 4IXSA 4MKJA 2JJHA 1ASBA 2BKWA 3JU7A 4OYTA 1LW4A 1DJ9A 1IJIA 3FVXA 3NUBA 3WCOA 1YJSA 3W1JA 1LS3A 2YCPA 4GEBA 4ADEA 1AKAA 2VMPA 1ASMA 1GEWA 3FFHA 1YJZA 4W8IA 1AIBA 3NRAA 2D5YA 1MDZA 1O69A 1E5FA 1D7SA 1VJOA 4ZDPA 3PA9A 4M2KA 1G7XA 3NTJA 3WKSA 4F5FA 2OGEA 4TN4A 2VGTA 1BKGA 1OHWA 2R0TA 1ASCA 5EUDA 2DGLA 5C6UA 4A6RA 1J04A 1BW0A 1G7WA 3PDXA 2BWNA 4ZSWA 2ZY3A 2HP1A 4IYOA 4OT8A 3BN1A 3I16A 3DC1A 3AOVA 4MQQA 3WY7A 1VP4A 1IAYA 1TOJA 3BWOA 2JG2A 5HHYA 3ACZA 2XH1A 4R5FA 1Y4IA 4F5LA 3NUIA 2CINA 2AY1A 4JE5D 1GCKA 1D7RA 2EGYA 5K8BA 2ZYJA 4WXFA 2D64A 4IXOA 4WD2A 1CL2A 3E2YA 4LW2A 4HVKA 3T32A 1ARHA 2CSTA 3A9ZA 4ISYA 2W7JA 1AMAA 3Q8NA 2DGKA 2E7IA 1U08A 3H7FA 3PJ0A 2GQNA 4WLHA 1ELUA 1CQ7A 3AENB 4AH3A 4FFCA 3L8AA 2C81A 3K28A 1GD9A 2E7JA 1O4SA 4OBUA 2X5DA 4GRXA 2ZY5A 5AX8A 3JWBA 1GC3A 2AEVA 3JWAA 3NU8A 1C7GA 3ECDA 3HBXA 5D5SA 3UAKA 2VMNA 4RITA 3EIBA 4MKKA 2VYCA 3GJUA 2VMXA 3CBFA 1YIZA 2BWPA 3LG0A 2O1BA 2ZC0A 2AY2A 3A9YA 3UWCA 1M0OA 4W1VA 3DU4A 1JS6A 4A0HA 1ASDA 1CL1A 2O7CA 1RVYA 1DGDA 4A0FA 3ZRPA 2VIAA 4AZKA 3MKJA 4JF1A 1TOKA 4F5MA 5E3KA 1LC8A 1D7UA 3KKIA 5HDMA 2PO3A 3NDNA
chains in the Genus database with same CATH superfamily
3FFRA 1AICA 3LVJA 3FQAA 3MAUA 4F5GA 1C9CA 2CH2A 4RKCA 3N4RA 3HT4A 3BS8A 3QM2A 4J5UA 1AAMA 3FDBA 3ZRRA 1O62A 2NMPA 1MDXA 1W7MA 1FG7A 2DR1A 4WBTA 1ZC9A 3FZ8A 3MAFA 3GR9A 2YRIA 2VMOA 1QZ9A 3NX3A 5G4IA 1XEYA 3AOWA 1OXOA 1AY8A 1PMMA 4WYGA 3VOMA 4E1OA 1BJWA 2WK8A 2TPLA 3FTBA 4GE7A 4JF0A 1AJSA 1WYUB 1V2FA 2VI8A 4U1TA 1M0PA 4ZASA 3R4TA 1W3UA 2YRRA 1S09A 3OP7A 3GETA 1B4XA 2AY3A 3TFTA 2VMUA 1I41A 4KYOA 3TQXA 1DTYA 3TATA 2CTZA 1ASAA 4ZDLA 1AMRA 3AEJC 1D7VA 2DKJA 4WYAA 4MY5A 4A0GA 4UHOA 1PG8A 3DXWA 2Z9XA 2BYJA 4MSOA 2Z61A 3E77A 1DFOA 4ZLVA 1P3WA 3GZDA 1I43A 3N5MA 4R5ZA 3CQ6A 1SZKA 5M49A 1XI9A 4RJ0A 5EUNA 2Z1ZA 4LC3A 1AHEA 2W7DA 3JTXA 5E4ZA 5FT8A 1LKCA 1TPLA 3R9AA 1BJNA 1T3IA 2WKAA 1TATA 3EUCA 1YIYA 3NYSA 3DYDA 3QN6A 4WYEA 3E6GA 4UHNA 1AKBA 1QJ3A 3AEMC 1GEXA 2Z1YA 4ZAHA 4K05A 4CBRA 3MC6C 5EUEA 2OATA 1WYVB 3FKDA 3N75A 4RLGA 4ZSYA 1X2AA 4JEZA 2FNIA 1H0CA 3E2ZA 4WXGA 2ZUKA 2OKJA 4WP0A 2BI9A 3TFUA 4AOAA 1N8PA 2G7JA 1S07A 2C44A 1AKCA 2WK9A 1PFFA 2YKUA 3FZ7A 3KGXA 4BA5A 4ATPA 2WK7A 3VK2A 1ARSA 1V2EA 4RJYA 1DJUA 2BI1A 3PDBA 5BJ3A 1B9HA 7AATA 2F8JA 1BJ4A 1WKGA 3NU7A 2ZP7A 3FRKA 4AO9A 2AY4A 3L44A 3RUYA 4WXBA 3AV7A 3EI7A 1X28A 3EIAA 1W7LA 3B1EA 1YAAA 1AHXA 1ELQA 2FNUA 1ORDA 4A6UA 1O61A 3HL2A 4AO4A 1B5OA 2Z9UA 2HZPA 1ASGA 4EMYA 1WYUA 3CAIA 3FQ7A 1IVRA 2DGMA 2JISA 3BWNC 5FT6A 5LH9A 2C7TA 2VLFA 1KKJA 2G6WA 1M0QA 1SVVA 2BHXA 3ELPA 4DGTA 3PPLA 2OQXA 1MAQA 2VGZA 3DXVA 3KGWA 4W1XA 4XJPA 1AIAA 2W7IA 5M4DA 1WSTA 2FYFA 2OKKA 5F9SA 1C7NA 3AENA 4AZJA 1BT4A 1DKAA 2AATA 3W1HA 2GMUA 3LVLB 3IHJA 8AATA 2EZ1A 1N2TA 1FC4A 2PB2A 2XBNA 2BI2A 4MQRA 4ZWMA 1S06A 1AMQA 4WB0A 3TCMA 1ARIA 1CS1A 2YKXA 2JJEA 3DODA 1IBJA 4F5HA 2E54A 1AHFA 3ZZJA 3PAAA 3BCBA 4N0BA 4CXQA 3NNKA 2ZY2A 2D7ZA 3HQTA 1PMOA 1ZOBA 4XJOA 4ADDA 1JS3A 1TARA 2VIBA 1ARTA 4GDYA 1Z3ZA 4ZDOA 1Z7DA 1QITA 1GBNA 2W8VA 3LWSA 2ZY4A 4Y0IA 3QPGA 4N0WA 3RCHB 2EYQA 4K2BA 2CB1A 3RQ1A 4F5JA 1KAFA 1ZODA 1CQ6A 4MGRA 2VMVA 1S0AA 3AEOA 3BCXA 1WYTA 3BV0A 2W7HA 4TV7A 2YCTA 1EJIA 4XK1A 5EIGA 3ASAA 2VMQA 4OCAA 3I4JA 3B46A 2R5EA 2W7KA 3I5TA 2VMWA 1EG5A 1RV3A 4NOGA 3QBOA 1IX6A 1UKJA 1WKHA 2HUFA 5EAVA 1WYVA 5EAAA 3JZLA 4KXKA 1LC7A 2BIEA 4CBSA 3DR7A 4H51A 4K2IA 4KAMA 2VGSA 4LNMA 3PD6A 3HDOA 2AY6A 3MEBA 2CJGA 2W8WA 3QHXA 2W7MA 1M4NA 3K7YA 4B9BA 5FT4A 2PB0A 1QGNA 3USFA 4UQVA 3N4XA 1GDEA 2QBTA 2X3LA 1OXPA 3K40A 4Y0HA 5J8QA 2FKIA 2ZSMA 1JF9A 3EI6A 3LVKA 2YHKA 3QGUA 4OBVA 2VGVA 1M6SA 1B8GA 1KKPA 1X0MA 5D95A 1JG8A 1TOGA 1IAXA 4EB5A 2E7UA 1FG3A 3FCRA 2Z9WA 1BJOB 2YKYA 2C0RA 1E5EA 3E9KA 4UOYA 4XEWA 4A0RA 1AMSA 1TASA 2AY7A 1MAPA 2W7LA 3HVYA 5DJ1A 2KFPA 4P3MA 2HOZA 4HF8A 3OKSA 2GSAA 3EZSA 4A6TA 4DQ6A 1UU0A 1H1CA 2VLHA 4Q76A 3F0HA 1QISA 4K2MA 3RBLA 1N31A 4CVQA 4LNJA 1MGVA 4ZM3A 2HOXA 1MLZA 4GSAA 3N7NA 2CJHA 3BC8A 1LK9A 3FSLA 4WLJA 1OHVA 3WZFA 1YNUA 3ZRQA 1B9IA 4EFFA 1SPAA 4RAEA 5BJ4A 2BI5A 2AY9A 1IX7A 2W7EA 4EU1A 1M0NA 4RIZA 4LNLA 1CJ0A 2VMZA 4ADBA 1RVUA 1KL1A 1GC0A 2GB3A 3AATA 3G7QA 4JEWA 4ZM4A 1AHYA 1KMJA 2HP2A 5F8VA 3GBXA 5DX5A 2GMSA 3ISLA 4XQ2A 4BHDA 1ASNA 3H9XA 1YOOA 2R2NA 2VI9A 3FDDA 3F9TA 1QJ5A 1J32A 1M7YA 5G2PA 2FN6A 3VK3A 1AJSB 1GEYA 3RBFA 4Y0DA 1BS0A 1D2FA 2JJFA 4JEXA 2HOYA 2O0RA 2X8UA 3ASBA 3B1CA 4WYFA 4TMRA 4R2NA 5EFSA 3W1IA 4PVFA 3MAFB 2VMYA 3WGCA 3CQ4A 2Z9VA 3EI8A 2VMTA 3ELEA 2R5CB 5TF5A 3ZZKA 2HUUA 3FVSA 3FD0A 1AJRA 4QGRA 1W23A 4F4EA 3GZDC 2QMAA 4P7YA 1KMKA 4WYCA 2WB6A 2AEUA 3NYTA 4BA4A 1G4VA 2W8JA 2HUIA 2QB3A 3HLMA 4ATQA 2AY8A 1TOIA 2QLRA 3HMUA 3LV2A 2CH1A 2W8UA 4GE9A 9AATA 3FZ6A 1GC4A 2D66A 5M4BA 3RCHA 2ZJGA 4A00A 4BMKA 1IX8A 2FM1A 3LVMA 3N0LA 2DOUA 4IX8A 3ATHA 4W91A 1OHYA 4PIWA 2DKBA 3VAXA 5M46A 1ARGA 4FL0A 4F5KA 2JJGA 1ASFA 2V0YA 4O6ZA 2V1PA 1I29A 4EB7A 1AHGA 1M32A 3FVUA 5DJ9A 1V72A 3BB8A 3WLXA 4ZWVA 4W5KA 1GC2A 4BQ0A 5G4JA 1C7OA 3AEJA 3A2BA 2YOBA 4WB0B 3WX9A 3JW9A 4WYDA 1KL2A 1VEFA 4XJLA 4I8AA 4ITGA 2AY5A 4LW4A 4GE4A 4PFFA 4F5IA 2BWOA 1C0NA 5JAYA 3G0TA 1C4KA 1OATA 2R5CA 3A8UX 1CZCA 2CFBA 3EZ1A 3NYUA 3MBBA 4M2MA 1V2DA 1BQAA 5DB5A 2CJDA 1I48A 