2WK9A

Structure of plp_thr aldimine form of vibrio cholerae cqsa
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
386
structure length
382
Chain Sequence
PQLPDFIQNKIDHYIENYFDNGKHLVLGKQASPDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAI-1 AUTOINDUCER SYNTHASE
publication title Insights Into the Biosynthesis of the Vibrio Cholerae Major Autoinducer Cai-1 from the Crystal Structure of the Plp-Dependent Enzyme Cqsa.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
total genus 133
structure length 382
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.3.-.-:
pdb deposition date 2009-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2wk9A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2wk9A01
2ZJGA 4W5KA 2BIGA 1WKHA 1MLYA 2BYLA 2D5YA 2EH6A 4AH3A 5M46A 4ZM3A 3BC8A 4M2KA 3DRDA 1AHXA 1AY5A 1UU0A 2R5EA 4GE4A 1AX4A 1BJNA 2G6WA 4Q76A 2BI2A 3DR7A 2Z9UA 3TATA 4A0GA 1WYUB 1GBNA 4CBSA 4WB0B 3JWAA 3FFRA 4R8DA 5EAAA 1UKJA 3TFUA 2AEVA 2BYJA 4OCAA 3R9AA 4A6UA 1ARHA 2DKBA 2D61A 2OATA 3RCHB 1AMQA 1LC8A 3WKRA 1U08A 1Z3ZA 3A9XA 3K7YA 4EB7A 1D2FA 4R2NA 3HMUA 1X29A 3GWPA 4OMAA 1E5FA 3CBFA 1RVUA 2VLHA 3NDNA 3DODA 4IXZA 3AOWA 1WYTB 4TV7A 4R5ZA 3I4JA 3MAFA 2BI1A 3QI6A 4XJPA 2BKWA 2FNIA 4JF0A 2BWPA 4IXOA 4ZWMA 2D64A 2YKVA 1IBJA 3P1TA 3JWBA 1YJSA 2GB3A 2QLRA 1B9IA 2CB1A 3NU7A 4IXSA 4A6RA 4F5IA 2BI3A 3ECDA 2CH1A 1J32A 2BIEA 2VYCA 4ZDPA 2QBTA 5E4ZA 3LV2A 3UAKA 2QA3A 4GEBA 4GDYA 4PIWA 2HP1A 1BJOA 5G2QA 1CQ8A 3A8UX 1QGNA 2AY9A 2VMOA 2PO3A 2QB2A 3HT4A 4HVKA 1ASMA 4W91A 1ARGA 1ASGA 2OQXA 3FZ6A 3GSBA 4ZSWA 4A0RA 2DGMA 4ADEA 5LH9A 4KYOA 3EI6A 3TCMA 3AELA 1CL2A 2O0RA 4AO9A 4N0WA 3G8MA 1AAMA 5TF5A 2HUFA 3AEMA 2EO5A 2YCPA 4IY7A 2BI9A 1WYVB 1M0NA 2JJGA 1TOJA 2ZY4A 4RKDA 3NYSA 2PB0A 1RVYA 5EQCA 9AATA 1QZ9A 3FZ8A 3PAAA 1YAAA 1WYUA 4RJ0A 4E3RA 2VI9A 1GD9A 4J5UA 3ZRRA 4U2HA 4JE5A 2JJEA 4WYAA 4MQPA 1GCKA 1W7LA 3DR4A 3LVJA 3MADA 4OT8A 3ZRQA 2VMQA 2X5FA 2BI5A 2CINA 2CSTA 4OYTA 2WKAA 3D6KA 4XEWA 3FDDA 2YRRA 4IW7A 2YCTA 5K8BA 1X2AA 2X5DA 1BQDA 2W8TA 2FQ6A 1AHFA 3VOMA 1SPAA 2JGTA 3PIUA 1MAPA 4RLGA 1S06A 4XJOA 4WYFA 3L8AA 1ECXA 5HHYA 2C7TA 4ITXA 2VGUA 5E3KA 5DJ1A 2W7LA 1Y4IA 3FDBA 2Z1YA 2JJFA 5M49A 2HORA 3MEBA 4Y0IA 4ZWVA 3EI5A 1PMMA 2Z1ZA 1IAYA 1CL1A 1AMSA 2W8UA 4PFNA 4XAUA 2XH1A 1ZOBA 2GMUA 2VIAA 3ASBA 1SZSA 2W7EA 4EFFA 5EUNA 1OHWA 3HDOA 3VK3A 4JEXA 3DU4A 3BS8A 3WZFA 4F5HA 5JAYA 1BJ4A 3CAIA 2PB2A 1S09A 2VMSA 2W8JA 4R5FA 3GZDA 3G0TA 1QIRA 2FNUA 1AICA 2FM1A 3BV0A 1DFOA 1LW5A 2VGVA 2HOZA 2ZYJA 3UE8A 1YJYA 1YIYA 1UU2A 1WYVA 4TN4A 2W7GA 2BWNA 3WCOA 4CXRA 2R5CB 1TOKA 3QM2A 5E5IA 4DBCA 1D7UA 4W1WA 2AY6A 2EGYA 3FVXA 3VK4A 1I48A 1OHYA 2V1PA 4LNLA 3EI8A 4ZSYA 1GEXA 3QHXA 1GDEA 2DGKA 4WXGA 3PJ0A 4MQRA 1MLZA 3II0A 4AOAA 3W1JA 1W7MA 2W8VA 3FTBA 4RJYA 1D7VA 4JE5D 4WYDA 2E7IA 4HF8A 4GSAA 3RQ1A 3DXWA 3ZZKA 2DR1A 2VMZA 1M7YA 3FD0A 2GMSA 4OTLA 2D66A 1JS6A 1V72A 2VGZA 1SZKA 1X28A 3EZ1A 4KXKA 4F5LA 1WKGA 1SF2A 4A6TA 2C81A 1LW4A 1SZUA 3I16A 3WGCA 4BHDA 3VK2A 4E77A 1CS1A 2BHXA 1VEFA 1UU1A 3E77A 4WYEA 4ZAHA 1V2FA 3LVMA 2ZY5A 1B5OA 3AEJC 3FVUA 4K2BA 3TQXA 5DX5A 3DXVA 4LW4A 1AHGA 4RAEA 5EUDA 2QB3A 1WSTA 1IVRA 2E54A 1D7RA 2JJHA 4A0FA 4FFCA 2VMRA 2D7ZA 1MGVA 3EUCA 1P3WA 4MQQA 4UHOA 1J04A 1ASCA 3DZZA 4LW2A 1FG7A 1ASDA 1ASFA 3F9TA 3FRKA 1W3UA 1LC7A 4M2JA 1IX7A 4PVFA 5G0AA 4GRXA 4P3MA 2Z9XA 1EG5A 2CANA 4UQVA 5F8VA 3CQ5A 1AJRA 1DGDA 3B46A 5D5SA 3GR9A 3HQTA 4MSOA 2ZUKA 1QISA 2Z67A 4Y0DA 3DC1A 2R5CA 1KKJA 1GC2A 3GJUA 2VMYA 3A9ZA 1DJEA 2VMPA 4AZKA 4Y0HA 3UWCA 3JZLA 4ATPA 1EQBA 2HUIA 4ADCA 1DKAA 2VMTA 3ZRPA 2AATA 1GEYA 3A9YA 3LWSA 4RIZA 2W7HA 1O4SA 1EJIA 1C9CA 1TPLA 5C6UA 2YKYA 2F8JA 4IX8A 1SVVA 3EIAA 4LNJA 4ADDA 2O7CA 3NUBA 1ARTA 1ELQA 3HLMA 1W7NA 1M0OA 4WXBA 1OATA 3F6TA 3VP6A 1DJUA 1FG3A 5HDMA 4WLHA 1B8GA 2ORDA 1I41A 2ZC0A 2YCNA 1CZCA 1ZC9A 3MKJA 4WYCA 3DYDA 2C0RA 2FYFA 2D7YA 2WK7A 1OHVA 3NNKA 1N8PA 3NU8A 2ZY3A 2AY3A 2VMWA 2TPLA 5EFSA 2VI8A 4F4EA 2AY5A 2OGAA 2WK8A 2AY2A 2D65A 4ISYA 2CJHA 4WP0A 2CJDA 2EZ2A 2OKJA 2AY8A 1TOEA 3PD6B 3GZCA 5G09A 4A0HA 2X3LA 4AO4A 3EIBA 4IYOB 3RI6A 4GE7A 2VMNA 3JW9A 1G7WA 2Z9WA 3ZZJA 1TOIA 4AZJA 2YKUA 3EZSA 3NX3A 3OP7A 3R4TA 1ARSA 1IX8A 1MDXA 3QBOA 2C44A 2VGTA 3ELEA 3W1IA 3MC6C 4WD2A 5HXXA 3B8XA 3I5TA 2R0TA 1T3IA 3E2ZB 4JF1A 5EUEA 4CVQA 1MDZA 3ELPA 1BQAA 3BWOA 3HVYA 3K40A 1G7XA 1LS3A 2Z61A 1XI9A 4OC9A 4CBRA 4XJMA 4LC3A 4W1XA 4WYGA 1YJZA 1GC0A 4XQ2A 4MY5A 2ZY2A 3RBFA 3K28A 3W1HA 3E6GA 3RBLA 3BN1A 5D95A 1VP4A 3CQ4A 3RUYA 1AJSB 1O62A 1LC5A 3COGA 4MKKA 3VAXA 3WY7A 1BW0A 3MAUA 1Z7DA 2X8UA 1O69A 3AEPA 4P7YA 1I29A 3BCAA 2VMXA 4MGRA 5EIGB 4ZASA 5FT8A 3QGUA 1GC4A 3B1CA 1JG8A 4N0BA 2BIAA 1M6SA 3NUIA 2VGWA 2CH2A 1YOOA 1M32A 3USFA 5F9SA 2JG2A 4MKJA 1B9HA 4K2MA 4W1VA 5M4DA 2HOXA 3FCRA 4XJLA 3FSLA 3LVKA 3N5MA 4PFFA 1YNUA 2EZ1A 1TATA 4F5KA 5I92A 5FT6A 2Z9VA 1CZEA 1CQ7A 3ATHA 4F5GA 4K2IA 4RM1A 7AATA 2GQNA 3PD6A 2W7DA 1B5PA 1BS0A 2VLFA 1ASNA 1ARIA 3PPLA 4IYOA 4E1OA 4JEZA 1AMAA 3PA9A 4OBVA 3H14A 1BKGA 4BQ0A 2JISA 1KL1A 4F5MA 3AEOA 2V0YA 4RKCA 2W7KA 5AX8A 2EPJA 2E7UA 3WX9A 4CXQA 4WBTA 2HUUA 2FN6A 2YRIA 1AMRA 3WGBA 3G7QA 1SFFA 3NYUA 3BCBA 4KAMA 4J8LA 1PFFA 3H7FA 1KL2A 2DKJA 1S07A 1ASLA 1DJ9A 3E2ZA 3OKSA 3B1EA 3AV7A 3KGWA 2R2NA 4A72A 1B4XA 4LNMA 1H0CA 1C4KA 3AEJA 2AEUA 2AY1A 2RFVA 4ZLVA 1QJ3A 2HZPA 3NRAA 1MDOA 3P6KA 1I43A 5DB5A 3ISLA 1JF9A 1TASA 4XK1A 1TARA 1IX6A 4DQ6A 1D7SA 3N0LA 1AY4A 3F0HA 1BT4A 1KKPA 1AJSA 2GSAA 1AKCA 1AKAA 1TOGA 3A2BA 3NYTA 2CY8A 3PDBA 3EI9A 3WLXA 1PG8A 3E9KA 4Q6RA 3WKSA 2VMVA 2W7JA 5EIGA 4EU1A 8AATA 1C7NA 2CJGA 3AOVA 2W7IA 1FC4A 5G2PA 1OXOA 4UOYA 2W8WA 3BB8A 2E7JA 2VIBA 4JEVA 2NMPA 1ASBA 1M4NA 4EMYA 3HL2A 3GETA 1CJ0A 2W7FA 4H51A 1ASEA 1ORDA 5DJ9A 1C7OA 4Q75A 1H1CA 1AHEA 1QJ5A 2O1BA 3AEMC 3FZ7A 4Q31A 4U1TA 2W7MA 1PMOA 1N2TA 3E2FA 3T32A 4O6ZA 2OGEA 1AIAA 1IUGA 2CTZA 1JS3A 1S0AA 2Q7WA 1E5EA 1OXPA 1G4XA 4BMKA 4E3QA 1G4VA 4FL0A 3ACZA 4ATQA 