2WKOA

Structure of metal loaded pathogenic sod1 mutant g93a.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
b'ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDAVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Structural and Biophysical Properties of Metal-Free Pathogenic Sod1 Mutants A4V and G93A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2wkoA00
2WZ6A 3GQFA 1CB4A 1SXSA 1BZOA 2VR6A 2C9VA 3L9YA 2AQQA 1SXAA 1UXLA 2WZ0A 1FUNA 3GZPA 1L3NA 1F18A 1PTZA 2WKOF 2AQPA 2WKOA 5CU9A 4U4IA 3MKGA 1S4IA 1SXBA 1F1AA 2C9SA 3T5WA 1IBHA 2XJLA 2K4WA 3QQDB 4A7QA 1E9OB 4N3TA 2AF2A 4OH2A 3SODB 1MFMA 3GZQA 3GTTA 1IBFA 1OAJA 1XTMA 2R27A 3HW7A 2V0AA 2JLPA 1JCVA 5KBKA 2WWNA 3K91A 2AQTA 3QQDA 4A7GF 1JK9B 1E9OA 4A7UA 3HFFA 1YAZA 1Z9NA 1SRDA 1SDAB 4A7GA 2WWOA 2E47A 3ECWA 3GTVA 1E9QB 3KM1A 2WZ5A 1IBDA 2Z7YA 2ZOWA 4BCZA 3MNDA 3S0PA 2VR7A 3KM2A 1JK9A 1OEZW 4FF9A 1SDYA 1IB5A 1TO5A 3KBFA 3PU7A 1AZVA 1SPDA 1EQWA 2Q2LA 2NNXA 1KMGA 1E9QA 1DO5A 1Z9PA 2Z7WA 2VR8A 2WYZA 4A7VA 2LU5A 3ECUA 1SXCA 2AQRA 2ZKXA 4N3UA 1E9PB 1OALA 5KBLA 1XTLA 4B3EA 1IBBA 3KH3A 1PU0A 2AQNA 1COBA 3F7KA 2AEOA 4L05A 3F7LA 1E9PA 2GBVA 1SOSA 1YAIA 1DSWA 2ZKWA 1ESOA 1BA9A 2Z7ZA 1B4LA 3LTVA 1F1GA 3L9EA 1UXMA 1EJ8A 1OZTG 3KH4A 1RK7A 3RE0A 2E46A 1Q0EA 2GBUA 3CQQA 3H2QA 3CQPA 1SXZA 1TO4A 4MCNA 4OJAA 2JCWA 4A7SA 1U3NA 4MCMA 4A7TA 1PZSA 1QUPA 3CE1A 4BD4A 2ZKYA 1OZUA 3KBEA 1YSOA 2APSA 2SODB 2WYTA 2Z7UA 1N18A 2C9UA 1HL5A 3GZOA 2XJKA 2GBTA 5KBMA 1N19A 1HL4A 1SXNA 3ECVA 1F1DA 4BCYA 1CBJA 3H2PA 2AQSA 1XSOA 1P1VA 1B4TA 3HOGA
chains in the Genus database with same CATH superfamily