3CQ5A 4PFNA 3E2FA 4RKDA 4E3QA 5I92A 4XJMA 1SZUA 4J8LA 4L0OA 5FT5A 3F6TA 3B8XA 2X5FA 1CZEA 1TOEA 3BWNA 3AELA 4DBCA 3WGBA 2VGUA 3LY1A 3AEMA 4OMAA 2CY8A 2BYLA 5G0AA 5G09A 1AX4A 5E5IA 1ASLA 4OTLA 1G4XA 1EQBA 3MC6A 3WCNA 1LC5A 3GZCA 1ECXA 4IY7A 1SFFA 2JGTA 3GWPA 3DRDA 4W1WA 3B1DA 1YJYA 3PDBB 4IYOB 4M2JA 5IWQA 2QB2A 3EI5A 5G2QA 1ASEA 2EZ2A 4RM1A 3DZZA 4JEVA 2EH6A 3BCAA 4CXRA 3II0A 3AEPA 5KTBA 1S08A 3VP6A 4E3RA 3EI9A 2W8TA 4A72A 3COGA 2EPJA 1DJEA 2VMRA 1LW5A 2D65A 3E2ZB 1SZSA 2ZSLA 4IXZA 5EQCA 3UE8A 2D61A 2D7YA 4ITXA 1UU1A 2CANA 1AAWA 3P1TA 3G8MA 3PD6B 1CQ8A 2Z67A 3RI6A 4B98A 1DGEA 4XAUA 2YKVA 5LHAA 3GSBA 4OC9A 3M5UA 1SF2A 2BIAA 2RFVA 2W7FA 3WKRA 3P6KA 4MQPA 2QA3A 3IF2A 4JE5A 3QI6A 2OGAA 2EO5A 2VGWA 2Q7WA 2VMSA 1BQDA 1MLYA 2D63A 4IW7A 4U2HA 1W7NA 3FQ8A 3PIUA 5EIGB 4UHMA 1AY5A 2HORA 4JEYA 3D6KA 3A9XA 4Q6RA 1WYTB 3VK4A 2ORDA 4Q31A 1BJOA 1IUGA 1MDOA 2BI3A 2BIGA 5HXXA 2Z20A 1QIRA 3N4SA 1RV4A 2FQ6A 2W7GA 3DR4A 4E77A 1X29A 4ADCA 1UU2A 2YCNA 1AY4A 3PGYA 3KE3A 3MADA 4Q75A 4R8DA 1B5PA 3H14A 2QSRA 4IXSA 4MKJA 2JJHA 1ASBA 2BKWA 3JU7A 4OYTA 1LW4A 1DJ9A 1IJIA 3FVXA 3NUBA 3WCOA 1YJSA 3W1JA 1LS3A 2YCPA 4GEBA 4ADEA 1AKAA 2VMPA 1ASMA 1GEWA 3FFHA 1YJZA 4W8IA 1AIBA 3NRAA 2D5YA 1MDZA 1O69A 1E5FA 1D7SA 1VJOA 4ZDPA 3PA9A 4M2KA 1G7XA 3NTJA 3WKSA 4F5FA 2OGEA 4TN4A 2VGTA 1BKGA 1OHWA 2R0TA 1ASCA 5EUDA 2DGLA 5C6UA 4A6RA 1J04A 1BW0A 1G7WA 3PDXA 2BWNA 4ZSWA 2ZY3A 2HP1A 4IYOA 4OT8A 3BN1A 3I16A 3DC1A 3AOVA 4MQQA 3WY7A 1VP4A 1IAYA 1TOJA 3BWOA 2JG2A 5HHYA 3ACZA 2XH1A 4R5FA 1Y4IA 4F5LA 3NUIA 2CINA 2AY1A 4JE5D 1GCKA 1D7RA 2EGYA 5K8BA 2ZYJA 4WXFA 2D64A 4IXOA 4WD2A 1CL2A 3E2YA 4LW2A 4HVKA 3T32A 1ARHA 2CSTA 3A9ZA 4ISYA 2W7JA 1AMAA 3Q8NA 2DGKA 2E7IA 1U08A 3H7FA 3PJ0A 2GQNA 4WLHA 1ELUA 1CQ7A 3AENB 4AH3A 4FFCA 3L8AA 2C81A 3K28A 1GD9A 2E7JA 1O4SA 4OBUA 2X5DA 4H63Q 4GRXA 2ZY5A 5AX8A 3JWBA 1GC3A 2AEVA 3JWAA 3NU8A 1C7GA 3ECDA 3HBXA 5D5SA 2A1VA 3UAKA 2VMNA 4RITA 3EIBA 4MKKA 2VYCA 3GJUA 2VMXA 3CBFA 1YIZA 2BWPA 3LG0A 2O1BA 2ZC0A 2AY2A 3A9YA 3UWCA 1M0OA 4W1VA 3DU4A 1JS6A 4A0HA 1ASDA 1CL1A 2O7CA 1RVYA 1DGDA 4A0FA 3ZRPA 2VIAA 4AZKA 3MKJA 4JF1A 1TOKA 4F5MA 5E3KA 1LC8A 1D7UA 3KKIA 5HDMA 2PO3A 3NDNA
chains in the Genus database with same CATH topology
3FFRA 1AICA 3LVJA 3FQAA 3MAUA 4F5GA 1C9CA 2CH2A 4RKCA 3N4RA 3HT4A 3BS8A 3QM2A 4J5UA 1AAMA 3FDBA 3ZRRA 1O62A 2NMPA 1MDXA 1W7MA 1FG7A 2DR1A 4WBTA 1ZC9A 3FZ8A 3MAFA 3GR9A 2YRIA 2VMOA 1QZ9A 3NX3A 5G4IA 1XEYA 3AOWA 1OXOA 1AY8A 1PMMA 4WYGA 3VOMA 4E1OA 1BJWA 2WK8A 2TPLA 3FTBA 4GE7A 4JF0A 1AJSA 1WYUB 1V2FA 2VI8A 4U1TA 1M0PA 4ZASA 3R4TA 1W3UA 2YRRA 1S09A 3OP7A 3GETA 1B4XA 2AY3A 3TFTA 2VMUA 1I41A 4KYOA 3TQXA 1DTYA 3TATA 2CTZA 1ASAA 4ZDLA 1AMRA 3AEJC 1D7VA 2DKJA 4WYAA 4MY5A 4A0GA 4UHOA 1PG8A 3DXWA 2Z9XA 2BYJA 4MSOA 2Z61A 3E77A 1DFOA 4ZLVA 1P3WA 3GZDA 1I43A 3N5MA 4R5ZA 3CQ6A 1SZKA 5M49A 1XI9A 4RJ0A 5EUNA 2Z1ZA 4LC3A 1AHEA 2W7DA 3JTXA 5E4ZA 5FT8A 1LKCA 1TPLA 3R9AA 1BJNA 1T3IA 2WKAA 1TATA 3EUCA 1YIYA 3NYSA 3DYDA 3QN6A 4WYEA 3E6GA 4UHNA 1AKBA 1QJ3A 3AEMC 1GEXA 2Z1YA 4ZAHA 4K05A 4CBRA 3MC6C 5EUEA 2OATA 1WYVB 3FKDA 3N75A 4RLGA 4ZSYA 1X2AA 4JEZA 2FNIA 1H0CA 3E2ZA 4WXGA 2ZUKA 2OKJA 4WP0A 2BI9A 3TFUA 4AOAA 1N8PA 2G7JA 1S07A 2C44A 1AKCA 2WK9A 1PFFA 2YKUA 3FZ7A 3KGXA 4BA5A 4ATPA 2WK7A 3VK2A 1ARSA 1V2EA 4RJYA 1DJUA 2BI1A 3PDBA 5BJ3A 1B9HA 7AATA 2F8JA 1BJ4A 1WKGA 3NU7A 2ZP7A 3FRKA 4AO9A 2AY4A 3L44A 3RUYA 4WXBA 3AV7A 3EI7A 1X28A 3EIAA 1W7LA 3B1EA 1YAAA 1AHXA 1ELQA 2FNUA 1ORDA 4A6UA 1O61A 3HL2A 4AO4A 1B5OA 2Z9UA 2HZPA 1ASGA 4EMYA 1WYUA 3CAIA 3FQ7A 1IVRA 2DGMA 2JISA 3BWNC 5FT6A 5LH9A 2C7TA 2VLFA 1KKJA 2G6WA 1M0QA 1SVVA 2BHXA 3ELPA 4DGTA 3PPLA 2OQXA 1MAQA 2VGZA 3DXVA 3KGWA 4W1XA 4XJPA 1AIAA 2W7IA 5M4DA 1WSTA 2FYFA 2OKKA 5F9SA 1C7NA 3AENA 4AZJA 1BT4A 1DKAA 2AATA 3W1HA 2GMUA 3LVLB 3IHJA 8AATA 2EZ1A 1N2TA 1FC4A 2PB2A 2XBNA 2BI2A 4MQRA 4ZWMA 1S06A 1AMQA 4WB0A 3TCMA 1ARIA 1CS1A 2YKXA 2JJEA 3DODA 1IBJA 4F5HA 2E54A 1AHFA 3ZZJA 3PAAA 3BCBA 4N0BA 4CXQA 3NNKA 2ZY2A 2D7ZA 3HQTA 1PMOA 1ZOBA 4XJOA 4ADDA 1JS3A 1TARA 2VIBA 1ARTA 4GDYA 1Z3ZA 4ZDOA 1Z7DA 1QITA 1GBNA 2W8VA 3LWSA 2ZY4A 4Y0IA 3QPGA 4N0WA 3RCHB 2EYQA 4K2BA 2CB1A 3RQ1A 4F5JA 1ZODA 1CQ6A 4MGRA 2VMVA 1S0AA 3AEOA 3BCXA 1WYTA 3BV0A 2W7HA 4TV7A 2YCTA 1EJIA 4XK1A 5EIGA 3ASAA 2VMQA 4OCAA 3I4JA 3B46A 2R5EA 2W7KA 3I5TA 2VMWA 1EG5A 1RV3A 4NOGA 3QBOA 1IX6A 1UKJA 1WKHA 2HUFA 5EAVA 1WYVA 5EAAA 3JZLA 4KXKA 1LC7A 2BIEA 4CBSA 3DR7A 4H51A 4K2IA 4KAMA 2VGSA 4LNMA 3PD6A 3HDOA 2AY6A 3MEBA 2CJGA 2W8WA 3QHXA 2W7MA 1M4NA 3K7YA 4B9BA 5FT4A 2PB0A 1QGNA 3USFA 4UQVA 3N4XA 1GDEA 2QBTA 2X3LA 1OXPA 3K40A 4Y0HA 5J8QA 2FKIA 2ZSMA 1JF9A 3EI6A 3LVKA 2YHKA 3QGUA 4OBVA 2VGVA 1M6SA 1B8GA 1KKPA 1X0MA 5D95A 1JG8A 1TOGA 1IAXA 4EB5A 2E7UA 1FG3A 3FCRA 2Z9WA 1BJOB 2YKYA 2C0RA 1E5EA 3E9KA 4UOYA 4XEWA 4A0RA 1AMSA 1TASA 2AY7A 1MAPA 2W7LA 3HVYA 5DJ1A 2KFPA 4P3MA 2HOZA 4HF8A 3OKSA 2GSAA 3EZSA 4A6TA 4DQ6A 1UU0A 1H1CA 2VLHA 4Q76A 3F0HA 1QISA 4K2MA 3RBLA 1N31A 4CVQA 4LNJA 1MGVA 4ZM3A 2HOXA 1MLZA 4GSAA 3N7NA 2CJHA 3BC8A 1LK9A 3FSLA 4WLJA 1OHVA 3WZFA 1YNUA 3ZRQA 1B9IA 4EFFA 1SPAA 4RAEA 5BJ4A 2BI5A 2AY9A 1IX7A 2W7EA 4EU1A 1M0NA 4RIZA 4LNLA 1CJ0A 2VMZA 4ADBA 1RVUA 1KL1A 1GC0A 2GB3A 3AATA 3G7QA 