1BJWA 3AENB 3LG0A 1KMKA 1QITA 3PGYA 1CQ6A 2OKKA 2XBNA 4JEWA 1X0MA 2YKXA 1LK9A 3E2YA 4EB5A 4ZDLA 3FFHA 4WLJA 4DGTA 3TFTA 3JU7A 3FQAA 1AHYA 3MBBA 1IJIA 3CQ6A 3IHJA 3N75A 4I8AA 5EAVA 5IWQA 1ELUA 1O61A 1GC3A 4B98A 4BA5A 2BWOA 5BJ4A 3KGXA 4B9BA 1C7GA 1M0QA 1VJOA 2ZP7A 4WB0A 4ZDOA 4ITGA 1XEYA 3BCXA 1AY8A 5M4BA 1AAWA 1ZODA 3NTJA 2HOYA 1RV3A 2ZSLA 3FQ8A 3RCHA 5BJ3A 2HP2A 3LVLB 2YHKA 2WK9A 1KMJA 3FVSA 5J8QA 2ZSMA 2DOUA 3BWNC 3QN6A 1WYTA 1MAQA 4RITA 1ASAA 1M0PA 4NOGA 2DGLA 4L0OA 2D63A 4F5FA 3B1DA 4QGRA 1LKCA 3BWNA 2QMAA 5G4IA 3MC6A 3QPGA 1RV4A 4W8IA 2AY4A 2Z20A 2CFBA 1V2EA 4A00A 3PDXA 4UHMA 1DGEA 5FT4A 3MAFB 5LHAA 3PDBB 1S08A 3GZDC 4M2MA 3LY1A 4TMRA 3HBXA 4F5JA 1C0NA 4ADBA 3Q8NA 2VMUA 3KE3A 1GEWA 4OBUA 3M5UA 3FQ7A 2YOBA 3KKIA 4GE9A 4WXFA 1IAXA 4UHNA 1N31A 3L44A 4JEYA 4ZM4A 1V2DA 2AY7A 1W23A 1DTYA 3IF2A 3EI7A 3AENA 3GBXA 3WCNA 5G4JA 1BJOB 1YIZA 4BA4A 3AATA 1AIBA 1AKBA 2VGSA 3FKDA 3ASAA 3JTXA 5FT5A
chains in the Genus database with same CATH superfamily
2ZJGA 4W5KA 2BIGA 1WKHA 1MLYA 2BYLA 2D5YA 2EH6A 4AH3A 5M46A 4ZM3A 3BC8A 4M2KA 3DRDA 1AHXA 1AY5A 5KTBA 1UU0A 2R5EA 4GE4A 1AX4A 1BJNA 2G6WA 4Q76A 2BI2A 3DR7A 2Z9UA 3TATA 4A0GA 1WYUB 1GBNA 4CBSA 4WB0B 3JWAA 3FFRA 4R8DA 5EAAA 1UKJA 3TFUA 2AEVA 2BYJA 4OCAA 3R9AA 4A6UA 1ARHA 2DKBA 2D61A 2OATA 3RCHB 1AMQA 1LC8A 3WKRA 1U08A 1Z3ZA 3A9XA 3K7YA 4EB7A 1D2FA 2QSRA 4R2NA 3HMUA 1X29A 3GWPA 4OMAA 1E5FA 3CBFA 1RVUA 2VLHA 3NDNA 3DODA 4IXZA 3AOWA 1KAFA 1WYTB 4TV7A 4R5ZA 3I4JA 3MAFA 2BI1A 3QI6A 4XJPA 2EYQA 2BKWA 2FNIA 4JF0A 2BWPA 4IXOA 4ZWMA 2D64A 2YKVA 1IBJA 3P1TA 3JWBA 1YJSA 2GB3A 2QLRA 1B9IA 2CB1A 3NU7A 4IXSA 4A6RA 4F5IA 2BI3A 3ECDA 2CH1A 1J32A 2BIEA 2VYCA 4ZDPA 2QBTA 5E4ZA 3LV2A 3UAKA 2QA3A 4GEBA 4GDYA 4PIWA 2HP1A 1BJOA 5G2QA 1CQ8A 3A8UX 1QGNA 2AY9A 2VMOA 2PO3A 2QB2A 3HT4A 4HVKA 1ASMA 4W91A 1ARGA 1ASGA 2OQXA 3FZ6A 3GSBA 4ZSWA 4A0RA 2DGMA 4ADEA 5LH9A 4KYOA 3EI6A 3TCMA 3AELA 1CL2A 2O0RA 4AO9A 4N0WA 3G8MA 1AAMA 5TF5A 2HUFA 3AEMA 2EO5A 2YCPA 4IY7A 2BI9A 1WYVB 1M0NA 2JJGA 1TOJA 2ZY4A 4RKDA 3NYSA 2PB0A 1RVYA 5EQCA 9AATA 1QZ9A 3FZ8A 3PAAA 1YAAA 1WYUA 4RJ0A 4E3RA 2VI9A 1GD9A 4J5UA 3ZRRA 4U2HA 4JE5A 2JJEA 4WYAA 4MQPA 1GCKA 1W7LA 3DR4A 3LVJA 3MADA 4OT8A 3ZRQA 2VMQA 2X5FA 2BI5A 2CINA 2CSTA 4OYTA 2WKAA 3D6KA 4XEWA 3FDDA 2YRRA 4IW7A 2YCTA 5K8BA 1X2AA 2X5DA 1BQDA 2W8TA 2FQ6A 1AHFA 3VOMA 1SPAA 2JGTA 3PIUA 1MAPA 4RLGA 1S06A 4XJOA 4WYFA 3L8AA 1ECXA 5HHYA 2C7TA 4ITXA 2VGUA 5E3KA 5DJ1A 2W7LA 1Y4IA 3FDBA 2Z1YA 2JJFA 5M49A 2HORA 3MEBA 4Y0IA 4ZWVA 3EI5A 1PMMA 2Z1ZA 1IAYA 1CL1A 1AMSA 2W8UA 4PFNA 4XAUA 2XH1A 1ZOBA 2GMUA 2VIAA 3ASBA 1SZSA 2W7EA 4EFFA 5EUNA 1OHWA 3HDOA 3VK3A 4JEXA 3DU4A 3BS8A 3WZFA 4F5HA 5JAYA 1BJ4A 3CAIA 2PB2A 1S09A 2VMSA 2W8JA 4R5FA 3GZDA 3G0TA 1QIRA 2FNUA 1AICA 2FM1A 3BV0A 1DFOA 1LW5A 2VGVA 2HOZA 2ZYJA 3UE8A 1YJYA 1YIYA 1UU2A 1WYVA 4TN4A 2W7GA 2BWNA 3WCOA 4CXRA 2R5CB 1TOKA 3QM2A 5E5IA 4DBCA 1D7UA 4W1WA 2AY6A 2EGYA 3FVXA 3VK4A 1I48A 1OHYA 2V1PA 4LNLA 3EI8A 4ZSYA 1GEXA 3QHXA 1GDEA 2DGKA 4WXGA 3PJ0A 4MQRA 1MLZA 3II0A 2KFPA 4AOAA 3W1JA 1W7MA 2W8VA 3FTBA 4RJYA 1D7VA 4JE5D 4WYDA 2E7IA 4HF8A 4GSAA 3RQ1A 3DXWA 3ZZKA 2DR1A 2VMZA 1M7YA 3FD0A 2GMSA 4OTLA 2D66A 3N4SA 1JS6A 1V72A 2VGZA 3H9XA 1SZKA 1X28A 3EZ1A 4KXKA 4F5LA 1WKGA 1SF2A 4A6TA 2C81A 1LW4A 1SZUA 3I16A 3WGCA 4BHDA 3VK2A 4E77A 1CS1A 2BHXA 1VEFA 1UU1A 3E77A 4WYEA 4ZAHA 1V2FA 3LVMA 2ZY5A 1B5OA 3AEJC 3FVUA 4K2BA 3TQXA 5DX5A 3DXVA 4LW4A 1AHGA 4RAEA 5EUDA 2QB3A 1WSTA 1IVRA 2E54A 1D7RA 2JJHA 4A0FA 4FFCA 2VMRA 2D7ZA 1MGVA 3EUCA 1P3WA 4MQQA 4UHOA 1J04A 1ASCA 3DZZA 4LW2A 1FG7A 1ASDA 1ASFA 3F9TA 3FRKA 1W3UA 1LC7A 4M2JA 1IX7A 4PVFA 5G0AA 4GRXA 4P3MA 2Z9XA 2WB6A 1EG5A 2CANA 4UQVA 5F8VA 3CQ5A 1AJRA 1DGDA 3B46A 5D5SA 3GR9A 3HQTA 4MSOA 2ZUKA 1QISA 2Z67A 4Y0DA 3DC1A 2R5CA 1KKJA 1GC2A 3GJUA 2VMYA 3A9ZA 1DJEA 2VMPA 4AZKA 4Y0HA 3UWCA 3JZLA 4ATPA 1EQBA 2HUIA 4ADCA 2G7JA 1DKAA 2VMTA 3ZRPA 2AATA 1GEYA 3A9YA 3LWSA 4RIZA 2W7HA 1O4SA 1EJIA 1C9CA 3N4RA 1TPLA 5C6UA 2YKYA 2F8JA 4IX8A 1SVVA 3EIAA 4LNJA 4ADDA 2O7CA 3NUBA 1ARTA 1ELQA 3HLMA 1W7NA 1M0OA 4WXBA 1OATA 3F6TA 3VP6A 1DJUA 1FG3A 5HDMA 4WLHA 1B8GA 2ORDA 1I41A 2ZC0A 2YCNA 1CZCA 1ZC9A 3MKJA 4WYCA 3DYDA 2C0RA 2FYFA 2D7YA 2WK7A 1OHVA 3NNKA 1N8PA 3NU8A 2ZY3A 2AY3A 2VMWA 2TPLA 5EFSA 2VI8A 4F4EA 2AY5A 2OGAA 2WK8A 2AY2A 2D65A 4ISYA 2CJHA 4WP0A 2CJDA 2EZ2A 2OKJA 2AY8A 1TOEA 3PD6B 3GZCA 5G09A 4A0HA 2X3LA 4AO4A 3EIBA 4IYOB 3RI6A 4GE7A 2VMNA 3JW9A 1G7WA 2Z9WA 3ZZJA 4K05A 1TOIA 4AZJA 2YKUA 3EZSA 3NX3A 3OP7A 3R4TA 1ARSA 1IX8A 1MDXA 3QBOA 2C44A 2VGTA 3ELEA 3W1IA 3MC6C 4WD2A 5HXXA 3B8XA 3I5TA 2R0TA 1T3IA 3E2ZB 4JF1A 5EUEA 4CVQA 1MDZA 3ELPA 1BQAA 3BWOA 3HVYA 3K40A 1G7XA 1LS3A 2Z61A 1XI9A 4OC9A 4CBRA 4XJMA 4LC3A 4W1XA 4WYGA 1YJZA 1GC0A 4XQ2A 4MY5A 2ZY2A 3RBFA 3K28A 3W1HA 3E6GA 3RBLA 3BN1A 5D95A 1VP4A 3CQ4A 3RUYA 1AJSB 1O62A 1LC5A 3COGA 4MKKA 3VAXA 3WY7A 1BW0A 3MAUA 1Z7DA 2X8UA 1O69A 3AEPA 4P7YA 3N7NA 1I29A 3BCAA 2VMXA 4MGRA 5EIGB 4ZASA 5FT8A 3QGUA 1GC4A 3B1CA 1JG8A 4N0BA 2BIAA 1M6SA 3NUIA 2VGWA 2CH2A 1YOOA 1M32A 3USFA 5F9SA 2JG2A 4MKJA 1B9HA 4K2MA 4W1VA 5M4DA 2HOXA 3FCRA 4XJLA 3FSLA 3LVKA 3N5MA 4PFFA 1YNUA 2EZ1A 1TATA 4F5KA 5I92A 5FT6A 2Z9VA 1CZEA 1CQ7A 3ATHA 4F5GA 4K2IA 4RM1A 7AATA 2GQNA 3PD6A 2W7DA 1B5PA 1BS0A 2VLFA 1ASNA 1ARIA 3PPLA 4IYOA 4E1OA 4JEZA 1AMAA 3PA9A 4OBVA 3H14A 1BKGA 4BQ0A 2JISA 1KL1A 4F5MA 3AEOA 2V0YA 4RKCA 2W7KA 5AX8A 2EPJA 2E7UA 3WX9A 4CXQA 4WBTA 2HUUA 2FN6A 2YRIA 1AMRA 3WGBA 3G7QA 1SFFA 3NYUA 3BCBA 4KAMA 4J8LA 1PFFA 3H7FA 1KL2A 2DKJA 1S07A 1ASLA 1DJ9A 3E2ZA 3OKSA 3B1EA 3AV7A 3KGWA 2R2NA 4A72A 1B4XA 4LNMA 1H0CA 1C4KA 3AEJA 2AEUA 2AY1A 2RFVA 4ZLVA 1QJ3A 2HZPA 3NRAA 1MDOA 3P6KA 1I43A 5DB5A 3ISLA 1JF9A 1TASA 4XK1A 1TARA 1IX6A 4DQ6A 1D7SA 3N0LA 1AY4A 3F0HA 1BT4A 1KKPA 1AJSA 2GSAA 1AKCA 1AKAA 1TOGA 3A2BA 3NYTA 2CY8A 3PDBA 3EI9A 3WLXA 1PG8A 3E9KA 4Q6RA 3WKSA 2VMVA 2W7JA 5EIGA 4EU1A 8AATA 1C7NA 2CJGA 3AOVA 2W7IA 1FC4A 5G2PA 1OXOA 