4EI6A 4XXWC 3RVWC 3QFJD 1CB4A 4L5FE 4Y19B 2KHAA 1PAMA 5EUOB 2OCJA 4DZ8B 3A47A 4HUMB 1ZT4B 3LZRA 2VXVH 1WBYB 1GJIA 1CTNA 4UAOB 3IMBA 3NCEB 1BXXA 1KLFA 4NPYA 5IQLA 2NY2C 3O11A 1FVCA 1H6FA 1KIQB 2O5YL 4Z78A 5MI0C 2XOTA 5DC4B 4Q89A 3JUYA 3QUGA 2E27L 3GTTA 4X5PA 2QGDA 4IBYA 4R90H 2IFFH 4G8GA 3ZDYE 4NI3A 4F7MA 1I3GL 2G9HB 1CO1A 4UT9H 4BKLB 1UM4H 1DQDH 1KJ3L 1A1NB 2EZ0C 5EBMA 3P2BA 3ECBB 5EWIH 4PJFB 4XCFH 1ZLVH 3UACA 4APQA 2DWEB 1T83C 3GMQB 4LLQB 5GS0L 2NY4B 4TXVB 2MEJB 2VXSH 4DKEL 3TFBA 2FH8A 3Q8FA 3KZ8A 5C0AA 2BNQB 3PJLA 3MV7B 4APXA 3IT8D 4A63A 1I8LA 4X98A 1CFBA 3QORD 3DTUB 4NKMB 4U7MA 5KVEH 1X9LA 1R17A 1WAAA 3AMLA 3JWNG 3VFRA 3UO1H 3F12B 5INDB 3ARRA 4Y5VC 4IKKA 3STBA 2HSIA 4LVNC 3MLYH 3QUXA 4U6VH 2Y06H 3TJHD 3SZ6A 3VD2A 1HCVA 5DUBB 3GXPA 2YAPA 5D1ZD 4MJ5B 2PO6A 4KX8A 3HCVB 4IRZL 1GS7A 1E5AA 3MRJB 2WB7A 4OBRA 2D31B 4X9BA 1C08A 4FHBD 1BWWA 3RX7A 1YYLL 1QO3B 1QFWM 2AERT 1OAYL 1DEEB 1I7RB 3OJDB 5G4NA 4MRCA 3G6AB 5D7KE 4F2MB 3TPUA 1T7ZA 2HVJA 4HKXB 2COVD 2XRAL 3A6BL 3H2QA 3EYOA 3RTQA 5CN2A 5GRJH 5J1TC 2VLRD 2LHAA 5HXMA 1FL5B 3BUYA 3FU0A 4JR9L 4F9PA 4FAAB 5I76B 3L1GA 1OAUL 4WENB 5DRNA 3VD0A 1NJ9B 2C26A 1IU1A 2J73A 4K73A 1UOLA 4OZIB 1FBIH 3QQ4B 2X0WA 4U0RB 2EEXA 4WUKL 3EHBC 3B9KA 2DW5A 2QBWA 2GVYA 2ZAGA 4QWWC 4XZUB 4LHUD 4R7NA 4LSSH 4PJ5E 1F4AA 5EIIA 3FCTA 2D7MA 2FJHA 4X4ZA 1KGCE 5E99L 3I84A 2NXYB 3F58H 3SDCA 1OPGL 3EJQA 1NUFA 3L7EA 2UVFA 3GIVA 4JANB 4P46B 4E9LA 1IT9H 3MHZA 1FNEB 3OXSA 4PWEA 3F85A 3L4YA 4ZOEA 1L3NA 4MWFA 3SBRA 4ODTL 5E0FA 1Z3GL 2YPLD 4GI6A 4JFVA 4LOUC 4UBDD 1I75A 4QOKB 1QSEB 4MS6A 1GZHA 2YA1A 5JLZA 5I75C 1CLYH 1QUNB 4JFEE 4NYLB 3KL5A 5FECA 2G4EA 3KPQA 1CXHA 3IGFA 4LIQL 1CDBA 4MJ2A 5JIKA 4UNVA 1H9DA 2WIIB 3BZ4B 1FHNA 3WY2A 3I6SA 4G5ZH 1GGIH 1S7RB 3PP3K 3MOAH 3NH7H 2A0LD 5FYJL 2BVPB 4KDVA 3QDAA 4O02A 4E9WA 4EPSA 4OZFA 2JB5L 3PUUA 3WIHL 4MA3A 4AJWA 2APVA 3JWOH 2XBDA 3TH2T 5IQ9A 5F6IB 4O5LL 1YN6B 2BSEA 3D69A 4UOW1 5T5FA 4F8LA 3VFOA 4J4PC 3V52L 3I75B 3VFWA 5JHMA 5CU5A 1BZQK 3BZFA 1RIUH 1QQDA 2K7QA 1VGKA 1XVSA 4OIAA 