4JEWA 4ZM4A 1AHYA 1KMJA 2HP2A 5F8VA 3GBXA 5DX5A 2GMSA 3ISLA 4XQ2A 4BHDA 1ASNA 3H9XA 1YOOA 2R2NA 2VI9A 3FDDA 3F9TA 1QJ5A 1J32A 1M7YA 5G2PA 2FN6A 3VK3A 1AJSB 1GEYA 3RBFA 4Y0DA 1BS0A 1D2FA 2JJFA 4JEXA 2HOYA 2O0RA 2X8UA 3ASBA 3B1CA 4WYFA 4TMRA 4R2NA 5EFSA 3W1IA 4PVFA 3MAFB 2VMYA 3WGCA 3CQ4A 2Z9VA 3EI8A 2VMTA 3ELEA 2R5CB 5TF5A 3ZZKA 2HUUA 3FVSA 3FD0A 1AJRA 4QGRA 1W23A 4F4EA 3GZDC 2QMAA 4P7YA 1KMKA 4WYCA 2WB6A 2AEUA 3NYTA 4BA4A 1G4VA 2W8JA 2HUIA 2QB3A 3HLMA 4ATQA 2AY8A 1TOIA 2QLRA 3HMUA 3LV2A 2CH1A 2W8UA 4GE9A 9AATA 3FZ6A 1GC4A 2D66A 5M4BA 3RCHA 2ZJGA 4A00A 4BMKA 1IX8A 2FM1A 3LVMA 3N0LA 2DOUA 4IX8A 3ATHA 4W91A 1OHYA 4PIWA 2DKBA 3VAXA 5M46A 1ARGA 4FL0A 4F5KA 2JJGA 1ASFA 2V0YA 4O6ZA 2V1PA 1I29A 4EB7A 1AHGA 1M32A 3FVUA 5DJ9A 1V72A 3BB8A 3WLXA 4ZWVA 4W5KA 1GC2A 4BQ0A 5G4JA 1C7OA 3AEJA 3A2BA 2YOBA 4WB0B 3WX9A 3JW9A 4WYDA 1KL2A 1VEFA 4XJLA 4I8AA 4ITGA 2AY5A 4LW4A 4GE4A 4PFFA 4F5IA 2BWOA 1C0NA 5JAYA 3G0TA 1C4KA 1OATA 2R5CA 3A8UX 1CZCA 2CFBA 3EZ1A 3NYUA 3MBBA 4M2MA 1V2DA 1BQAA 5DB5A 2CJDA 1I48A 3CQ5A 4PFNA 3E2FA 4RKDA 4E3QA 5I92A 4XJMA 1SZUA 4J8LA 4L0OA 5FT5A 3F6TA 3B8XA 2X5FA 1CZEA 1TOEA 3BWNA 3AELA 4DBCA 3WGBA 2VGUA 3LY1A 3AEMA 4OMAA 2CY8A 2BYLA 5G0AA 5G09A 1AX4A 5E5IA 1ASLA 4OTLA 1G4XA 1EQBA 3MC6A 3WCNA 1LC5A 3GZCA 1ECXA 4IY7A 1SFFA 2JGTA 3GWPA 3DRDA 4W1WA 3B1DA 1YJYA 3PDBB 4IYOB 4M2JA 5IWQA 2QB2A 3EI5A 5G2QA 1ASEA 2EZ2A 4RM1A 3DZZA 4JEVA 2EH6A 3BCAA 4CXRA 3II0A 3AEPA 5KTBA 1S08A 3VP6A 4E3RA 3EI9A 2W8TA 4A72A 3COGA 2EPJA 1DJEA 2VMRA 1LW5A 2D65A 3E2ZB 1SZSA 2ZSLA 4IXZA 5EQCA 3UE8A 2D61A 2D7YA 4ITXA 1UU1A 2CANA 1AAWA 3P1TA 3G8MA 3PD6B 1CQ8A 2Z67A 3RI6A 4B98A 1DGEA 4XAUA 2YKVA 5LHAA 3GSBA 4OC9A 3M5UA 1SF2A 2BIAA 2RFVA 2W7FA 3WKRA 3P6KA 4MQPA 2QA3A 3IF2A 4JE5A 3QI6A 2OGAA 2EO5A 2VGWA 2Q7WA 2VMSA 1BQDA 1MLYA 2D63A 4IW7A 4U2HA 1W7NA 3FQ8A 3PIUA 5EIGB 4UHMA 1AY5A 2HORA 4JEYA 3D6KA 3A9XA 4Q6RA 1WYTB 3VK4A 2ORDA 4Q31A 1BJOA 1IUGA 1MDOA 2BI3A 2BIGA 5HXXA 2Z20A 1QIRA 3N4SA 1RV4A 2FQ6A 2W7GA 3DR4A 4E77A 1X29A 4ADCA 1UU2A 2YCNA 1AY4A 3PGYA 3KE3A 3MADA 4Q75A 4R8DA 1B5PA 3H14A 2QSRA 4IXSA 4MKJA 2JJHA 1ASBA 2BKWA 3JU7A 4OYTA 1LW4A 1DJ9A 1IJIA 3FVXA 3NUBA 3WCOA 1YJSA 3W1JA 1LS3A 2YCPA 4GEBA 4ADEA 1AKAA 2VMPA 1ASMA 1GEWA 3FFHA 1YJZA 4W8IA 1AIBA 3NRAA 2D5YA 1MDZA 1O69A 1E5FA 1D7SA 1VJOA 4ZDPA 3PA9A 4M2KA 1G7XA 3NTJA 3WKSA 4F5FA 2OGEA 4TN4A 2VGTA 1BKGA 1OHWA 2R0TA 1ASCA 5EUDA 2DGLA 5C6UA 4A6RA 1J04A 1BW0A 1G7WA 3PDXA 2BWNA 4ZSWA 2ZY3A 2HP1A 4IYOA 4OT8A 3BN1A 3I16A 3DC1A 3AOVA 4MQQA 3WY7A 1VP4A 1IAYA 1TOJA 3BWOA 2JG2A 5HHYA 3ACZA 2XH1A 4R5FA 1Y4IA 4F5LA 3NUIA 2CINA 2AY1A 4JE5D 1GCKA 1D7RA 2EGYA 5K8BA 2ZYJA 4WXFA 2D64A 4IXOA 4WD2A 1CL2A 3E2YA 4LW2A 4HVKA 3T32A 1ARHA 2CSTA 3A9ZA 4ISYA 2W7JA 1AMAA 3Q8NA 2DGKA 2E7IA 1U08A 3H7FA 3PJ0A 2GQNA 4WLHA 1ELUA 1CQ7A 3AENB 4AH3A 4FFCA 3L8AA 2C81A 3K28A 1GD9A 2E7JA 1O4SA 4OBUA 2X5DA 4H63Q 4GRXA 2ZY5A 5AX8A 3JWBA 1GC3A 2AEVA 3JWAA 3NU8A 1C7GA 3ECDA 3HBXA 5D5SA 2A1VA 3UAKA 2VMNA 4RITA 3EIBA 4MKKA 2VYCA 3GJUA 2VMXA 3CBFA 1YIZA 2BWPA 3LG0A 2O1BA 2ZC0A 2AY2A 3A9YA 3UWCA 1M0OA 4W1VA 3DU4A 1JS6A 4A0HA 1ASDA 1CL1A 2O7CA 1RVYA 1DGDA 4A0FA 3ZRPA 2VIAA 4AZKA 3MKJA 4JF1A 1TOKA 4F5MA 5E3KA 1LC8A 1D7UA 3KKIA 5HDMA 2PO3A 3NDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FFR A;  1AIC A;  3LVJ A;  3FQA A;  3MAU A;  4F5G A;  1C9C A;  2CH2 A;  4RKC A;  3HT4 A;  3BS8 A;  3QM2 A;  4J5U A;  1AAM A;  3FDB A;  3ZRR A;  1O62 A;  2NMP A;  1MDX A;  1W7M A;  1FG7 A;  2DR1 A;  4WBT A;  1ZC9 A;  3FZ8 A;  3MAF A;  3GR9 A;  2YRI A;  2VMO A;  1QZ9 A;  3NX3 A;  5G4I A;  1XEY A;  3AOW A;  1OXO A;  1AY8 A;  1PMM A;  4WYG A;  3VOM A;  4E1O A;  1BJW A;  2WK8 A;  2TPL A;  3FTB A;  4GE7 A;  4JF0 A;  1AJS A;  1WYU B;  1V2F A;  2VI8 A;  4U1T A;  1M0P A;  4ZAS A;  3R4T A;  1W3U A;  2YRR A;  1S09 A;  3OP7 A;  3GET A;  1B4X A;  2AY3 A;  3TFT A;  2VMU A;  1I41 A;  4KYO A;  3TQX A;  1DTY A;  3TAT A;  2CTZ A;  1ASA A;  4ZDL A;  1AMR A;  3AEJ C;  1D7V A;  2DKJ A;  4WYA A;  4MY5 A;  4A0G A;  4UHO A;  1PG8 A;  3DXW A;  2Z9X A;  2BYJ A;  4MSO A;  2Z61 A;  3E77 A;  1DFO A;  4ZLV A;  1P3W A;  3GZD A;  1I43 A;  3N5M A;  4R5Z A;  3CQ6 A;  1SZK A;  5M49 A;  1XI9 A;  4RJ0 A;  5EUN A;  2Z1Z A;  4LC3 A;  1AHE A;  2W7D A;  3JTX A;  5E4Z A;  5FT8 A;  1LKC A;  1TPL A;  3R9A A;  1BJN A;  1T3I A;  2WKA A;  1TAT A;  3EUC A;  1YIY A;  3NYS A;  3DYD A;  3QN6 A;  4WYE A;  3E6G A;  4UHN A;  1AKB A;  1QJ3 A;  3AEM C;  1GEX A;  2Z1Y A;  4ZAH A;  4CBR A;  3MC6 C;  5EUE A;  2OAT A;  1WYV B;  3FKD A;  3N75 A;  4RLG A;  4ZSY A;  1X2A A;  4JEZ A;  2FNI A;  1H0C A;  3E2Z A;  4WXG A;  2ZUK A;  2OKJ A;  4WP0 A;  2BI9 A;  3TFU A;  4AOA A;  1N8P A;  1S07 A;  2C44 A;  1AKC A;  2WK9 A;  1PFF A;  2YKU A;  3FZ7 A;  3KGX A;  4BA5 A;  4ATP A;  2WK7 A;  3VK2 A;  1ARS A;  1V2E A;  4RJY A;  1DJU A;  2BI1 A;  3PDB A;  5BJ3 A;  1B9H A;  7AAT A;  2F8J A;  1BJ4 A;  1WKG A;  3NU7 A;  2ZP7 A;  3FRK A;  4AO9 A;  2AY4 A;  3L44 A;  3RUY A;  4WXB A;  3AV7 A;  3EI7 A;  1X28 A;  3EIA A;  1W7L A;  3B1E A;  1YAA A;  1AHX A;  1ELQ A;  2FNU A;  1ORD A;  4A6U A;  1O61 A;  3HL2 A;  4AO4 A;  1B5O A;  2Z9U A;  2HZP A;  1ASG A;  4EMY A;  1WYU