4UOYA 2W8WA 3BB8A 2E7JA 2VIBA 4JEVA 2NMPA 1ASBA 1M4NA 4EMYA 3HL2A 3GETA 1CJ0A 2W7FA 4H63Q 4H51A 1ASEA 1ORDA 5DJ9A 1C7OA 4Q75A 1H1CA 1AHEA 1QJ5A 2O1BA 3AEMC 3FZ7A 4Q31A 4U1TA 2W7MA 1PMOA 1N2TA 3E2FA 3T32A 4O6ZA 2OGEA 1AIAA 1IUGA 2CTZA 1JS3A 1S0AA 2Q7WA 1E5EA 1OXPA 1G4XA 4BMKA 4E3QA 1G4VA 4FL0A 3ACZA 4ATQA 1BJWA 3AENB 3LG0A 1KMKA 1QITA 3PGYA 1CQ6A 2OKKA 2XBNA 4JEWA 1X0MA 2YKXA 1LK9A 3E2YA 4EB5A 4ZDLA 3FFHA 4WLJA 4DGTA 3TFTA 3JU7A 3FQAA 1AHYA 3MBBA 1IJIA 3CQ6A 3IHJA 3N75A 4I8AA 5EAVA 5IWQA 1ELUA 1O61A 1GC3A 4B98A 4BA5A 2BWOA 5BJ4A 3KGXA 4B9BA 1C7GA 1M0QA 1VJOA 2ZP7A 4WB0A 4ZDOA 4ITGA 1XEYA 3BCXA 1AY8A 5M4BA 1AAWA 1ZODA 3NTJA 2HOYA 1RV3A 2ZSLA 3FQ8A 3RCHA 5BJ3A 2HP2A 3LVLB 2YHKA 2WK9A 1KMJA 3FVSA 5J8QA 2ZSMA 2DOUA 3BWNC 3QN6A 1WYTA 1MAQA 4RITA 1ASAA 1M0PA 4NOGA 2DGLA 4L0OA 2D63A 4F5FA 3B1DA 4QGRA 1LKCA 3BWNA 2QMAA 5G4IA 3MC6A 3QPGA 1RV4A 4W8IA 2AY4A 2FKIA 2Z20A 2CFBA 1V2EA 3N4XA 4A00A 3PDXA 4UHMA 1DGEA 5FT4A 3MAFB 5LHAA 3PDBB 1S08A 3GZDC 4M2MA 3LY1A 4TMRA 3HBXA 4F5JA 1C0NA 4ADBA 3Q8NA 2VMUA 3KE3A 1GEWA 4OBUA 3M5UA 3FQ7A 2YOBA 3KKIA 4GE9A 4WXFA 1IAXA 4UHNA 1N31A 3L44A 4JEYA 4ZM4A 1V2DA 2AY7A 1W23A 1DTYA 3IF2A 3EI7A 3AENA 3GBXA 3WCNA 5G4JA 1BJOB 1YIZA 2A1VA 4BA4A 3AATA 1AIBA 1AKBA 2VGSA 3FKDA 3ASAA 3JTXA 5FT5A
chains in the Genus database with same CATH topology
2ZJGA 4W5KA 2BIGA 1WKHA 1MLYA 2BYLA 2D5YA 2EH6A 4AH3A 5M46A 4ZM3A 3BC8A 4M2KA 3DRDA 1AHXA 1AY5A 5KTBA 1UU0A 2R5EA 4GE4A 1AX4A 1BJNA 2G6WA 4Q76A 2BI2A 3DR7A 2Z9UA 3TATA 4A0GA 1WYUB 1GBNA 4CBSA 4WB0B 3JWAA 3FFRA 4R8DA 5EAAA 1UKJA 3TFUA 2AEVA 2BYJA 4OCAA 3R9AA 4A6UA 1ARHA 2DKBA 2D61A 2OATA 3RCHB 1AMQA 1LC8A 3WKRA 1U08A 1Z3ZA 3A9XA 3K7YA 4EB7A 1D2FA 2QSRA 4R2NA 3HMUA 1X29A 3GWPA 4OMAA 1E5FA 3CBFA 1RVUA 2VLHA 3NDNA 3DODA 4IXZA 3AOWA 1WYTB 4TV7A 4R5ZA 3I4JA 3MAFA 2BI1A 3QI6A 4XJPA 2EYQA 2BKWA 2FNIA 4JF0A 2BWPA 4IXOA 4ZWMA 2D64A 2YKVA 1IBJA 3P1TA 3JWBA 1YJSA 2GB3A 2QLRA 1B9IA 2CB1A 3NU7A 4IXSA 4A6RA 4F5IA 2BI3A 3ECDA 2CH1A 1J32A 2BIEA 2VYCA 4ZDPA 2QBTA 5E4ZA 3LV2A 3UAKA 2QA3A 4GEBA 4GDYA 4PIWA 2HP1A 1BJOA 5G2QA 1CQ8A 3A8UX 1QGNA 2AY9A 2VMOA 2PO3A 2QB2A 3HT4A 4HVKA 1ASMA 4W91A 1ARGA 1ASGA 2OQXA 3FZ6A 3GSBA 4ZSWA 4A0RA 2DGMA 4ADEA 5LH9A 4KYOA 3EI6A 3TCMA 3AELA 1CL2A 2O0RA 4AO9A 4N0WA 3G8MA 1AAMA 5TF5A 2HUFA 3AEMA 2EO5A 2YCPA 4IY7A 2BI9A 1WYVB 1M0NA 2JJGA 1TOJA 2ZY4A 4RKDA 3NYSA 2PB0A 1RVYA 5EQCA 9AATA 1QZ9A 3FZ8A 3PAAA 1YAAA 1WYUA 4RJ0A 4E3RA 2VI9A 1GD9A 4J5UA 3ZRRA 4U2HA 4JE5A 2JJEA 4WYAA 4MQPA 1GCKA 1W7LA 3DR4A 3LVJA 3MADA 4OT8A 3ZRQA 2VMQA 2X5FA 2BI5A 2CINA 2CSTA 4OYTA 2WKAA 3D6KA 4XEWA 3FDDA 2YRRA 4IW7A 2YCTA 5K8BA 1X2AA 2X5DA 1BQDA 2W8TA 2FQ6A 1AHFA 3VOMA 1SPAA 2JGTA 3PIUA 1MAPA 4RLGA 1S06A 4XJOA 4WYFA 3L8AA 1ECXA 5HHYA 2C7TA 4ITXA 2VGUA 5E3KA 5DJ1A 2W7LA 1Y4IA 3FDBA 2Z1YA 2JJFA 5M49A 2HORA 3MEBA 4Y0IA 4ZWVA 3EI5A 1PMMA 2Z1ZA 1IAYA 1CL1A 1AMSA 2W8UA 4PFNA 4XAUA 2XH1A 1ZOBA 2GMUA 2VIAA 3ASBA 1SZSA 2W7EA 4EFFA 5EUNA 1OHWA 3HDOA 3VK3A 4JEXA 3DU4A 3BS8A 3WZFA 4F5HA 5JAYA 1BJ4A 3CAIA 2PB2A 1S09A 2VMSA 2W8JA 4R5FA 3GZDA 3G0TA 1QIRA 2FNUA 1AICA 2FM1A 3BV0A 1DFOA 1LW5A 2VGVA 2HOZA 2ZYJA 3UE8A 1YJYA 1YIYA 1UU2A 1WYVA 4TN4A 2W7GA 2BWNA 3WCOA 4CXRA 2R5CB 1TOKA 3QM2A 5E5IA 4DBCA 1D7UA 4W1WA 2AY6A 2EGYA 3FVXA 3VK4A 1I48A 1OHYA 2V1PA 4LNLA 3EI8A 4ZSYA 1GEXA 3QHXA 1GDEA 2DGKA 4WXGA 3PJ0A 4MQRA 1MLZA 3II0A 2KFPA 4AOAA 3W1JA 1W7MA 2W8VA 3FTBA 4RJYA 1D7VA 4JE5D 4WYDA 2E7IA 4HF8A 4GSAA 3RQ1A 3DXWA 3ZZKA 2DR1A 2VMZA 1M7YA 3FD0A 2GMSA 4OTLA 2D66A 3N4SA 1JS6A 1V72A 2VGZA 3H9XA 1SZKA 1X28A 3EZ1A 4KXKA 4F5LA 1WKGA 1SF2A 4A6TA 2C81A 1LW4A 1SZUA 3I16A 3WGCA 4BHDA 3VK2A 4E77A 1CS1A 2BHXA 1VEFA 1UU1A 3E77A 4WYEA 4ZAHA 1V2FA 3LVMA 2ZY5A 1B5OA 3AEJC 3FVUA 4K2BA 3TQXA 5DX5A 3DXVA 4LW4A 1AHGA 4RAEA 5EUDA 2QB3A 1WSTA 1IVRA 2E54A 1D7RA 2JJHA 4A0FA 4FFCA 2VMRA 2D7ZA 1MGVA 3EUCA 1P3WA 4MQQA 4UHOA 1J04A 1ASCA 3DZZA 4LW2A 1FG7A 1ASDA 1ASFA 3F9TA 3FRKA 1W3UA 1LC7A 4M2JA 1IX7A 4PVFA 5G0AA 4GRXA 4P3MA 2Z9XA 2WB6A 1EG5A 2CANA 4UQVA 5F8VA 3CQ5A 1AJRA 1DGDA 3B46A 5D5SA 3GR9A 3HQTA 4MSOA 2ZUKA 1QISA 2Z67A 4Y0DA 3DC1A 2R5CA 1KKJA 1GC2A 3GJUA 2VMYA 3A9ZA 1DJEA 2VMPA 4AZKA 4Y0HA 3UWCA 3JZLA 4ATPA 1EQBA 2HUIA 4ADCA 2G7JA 1DKAA 2VMTA 3ZRPA 2AATA 1GEYA 3A9YA 3LWSA 4RIZA 2W7HA 1O4SA 1EJIA 1C9CA 3N4RA 1TPLA 5C6UA 2YKYA 2F8JA 4IX8A 1SVVA 3EIAA 4LNJA 4ADDA 2O7CA 3NUBA 1ARTA 1ELQA 3HLMA 1W7NA 1M0OA 4WXBA 1OATA 3F6TA 3VP6A 1DJUA 1FG3A 5HDMA 4WLHA 1B8GA 2ORDA 1I41A 2ZC0A 2YCNA 1CZCA 1ZC9A 3MKJA 4WYCA 3DYDA 2C0RA 2FYFA 2D7YA 2WK7A 1OHVA 3NNKA 1N8PA 3NU8A 2ZY3A 2AY3A 2VMWA 2TPLA 5EFSA 2VI8A 4F4EA 2AY5A 2OGAA 2WK8A 2AY2A 2D65A 4ISYA 2CJHA 4WP0A 2CJDA 2EZ2A 2OKJA 2AY8A 1TOEA 3PD6B 3GZCA 5G09A 4A0HA 2X3LA 4AO4A 3EIBA 4IYOB 3RI6A 4GE7A 2VMNA 3JW9A 1G7WA 2Z9WA 3ZZJA 4K05A 1TOIA 4AZJA 2YKUA 3EZSA 3NX3A 3OP7A 3R4TA 1ARSA 1IX8A 1MDXA 3QBOA 2C44A 2VGTA 3ELEA 3W1IA 3MC6C 4WD2A 5HXXA 3B8XA 3I5TA 2R0TA 1T3IA 3E2ZB 4JF1A 5EUEA 4CVQA 1MDZA 3ELPA 1BQAA 3BWOA 3HVYA 3K40A 1G7XA 1LS3A 2Z61A 1XI9A 4OC9A 4CBRA 4XJMA 4LC3A 4W1XA 4WYGA 1YJZA 1GC0A 4XQ2A 4MY5A 2ZY2A 3RBFA 3K28A 3W1HA 3E6GA 3RBLA 3BN1A 5D95A 1VP4A 3CQ4A 3RUYA 1AJSB 1O62A 1LC5A 3COGA 4MKKA 3VAXA 3WY7A 1BW0A 3MAUA 1Z7DA 2X8UA 1O69A 3AEPA 4P7YA 3N7NA 1I29A 3BCAA 2VMXA 4MGRA 5EIGB 4ZASA 5FT8A 3QGUA 1GC4A 3B1CA 1JG8A 4N0BA 2BIAA 1M6SA 3NUIA 2VGWA 2CH2A 1YOOA 1M32A 3USFA 5F9SA 2JG2A 4MKJA 1B9HA 4K2MA 4W1VA 5M4DA 2HOXA 3FCRA 4XJLA 3FSLA 3LVKA 3N5MA 4PFFA 1YNUA 2EZ1A 1TATA 4F5KA 5I92A 5FT6A 2Z9VA 1CZEA 1CQ7A 3ATHA 4F5GA 4K2IA 4RM1A 7AATA 2GQNA 3PD6A 2W7DA 1B5PA 1BS0A 2VLFA 1ASNA 1ARIA 3PPLA 4IYOA 4E1OA 4JEZA 1AMAA 3PA9A 4OBVA 3H14A 1BKGA 4BQ0A 2JISA 1KL1A 4F5MA 3AEOA 2V0YA 4RKCA 2W7KA 5AX8A 2EPJA 2E7UA 3WX9A 4CXQA 4WBTA 2HUUA 2FN6A 2YRIA 1AMRA 3WGBA 3G7QA 1SFFA 3NYUA 3BCBA 4KAMA 4J8LA 1PFFA 3H7FA 1KL2A 2DKJA 1S07A 1ASLA 1DJ9A 3E2ZA 3OKSA 3B1EA 3AV7A 3KGWA 2R2NA 4A72A 1B4XA 4LNMA 1H0CA 