4ZS7L 4Y16B 3QXAA 2GITB 5KTEL 1UYWL 4U6TA 1KBPA 1MG2C 3BYTA 3BGFB 3UTTD 2E7LA 3ZE2F 1RFDH 1YNTF 2WO4A 3OKDA 1EXUA 5EU6A 2CUAA 5E5RB 5F0PB 3VMOA 4HX1B 1J5CA 1SBSH 2AK4E 2CO6B 4RA0C 1FNSH 1JZ4A 3P4OA 1F1GA 2BSRA 2H3KA 3GLDA 2XIDA 3GMMA 4GW5B 4MA8H 3VFUB 3C2AL 3T6VA 2YGOA 2CHNA 4LFHG 1DUZB 1TENA 3HVNA 3KYAA 5BJTA 1E3XA 1EEQA 1GZPA 2W9LA 1JGVH 5E6YA 2PPCA 5DTFB 5IBTL 4C56A 2HT2D 1PCXA 3BP6B 3VB8A 4XN9A 4NCC2 1CE1L 2GK0A 2P9RA 3QRGH 5G5DA 2VO8A 4W4OC 4IU2B 5D5MB 2PYFB 3K74B 1G0DA 1F3RB 3U36B 4WWPA 2DL2A 2UX6A 3MLSL 4FXLA 4GBXC 1SHSA 3W2DL 1S9WB 4KVPA 5F3HA 1DLHA 1FC1A 2AQ3A 1DSFL 3RA7H 3EYVA 3ECVA 1JWMB 4X5WB 4PB9L 4ANVA 4DW2L 2FBJH 3L54A 1P1VA 3KCWA 2DMKA 1AYOA 4Y7MA 3TA3D 5K69A 3RUGA 4P9HC 4ZODA 2DQFB 1BQLL 4MD4B 3U1SH 3WJMA 4ZUUA 2EYSB 3BUPA 3GEFA 1KIPB 1VFBA 1ZY9A 4OZHF 4OZ4B 1HT6A 1O9WA 3B2MA 3ZX1A 1HU8A 1AKPA 3DXAE 3G04A 3P9MA 4XP4L 4LPCA 1SEQL 4MZ2A 1S3KL 4TUKL 1RIVH 2FQDA 1G9EA 5KSBF 3D07A 3FCSA 3IWVA 2A73B 4PG2C 1XX9C 2VXUH 2XTSA 3ESPA 3IPEA 1KJMA 4RISH 1FVEA 1YZZA 2VE6B 5GHWL 4E41E 4X5XA 5IEHA 4FKEA 2FUTA 4XI5C 3LAFA 4ERSL 4YSPA 1MCEA 3BEWA 3IRPX 4PPTA 4M7LT 5EZLB 3EYFA 2KLTA 3SPGA 5E08H 4AV0A 3VXOB 4M93B 5AOLA 1AZZC 3NQKA 4J3XA 2R56H 3CX2A 1C5DA 3PPEA 3W1ZA 2GBAA 3VQLA 1MCKA 4E68A 2J8UA 5FHBH 4Z76B 1SF5A 2EO7A 3X2QB 2Y0SA 1MCIA 3HG2A 4FQCL 4NXKA 3S96B 4BFBD 2VM9A 3QPQC 2FWOA 3OHXC 3B6SA 3HLAA 1INDL 5GS3A 3VYNA 4RMBA 3C5ZD 1L9QA 4WI9A 3DECA 3KJ6L 3CV5A 2D03H 4YGAB 1N0LB 4EN3D 2YLKA 4W4NA 4CDHA 4KXZI 4LRIA 5AZ2L 1DO6A 2MFNA 5B38G 1RUKL 4L8SB 1SNRA 3REWA 4UV7L 3V79C 2EO1A 3OL2A 1FFOA 5CLXA 2R9HD 4OF5A 5HHVL 1U93B 4JPWL 4PJBE 4R26H 4KY2A 4L4VE 3EAKA 2X9WA 4U0QB 5C2UB 4K71C 2BOCB 1WDAA 1IUZA 4FL4B 5GS0D 4FQXA 3O9WD 3JV0A 4FQQA 4M5TA 3L7FA 1AVAA 3MR9B 1CFTB 2IDCA 2PNDA 3MUHL 4YHLL 4YR6A 3WTUA 3FNKA 2Q8BH 3MTXA 5HI3D 3QPKA 