A;  3CAI A;  3FQ7 A;  1IVR A;  2DGM A;  2JIS A;  3BWN C;  5FT6 A;  5LH9 A;  2C7T A;  2VLF A;  1KKJ A;  2G6W A;  1M0Q A;  1SVV A;  2BHX A;  3ELP A;  4DGT A;  3PPL A;  2OQX A;  1MAQ A;  2VGZ A;  3DXV A;  3KGW A;  4W1X A;  4XJP A;  1AIA A;  2W7I A;  5M4D A;  1WST A;  2FYF A;  2OKK A;  5F9S A;  1C7N A;  3AEN A;  4AZJ A;  1BT4 A;  1DKA A;  2AAT A;  3W1H A;  2GMU A;  3LVL B;  3IHJ A;  8AAT A;  2EZ1 A;  1N2T A;  1FC4 A;  2PB2 A;  2XBN A;  2BI2 A;  4MQR A;  4ZWM A;  1S06 A;  1AMQ A;  4WB0 A;  3TCM A;  1ARI A;  1CS1 A;  2YKX A;  2JJE A;  3DOD A;  1IBJ A;  4F5H A;  2E54 A;  1AHF A;  3ZZJ A;  3PAA A;  3BCB A;  4N0B A;  4CXQ A;  3NNK A;  2ZY2 A;  2D7Z A;  3HQT A;  1PMO A;  1ZOB A;  4XJO A;  4ADD A;  1JS3 A;  1TAR A;  2VIB A;  1ART A;  4GDY A;  1Z3Z A;  4ZDO A;  1Z7D A;  1QIT A;  1GBN A;  2W8V A;  3LWS A;  2ZY4 A;  4Y0I A;  3QPG A;  4N0W A;  3RCH B;  4K2B A;  2CB1 A;  3RQ1 A;  4F5J A;  1ZOD A;  1CQ6 A;  4MGR A;  2VMV A;  1S0A A;  3AEO A;  3BCX A;  1WYT A;  3BV0 A;  2W7H A;  4TV7 A;  2YCT A;  1EJI A;  4XK1 A;  5EIG A;  3ASA A;  2VMQ A;  4OCA A;  3I4J A;  3B46 A;  2R5E A;  2W7K A;  3I5T A;  2VMW A;  1EG5 A;  1RV3 A;  4NOG A;  3QBO A;  1IX6 A;  1UKJ A;  1WKH A;  2HUF A;  5EAV A;  1WYV A;  5EAA A;  3JZL A;  4KXK A;  1LC7 A;  2BIE A;  4CBS A;  3DR7 A;  4H51 A;  4K2I A;  4KAM A;  2VGS A;  4LNM A;  3PD6 A;  3HDO A;  2AY6 A;  3MEB A;  2CJG A;  2W8W A;  3QHX A;  2W7M A;  1M4N A;  3K7Y A;  4B9B A;  5FT4 A;  2PB0 A;  1QGN A;  3USF A;  4UQV A;  1GDE A;  2QBT A;  2X3L A;  1OXP A;  3K40 A;  4Y0H A;  5J8Q A;  2ZSM A;  1JF9 A;  3EI6 A;  3LVK A;  2YHK A;  3QGU A;  4OBV A;  2VGV A;  1M6S A;  1B8G A;  1KKP A;  1X0M A;  5D95 A;  1JG8 A;  1TOG A;  1IAX A;  4EB5 A;  2E7U A;  1FG3 A;  3FCR A;  2Z9W A;  1BJO B;  2YKY A;  2C0R A;  1E5E A;  3E9K A;  4UOY A;  4XEW A;  4A0R A;  1AMS A;  1TAS A;  2AY7 A;  1MAP A;  2W7L A;  3HVY A;  5DJ1 A;  4P3M A;  2HOZ A;  4HF8 A;  3OKS A;  2GSA A;  3EZS A;  4A6T A;  4DQ6 A;  1UU0 A;  1H1C A;  2VLH A;  4Q76 A;  3F0H A;  1QIS A;  4K2M A;  3RBL A;  1N31 A;  4CVQ A;  4LNJ A;  1MGV A;  4ZM3 A;  2HOX A;  1MLZ A;  4GSA A;  2CJH A;  3BC8 A;  1LK9 A;  3FSL A;  4WLJ A;  1OHV A;  3WZF A;  1YNU A;  3ZRQ A;  1B9I A;  4EFF A;  1SPA A;  4RAE A;  5BJ4 A;  2BI5 A;  2AY9 A;  1IX7 A;  2W7E A;  4EU1 A;  1M0N A;  4RIZ A;  4LNL A;  1CJ0 A;  2VMZ A;  4ADB A;  1RVU A;  1KL1 A;  1GC0 A;  2GB3 A;  3AAT A;  3G7Q A;  4JEW A;  4ZM4 A;  1AHY A;  1KMJ A;  2HP2 A;  5F8V A;  3GBX A;  5DX5 A;  2GMS A;  3ISL A;  4XQ2 A;  4BHD A;  1ASN A;  1YOO A;  2R2N A;  2VI9 A;  3FDD A;  3F9T A;  1QJ5 A;  1J32 A;  1M7Y A;  5G2P A;  2FN6 A;  3VK3 A;  1AJS B;  1GEY A;  3RBF A;  4Y0D A;  1BS0 A;  1D2F A;  2JJF A;  4JEX A;  2HOY A;  2O0R A;  2X8U A;  3ASB A;  3B1C A;  4WYF A;  4TMR A;  4R2N A;  5EFS A;  3W1I A;  4PVF A;  3MAF B;  2VMY A;  3WGC A;  3CQ4 A;  2Z9V A;  3EI8 A;  2VMT A;  3ELE A;  2R5C B;  5TF5 A;  3ZZK A;  2HUU A;  3FVS A;  3FD0 A;  1AJR A;  4QGR A;  1W23 A;  4F4E A;  3GZD C;  2QMA A;  4P7Y A;  1KMK A;  4WYC A;  2AEU A;  3NYT A;  4BA4 A;  1G4V A;  2W8J A;  2HUI A;  2QB3 A;  3HLM A;  4ATQ A;  2AY8 A;  1TOI A;  2QLR A;  3HMU A;  3LV2 A;  2CH1 A;  2W8U A;  4GE9 A;  9AAT A;  3FZ6 A;  1GC4 A;  2D66 A;  5M4B A;  3RCH A;  2ZJG A;  4A00 A;  4BMK A;  1IX8 A;  2FM1 A;  3LVM A;  3N0L A;  2DOU A;  4IX8 A;  3ATH A;  4W91 A;  1OHY A;  4PIW A;  2DKB A;  3VAX A;  5M46 A;  1ARG A;  4FL0 A;  4F5K A;  2JJG A;  1ASF A;  2V0Y A;  4O6Z A;  2V1P A;  1I29 A;  4EB7 A;  1AHG A;  1M32 A;  3FVU A;  5DJ9 A;  1V72 A;  3BB8 A;  3WLX A;  4ZWV A;  4W5K A;  1GC2 A;  4BQ0 A;  5G4J A;  1C7O A;  3AEJ A;  3A2B A;  2YOB A;  4WB0 B;  3WX9 A;  3JW9 A;  4WYD A;  1KL2 A;  1VEF A;  4XJL A;  4I8A A;  4ITG A;  2AY5 A;  4LW4 A;  4GE4 A;  4PFF A;  4F5I A;  2BWO A;  1C0N A;  5JAY A;  3G0T A;  1C4K A;  1OAT A;  2R5C A;  3A8U X;  1CZC A;  2CFB A;  3EZ1 A;  3NYU A;  3MBB A;  4M2M A;  1V2D A;  1BQA A;  5DB5 A;  2CJD A;  1I48 A;  3CQ5 A;  4PFN A;  3E2F A;  4RKD A;  4E3Q A;  5I92 A;  4XJM A;  1SZU A;  4J8L A;  4L0O A;  5FT5 A;  3F6T A;  3B8X A;  2X5F A;  1CZE A;  1TOE A;  3BWN A;  3AEL A;  4DBC A;  3WGB A;  2VGU A;  3LY1 A;  3AEM A;  4OMA A;  2CY8 A;  2BYL A;  5G0A A;  5G09 A;  1AX4 A;  5E5I A;  1ASL A;  4OTL A;  1G4X A;  1EQB A;  3MC6 A;  3WCN A;  1LC5 A;  3GZC A;  1ECX A;  4IY7 A;  1SFF A;  2JGT A;  3GWP A;  3DRD A;  4W1W A;  3B1D A;  1YJY A;  3PDB B;  4IYO B;  4M2J A;  5IWQ A;  2QB2 A;  3EI5 A;  5G2Q A;  1ASE A;  2EZ2 A;  4RM1 A;  3DZZ A;  4JEV A;  2EH6 A;  3BCA A;  4CXR A;  3II0 A;  3AEP A;  1S08 A;  3VP6 A;  4E3R A;  3EI9 A;  2W8T A;  4A72 A;  3COG A;  2EPJ A;  1DJE A;  2VMR A;  1LW5 A;  2D65 A;  3E2Z B;  1SZS A;  2ZSL A;  4IXZ A;  5EQC A;  3UE8 A;  2D61 A;  2D7Y A;  4ITX A;  1UU1 A;  2CAN A;  1AAW A;  3P1T A;  3G8M A;  3PD6 B;  1CQ8 A;  2Z67 A;  3RI6 A;  4B98 A;  1DGE A;  4XAU A;  2YKV A;  5LHA A;  3GSB A;  4OC9 A;  3M5U A;  1SF2 A;  2BIA A;  2RFV A;  2W7F A;  3WKR A;  3P6K A;  4MQP A;  2QA3 A;  3IF2 A;  4JE5 A;  3QI6 A;  2OGA A;  2EO5 A;  2VGW A;  2Q7W A;  2VMS A;  1BQD A;  1MLY A;  2D63 A;  4IW7 A;  4U2H A;  1W7N A;  3FQ8 A;  3PIU A;  