1C4KA 3AEJA 2AEUA 2AY1A 2RFVA 4ZLVA 1QJ3A 2HZPA 3NRAA 1MDOA 3P6KA 1I43A 5DB5A 3ISLA 1JF9A 1TASA 4XK1A 1TARA 1IX6A 4DQ6A 1D7SA 3N0LA 1AY4A 3F0HA 1BT4A 1KKPA 1AJSA 2GSAA 1AKCA 1AKAA 1TOGA 3A2BA 3NYTA 2CY8A 3PDBA 3EI9A 3WLXA 1PG8A 3E9KA 4Q6RA 3WKSA 2VMVA 2W7JA 5EIGA 4EU1A 8AATA 1C7NA 2CJGA 3AOVA 2W7IA 1FC4A 5G2PA 1OXOA 4UOYA 2W8WA 3BB8A 2E7JA 2VIBA 4JEVA 2NMPA 1ASBA 1M4NA 4EMYA 3HL2A 3GETA 1CJ0A 2W7FA 4H63Q 4H51A 1ASEA 1ORDA 5DJ9A 1C7OA 4Q75A 1H1CA 1AHEA 1QJ5A 2O1BA 3AEMC 3FZ7A 4Q31A 4U1TA 2W7MA 1PMOA 1N2TA 3E2FA 3T32A 4O6ZA 2OGEA 1AIAA 1IUGA 2CTZA 1JS3A 1S0AA 2Q7WA 1E5EA 1OXPA 1G4XA 4BMKA 4E3QA 1G4VA 4FL0A 3ACZA 4ATQA 1BJWA 3AENB 3LG0A 1KMKA 1QITA 3PGYA 1CQ6A 2OKKA 2XBNA 4JEWA 1X0MA 2YKXA 1LK9A 3E2YA 4EB5A 4ZDLA 3FFHA 4WLJA 4DGTA 3TFTA 3JU7A 3FQAA 1AHYA 3MBBA 1IJIA 3CQ6A 3IHJA 3N75A 4I8AA 5EAVA 5IWQA 1ELUA 1O61A 1GC3A 4B98A 4BA5A 2BWOA 5BJ4A 3KGXA 4B9BA 1C7GA 1M0QA 1VJOA 2ZP7A 4WB0A 4ZDOA 4ITGA 1XEYA 3BCXA 1AY8A 5M4BA 1AAWA 1ZODA 3NTJA 2HOYA 1RV3A 2ZSLA 3FQ8A 3RCHA 5BJ3A 2HP2A 3LVLB 2YHKA 2WK9A 1KMJA 3FVSA 5J8QA 2ZSMA 2DOUA 3BWNC 3QN6A 1WYTA 1MAQA 4RITA 1ASAA 1M0PA 4NOGA 2DGLA 4L0OA 2D63A 4F5FA 3B1DA 4QGRA 1LKCA 3BWNA 2QMAA 5G4IA 3MC6A 3QPGA 1RV4A 4W8IA 2AY4A 2FKIA 2Z20A 2CFBA 1V2EA 3N4XA 4A00A 3PDXA 4UHMA 1DGEA 5FT4A 3MAFB 5LHAA 3PDBB 1S08A 3GZDC 4M2MA 3LY1A 4TMRA 3HBXA 4F5JA 1C0NA 4ADBA 3Q8NA 2VMUA 3KE3A 1GEWA 4OBUA 3M5UA 3FQ7A 2YOBA 3KKIA 4GE9A 4WXFA 1IAXA 4UHNA 1N31A 3L44A 4JEYA 4ZM4A 1V2DA 2AY7A 1W23A 1DTYA 3IF2A 3EI7A 3AENA 3GBXA 3WCNA 5G4JA 1BJOB 1YIZA 2A1VA 4BA4A 3AATA 1AIBA 1AKBA 2VGSA 3FKDA 3ASAA 3JTXA 5FT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJG A;  4W5K A;  2BIG A;  1WKH A;  1MLY A;  2BYL A;  2D5Y A;  2EH6 A;  4AH3 A;  5M46 A;  4ZM3 A;  3BC8 A;  4M2K A;  3DRD A;  1AHX A;  1AY5 A;  1UU0 A;  2R5E A;  4GE4 A;  1AX4 A;  1BJN A;  2G6W A;  4Q76 A;  2BI2 A;  3DR7 A;  2Z9U A;  3TAT A;  4A0G A;  1WYU B;  1GBN A;  4CBS A;  4WB0 B;  3JWA A;  3FFR A;  4R8D A;  5EAA A;  1UKJ A;  3TFU A;  2AEV A;  2BYJ A;  4OCA A;  3R9A A;  4A6U A;  1ARH A;  2DKB A;  2D61 A;  2OAT A;  3RCH B;  1AMQ A;  1LC8 A;  3WKR A;  1U08 A;  1Z3Z A;  3A9X A;  3K7Y A;  4EB7 A;  1D2F A;  4R2N A;  3HMU A;  1X29 A;  3GWP A;  4OMA A;  1E5F A;  3CBF A;  1RVU A;  2VLH A;  3NDN A;  3DOD A;  4IXZ A;  3AOW A;  1WYT B;  4TV7 A;  4R5Z A;  3I4J A;  3MAF A;  2BI1 A;  3QI6 A;  4XJP A;  2BKW A;  2FNI A;  4JF0 A;  2BWP A;  4IXO A;  4ZWM A;  2D64 A;  2YKV A;  1IBJ A;  3P1T A;  3JWB A;  1YJS A;  2GB3 A;  2QLR A;  1B9I A;  2CB1 A;  3NU7 A;  4IXS A;  4A6R A;  4F5I A;  2BI3 A;  3ECD A;  2CH1 A;  1J32 A;  2BIE A;  2VYC A;  4ZDP A;  2QBT A;  5E4Z A;  3LV2 A;  3UAK A;  2QA3 A;  4GEB A;  4GDY A;  4PIW A;  2HP1 A;  1BJO A;  5G2Q A;  1CQ8 A;  3A8U X;  1QGN A;  2AY9 A;  2VMO A;  2PO3 A;  2QB2 A;  3HT4 A;  4HVK A;  1ASM A;  4W91 A;  1ARG A;  1ASG A;  2OQX A;  3FZ6 A;  3GSB A;  4ZSW A;  4A0R A;  2DGM A;  4ADE A;  5LH9 A;  4KYO A;  3EI6 A;  3TCM A;  3AEL A;  1CL2 A;  2O0R A;  4AO9 A;  4N0W A;  3G8M A;  1AAM A;  5TF5 A;  2HUF A;  3AEM A;  2EO5 A;  2YCP A;  4IY7 A;  2BI9 A;  1WYV B;  1M0N A;  2JJG A;  1TOJ A;  2ZY4 A;  4RKD A;  3NYS A;  2PB0 A;  1RVY A;  5EQC A;  9AAT A;  1QZ9 A;  3FZ8 A;  3PAA A;  1YAA A;  1WYU A;  4RJ0 A;  4E3R A;  2VI9 A;  1GD9 A;  4J5U A;  3ZRR A;  4U2H A;  4JE5 A;  2JJE A;  4WYA A;  4MQP A;  1GCK A;  1W7L A;  3DR4 A;  3LVJ A;  3MAD A;  4OT8 A;  3ZRQ A;  2VMQ A;  2X5F A;  2BI5 A;  2CIN A;  2CST A;  4OYT A;  2WKA A;  3D6K A;  4XEW A;  3FDD A;  2YRR A;  4IW7 A;  2YCT A;  5K8B A;  1X2A A;  2X5D A;  1BQD A;  2W8T A;  2FQ6 A;  1AHF A;  3VOM A;  1SPA A;  2JGT A;  3PIU A;  1MAP A;  4RLG A;  1S06 A;  4XJO A;  4WYF A;  3L8A A;  1ECX A;  5HHY A;  2C7T A;  4ITX A;  2VGU A;  5E3K A;  5DJ1 A;  2W7L A;  1Y4I A;  3FDB A;  2Z1Y A;  2JJF A;  5M49 A;  2HOR A;  3MEB A;  4Y0I A;  4ZWV A;  3EI5 A;  1PMM A;  2Z1Z A;  1IAY A;  1CL1 A;  1AMS A;  2W8U A;  4PFN A;  4XAU A;  2XH1 A;  1ZOB A;  2GMU A;  2VIA A;  3ASB A;  1SZS A;  2W7E A;  4EFF A;  5EUN A;  1OHW A;  3HDO A;  3VK3 A;  4JEX A;  3DU4 A;  3BS8 A;  3WZF A;  4F5H A;  5JAY A;  1BJ4 A;  3CAI A;  2PB2 A;  1S09 A;  2VMS A;  2W8J A;  4R5F A;  3GZD A;  3G0T A;  1QIR A;  2FNU A;  1AIC A;  2FM1 A;  3BV0 A;  1DFO A;  1LW5 A;  2VGV A;  2HOZ A;  2ZYJ A;  3UE8 A;  1YJY A;  1YIY A;  1UU2 A;  1WYV A;  4TN4 A;  2W7G A;  2BWN A;  3WCO A;  4CXR A;  2R5C B;  1TOK A;  3QM2 A;  5E5I A;  4DBC A;  1D7U A;  4W1W A;  2AY6 A;  2EGY A;  3FVX A;  3VK4 A;  1I48 A;  1OHY A;  2V1P A;  4LNL A;  3EI8 A;  4ZSY A;  1GEX A;  3QHX A;  1GDE A;  2DGK A;  4WXG A;  3PJ0 A;  4MQR A;  1MLZ A;  3II0 A;  4AOA A;  3W1J A;  1W7M A;  2W8V A;  3FTB A;  4RJY A;  1D7V A;  4JE5 D;  4WYD A;  2E7I A;  4HF8 A;  4GSA A;  3RQ1 A;  3DXW A;  3ZZK A;  2DR1 A;  2VMZ A;  1M7Y A;  3FD0 A;  2GMS A;  4OTL A;  2D66 A;  1JS6 A;  1V72 A;  2VGZ A;  1SZK A;  1X28 A;  3EZ1 A;  4KXK A;  4F5L A;  1WKG A;  1SF2 A;  4A6T A;  2C81 A;  1LW4 A;  1SZU A;  3I16 A;  3WGC A;  4BHD A;  3VK2 A;  4E77 A;  1CS1 A;  2BHX A;  1VEF A;  1UU1 A;  3E77 A;  4WYE A;  4ZAH A;  1V2F A;  3LVM A;  2ZY5 A;  1B5O A;  3AEJ C;  3FVU A;  4K2B A;  3TQX A;  5DX5 A;  3DXV A;  4LW4 A;  1AHG A;  4RAE A;  5EUD A;  2QB3 A;  1WST A;  1IVR A;  2E54 A;  1D7R A;  2JJH A;  4A0F A;  4FFC A;  2VMR A;  2D7Z A;  1MGV A;  3EUC A;  1P3W A;  4MQQ A;  4UHO A;  1J04 A;  1ASC A;  3DZZ A;  4LW2 A;  1FG7 A;  1ASD A;  1ASF A;  3F9T A;  3FRK A;  1W3U A;  1LC7 A;  4M2J A;  1IX7 A;  4PVF A;  5G0A A;  4GRX A;  4P3M A;  2Z9X A;  1EG5 A;  2CAN A;  4UQV A;  5F8V A;  3CQ5 A;  1AJR A;  1DGD A;  3B46 A;  5D5S A;  3GR9 A;  3HQT A;  4MSO A;  2ZUK A;  1QIS A;  2Z67 A;  4Y0D A;  3DC1 A;  2R5C A;  1KKJ A;  1GC2 A;  3GJU A;  2VMY A;  3A9Z A;  1DJE A;  2VMP A;  4AZK A;  4Y0H A;  3UWC A;  3JZL A;  4ATP A;  1EQB A;  2HUI A;  4ADC A;  1DKA A;  2VMT A;  3ZRP