3IGAA 5I15H 1KXHA 1JL8A 1LO4H 3VFPB 4P5KA 4WW2F 5E0QA 3V10A 5C08A 4LNVA 3UGXA 3L3KB 3DSNA 3ZHDA 3H9SD 4ICXA 3KLAB 4L0PB 1UD4A 3IS1X 4ISVB 3A6CH 3FT9A 3MXVL 4HK0B 5F7BA 3CN4A 3V8CA 3WXVL 5E8EB 4I77H 3US9A 4NP4L 3T6XA 1OP4A 4JDVB 4AW4A 1FG2A 4GXUN 4HFWA 1AQDA 3EYQC 3MRFA 4IHOB 1LEGA 4JFFA 5DQ9A 3DX1A 1C7SA 3VXPA 7PCYA 5DMKB 3EG9B 3GT6A 4FXKC 2IH1A 4JFHE 4NM4H 4WTQA 5FYKH 3FYIB 1TQTA 4J27A 4U1NB 3N41B 4LU5L 3IDGA 3KPSA 1RQ5A 4WEBL 4XN1A 1JPGA 1P5UC 4ZMOA 1LL1A 2YQGA 1Z5LB 2N7SA 3HZVB 15C8H 3K8LA 1XL6A 5DZOA 3SOBH 2CR0A 1D6EB 3T1FA 4HEME 4A04A 2B3IA 1RIHH 2FEJA 3LZFL 4IKIA 3UPRB 4YOKA 3CMOH 2WJ7A 3ASWA 1Z9NA 1S7XB 5E9DE 3UBGA 1E30A 2E47A 2WQ8A 4KQ0A 2XWXA 3G5XB 2OSLA 5EA0H 1D7BA 5AVYB 3BGMA 4P23A 5T1MA 4S1SH 4LSUH 4K5OA 3U4EB 1FO0B 1FL3A 2Q8AH 5B8CC 1ORQA 3HC3L 4OIIH 2X41A 2DBJA 1M4KA 1XSIA 2HRLA 4HQQL 1IKFL 1CD1B 4AENA 2R23A 1KB5B 3A67H 1IARB 2K70A 3O45A 4HF5L 5DD6B 3FU5A 1BFVL 1RJCA 2C1PA 2BC4A 5F3BB 1H6TA 4QJ5B 2GY5A 1KTDA 3MODH 3AS1A 1IZKA 1ZE3H 4TSCH 3W82A 4CMHC 5K5YA 4NQEB 3RGVB 1XH2A 1F0LA 3IGLA 3Q13A 2JNZA 1WICA 3CFCH 1BEXA 2XNAA 4G1EA 2VDNH 3LV3B 5FO8B 5EUKB 3IKCA 5DO2C 4Z5RB 3QUMA 2FECL 2I85A 4AE0A 5KVMC 1JHLH 3P3UA 4ODWB 4IMKA 2BVEA 1DJIA 5LN4A 3VW3H 4JM0A 1RLBA 1R3HA 2VDOB 3KXFD 3D85A 3GUFA 2CJUH 4LE8A 2CNYA 5KS9B 1HHJB 1A4KA 2XBZA 1SYVB 4FC3E 1R3KA 1THCA 3ZUNC 1CGVA 4XNMA 5DS8B 5J9PA 4ZMPA 1IKOP 5ESAB 3V0IA 4FCHA 2O6PA 1MOEA 2ZYIA 1YMME 3BW9B 3VGHA 3AS0A 3HJEA 4KU1A 5I1HH 4HHGA 2YC1B 3ARGD 4J3WA 3UXFA 1ONQA 2GJZA 1NDMA 3VFGH 4OSUL 4ADGA 3QFGA 3ARZA 4P2QE 1CD0A 1RP9A 2GBTA 3DRQA 1M1XB 2EDEA 4Y2OB 1KXVC 5E8PB 1M7XA 3BP4A 1NLBH 2NR6D 4XNQA 4YNYB 3VX0A 5AD0B 5ISZD 1TR7A 2RD0A 4R4BA 3UTSE 5TDOB 4HU2A 3JXAA 4PJHA 3QIUD 3IE9A 2NTFA 5GZOC 1YVLA 4MA1B 1U36A 3U6XS 5ABAA 3ZYJA 1OP5K 3QDJB 4X6EB 1AE6L 4OCRH 4RMWA 2JVUA 