5EIG B;  4UHM A;  1AY5 A;  2HOR A;  4JEY A;  3D6K A;  3A9X A;  4Q6R A;  1WYT B;  3VK4 A;  2ORD A;  4Q31 A;  1BJO A;  1IUG A;  1MDO A;  2BI3 A;  2BIG A;  5HXX A;  2Z20 A;  1QIR A;  1RV4 A;  2FQ6 A;  2W7G A;  3DR4 A;  4E77 A;  1X29 A;  4ADC A;  1UU2 A;  2YCN A;  1AY4 A;  3PGY A;  3KE3 A;  3MAD A;  4Q75 A;  4R8D A;  1B5P A;  3H14 A;  4IXS A;  4MKJ A;  2JJH A;  1ASB A;  2BKW A;  3JU7 A;  4OYT A;  1LW4 A;  1DJ9 A;  1IJI A;  3FVX A;  3NUB A;  3WCO A;  1YJS A;  3W1J A;  1LS3 A;  2YCP A;  4GEB A;  4ADE A;  1AKA A;  2VMP A;  1ASM A;  1GEW A;  3FFH A;  1YJZ A;  4W8I A;  1AIB A;  3NRA A;  2D5Y A;  1MDZ A;  1O69 A;  1E5F A;  1D7S A;  1VJO A;  4ZDP A;  3PA9 A;  4M2K A;  1G7X A;  3NTJ A;  3WKS A;  4F5F A;  2OGE A;  4TN4 A;  2VGT A;  1BKG A;  1OHW A;  2R0T A;  1ASC A;  5EUD A;  2DGL A;  5C6U A;  4A6R A;  1J04 A;  1BW0 A;  1G7W A;  3PDX A;  2BWN A;  4ZSW A;  2ZY3 A;  2HP1 A;  4IYO A;  4OT8 A;  3BN1 A;  3I16 A;  3DC1 A;  3AOV A;  4MQQ A;  3WY7 A;  1VP4 A;  1IAY A;  1TOJ A;  3BWO A;  2JG2 A;  5HHY A;  3ACZ A;  2XH1 A;  4R5F A;  1Y4I A;  4F5L A;  3NUI A;  2CIN A;  2AY1 A;  4JE5 D;  1GCK A;  1D7R A;  2EGY A;  5K8B A;  2ZYJ A;  4WXF A;  2D64 A;  4IXO A;  4WD2 A;  1CL2 A;  3E2Y A;  4LW2 A;  4HVK A;  3T32 A;  1ARH A;  2CST A;  3A9Z A;  4ISY A;  2W7J A;  1AMA A;  3Q8N A;  2DGK A;  2E7I A;  1U08 A;  3H7F A;  3PJ0 A;  2GQN A;  4WLH A;  1ELU A;  1CQ7 A;  3AEN B;  4AH3 A;  4FFC A;  3L8A A;  2C81 A;  3K28 A;  1GD9 A;  2E7J A;  1O4S A;  4OBU A;  2X5D A;  4GRX A;  2ZY5 A;  5AX8 A;  3JWB A;  1GC3 A;  2AEV A;  3JWA A;  3NU8 A;  1C7G A;  3ECD A;  3HBX A;  5D5S A;  3UAK A;  2VMN A;  4RIT A;  3EIB A;  4MKK A;  2VYC A;  3GJU A;  2VMX A;  3CBF A;  1YIZ A;  2BWP A;  3LG0 A;  2O1B A;  2ZC0 A;  2AY2 A;  3A9Y A;  3UWC A;  1M0O A;  4W1V A;  3DU4 A;  1JS6 A;  4A0H A;  1ASD A;  1CL1 A;  2O7C A;  1RVY A;  1DGD A;  4A0F A;  3ZRP A;  2VIA A;  4AZK A;  3MKJ A;  4JF1 A;  1TOK A;  4F5M A;  5E3K A;  1LC8 A;  1D7U A;  3KKI A;  5HDM A;  2PO3 A;  3NDN A; 
#chains in the Genus database with same CATH topology
 3FFR A;  1AIC A;  3LVJ A;  3FQA A;  3MAU A;  4F5G A;  1C9C A;  2CH2 A;  4RKC A;  3N4R A;  3HT4 A;  3BS8 A;  3QM2 A;  4J5U A;  1AAM A;  3FDB A;  3ZRR A;  1O62 A;  2NMP A;  1MDX A;  1W7M A;  1FG7 A;  2DR1 A;  4WBT A;  1ZC9 A;  3FZ8 A;  3MAF A;  3GR9 A;  2YRI A;  2VMO A;  1QZ9 A;  3NX3 A;  5G4I A;  1XEY A;  3AOW A;  1OXO A;  1AY8 A;  1PMM A;  4WYG A;  3VOM A;  4E1O A;  1BJW A;  2WK8 A;  2TPL A;  3FTB A;  4GE7 A;  4JF0 A;  1AJS A;  1WYU B;  1V2F A;  2VI8 A;  4U1T A;  1M0P A;  4ZAS A;  3R4T A;  1W3U A;  2YRR A;  1S09 A;  3OP7 A;  3GET A;  1B4X A;  2AY3 A;  3TFT A;  2VMU A;  1I41 A;  4KYO A;  3TQX A;  1DTY A;  3TAT A;  2CTZ A;  1ASA A;  4ZDL A;  1AMR A;  3AEJ C;  1D7V A;  2DKJ A;  4WYA A;  4MY5 A;  4A0G A;  4UHO A;  1PG8 A;  3DXW A;  2Z9X A;  2BYJ A;  4MSO A;  2Z61 A;  3E77 A;  1DFO A;  4ZLV A;  1P3W A;  3GZD A;  1I43 A;  3N5M A;  4R5Z A;  3CQ6 A;  1SZK A;  5M49 A;  1XI9 A;  4RJ0 A;  5EUN A;  2Z1Z A;  4LC3 A;  1AHE A;  2W7D A;  3JTX A;  5E4Z A;  5FT8 A;  1LKC A;  1TPL A;  3R9A A;  1BJN A;  1T3I A;  2WKA A;  1TAT A;  3EUC A;  1YIY A;  3NYS A;  3DYD A;  3QN6 A;  4WYE A;  3E6G A;  4UHN A;  1AKB A;  1QJ3 A;  3AEM C;  1GEX A;  2Z1Y A;  4ZAH A;  4K05 A;  4CBR A;  3MC6 C;  5EUE A;  2OAT A;  1WYV B;  3FKD A;  3N75 A;  4RLG A;  4ZSY A;  1X2A A;  4JEZ A;  2FNI A;  1H0C A;  3E2Z A;  4WXG A;  2ZUK A;  2OKJ A;  4WP0 A;  2BI9 A;  3TFU A;  4AOA A;  1N8P A;  2G7J A;  1S07 A;  2C44 A;  1AKC A;  2WK9 A;  1PFF A;  2YKU A;  3FZ7 A;  3KGX A;  4BA5 A;  4ATP A;  2WK7 A;  3VK2 A;  1ARS A;  1V2E A;  4RJY A;  1DJU A;  2BI1 A;  3PDB A;  5BJ3 A;  1B9H A;  7AAT A;  2F8J A;  1BJ4 A;  1WKG A;  3NU7 A;  2ZP7 A;  3FRK A;  4AO9 A;  2AY4 A;  3L44 A;  3RUY A;  4WXB A;  3AV7 A;  3EI7 A;  1X28 A;  3EIA A;  1W7L A;  3B1E A;  1YAA A;  1AHX A;  1ELQ A;  2FNU A;  1ORD A;  4A6U A;  1O61 A;  3HL2 A;  4AO4 A;  1B5O A;  2Z9U A;  2HZP A;  1ASG A;  4EMY A;  1WYU A;  3CAI A;  3FQ7 A;  1IVR A;  2DGM A;  2JIS A;  3BWN C;  5FT6 A;  5LH9 A;  2C7T A;  2VLF A;  1KKJ A;  2G6W A;  1M0Q A;  1SVV A;  2BHX A;  3ELP A;  4DGT A;  3PPL A;  2OQX A;  1MAQ A;  2VGZ A;  3DXV A;  3KGW A;  4W1X A;  4XJP A;  1AIA A;  2W7I A;  5M4D A;  1WST A;  2FYF A;  2OKK A;  5F9S A;  1C7N A;  3AEN A;  4AZJ A;  1BT4 A;  1DKA A;  2AAT A;  3W1H A;  2GMU A;  3LVL B;  3IHJ A;  8AAT A;  2EZ1 A;  1N2T A;  1FC4 A;  2PB2 A;  2XBN A;  2BI2 A;  4MQR A;  4ZWM A;  1S06 A;  1AMQ A;  4WB0 A;  3TCM A;  1ARI A;  1CS1 A;  2YKX A;  2JJE A;  3DOD A;  1IBJ A;  4F5H A;  2E54 A;  1AHF A;  3ZZJ A;  3PAA A;  3BCB A;  4N0B A;  4CXQ A;  3NNK A;  2ZY2 A;  2D7Z A;  3HQT A;  1PMO A;  1ZOB A;  4XJO A;  4ADD A;  1JS3 A;  1TAR A;  2VIB A;  1ART A;  4GDY A;  1Z3Z A;  4ZDO A;  1Z7D A;  1QIT A;  1GBN A;  2W8V A;  3LWS A;  2ZY4 A;  4Y0I A;  3QPG A;  4N0W A;  3RCH B;  2EYQ A;  4K2B A;  2CB1 A;  3RQ1 A;  4F5J A;  1KAF A;  1ZOD A;  1CQ6 A;  4MGR A;  2VMV A;  1S0A A;  3AEO A;  3BCX A;  1WYT A;  3BV0 A;  2W7H A;  4TV7 A;  2YCT A;  1EJI A;  4XK1 A;  5EIG A;  3ASA A;  2VMQ A;  4OCA A;  3I4J A;  3B46 A;  2R5E A;  2W7K A;  3I5T