A;  2AAT A;  1GEY A;  3A9Y A;  3LWS A;  4RIZ A;  2W7H A;  1O4S A;  1EJI A;  1C9C A;  1TPL A;  5C6U A;  2YKY A;  2F8J A;  4IX8 A;  1SVV A;  3EIA A;  4LNJ A;  4ADD A;  2O7C A;  3NUB A;  1ART A;  1ELQ A;  3HLM A;  1W7N A;  1M0O A;  4WXB A;  1OAT A;  3F6T A;  3VP6 A;  1DJU A;  1FG3 A;  5HDM A;  4WLH A;  1B8G A;  2ORD A;  1I41 A;  2ZC0 A;  2YCN A;  1CZC A;  1ZC9 A;  3MKJ A;  4WYC A;  3DYD A;  2C0R A;  2FYF A;  2D7Y A;  2WK7 A;  1OHV A;  3NNK A;  1N8P A;  3NU8 A;  2ZY3 A;  2AY3 A;  2VMW A;  2TPL A;  5EFS A;  2VI8 A;  4F4E A;  2AY5 A;  2OGA A;  2WK8 A;  2AY2 A;  2D65 A;  4ISY A;  2CJH A;  4WP0 A;  2CJD A;  2EZ2 A;  2OKJ A;  2AY8 A;  1TOE A;  3PD6 B;  3GZC A;  5G09 A;  4A0H A;  2X3L A;  4AO4 A;  3EIB A;  4IYO B;  3RI6 A;  4GE7 A;  2VMN A;  3JW9 A;  1G7W A;  2Z9W A;  3ZZJ A;  1TOI A;  4AZJ A;  2YKU A;  3EZS A;  3NX3 A;  3OP7 A;  3R4T A;  1ARS A;  1IX8 A;  1MDX A;  3QBO A;  2C44 A;  2VGT A;  3ELE A;  3W1I A;  3MC6 C;  4WD2 A;  5HXX A;  3B8X A;  3I5T A;  2R0T A;  1T3I A;  3E2Z B;  4JF1 A;  5EUE A;  4CVQ A;  1MDZ A;  3ELP A;  1BQA A;  3BWO A;  3HVY A;  3K40 A;  1G7X A;  1LS3 A;  2Z61 A;  1XI9 A;  4OC9 A;  4CBR A;  4XJM A;  4LC3 A;  4W1X A;  4WYG A;  1YJZ A;  1GC0 A;  4XQ2 A;  4MY5 A;  2ZY2 A;  3RBF A;  3K28 A;  3W1H A;  3E6G A;  3RBL A;  3BN1 A;  5D95 A;  1VP4 A;  3CQ4 A;  3RUY A;  1AJS B;  1O62 A;  1LC5 A;  3COG A;  4MKK A;  3VAX A;  3WY7 A;  1BW0 A;  3MAU A;  1Z7D A;  2X8U A;  1O69 A;  3AEP A;  4P7Y A;  1I29 A;  3BCA A;  2VMX A;  4MGR A;  5EIG B;  4ZAS A;  5FT8 A;  3QGU A;  1GC4 A;  3B1C A;  1JG8 A;  4N0B A;  2BIA A;  1M6S A;  3NUI A;  2VGW A;  2CH2 A;  1YOO A;  1M32 A;  3USF A;  5F9S A;  2JG2 A;  4MKJ A;  1B9H A;  4K2M A;  4W1V A;  5M4D A;  2HOX A;  3FCR A;  4XJL A;  3FSL A;  3LVK A;  3N5M A;  4PFF A;  1YNU A;  2EZ1 A;  1TAT A;  4F5K A;  5I92 A;  5FT6 A;  2Z9V A;  1CZE A;  1CQ7 A;  3ATH A;  4F5G A;  4K2I A;  4RM1 A;  7AAT A;  2GQN A;  3PD6 A;  2W7D A;  1B5P A;  1BS0 A;  2VLF A;  1ASN A;  1ARI A;  3PPL A;  4IYO A;  4E1O A;  4JEZ A;  1AMA A;  3PA9 A;  4OBV A;  3H14 A;  1BKG A;  4BQ0 A;  2JIS A;  1KL1 A;  4F5M A;  3AEO A;  2V0Y A;  4RKC A;  2W7K A;  5AX8 A;  2EPJ A;  2E7U A;  3WX9 A;  4CXQ A;  4WBT A;  2HUU A;  2FN6 A;  2YRI A;  1AMR A;  3WGB A;  3G7Q A;  1SFF A;  3NYU A;  3BCB A;  4KAM A;  4J8L A;  1PFF A;  3H7F A;  1KL2 A;  2DKJ A;  1S07 A;  1ASL A;  1DJ9 A;  3E2Z A;  3OKS A;  3B1E A;  3AV7 A;  3KGW A;  2R2N A;  4A72 A;  1B4X A;  4LNM A;  1H0C A;  1C4K A;  3AEJ A;  2AEU A;  2AY1 A;  2RFV A;  4ZLV A;  1QJ3 A;  2HZP A;  3NRA A;  1MDO A;  3P6K A;  1I43 A;  5DB5 A;  3ISL A;  1JF9 A;  1TAS A;  4XK1 A;  1TAR A;  1IX6 A;  4DQ6 A;  1D7S A;  3N0L A;  1AY4 A;  3F0H A;  1BT4 A;  1KKP A;  1AJS A;  2GSA A;  1AKC A;  1AKA A;  1TOG A;  3A2B A;  3NYT A;  2CY8 A;  3PDB A;  3EI9 A;  3WLX A;  1PG8 A;  3E9K A;  4Q6R A;  3WKS A;  2VMV A;  2W7J A;  5EIG A;  4EU1 A;  8AAT A;  1C7N A;  2CJG A;  3AOV A;  2W7I A;  1FC4 A;  5G2P A;  1OXO A;  4UOY A;  2W8W A;  3BB8 A;  2E7J A;  2VIB A;  4JEV A;  2NMP A;  1ASB A;  1M4N A;  4EMY A;  3HL2 A;  3GET A;  1CJ0 A;  2W7F A;  4H51 A;  1ASE A;  1ORD A;  5DJ9 A;  1C7O A;  4Q75 A;  1H1C A;  1AHE A;  1QJ5 A;  2O1B A;  3AEM C;  3FZ7 A;  4Q31 A;  4U1T A;  2W7M A;  1PMO A;  1N2T A;  3E2F A;  3T32 A;  4O6Z A;  2OGE A;  1AIA A;  1IUG A;  2CTZ A;  1JS3 A;  1S0A A;  2Q7W A;  1E5E A;  1OXP A;  1G4X A;  4BMK A;  4E3Q A;  1G4V A;  4FL0 A;  3ACZ A;  4ATQ A;  1BJW A;  3AEN B;  3LG0 A;  1KMK A;  1QIT A;  3PGY A;  1CQ6 A;  2OKK A;  2XBN A;  4JEW A;  1X0M A;  2YKX A;  1LK9 A;  3E2Y A;  4EB5 A;  4ZDL A;  3FFH A;  4WLJ A;  4DGT A;  3TFT A;  3JU7 A;  3FQA A;  1AHY A;  3MBB A;  1IJI A;  3CQ6 A;  3IHJ A;  3N75 A;  4I8A A;  5EAV A;  5IWQ A;  1ELU A;  1O61 A;  1GC3 A;  4B98 A;  4BA5 A;  2BWO A;  5BJ4 A;  3KGX A;  4B9B A;  1C7G A;  1M0Q A;  1VJO A;  2ZP7 A;  4WB0 A;  4ZDO A;  4ITG A;  1XEY A;  3BCX A;  1AY8 A;  5M4B A;  1AAW A;  1ZOD A;  3NTJ A;  2HOY A;  1RV3 A;  2ZSL A;  3FQ8 A;  3RCH A;  5BJ3 A;  2HP2 A;  3LVL B;  2YHK A;  2WK9 A;  1KMJ A;  3FVS A;  5J8Q A;  2ZSM A;  2DOU A;  3BWN C;  3QN6 A;  1WYT A;  1MAQ A;  4RIT A;  1ASA A;  1M0P A;  4NOG A;  2DGL A;  4L0O A;  2D63 A;  4F5F A;  3B1D A;  4QGR A;  1LKC A;  3BWN A;  2QMA A;  5G4I A;  3MC6 A;  3QPG A;  1RV4 A;  4W8I A;  2AY4 A;  2Z20 A;  2CFB A;  1V2E A;  4A00 A;  3PDX A;  4UHM A;  1DGE A;  5FT4 A;  3MAF B;  5LHA A;  3PDB B;  1S08 A;  3GZD C;  4M2M A;  3LY1 A;  4TMR A;  3HBX A;  4F5J A;  1C0N A;  4ADB A;  3Q8N A;  2VMU A;  3KE3 A;  1GEW A;  4OBU A;  3M5U A;  3FQ7 A;  2YOB A;  3KKI A;  4GE9 A;  4WXF A;  1IAX A;  4UHN A;  1N31 A;  3L44 A;  4JEY A;  4ZM4 A;  1V2D A;  2AY7 A;  1W23 A;  1DTY A;  3IF2 A;  3EI7 A;  3AEN A;  3GBX A;  3WCN A;  5G4J A;  1BJO B;  1YIZ A;  4BA4 A;  3AAT A;  1AIB A;  1AKB A;  2VGS A;  3FKD A;  3ASA A;  3JTX A;  5FT5 A; 
#chains in the Genus database with same CATH topology
 2ZJG A;  4W5K A;  2BIG A;  1WKH A;  1MLY A;  2BYL A;  2D5Y A;  2EH6 A;  4AH3 A;  5M46 A;  4ZM3 A;  3BC8 A;  4M2K A;  3DRD A;  1AHX A;  1AY5 A;  5KTB A;  1UU0 A;  2R5E A;  4GE4 A;  1AX4 A;  1BJN A;  2G6W A;  4Q76 A;  2BI2 A;  3DR7 A;  2Z9U A;  3TAT A;  4A0G A;  1WYU B;  1GBN A;  4CBS A;  4WB0 B;  3JWA A;  3FFR A;  4R8D A;  5EAA A;  1UKJ A;  3TFU A;  2AEV A;  2BYJ A;  4OCA A;  3R9A A;  4A6U A;  1ARH A;  2DKB A;  2D61 A;  2OAT A;  3RCH B;  1AMQ A;  1LC8 A;  3WKR A;  1U08 A;  1Z3Z A;  3A9X A;  3K7Y A;  4EB7 A;  1D2F A;  2QSR A;  4R2N A;  3HMU A;  1X29 A;  3GWP A;  4OMA A;  1E5F A;  3CBF A;  1RVU A;  2VLH A;  3NDN A;  3DOD A;  4IXZ A;  3AOW A;  1KAF A;  1WYT B;  4TV7 A;  4R5Z A;  3I4J A;  3MAF A;  2BI1 A;  3QI6 A;  4XJP A;  2EYQ A;  2BKW A;  2FNI A;  4JF0 A;  2BWP A;  4IXO A;  4ZWM A;  2D64 A;  2YKV A;  1IBJ A;  3P1T A;  3JWB A;  1YJS A;  2GB3 A;  2QLR A;  1B9I A;  2CB1 A;  3NU7 A;  4IXS A;  4A6R