4JO2H 1CICA 4Y7OC 1GL4B 1SXBA 2UWEA 1YC8A 5TE6H 2W0FA 4BDVA 3BXNB 2YA2A 4AL8H 3BAXA 4XNAA 1BOGA 3KVPA 4OLZH 2OZ4A 1JRHL 2YPVH 4HKZB 4ETQA 2RQEA 4YE0A 4UYQA 5L7XH 1I7ZA 4D3CL 4CNIA 4ZNEE 4ICWA 3S36L 4YSQA 3QIBB 4A7GA 3GRWL 2DQMA 2WWOA 4ZW5A 1U2YA 2J1YA 4I18A 1MIMH 5CCHE 1KNOA 3PP3H 3D18A 4H26B 3UAEA 4F1SA 3PS6A 4MAYB 4M1GL 3ZZLA 2WB1A 5T3ZL 2V2WA 2VDKL 3OWEA 1Z6JT 1H0DB 3NN8B 1SDDB 4D9LL 1QI4A 1L7IL 4XMVA 2ZP8A 4PJXA 5AEAA 3IMTA 2CH8A 2G75A 3MLZL 2C5DC 3UABA 1INQB 2UXFA 3ZPDA 3ZBMA 4Y1AE 1H3VA 2EIBA 2OJEB 1M7DB 2OR9L 3BAYA 4NHCL 1RUAH 5ANHA 4Y1TA 3OKLB 1EXGA 4M6NH 4U4BA 3BFOA 5GGSA 1YJDH 4S10A 1QACA 4WFHD 4XVUD 4NPKA 2Q0ZX 2CO7A 1CLOL 4KRPD 1TCRA 3U0TB 5HP5A 2FX9H 5TGBA 5IFAL 1C5BH 2P1YA 4M5YH 3MRBB 1DVFD 3QA3A 1EJ8A 4FTVE 3EJYD 4N85A 2EAEA 2OYMA 3BVXA 3VB9A 3GHEL 3VXSA 1K6QH 4DHLA 1Q94B 1BX2A 2IAMA 5E4EB 4JRXD 3UGUA 3GLAA 4HUWA 1A1MA 3RHWK 5BV7L 2IQAB 4WGWB 5HDBF 3CHOA 1QUPA 1PNDA 4X9YA 1VCBC 2DTSA 1N5AA 1YQVL 3NSYA 1A3LH 4NENB 1NCNA 1N18A 1U8OB 3M1BA 3KLKA 4GUPB 3NRPA 5D70H 3WLWC 1E6JH 4HFUL 3UZVA 4TMPA 1CK0L 4LSRH 5EBWA 2CRYA 5MEPA 1A7RL 1NGYB 4E9VA 2GAZB 1ND0A 2A2QT 2VSKB 3L1FA 4JGMA 5AB9A 4HC1A 3OSVA 1DDHB 2P48B 1U6AH 4WI0B 1IFRA 4C55A 2QPFA 4HHAB 1IQWL 2IADB 3D39E 4WAFA 3SY0B 1U91B 2CKBH 4P4KC 1KY7A 1I1YB 2A7BA 5JHBA 5B3JE 5IREA 1F4XL 1KBBA 5E6ID 4NQXB 2BNQE 2FBRA 4GRLB 3MV7E 4JO4H 4KK9C 4P3DB 4JPQA 3S34L 3V6FB 4F93B 2MPVA 2W88A 3O4LE 4XBGA 4EAEA 3NPZB 1XIWA 1F8TL 3RNKA 4P04A 2IQ9H 1E4KC 2X6VA 1F6AB 5BRZE 1G0XA 2EXSA 4RDQF 3PPSA 2NZ9C 4HIXH 5EZJA 4BEIA 4HZLA 5FWRA 2B0SH 1CFNB 3FOLA 2IPKB 1NFIA 1I1FA 2FIKA 2PP8A 4RGOH 2FO1A 5IM7B 1R5VB 1U2CA 3GUTB 5FUCE 2BO0A 3CZJA 2CPUA 3G08B 4MA7H 5GGQL 3IETA 1O75A 2J8OA 2XA8H 3Q1EA 2JXMA 3SJVD 5HHQB 1PAZA 2G3MA 4G72B 2Y72A 2J71A 4M4PA 4F2ME 5EF1A 5CILL 4Z95H 5BPPA 4N2LA 3GNML 3C60B 