A;  2VMW A;  1EG5 A;  1RV3 A;  4NOG A;  3QBO A;  1IX6 A;  1UKJ A;  1WKH A;  2HUF A;  5EAV A;  1WYV A;  5EAA A;  3JZL A;  4KXK A;  1LC7 A;  2BIE A;  4CBS A;  3DR7 A;  4H51 A;  4K2I A;  4KAM A;  2VGS A;  4LNM A;  3PD6 A;  3HDO A;  2AY6 A;  3MEB A;  2CJG A;  2W8W A;  3QHX A;  2W7M A;  1M4N A;  3K7Y A;  4B9B A;  5FT4 A;  2PB0 A;  1QGN A;  3USF A;  4UQV A;  3N4X A;  1GDE A;  2QBT A;  2X3L A;  1OXP A;  3K40 A;  4Y0H A;  5J8Q A;  2FKI A;  2ZSM A;  1JF9 A;  3EI6 A;  3LVK A;  2YHK A;  3QGU A;  4OBV A;  2VGV A;  1M6S A;  1B8G A;  1KKP A;  1X0M A;  5D95 A;  1JG8 A;  1TOG A;  1IAX A;  4EB5 A;  2E7U A;  1FG3 A;  3FCR A;  2Z9W A;  1BJO B;  2YKY A;  2C0R A;  1E5E A;  3E9K A;  4UOY A;  4XEW A;  4A0R A;  1AMS A;  1TAS A;  2AY7 A;  1MAP A;  2W7L A;  3HVY A;  5DJ1 A;  2KFP A;  4P3M A;  2HOZ A;  4HF8 A;  3OKS A;  2GSA A;  3EZS A;  4A6T A;  4DQ6 A;  1UU0 A;  1H1C A;  2VLH A;  4Q76 A;  3F0H A;  1QIS A;  4K2M A;  3RBL A;  1N31 A;  4CVQ A;  4LNJ A;  1MGV A;  4ZM3 A;  2HOX A;  1MLZ A;  4GSA A;  3N7N A;  2CJH A;  3BC8 A;  1LK9 A;  3FSL A;  4WLJ A;  1OHV A;  3WZF A;  1YNU A;  3ZRQ A;  1B9I A;  4EFF A;  1SPA A;  4RAE A;  5BJ4 A;  2BI5 A;  2AY9 A;  1IX7 A;  2W7E A;  4EU1 A;  1M0N A;  4RIZ A;  4LNL A;  1CJ0 A;  2VMZ A;  4ADB A;  1RVU A;  1KL1 A;  1GC0 A;  2GB3 A;  3AAT A;  3G7Q A;  4JEW A;  4ZM4 A;  1AHY A;  1KMJ A;  2HP2 A;  5F8V A;  3GBX A;  5DX5 A;  2GMS A;  3ISL A;  4XQ2 A;  4BHD A;  1ASN A;  3H9X A;  1YOO A;  2R2N A;  2VI9 A;  3FDD A;  3F9T A;  1QJ5 A;  1J32 A;  1M7Y A;  5G2P A;  2FN6 A;  3VK3 A;  1AJS B;  1GEY A;  3RBF A;  4Y0D A;  1BS0 A;  1D2F A;  2JJF A;  4JEX A;  2HOY A;  2O0R A;  2X8U A;  3ASB A;  3B1C A;  4WYF A;  4TMR A;  4R2N A;  5EFS A;  3W1I A;  4PVF A;  3MAF B;  2VMY A;  3WGC A;  3CQ4 A;  2Z9V A;  3EI8 A;  2VMT A;  3ELE A;  2R5C B;  5TF5 A;  3ZZK A;  2HUU A;  3FVS A;  3FD0 A;  1AJR A;  4QGR A;  1W23 A;  4F4E A;  3GZD C;  2QMA A;  4P7Y A;  1KMK A;  4WYC A;  2WB6 A;  2AEU A;  3NYT A;  4BA4 A;  1G4V A;  2W8J A;  2HUI A;  2QB3 A;  3HLM A;  4ATQ A;  2AY8 A;  1TOI A;  2QLR A;  3HMU A;  3LV2 A;  2CH1 A;  2W8U A;  4GE9 A;  9AAT A;  3FZ6 A;  1GC4 A;  2D66 A;  5M4B A;  3RCH A;  2ZJG A;  4A00 A;  4BMK A;  1IX8 A;  2FM1 A;  3LVM A;  3N0L A;  2DOU A;  4IX8 A;  3ATH A;  4W91 A;  1OHY A;  4PIW A;  2DKB A;  3VAX A;  5M46 A;  1ARG A;  4FL0 A;  4F5K A;  2JJG A;  1ASF A;  2V0Y A;  4O6Z A;  2V1P A;  1I29 A;  4EB7 A;  1AHG A;  1M32 A;  3FVU A;  5DJ9 A;  1V72 A;  3BB8 A;  3WLX A;  4ZWV A;  4W5K A;  1GC2 A;  4BQ0 A;  5G4J A;  1C7O A;  3AEJ A;  3A2B A;  2YOB A;  4WB0 B;  3WX9 A;  3JW9 A;  4WYD A;  1KL2 A;  1VEF A;  4XJL A;  4I8A A;  4ITG A;  2AY5 A;  4LW4 A;  4GE4 A;  4PFF A;  4F5I A;  2BWO A;  1C0N A;  5JAY A;  3G0T A;  1C4K A;  1OAT A;  2R5C A;  3A8U X;  1CZC A;  2CFB A;  3EZ1 A;  3NYU A;  3MBB A;  4M2M A;  1V2D A;  1BQA A;  5DB5 A;  2CJD A;  1I48 A;  3CQ5 A;  4PFN A;  3E2F A;  4RKD A;  4E3Q A;  5I92 A;  4XJM A;  1SZU A;  4J8L A;  4L0O A;  5FT5 A;  3F6T A;  3B8X A;  2X5F A;  1CZE A;  1TOE A;  3BWN A;  3AEL A;  4DBC A;  3WGB A;  2VGU A;  3LY1 A;  3AEM A;  4OMA A;  2CY8 A;  2BYL A;  5G0A A;  5G09 A;  1AX4 A;  5E5I A;  1ASL A;  4OTL A;  1G4X A;  1EQB A;  3MC6 A;  3WCN A;  1LC5 A;  3GZC A;  1ECX A;  4IY7 A;  1SFF A;  2JGT A;  3GWP A;  3DRD A;  4W1W A;  3B1D A;  1YJY A;  3PDB B;  4IYO B;  4M2J A;  5IWQ A;  2QB2 A;  3EI5 A;  5G2Q A;  1ASE A;  2EZ2 A;  4RM1 A;  3DZZ A;  4JEV A;  2EH6 A;  3BCA A;  4CXR A;  3II0 A;  3AEP A;  5KTB A;  1S08 A;  3VP6 A;  4E3R A;  3EI9 A;  2W8T A;  4A72 A;  3COG A;  2EPJ A;  1DJE A;  2VMR A;  1LW5 A;  2D65 A;  3E2Z B;  1SZS A;  2ZSL A;  4IXZ A;  5EQC A;  3UE8 A;  2D61 A;  2D7Y A;  4ITX A;  1UU1 A;  2CAN A;  1AAW A;  3P1T A;  3G8M A;  3PD6 B;  1CQ8 A;  2Z67 A;  3RI6 A;  4B98 A;  1DGE A;  4XAU A;  2YKV A;  5LHA A;  3GSB A;  4OC9 A;  3M5U A;  1SF2 A;  2BIA A;  2RFV A;  2W7F A;  3WKR A;  3P6K A;  4MQP A;  2QA3 A;  3IF2 A;  4JE5 A;  3QI6 A;  2OGA A;  2EO5 A;  2VGW A;  2Q7W A;  2VMS A;  1BQD A;  1MLY A;  2D63 A;  4IW7 A;  4U2H A;  1W7N A;  3FQ8 A;  3PIU A;  5EIG B;  4UHM A;  1AY5 A;  2HOR A;  4JEY A;  3D6K A;  3A9X A;  4Q6R A;  1WYT B;  3VK4 A;  2ORD A;  4Q31 A;  1BJO A;  1IUG A;  1MDO A;  2BI3 A;  2BIG A;  5HXX A;  2Z20 A;  1QIR A;  3N4S A;  1RV4 A;  2FQ6 A;  2W7G A;  3DR4 A;  4E77 A;  1X29 A;  4ADC A;  1UU2 A;  2YCN A;  1AY4 A;  3PGY A;  3KE3 A;  3MAD A;  4Q75 A;  4R8D A;  1B5P A;  3H14 A;  2QSR A;  4IXS A;  4MKJ A;  2JJH A;  1ASB A;  2BKW A;  3JU7 A;  4OYT A;  1LW4 A;  1DJ9 A;  1IJI A;  3FVX A;  3NUB A;  3WCO A;  1YJS A;  3W1J A;  1LS3 A;  2YCP A;  4GEB A;  4ADE A;  1AKA A;  2VMP A;  1ASM A;  1GEW A;  3FFH A;  1YJZ A;  4W8I A;  1AIB A;  3NRA A;  2D5Y A;  1MDZ A;  1O69 A;  1E5F A;  1D7S A;  1VJO A;  4ZDP A;  3PA9 A;  4M2K A;  1G7X A;  3NTJ A;  3WKS A;  4F5F A;  2OGE A;  4TN4 A;  2VGT A;  1BKG A;  1OHW A;  2R0T A;  1ASC A;  5EUD A;  2DGL A;  5C6U A;  4A6R A;  1J04 A;  1BW0 A;  1G7W A;  3PDX A;  2BWN A;  4ZSW A;  2ZY3 A;  2HP1 A;  4IYO A;  4OT8 A;  3BN1 A;  3I16 A;  3DC1 A;  3AOV A;  4MQQ A;  3WY7 A;  1VP4 A;  1IAY A;  1TOJ A;  3BWO A;  2JG2 A;  5HHY A;  3ACZ A;  