A;  4F5I A;  2BI3 A;  3ECD A;  2CH1 A;  1J32 A;  2BIE A;  2VYC A;  4ZDP A;  2QBT A;  5E4Z A;  3LV2 A;  3UAK A;  2QA3 A;  4GEB A;  4GDY A;  4PIW A;  2HP1 A;  1BJO A;  5G2Q A;  1CQ8 A;  3A8U X;  1QGN A;  2AY9 A;  2VMO A;  2PO3 A;  2QB2 A;  3HT4 A;  4HVK A;  1ASM A;  4W91 A;  1ARG A;  1ASG A;  2OQX A;  3FZ6 A;  3GSB A;  4ZSW A;  4A0R A;  2DGM A;  4ADE A;  5LH9 A;  4KYO A;  3EI6 A;  3TCM A;  3AEL A;  1CL2 A;  2O0R A;  4AO9 A;  4N0W A;  3G8M A;  1AAM A;  5TF5 A;  2HUF A;  3AEM A;  2EO5 A;  2YCP A;  4IY7 A;  2BI9 A;  1WYV B;  1M0N A;  2JJG A;  1TOJ A;  2ZY4 A;  4RKD A;  3NYS A;  2PB0 A;  1RVY A;  5EQC A;  9AAT A;  1QZ9 A;  3FZ8 A;  3PAA A;  1YAA A;  1WYU A;  4RJ0 A;  4E3R A;  2VI9 A;  1GD9 A;  4J5U A;  3ZRR A;  4U2H A;  4JE5 A;  2JJE A;  4WYA A;  4MQP A;  1GCK A;  1W7L A;  3DR4 A;  3LVJ A;  3MAD A;  4OT8 A;  3ZRQ A;  2VMQ A;  2X5F A;  2BI5 A;  2CIN A;  2CST A;  4OYT A;  2WKA A;  3D6K A;  4XEW A;  3FDD A;  2YRR A;  4IW7 A;  2YCT A;  5K8B A;  1X2A A;  2X5D A;  1BQD A;  2W8T A;  2FQ6 A;  1AHF A;  3VOM A;  1SPA A;  2JGT A;  3PIU A;  1MAP A;  4RLG A;  1S06 A;  4XJO A;  4WYF A;  3L8A A;  1ECX A;  5HHY A;  2C7T A;  4ITX A;  2VGU A;  5E3K A;  5DJ1 A;  2W7L A;  1Y4I A;  3FDB A;  2Z1Y A;  2JJF A;  5M49 A;  2HOR A;  3MEB A;  4Y0I A;  4ZWV A;  3EI5 A;  1PMM A;  2Z1Z A;  1IAY A;  1CL1 A;  1AMS A;  2W8U A;  4PFN A;  4XAU A;  2XH1 A;  1ZOB A;  2GMU A;  2VIA A;  3ASB A;  1SZS A;  2W7E A;  4EFF A;  5EUN A;  1OHW A;  3HDO A;  3VK3 A;  4JEX A;  3DU4 A;  3BS8 A;  3WZF A;  4F5H A;  5JAY A;  1BJ4 A;  3CAI A;  2PB2 A;  1S09 A;  2VMS A;  2W8J A;  4R5F A;  3GZD A;  3G0T A;  1QIR A;  2FNU A;  1AIC A;  2FM1 A;  3BV0 A;  1DFO A;  1LW5 A;  2VGV A;  2HOZ A;  2ZYJ A;  3UE8 A;  1YJY A;  1YIY A;  1UU2 A;  1WYV A;  4TN4 A;  2W7G A;  2BWN A;  3WCO A;  4CXR A;  2R5C B;  1TOK A;  3QM2 A;  5E5I A;  4DBC A;  1D7U A;  4W1W A;  2AY6 A;  2EGY A;  3FVX A;  3VK4 A;  1I48 A;  1OHY A;  2V1P A;  4LNL A;  3EI8 A;  4ZSY A;  1GEX A;  3QHX A;  1GDE A;  2DGK A;  4WXG A;  3PJ0 A;  4MQR A;  1MLZ A;  3II0 A;  2KFP A;  4AOA A;  3W1J A;  1W7M A;  2W8V A;  3FTB A;  4RJY A;  1D7V A;  4JE5 D;  4WYD A;  2E7I A;  4HF8 A;  4GSA A;  3RQ1 A;  3DXW A;  3ZZK A;  2DR1 A;  2VMZ A;  1M7Y A;  3FD0 A;  2GMS A;  4OTL A;  2D66 A;  3N4S A;  1JS6 A;  1V72 A;  2VGZ A;  3H9X A;  1SZK A;  1X28 A;  3EZ1 A;  4KXK A;  4F5L A;  1WKG A;  1SF2 A;  4A6T A;  2C81 A;  1LW4 A;  1SZU A;  3I16 A;  3WGC A;  4BHD A;  3VK2 A;  4E77 A;  1CS1 A;  2BHX A;  1VEF A;  1UU1 A;  3E77 A;  4WYE A;  4ZAH A;  1V2F A;  3LVM A;  2ZY5 A;  1B5O A;  3AEJ C;  3FVU A;  4K2B A;  3TQX A;  5DX5 A;  3DXV A;  4LW4 A;  1AHG A;  4RAE A;  5EUD A;  2QB3 A;  1WST A;  1IVR A;  2E54 A;  1D7R A;  2JJH A;  4A0F A;  4FFC A;  2VMR A;  2D7Z A;  1MGV A;  3EUC A;  1P3W A;  4MQQ A;  4UHO A;  1J04 A;  1ASC A;  3DZZ A;  4LW2 A;  1FG7 A;  1ASD A;  1ASF A;  3F9T A;  3FRK A;  1W3U A;  1LC7 A;  4M2J A;  1IX7 A;  4PVF A;  5G0A A;  4GRX A;  4P3M A;  2Z9X A;  2WB6 A;  1EG5 A;  2CAN A;  4UQV A;  5F8V A;  3CQ5 A;  1AJR A;  1DGD A;  3B46 A;  5D5S A;  3GR9 A;  3HQT A;  4MSO A;  2ZUK A;  1QIS A;  2Z67 A;  4Y0D A;  3DC1 A;  2R5C A;  1KKJ A;  1GC2 A;  3GJU A;  2VMY A;  3A9Z A;  1DJE A;  2VMP A;  4AZK A;  4Y0H A;  3UWC A;  3JZL A;  4ATP A;  1EQB A;  2HUI A;  4ADC A;  2G7J A;  1DKA A;  2VMT A;  3ZRP A;  2AAT A;  1GEY A;  3A9Y A;  3LWS A;  4RIZ A;  2W7H A;  1O4S A;  1EJI A;  1C9C A;  3N4R A;  1TPL A;  5C6U A;  2YKY A;  2F8J A;  4IX8 A;  1SVV A;  3EIA A;  4LNJ A;  4ADD A;  2O7C A;  3NUB A;  1ART A;  1ELQ A;  3HLM A;  1W7N A;  1M0O A;  4WXB A;  1OAT A;  3F6T A;  3VP6 A;  1DJU A;  1FG3 A;  5HDM A;  4WLH A;  1B8G A;  2ORD A;  1I41 A;  2ZC0 A;  2YCN A;  1CZC A;  1ZC9 A;  3MKJ A;  4WYC A;  3DYD A;  2C0R A;  2FYF A;  2D7Y A;  2WK7 A;  1OHV A;  3NNK A;  1N8P A;  3NU8 A;  2ZY3 A;  2AY3 A;  2VMW A;  2TPL A;  5EFS A;  2VI8 A;  4F4E A;  2AY5 A;  2OGA A;  2WK8 A;  2AY2 A;  2D65 A;  4ISY A;  2CJH A;  4WP0 A;  2CJD A;  2EZ2 A;  2OKJ A;  2AY8 A;  1TOE A;  3PD6 B;  3GZC A;  5G09 A;  4A0H A;  2X3L A;  4AO4 A;  3EIB A;  4IYO B;  3RI6 A;  4GE7 A;  2VMN A;  3JW9 A;  1G7W A;  2Z9W A;  3ZZJ A;  4K05 A;  1TOI A;  4AZJ A;  2YKU A;  3EZS A;  3NX3 A;  3OP7 A;  3R4T A;  1ARS A;  1IX8 A;  1MDX A;  3QBO A;  2C44 A;  2VGT A;  3ELE A;  3W1I A;  3MC6 C;  4WD2 A;  5HXX A;  3B8X A;  3I5T A;  2R0T A;  1T3I A;  3E2Z B;  4JF1 A;  5EUE A;  4CVQ A;  1MDZ A;  3ELP A;  1BQA A;  3BWO A;  3HVY A;  3K40 A;  1G7X A;  1LS3 A;  2Z61 A;  1XI9 A;  4OC9 A;  4CBR A;  4XJM A;  4LC3 A;  4W1X A;  4WYG A;  1YJZ A;  1GC0 A;  4XQ2 A;  4MY5 A;  2ZY2 A;  3RBF A;  3K28 A;  3W1H A;  3E6G A;  3RBL A;  3BN1 A;  5D95 A;  1VP4 A;  3CQ4 A;  3RUY A;  1AJS B;  1O62 A;  1LC5 A;  3COG A;  4MKK A;  3VAX A;  3WY7 A;  1BW0 A;  3MAU A;  1Z7D A;  2X8U A;  1O69 A;  3AEP A;  4P7Y A;  3N7N A;  1I29 A;  3BCA A;  2VMX A;  4MGR A;  5EIG B;  4ZAS A;  5FT8 A;  3QGU A;  1GC4 A;  3B1C A;  1JG8 A;  4N0B A;  2BIA A;  1M6S A;  3NUI A;  2VGW A;  2CH2 A;  1YOO A;  1M32 A;  3USF A;  5F9S A;  2JG2 A;  4MKJ A;  1B9H A;  4K2M A;  4W1V A;  5M4D A;  2HOX A;  3FCR A;  4XJL A;  3FSL A;  3LVK A;  3N5M A;  4PFF A;  1YNU A;  2EZ1 A;  1TAT A;  4F5K A;  5I92 A;  5FT6 A;  2Z9V A;  1CZE A;  1CQ7 A;  3ATH A;  4F5G A;  4K2I A;  4RM1 A;  7AAT A;  2GQN A;  3PD6 A;  2W7D A;  1B5P A;  1BS0 A;  2VLF A;  1ASN A;  1ARI A;  3PPL A;  4IYO A;  4E1O A;  4JEZ A;  1AMA A;  3PA9 A;  4OBV A;  3H14 A;  1BKG A;  4BQ0 A;  2JIS A;  1KL1 A;  4F5M A;  3AEO A;  2V0Y A;  4RKC A;  2W7K A;  5AX8 A;  2EPJ A;  2E7U A;  3WX9 A;  4CXQ A;  4WBT A;  2HUU A;  2FN6 A;  2YRI A;  1AMR A;  3WGB A;  3G7Q A;  1SFF A;  3NYU A;  3BCB A;  4KAM A;  4J8L A;  1PFF A;  3H7F A;  1KL2 A;  2DKJ A;  1S07 A;  1ASL A;  1DJ9 A;  3E2Z A;  3OKS A;  3B1E A;  3AV7 A;  3KGW A;  2R2N A;  4A72 A;  1B4X A;  4LNM A;  1H0C A;  1C4K A;  3AEJ A;  2AEU A;  2AY1 A;  2RFV A;  4ZLV A;  1QJ3 A;  2HZP A;  3NRA A;  1MDO A;  3P6K A;  1I43 A;  5DB5 A;  3ISL A;  1JF9 A;  1TAS A;  4XK1 A;  1TAR A;  1IX6 A;  4DQ6 A;  1D7S A;  3N0L A;  1AY4 A;  3F0H A;  1BT4 A;  1KKP A;  1AJS A;  2GSA A;  1AKC A;  1AKA A;  1TOG A;  3A2B A;  3NYT A;  2CY8 A;  3PDB A;  3EI9 A;  3WLX A;  1PG8 A;  3E9K A;  4Q6R A;  3WKS A;  2VMV A;  2W7J A;  5EIG A;  4EU1 A;  8AAT A;  1C7N A;  2CJG A;  3AOV A;  2W7I A;  1FC4 A;  5G2P A;  1OXO A;  4UOY A;  2W8W A;  3BB8 A;  2E7J A;  2VIB A;  4JEV A;  2NMP A;  1ASB A;  1M4N A;  4EMY A;  3HL2 A;  3GET A;  1CJ0 A;  2W7F A;  4H63 Q;  4H51 A;  1ASE A;  1ORD A;  5DJ9 A;  1C7O A;  4Q75 A;  1H1C A;  1AHE A;  1QJ5 A;  2O1B A;  3AEM C;  3FZ7 A;  4Q31 A;  4U1T A;  2W7M A;  1PMO A;  1N2T A;  3E2F A;  3T32 A;  4O6Z A;  2OGE A;  1AIA A;  1IUG A;  2CTZ A;  1JS3 A;  1S0A A;  2Q7W A;  1E5E A;  1OXP A;  1G4X A;  4BMK A;  4E3Q A;  1G4V A;  4FL0 A;  3ACZ A;  4ATQ A;  1BJW A;  3AEN B;  3LG0 A;  1KMK A;  1QIT A;  3PGY A;  1CQ6 A;  2OKK A;  2XBN A;  4JEW A;  1X0M A;  2YKX A;  1LK9 A;  3E2Y A;  4EB5 A;  4ZDL A;  3FFH A;  4WLJ A;  4DGT A;  3TFT A;  3JU7 A;  3FQA A;  1AHY A;  3MBB A;  1IJI A;  3CQ6 A;  3IHJ A;  3N75 A;  4I8A A;  5EAV A;  5IWQ A;  1ELU A;  1O61 A;  1GC3 A;  4B98 A;  4BA5 A;  2BWO A;  5BJ4 A;  3KGX A;  4B9B A;  1C7G A;  1M0Q A;  1VJO A;  2ZP7 A;  4WB0 A;  4ZDO A;  4ITG A;  1XEY A;  3BCX A;  1AY8 A;  5M4B A;  1AAW A;  1ZOD A;  3NTJ A;  2HOY A;  1RV3 A;  2ZSL A;  3FQ8 A;  3RCH A;  5BJ3 A;  2HP2 A;  3LVL B;  2YHK A;  2WK9 A;  1KMJ A;  3FVS A;  5J8Q A;  2ZSM A;  2DOU A;  3BWN C;  3QN6 A;  1WYT A;  1MAQ A;  4RIT A;  1ASA A;  1M0P A;  4NOG A;  2DGL A;  4L0O A;  2D63 A;  4F5F A;  3B1D A;  4QGR A;  1LKC A;  3BWN A;  2QMA A;  5G4I A;  3MC6 A;  3QPG A;  1RV4 A;  4W8I A;  2AY4 A;  2FKI A;  2Z20 A;  2CFB A;  1V2E A;  3N4X A;  4A00 A;  3PDX A;  4UHM A;  1DGE A;  5FT4 A;  3MAF B;  5LHA A;  3PDB B;  1S08 A;  3GZD C;  4M2M A;  3LY1 A;  4TMR A;  3HBX A;  4F5J A;  1C0N A;  4ADB A;  3Q8N A;  2VMU A;  3KE3 A;  1GEW A;  4OBU A;  3M5U A;  3FQ7 A;  2YOB A;  3KKI A;  4GE9 A;  4WXF A;  1IAX A;  4UHN A;  1N31 A;  3L44 A;  4JEY A;  4ZM4 A;  1V2D A;  2AY7 A;  1W23 A;  1DTY A;  3IF2 A;  3EI7 A;  3AEN A;  3GBX A;  3WCN A;  5G4J A;  1BJO B;  1YIZ A;  2A1V A;  4BA4 A;  3AAT A;  1AIB A;  1AKB A;  2VGS A;  3FKD A;  3ASA A;  3JTX A;  5FT5 A; 
#chains in the Genus database with same CATH homology
 2ZJG A;  4W5K A;  2BIG A;  1WKH A;  1MLY A;  2BYL A;  2D5Y A;  2EH6 A;  4AH3 A;  5M46 A;  4ZM3 A;  3BC8 A;  4M2K A;  3DRD A;  1AHX A;  1AY5 A;  5KTB A;  1UU0 A;  2R5E A;  4GE4 A;  1AX4 A;  1BJN A;  2G6W A;  4Q76 A;  2BI2 A;  3DR7 A;  2Z9U A;  3TAT A;  4A0G A;  1WYU B;  1GBN A;  4CBS A;  4WB0 B;  3JWA A;  3FFR A;  4R8D A;  5EAA A;  1UKJ A;  3TFU A;  2AEV A;  2BYJ A;  4OCA A;  3R9A A;  4A6U A;  1ARH A;  2DKB A;  2D61 A;  2OAT A;  3RCH B;  1AMQ A;  1LC8 A;  3WKR A;  1U08 A;  1Z3Z A;  3A9X A;  3K7Y A;  4EB7 A;  1D2F A;  2QSR A;  4R2N A;  3HMU A;  1X29 A;  3GWP A;  4OMA A;  1E5F A;  3CBF A;  1RVU A;  2VLH A;  3NDN A;  3DOD A;  4IXZ A;  3AOW A;  1WYT B;  4TV7 A;  4R5Z A;  3I4J A;  3MAF A;  2BI1 A;  3QI6 A;  4XJP A;  2EYQ A;  2BKW A;  2FNI A;  4JF0 A;  2BWP A;  4IXO A;  4ZWM A;  2D64 A;  2YKV A;  1IBJ A;  3P1T A;  3JWB A;  1YJS A;  2GB3 A;  2QLR A;  1B9I A;  2CB1 A;  3NU7 A;  4IXS A;  4A6R A;  4F5I A;  2BI3 A;  3ECD A;  2CH1 A;  1J32 A;  2BIE A;  2VYC A;  4ZDP A;  2QBT A;  5E4Z A;  3LV2 A;  3UAK A;  2QA3 A;  4GEB A;  4GDY A;  4PIW A;  2HP1 A;  1BJO A;  5G2Q A;  1CQ8 A;  3A8U X;  1QGN A;  2AY9 A;  2VMO A;  2PO3 A;  2QB2 A;  3HT4 A;  4HVK A;  1ASM A;  4W91 A;  1ARG A;  1ASG A;  2OQX A;  3FZ6 A;  3GSB A;  4ZSW A;  4A0R A;  2DGM A;  4ADE A;  5LH9 A;  4KYO A;  3EI6 A;  3TCM A;  3AEL A;  1CL2 A;  2O0R A;  4AO9 A;  4N0W A;  3G8M A;  1AAM A;  5TF5 A;  2HUF A;  3AEM A;  2EO5 A;  2YCP A;  4IY7 A;  2BI9 A;  1WYV B;  1M0N A;  2JJG A;  1TOJ A;  2ZY4 A;  4RKD A;  3NYS A;  2PB0 A;  1RVY A;  5EQC A;  9AAT A;  1QZ9 A;  3FZ8 A;  3PAA A;  1YAA A;  1WYU A;  4RJ0 A;  4E3R A;  2VI9 A;  1GD9 A;  4J5U A;  3ZRR A;  4U2H A;  4JE5 A;  2JJE A;  4WYA A;  4MQP A;  1GCK A;  1W7L A;  3DR4 A;  3LVJ A;  3MAD A;  4OT8 A;  3ZRQ A;  2VMQ A;  2X5F A;  2BI5 A;  2CIN A;  2CST A;  4OYT A;  2WKA A;  3D6K A;  4XEW A;  3FDD A;  2YRR A;  4IW7 A;  2YCT A;  5K8B A;  1X2A A;  2X5D A;  1BQD A;  2W8T A;  2FQ6 A;  1AHF A;  3VOM A;  1SPA A;  2JGT A;  3PIU A;  1MAP A;  4RLG A;  1S06 A;  4XJO A;  4WYF A;  3L8A A;  1ECX A;  5HHY A;  2C7T A;  4ITX A;  2VGU A;  5E3K A;  5DJ1 A;  2W7L A;  1Y4I A;  3FDB A;  2Z1Y A;  2JJF A;  5M49 A;  2HOR A;  3MEB A;  4Y0I A;  4ZWV A;  3EI5 A;  1PMM A;  2Z1Z A;  1IAY A;  1CL1 A;  1AMS A;  2W8U A;  4PFN A;  4XAU A;  2XH1 A;  1ZOB A;  2GMU A;  2VIA A;  3ASB A;  1SZS A;  2W7E A;  4EFF A;  5EUN A;  1OHW A;  3HDO A;  3VK3 A;  4JEX A;  3DU4 A;  3BS8 A;  3WZF A;  4F5H A;  5JAY A;  1BJ4 A;  3CAI A;  2PB2 A;  1S09 A;  2VMS A;  2W8J A;  4R5F A;  3GZD A;  3G0T A;  1QIR A;  2FNU A;  1AIC A;  2FM1 A;  3BV0 A;  1DFO A;  1LW5 A;  2VGV A;  2HOZ A;  2ZYJ A;  3UE8 A;  1YJY A;  1YIY A;  1UU2 A;  1WYV A;  4TN4 A;  2W7G A;  2BWN A;  3WCO A;  4CXR A;  2R5C B;  1TOK A;  3QM2 A;  5E5I A;  4DBC A;  1D7U A;  4W1W A;  2AY6 A;  2EGY A;  3FVX A;  3VK4 A;  1I48 A;  1OHY A;  2V1P A;  4LNL A;  3EI8 A;  4ZSY A;  1GEX A;  3QHX A;  1GDE A;  2DGK A;  4WXG A;  3PJ0 A;  4MQR A;  1MLZ A;  3II0 A;  2KFP A;  4AOA A;  3W1J A;  1W7M A;  2W8V A;  3FTB A;  4RJY A;  1D7V A;  4JE5 D;  4WYD A;  2E7I A;  4HF8 A;  4GSA A;  3RQ1 A;  3DXW A;  3ZZK A;  2DR1 A;  2VMZ A;  1M7Y A;  3FD0 A;  2GMS A;  4OTL A;  2D66 A;  3N4S A;  1JS6 A;  1V72 A;  2VGZ A;  3H9X A;  1SZK A;  1X28 A;  3EZ1 A;  4KXK A;  4F5L A;  1WKG A;  1SF2 A;  4A6T A;  2C81 A;  1LW4 A;  1SZU A;  3I16 A;  3WGC A;  4BHD