2XH1 A;  4R5F A;  1Y4I A;  4F5L A;  3NUI A;  2CIN A;  2AY1 A;  4JE5 D;  1GCK A;  1D7R A;  2EGY A;  5K8B A;  2ZYJ A;  4WXF A;  2D64 A;  4IXO A;  4WD2 A;  1CL2 A;  3E2Y A;  4LW2 A;  4HVK A;  3T32 A;  1ARH A;  2CST A;  3A9Z A;  4ISY A;  2W7J A;  1AMA A;  3Q8N A;  2DGK A;  2E7I A;  1U08 A;  3H7F A;  3PJ0 A;  2GQN A;  4WLH A;  1ELU A;  1CQ7 A;  3AEN B;  4AH3 A;  4FFC A;  3L8A A;  2C81 A;  3K28 A;  1GD9 A;  2E7J A;  1O4S A;  4OBU A;  2X5D A;  4H63 Q;  4GRX A;  2ZY5 A;  5AX8 A;  3JWB A;  1GC3 A;  2AEV A;  3JWA A;  3NU8 A;  1C7G A;  3ECD A;  3HBX A;  5D5S A;  2A1V A;  3UAK A;  2VMN A;  4RIT A;  3EIB A;  4MKK A;  2VYC A;  3GJU A;  2VMX A;  3CBF A;  1YIZ A;  2BWP A;  3LG0 A;  2O1B A;  2ZC0 A;  2AY2 A;  3A9Y A;  3UWC A;  1M0O A;  4W1V A;  3DU4 A;  1JS6 A;  4A0H A;  1ASD A;  1CL1 A;  2O7C A;  1RVY A;  1DGD A;  4A0F A;  3ZRP A;  2VIA A;  4AZK A;  3MKJ A;  4JF1 A;  1TOK A;  4F5M A;  5E3K A;  1LC8 A;  1D7U A;  3KKI A;  5HDM A;  2PO3 A;  3NDN A; 
#chains in the Genus database with same CATH homology
 3FFR A;  1AIC A;  3LVJ A;  3FQA A;  3MAU A;  4F5G A;  1C9C A;  2CH2 A;  4RKC A;  3N4R A;  3HT4 A;  3BS8 A;  3QM2 A;  4J5U A;  1AAM A;  3FDB A;  3ZRR A;  1O62 A;  2NMP A;  1MDX A;  1W7M A;  1FG7 A;  2DR1 A;  4WBT A;  1ZC9 A;  3FZ8 A;  3MAF A;  3GR9 A;  2YRI A;  2VMO A;  1QZ9 A;  3NX3 A;  5G4I A;  1XEY A;  3AOW A;  1OXO A;  1AY8 A;  1PMM A;  4WYG A;  3VOM A;  4E1O A;  1BJW A;  2WK8 A;  2TPL A;  3FTB A;  4GE7 A;  4JF0 A;  1AJS A;  1WYU B;  1V2F A;  2VI8 A;  4U1T A;  1M0P A;  4ZAS A;  3R4T A;  1W3U A;  2YRR A;  1S09 A;  3OP7 A;  3GET A;  1B4X A;  2AY3 A;  3TFT A;  2VMU A;  1I41 A;  4KYO A;  3TQX A;  1DTY A;  3TAT A;  2CTZ A;  1ASA A;  4ZDL A;  1AMR A;  3AEJ C;  1D7V A;  2DKJ A;  4WYA A;  4MY5 A;  4A0G A;  4UHO A;  1PG8 A;  3DXW A;  2Z9X A;  2BYJ A;  4MSO A;  2Z61 A;  3E77 A;  1DFO A;  4ZLV A;  1P3W A;  3GZD A;  1I43 A;  3N5M A;  4R5Z A;  3CQ6 A;  1SZK A;  5M49 A;  1XI9 A;  4RJ0 A;  5EUN A;  2Z1Z A;  4LC3 A;  1AHE A;  2W7D A;  3JTX A;  5E4Z A;  5FT8 A;  1LKC A;  1TPL A;  3R9A A;  1BJN A;  1T3I A;  2WKA A;  1TAT A;  3EUC A;  1YIY A;  3NYS A;  3DYD A;  3QN6 A;  4WYE A;  3E6G A;  4UHN A;  1AKB A;  1QJ3 A;  3AEM C;  1GEX A;  2Z1Y A;  4ZAH A;  4K05 A;  4CBR A;  3MC6 C;  5EUE A;  2OAT A;  1WYV B;  3FKD A;  3N75 A;  4RLG A;  4ZSY A;  1X2A A;  4JEZ A;  2FNI A;  1H0C A;  3E2Z A;  4WXG A;  2ZUK A;  2OKJ A;  4WP0 A;  2BI9 A;  3TFU A;  4AOA A;  1N8P A;  2G7J A;  1S07 A;  2C44 A;  1AKC A;  2WK9 A;  1PFF A;  2YKU A;  3FZ7 A;  3KGX A;  4BA5 A;  4ATP A;  2WK7 A;  3VK2 A;  1ARS A;  1V2E A;  4RJY A;  1DJU A;  2BI1 A;  3PDB A;  5BJ3 A;  1B9H A;  7AAT A;  2F8J A;  1BJ4 A;  1WKG A;  3NU7 A;  2ZP7 A;  3FRK A;  4AO9 A;  2AY4 A;  3L44 A;  3RUY A;  4WXB A;  3AV7 A;  3EI7 A;  1X28 A;  3EIA A;  1W7L A;  3B1E A;  1YAA A;  1AHX A;  1ELQ A;  2FNU A;  1ORD A;  4A6U A;  1O61 A;  3HL2 A;  4AO4 A;  1B5O A;  2Z9U A;  2HZP A;  1ASG A;  4EMY A;  1WYU A;  3CAI A;  3FQ7 A;  1IVR A;  2DGM A;  2JIS A;  3BWN C;  5FT6 A;  5LH9 A;  2C7T A;  2VLF A;  1KKJ A;  2G6W A;  1M0Q A;  1SVV A;  2BHX A;  3ELP A;  4DGT A;  3PPL A;  2OQX A;  1MAQ A;  2VGZ A;  3DXV A;  3KGW A;  4W1X A;  4XJP A;  1AIA A;  2W7I A;  5M4D A;  1WST A;  2FYF A;  2OKK A;  5F9S A;  1C7N A;  3AEN A;  4AZJ A;  1BT4 A;  1DKA A;  2AAT A;  3W1H A;  2GMU A;  3LVL B;  3IHJ A;  8AAT A;  2EZ1 A;  1N2T A;  1FC4 A;  2PB2 A;  2XBN A;  2BI2 A;  4MQR A;  4ZWM A;  1S06 A;  1AMQ A;  4WB0 A;  3TCM A;  1ARI A;  1CS1 A;  2YKX A;  2JJE A;  3DOD A;  1IBJ A;  4F5H A;  2E54 A;  1AHF A;  3ZZJ A;  3PAA A;  3BCB A;  4N0B A;  4CXQ A;  3NNK A;  2ZY2 A;  2D7Z A;  3HQT A;  1PMO A;  1ZOB A;  4XJO A;  4ADD A;  1JS3 A;  1TAR A;  2VIB A;  1ART A;  4GDY A;  1Z3Z A;  4ZDO A;  1Z7D A;  1QIT A;  1GBN A;  2W8V A;  3LWS A;  2ZY4 A;  4Y0I A;  3QPG A;  4N0W A;  3RCH B;  2EYQ A;  4K2B A;  2CB1 A;  3RQ1 A;  4F5J A;  1ZOD A;  1CQ6 A;  4MGR A;  2VMV A;  1S0A A;  3AEO A;  3BCX A;  1WYT A;  3BV0 A;  2W7H A;  4TV7 A;  2YCT A;  1EJI A;  4XK1 A;  5EIG A;  3ASA A;  2VMQ A;  4OCA A;  3I4J A;  3B46 A;  2R5E A;  2W7K A;  3I5T A;  2VMW A;  1EG5 A;  1RV3 A;  4NOG A;  3QBO A;  1IX6 A;  1UKJ A;  1WKH A;  2HUF A;  5EAV A;  1WYV A;  5EAA A;  3JZL A;  4KXK A;  1LC7 A;  2BIE A;  4CBS A;  3DR7 A;  4H51 A;  4K2I A;  4KAM A;  2VGS A;  4LNM A;  3PD6 A;  3HDO A;  2AY6 A;  3MEB A;  2CJG A;  2W8W A;  3QHX A;  2W7M A;  1M4N A;  3K7Y A;  4B9B A;  5FT4 A;  2PB0 A;  1QGN A;  3USF A;  4UQV A;  3N4X A;  1GDE A;  2QBT A;  2X3L A;  1OXP A;  3K40 A;  4Y0H A;  5J8Q A;  2FKI A;  2ZSM A;  1JF9 A;  3EI6 A;  3LVK A;  2YHK A;  3QGU A;  4OBV A;  2VGV A;  1M6S A;  1B8G A;  1KKP A;  1X0M A;  5D95 A;  1JG8 A;  1TOG A;  1IAX A;  4EB5 A;  2E7U A;  1FG3 A;  3FCR A;  2Z9W A;  1BJO B;  2YKY A;  2C0R A;  1E5E A;  3E9K A;  4UOY A;  4XEW A;  4A0R A;  1AMS A;  1TAS A;  2AY7 A;  1MAP A;  2W7L A;  3HVY A;  5DJ1 A;  2KFP A;  4P3M A;  2HOZ A;  4HF8 A;  3OKS A;  2GSA A;  3EZS A;  4A6T A;  4DQ6 A;  1UU0 A;  1H1C A;  2VLH A;  4Q76 A;  3F0H A;  1QIS A;  4K2M A;  3RBL A;  1N31 A;  4CVQ A;  4LNJ A;  1MGV A;  4ZM3 A;  2HOX A;  1MLZ A;  4GSA A;  3N7N A;  