A;  3VK2 A;  4E77 A;  1CS1 A;  2BHX A;  1VEF A;  1UU1 A;  3E77 A;  4WYE A;  4ZAH A;  1V2F A;  3LVM A;  2ZY5 A;  1B5O A;  3AEJ C;  3FVU A;  4K2B A;  3TQX A;  5DX5 A;  3DXV A;  4LW4 A;  1AHG A;  4RAE A;  5EUD A;  2QB3 A;  1WST A;  1IVR A;  2E54 A;  1D7R A;  2JJH A;  4A0F A;  4FFC A;  2VMR A;  2D7Z A;  1MGV A;  3EUC A;  1P3W A;  4MQQ A;  4UHO A;  1J04 A;  1ASC A;  3DZZ A;  4LW2 A;  1FG7 A;  1ASD A;  1ASF A;  3F9T A;  3FRK A;  1W3U A;  1LC7 A;  4M2J A;  1IX7 A;  4PVF A;  5G0A A;  4GRX A;  4P3M A;  2Z9X A;  2WB6 A;  1EG5 A;  2CAN A;  4UQV A;  5F8V A;  3CQ5 A;  1AJR A;  1DGD A;  3B46 A;  5D5S A;  3GR9 A;  3HQT A;  4MSO A;  2ZUK A;  1QIS A;  2Z67 A;  4Y0D A;  3DC1 A;  2R5C A;  1KKJ A;  1GC2 A;  3GJU A;  2VMY A;  3A9Z A;  1DJE A;  2VMP A;  4AZK A;  4Y0H A;  3UWC A;  3JZL A;  4ATP A;  1EQB A;  2HUI A;  4ADC A;  2G7J A;  1DKA A;  2VMT A;  3ZRP A;  2AAT A;  1GEY A;  3A9Y A;  3LWS A;  4RIZ A;  2W7H A;  1O4S A;  1EJI A;  1C9C A;  3N4R A;  1TPL A;  5C6U A;  2YKY A;  2F8J A;  4IX8 A;  1SVV A;  3EIA A;  4LNJ A;  4ADD A;  2O7C A;  3NUB A;  1ART A;  1ELQ A;  3HLM A;  1W7N A;  1M0O A;  4WXB A;  1OAT A;  3F6T A;  3VP6 A;  1DJU A;  1FG3 A;  5HDM A;  4WLH A;  1B8G A;  2ORD A;  1I41 A;  2ZC0 A;  2YCN A;  1CZC A;  1ZC9 A;  3MKJ A;  4WYC A;  3DYD A;  2C0R A;  2FYF A;  2D7Y A;  2WK7 A;  1OHV A;  3NNK A;  1N8P A;  3NU8 A;  2ZY3 A;  2AY3 A;  2VMW A;  2TPL A;  5EFS A;  2VI8 A;  4F4E A;  2AY5 A;  2OGA A;  2WK8 A;  2AY2 A;  2D65 A;  4ISY A;  2CJH A;  4WP0 A;  2CJD A;  2EZ2 A;  2OKJ A;  2AY8 A;  1TOE A;  3PD6 B;  3GZC A;  5G09 A;  4A0H A;  2X3L A;  4AO4 A;  3EIB A;  4IYO B;  3RI6 A;  4GE7 A;  2VMN A;  3JW9 A;  1G7W A;  2Z9W A;  3ZZJ A;  4K05 A;  1TOI A;  4AZJ A;  2YKU A;  3EZS A;  3NX3 A;  3OP7 A;  3R4T A;  1ARS A;  1IX8 A;  1MDX A;  3QBO A;  2C44 A;  2VGT A;  3ELE A;  3W1I A;  3MC6 C;  4WD2 A;  5HXX A;  3B8X A;  3I5T A;  2R0T A;  1T3I A;  3E2Z B;  4JF1 A;  5EUE A;  4CVQ A;  1MDZ A;  3ELP A;  1BQA A;  3BWO A;  3HVY A;  3K40 A;  1G7X A;  1LS3 A;  2Z61 A;  1XI9 A;  4OC9 A;  4CBR A;  4XJM A;  4LC3 A;  4W1X A;  4WYG A;  1YJZ A;  1GC0 A;  4XQ2 A;  4MY5 A;  2ZY2 A;  3RBF A;  3K28 A;  3W1H A;  3E6G A;  3RBL A;  3BN1 A;  5D95 A;  1VP4 A;  3CQ4 A;  3RUY A;  1AJS B;  1O62 A;  1LC5 A;  3COG A;  4MKK A;  3VAX A;  3WY7 A;  1BW0 A;  3MAU A;  1Z7D A;  2X8U A;  1O69 A;  3AEP A;  4P7Y A;  3N7N A;  1I29 A;  3BCA A;  2VMX A;  4MGR A;  5EIG B;  4ZAS A;  5FT8 A;  3QGU A;  1GC4 A;  3B1C A;  1JG8 A;  4N0B A;  2BIA A;  1M6S A;  3NUI A;  2VGW A;  2CH2 A;  1YOO A;  1M32 A;  3USF A;  5F9S A;  2JG2 A;  4MKJ A;  1B9H A;  4K2M A;  4W1V A;  5M4D A;  2HOX A;  3FCR A;  4XJL A;  3FSL A;  3LVK A;  3N5M A;  4PFF A;  1YNU A;  2EZ1 A;  1TAT A;  4F5K A;  5I92 A;  5FT6 A;  2Z9V A;  1CZE A;  1CQ7 A;  3ATH A;  4F5G A;  4K2I A;  4RM1 A;  7AAT A;  2GQN A;  3PD6 A;  2W7D A;  1B5P A;  1BS0 A;  2VLF A;  1ASN A;  1ARI A;  3PPL A;  4IYO A;  4E1O A;  4JEZ A;  1AMA A;  3PA9 A;  4OBV A;  3H14 A;  1BKG A;  4BQ0 A;  2JIS A;  1KL1 A;  4F5M A;  3AEO A;  2V0Y A;  4RKC A;  2W7K A;  5AX8 A;  2EPJ A;  2E7U A;  3WX9 A;  4CXQ A;  4WBT A;  2HUU A;  2FN6 A;  2YRI A;  1AMR A;  3WGB A;  3G7Q A;  1SFF A;  3NYU A;  3BCB A;  4KAM A;  4J8L A;  1PFF A;  3H7F A;  1KL2 A;  2DKJ A;  1S07 A;  1ASL A;  1DJ9 A;  3E2Z A;  3OKS A;  3B1E A;  3AV7 A;  3KGW A;  2R2N A;  4A72 A;  1B4X A;  4LNM A;  1H0C A;  1C4K A;  3AEJ A;  2AEU A;  2AY1 A;  2RFV A;  4ZLV A;  1QJ3 A;  2HZP A;  3NRA A;  1MDO A;  3P6K A;  1I43 A;  5DB5 A;  3ISL A;  1JF9 A;  1TAS A;  4XK1 A;  1TAR A;  1IX6 A;  4DQ6 A;  1D7S A;  3N0L A;  1AY4 A;  3F0H A;  1BT4 A;  1KKP A;  1AJS A;  2GSA A;  1AKC A;  1AKA A;  1TOG A;  3A2B A;  3NYT A;  2CY8 A;  3PDB A;  3EI9 A;  3WLX A;  1PG8 A;  3E9K A;  4Q6R A;  3WKS A;  2VMV A;  2W7J A;  5EIG A;  4EU1 A;  8AAT A;  1C7N A;  2CJG A;  3AOV A;  2W7I A;  1FC4 A;  5G2P A;  1OXO A;  4UOY A;  2W8W A;  3BB8 A;  2E7J A;  2VIB A;  4JEV A;  2NMP A;  1ASB A;  1M4N A;  4EMY A;  3HL2 A;  3GET A;  1CJ0 A;  2W7F A;  4H63 Q;  4H51 A;  1ASE A;  1ORD A;  5DJ9 A;  1C7O A;  4Q75 A;  1H1C A;  1AHE A;  1QJ5 A;  2O1B A;  3AEM C;  3FZ7 A;  4Q31 A;  4U1T A;  2W7M A;  1PMO A;  1N2T A;  3E2F A;  3T32 A;  4O6Z A;  2OGE A;  1AIA A;  1IUG A;  2CTZ A;  1JS3 A;  1S0A A;  2Q7W A;  1E5E A;  1OXP A;  1G4X A;  4BMK A;  4E3Q A;  1G4V A;  4FL0 A;  3ACZ A;  4ATQ A;  1BJW A;  3AEN B;  3LG0 A;  1KMK A;  1QIT A;  3PGY A;  1CQ6 A;  2OKK A;  2XBN A;  4JEW A;  1X0M A;  2YKX A;  1LK9 A;  3E2Y A;  4EB5 A;  4ZDL A;  3FFH A;  4WLJ A;  4DGT A;  3TFT A;  3JU7 A;  3FQA A;  1AHY A;  3MBB A;  1IJI A;  3CQ6 A;  3IHJ A;  3N75 A;  4I8A A;  5EAV A;  5IWQ A;  1ELU A;  1O61 A;  1GC3 A;  4B98 A;  4BA5 A;  2BWO A;  5BJ4 A;  3KGX A;  4B9B A;  1C7G A;  1M0Q A;  1VJO A;  2ZP7 A;  4WB0 A;  4ZDO A;  4ITG A;  1XEY A;  3BCX A;  1AY8 A;  5M4B A;  1AAW A;  1ZOD A;  3NTJ A;  2HOY A;  1RV3 A;  2ZSL A;  3FQ8 A;  3RCH A;  5BJ3 A;  2HP2 A;  3LVL B;  2YHK A;  2WK9 A;  1KMJ A;  3FVS A;  5J8Q A;  2ZSM A;  2DOU A;  3BWN C;  3QN6 A;  1WYT A;  1MAQ A;  4RIT A;  1ASA A;  1M0P A;  4NOG A;  2DGL A;  4L0O A;  2D63 A;  4F5F A;  3B1D A;  4QGR A;  1LKC A;  3BWN A;  2QMA A;  5G4I A;  3MC6 A;  3QPG A;  1RV4 A;  4W8I A;  2AY4 A;  2FKI A;  2Z20 A;  2CFB A;  1V2E A;  3N4X A;  4A00 A;  3PDX A;  4UHM A;  1DGE A;  5FT4 A;  3MAF B;  5LHA A;  3PDB B;  1S08 A;  3GZD C;  4M2M A;  3LY1 A;  4TMR A;  3HBX A;  4F5J A;  1C0N A;  4ADB A;  3Q8N A;  2VMU A;  3KE3 A;  1GEW A;  4OBU A;  3M5U A;  3FQ7 A;  2YOB A;  3KKI A;  4GE9 A;  4WXF A;  1IAX A;  4UHN A;  1N31 A;  3L44 A;  4JEY A;  4ZM4 A;  1V2D A;  2AY7 A;  1W23 A;  1DTY A;  3IF2 A;  3EI7 A;  3AEN A;  3GBX A;  3WCN A;  5G4J A;  1BJO B;  1YIZ A;  2A1V A;  4BA4 A;  3AAT A;  1AIB A;  1AKB A;  2VGS A;  3FKD A;  3ASA A;  3JTX A;  5FT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...