2CJH A;  3BC8 A;  1LK9 A;  3FSL A;  4WLJ A;  1OHV A;  3WZF A;  1YNU A;  3ZRQ A;  1B9I A;  4EFF A;  1SPA A;  4RAE A;  5BJ4 A;  2BI5 A;  2AY9 A;  1IX7 A;  2W7E A;  4EU1 A;  1M0N A;  4RIZ A;  4LNL A;  1CJ0 A;  2VMZ A;  4ADB A;  1RVU A;  1KL1 A;  1GC0 A;  2GB3 A;  3AAT A;  3G7Q A;  4JEW A;  4ZM4 A;  1AHY A;  1KMJ A;  2HP2 A;  5F8V A;  3GBX A;  5DX5 A;  2GMS A;  3ISL A;  4XQ2 A;  4BHD A;  1ASN A;  3H9X A;  1YOO A;  2R2N A;  2VI9 A;  3FDD A;  3F9T A;  1QJ5 A;  1J32 A;  1M7Y A;  5G2P A;  2FN6 A;  3VK3 A;  1AJS B;  1GEY A;  3RBF A;  4Y0D A;  1BS0 A;  1D2F A;  2JJF A;  4JEX A;  2HOY A;  2O0R A;  2X8U A;  3ASB A;  3B1C A;  4WYF A;  4TMR A;  4R2N A;  5EFS A;  3W1I A;  4PVF A;  3MAF B;  2VMY A;  3WGC A;  3CQ4 A;  2Z9V A;  3EI8 A;  2VMT A;  3ELE A;  2R5C B;  5TF5 A;  3ZZK A;  2HUU A;  3FVS A;  3FD0 A;  1AJR A;  4QGR A;  1W23 A;  4F4E A;  3GZD C;  2QMA A;  4P7Y A;  1KMK A;  4WYC A;  2WB6 A;  2AEU A;  3NYT A;  4BA4 A;  1G4V A;  2W8J A;  2HUI A;  2QB3 A;  3HLM A;  4ATQ A;  2AY8 A;  1TOI A;  2QLR A;  3HMU A;  3LV2 A;  2CH1 A;  2W8U A;  4GE9 A;  9AAT A;  3FZ6 A;  1GC4 A;  2D66 A;  5M4B A;  3RCH A;  2ZJG A;  4A00 A;  4BMK A;  1IX8 A;  2FM1 A;  3LVM A;  3N0L A;  2DOU A;  4IX8 A;  3ATH A;  4W91 A;  1OHY A;  4PIW A;  2DKB A;  3VAX A;  5M46 A;  1ARG A;  4FL0 A;  4F5K A;  2JJG A;  1ASF A;  2V0Y A;  4O6Z A;  2V1P A;  1I29 A;  4EB7 A;  1AHG A;  1M32 A;  3FVU A;  5DJ9 A;  1V72 A;  3BB8 A;  3WLX A;  4ZWV A;  4W5K A;  1GC2 A;  4BQ0 A;  5G4J A;  1C7O A;  3AEJ A;  3A2B A;  2YOB A;  4WB0 B;  3WX9 A;  3JW9 A;  4WYD A;  1KL2 A;  1VEF A;  4XJL A;  4I8A A;  4ITG A;  2AY5 A;  4LW4 A;  4GE4 A;  4PFF A;  4F5I A;  2BWO A;  1C0N A;  5JAY A;  3G0T A;  1C4K A;  1OAT A;  2R5C A;  3A8U X;  1CZC A;  2CFB A;  3EZ1 A;  3NYU A;  3MBB A;  4M2M A;  1V2D A;  1BQA A;  5DB5 A;  2CJD A;  1I48 A;  3CQ5 A;  4PFN A;  3E2F A;  4RKD A;  4E3Q A;  5I92 A;  4XJM A;  1SZU A;  4J8L A;  4L0O A;  5FT5 A;  3F6T A;  3B8X A;  2X5F A;  1CZE A;  1TOE A;  3BWN A;  3AEL A;  4DBC A;  3WGB A;  2VGU A;  3LY1 A;  3AEM A;  4OMA A;  2CY8 A;  2BYL A;  5G0A A;  5G09 A;  1AX4 A;  5E5I A;  1ASL A;  4OTL A;  1G4X A;  1EQB A;  3MC6 A;  3WCN A;  1LC5 A;  3GZC A;  1ECX A;  4IY7 A;  1SFF A;  2JGT A;  3GWP A;  3DRD A;  4W1W A;  3B1D A;  1YJY A;  3PDB B;  4IYO B;  4M2J A;  5IWQ A;  2QB2 A;  3EI5 A;  5G2Q A;  1ASE A;  2EZ2 A;  4RM1 A;  3DZZ A;  4JEV A;  2EH6 A;  3BCA A;  4CXR A;  3II0 A;  3AEP A;  5KTB A;  1S08 A;  3VP6 A;  4E3R A;  3EI9 A;  2W8T A;  4A72 A;  3COG A;  2EPJ A;  1DJE A;  2VMR A;  1LW5 A;  2D65 A;  3E2Z B;  1SZS A;  2ZSL A;  4IXZ A;  5EQC A;  3UE8 A;  2D61 A;  2D7Y A;  4ITX A;  1UU1 A;  2CAN A;  1AAW A;  3P1T A;  3G8M A;  3PD6 B;  1CQ8 A;  2Z67 A;  3RI6 A;  4B98 A;  1DGE A;  4XAU A;  2YKV A;  5LHA A;  3GSB A;  4OC9 A;  3M5U A;  1SF2 A;  2BIA A;  2RFV A;  2W7F A;  3WKR A;  3P6K A;  4MQP A;  2QA3 A;  3IF2 A;  4JE5 A;  3QI6 A;  2OGA A;  2EO5 A;  2VGW A;  2Q7W A;  2VMS A;  1BQD A;  1MLY A;  2D63 A;  4IW7 A;  4U2H A;  1W7N A;  3FQ8 A;  3PIU A;  5EIG B;  4UHM A;  1AY5 A;  2HOR A;  4JEY A;  3D6K A;  3A9X A;  4Q6R A;  1WYT B;  3VK4 A;  2ORD A;  4Q31 A;  1BJO A;  1IUG A;  1MDO A;  2BI3 A;  2BIG A;  5HXX A;  2Z20 A;  1QIR A;  3N4S A;  1RV4 A;  2FQ6 A;  2W7G A;  3DR4 A;  4E77 A;  1X29 A;  4ADC A;  1UU2 A;  2YCN A;  1AY4 A;  3PGY A;  3KE3 A;  3MAD A;  4Q75 A;  4R8D A;  1B5P A;  3H14 A;  2QSR A;  4IXS A;  4MKJ A;  2JJH A;  1ASB A;  2BKW A;  3JU7 A;  4OYT A;  1LW4 A;  1DJ9 A;  1IJI A;  3FVX A;  3NUB A;  3WCO A;  1YJS A;  3W1J A;  1LS3 A;  2YCP A;  4GEB A;  4ADE A;  1AKA A;  2VMP A;  1ASM A;  1GEW A;  3FFH A;  1YJZ A;  4W8I A;  1AIB A;  3NRA A;  2D5Y A;  1MDZ A;  1O69 A;  1E5F A;  1D7S A;  1VJO A;  4ZDP A;  3PA9 A;  4M2K A;  1G7X A;  3NTJ A;  3WKS A;  4F5F A;  2OGE A;  4TN4 A;  2VGT A;  1BKG A;  1OHW A;  2R0T A;  1ASC A;  5EUD A;  2DGL A;  5C6U A;  4A6R A;  1J04 A;  1BW0 A;  1G7W A;  3PDX A;  2BWN A;  4ZSW A;  2ZY3 A;  2HP1 A;  4IYO A;  4OT8 A;  3BN1 A;  3I16 A;  3DC1 A;  3AOV A;  4MQQ A;  3WY7 A;  1VP4 A;  1IAY A;  1TOJ A;  3BWO A;  2JG2 A;  5HHY A;  3ACZ A;  2XH1 A;  4R5F A;  1Y4I A;  4F5L A;  3NUI A;  2CIN A;  2AY1 A;  4JE5 D;  1GCK A;  1D7R A;  2EGY A;  5K8B A;  2ZYJ A;  4WXF A;  2D64 A;  4IXO A;  4WD2 A;  1CL2 A;  3E2Y A;  4LW2 A;  4HVK A;  3T32 A;  1ARH A;  2CST A;  3A9Z A;  4ISY A;  2W7J A;  1AMA A;  3Q8N A;  2DGK A;  2E7I A;  1U08 A;  3H7F A;  3PJ0 A;  2GQN A;  4WLH A;  1ELU A;  1CQ7 A;  3AEN B;  4AH3 A;  4FFC A;  3L8A A;  2C81 A;  3K28 A;  1GD9 A;  2E7J A;  1O4S A;  4OBU A;  2X5D A;  4H63 Q;  4GRX A;  2ZY5 A;  5AX8 A;  3JWB A;  1GC3 A;  2AEV A;  3JWA A;  3NU8 A;  1C7G A;  3ECD A;  3HBX A;  5D5S A;  2A1V A;  3UAK A;  2VMN A;  4RIT A;  3EIB A;  4MKK A;  2VYC A;  3GJU A;  2VMX A;  3CBF A;  1YIZ A;  2BWP A;  3LG0 A;  2O1B A;  2ZC0 A;  2AY2 A;  3A9Y A;  3UWC A;  1M0O A;  4W1V A;  3DU4 A;  1JS6 A;  4A0H A;  1ASD A;  1CL1 A;  2O7C A;  1RVY A;  1DGD A;  4A0F A;  3ZRP A;  2VIA A;  4AZK A;  3MKJ A;  4JF1 A;  1TOK A;  4F5M A;  5E3K A;  1LC8 A;  1D7U A;  3KKI A;  5HDM A;  2PO3 A;  3NDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...