2V17L 1VFUA 1CMOA 1ZHLA 5AAMA 3FQXB 2HLAA 4L4JA 2PTTB 2R4SL 2I07A 3KWTA 2X6AA 3EJRA 1I9RH 4NKIL 4G8GE 4EUPB 1IGFH 5E4OA 3II1A 3WHE0 3RWJA 5DD0H 3BDXA 4BZ2A 4ECNA 5AL8A 4J8RB 1AFVL 1IJNA 4H8VA 4QHKI 1HVXA 3L9EA 3MACL 5LBVA 2QPDB 1EAOA 4OKVB 5FS5A 5I5IA 1T7XA 3MGTA 5K39B 1TTRA 4PRNA 5AVTB 3PWJA 4AEHL 1A6UL 5C0AE 5IF0A 4GG8B 2NX5B 2ED6A 2ZOLB 1QP1A 2VLLA 1MI5A 3AWEA 4K5PA 4XOBA 1WAAE 1OHQA 4JFDB 1NUDA 2NCEA 1MF2H 5ALCL 4WFED 2A9MH 3FT1A 2WNXA 2B1AL 35C8H 3QWRA 4IK6A 1GH7A 1AI1L 3F84A 4KKCC 5LQBL 3QWOA 4PW3A 4PJDA 2ROXA 1A9VA 1KCKA 2J88H 3UBHA 2OMTA 4FTDA 4NZTL 2NY7L 5BMFL 1BVKB 1KUMA 2HUHA 4UAOC 2CSPA 3S4SG 1IGTB 2X1OA 5D96B 3II3A 3GKWH 1D5BB 3BWAB 4G5AA 4AGPA 3WEXA 3EGXA 3EO0B 2CUHA 4MCZA 3S3SA 5J06A 5KVFH 4MNGB 3OKYA 5H4ZA 4G11A 2JKJA 3F05A 2ADGB 4MJIA 4P5TB 5IROC 3N55A 5JQHC 3TBWA 2VDQL 4UIMA 4V1DB 4GAYB 4JLRB 1DCLA 2IBZY 5CKAA 3ARWA 2AMUA 3FO2B 4JFWA 4LOEA 2QQNH 3NSJA 1EUTA 1QBLH 4LPTA 1B4RA 3S3PA 4JRYA 1CQKA 3CHRA 4Z7AA 4A7UA 2NY4C 4KI5D 4XX1E 4BE5A 5BCAA 1E4HA 1J87A 4MXVE 4ZFGL 4Y2DB 1BFOB 2F1EA 4HWUA 4D9RE 2OTWB 4JQIA 3FH7A 3KE0A 3KM2A 2PXYA 3DJ9A 3MZTA 3VGFA 3UEZA 1IAMA 2I60H 3V9FA 5EC1A 1GW6A 4IU3A 1P6AB 2Y6SD 5SWZB 2Y1VA 3U7WH 3DV6B 4BHUA 5AOJA 2EDTA 1JD9A 3F7VA 3NJFA 1UM5L 2PYEB 3TBYA 4JFOB 1LO2H 3Q01A 3QZWB 4Z7WB 1BLIA 1MWAL 4IOIB 2UYLB 1WCBB 4BSVA 1M1SA 5ILTH 2YN5A 3OMAB 2QQKH 3BWUC 3LXBA 2QV2A 3OZKA 2AXFA 3NSXA 5K1NA 3MCLL 2JJSA 3D33A 3TEUA 1P1ZB 2IAAC 3AT8A 5FPIA 2R4RL 1R1CA 1U8KB 3DRTB 1UFGA 2R1XA 4GG6F 4WUUB 5DSCA 2YJLA 4BFFA 1XBRA 1XF2A 3MLVH 5T3ZD 2PW1A 3SDXA 3HMXL 5DLML 2ZYRA 1XGPB 2E76C 4BFNA 3CFEA 1VPOH 4NKDA 4U0RC 2MIZA 1K2DB 2OTPA 1F45A 4WNQA 1KJVB 1E4XH 1EDYA 1JZIA 2X6MA 2ZKYA 4TVPL 3HPJB 4X8XA 4MQSB 4F91B 1XCQA 5ACZA 3ESNA 2NXYC 2H41A 3ABGA 3NZUA 5C07B 5AFAA 2EIJB 3STLA 3WHXB 3H4HA 1YECH 3MAWA 3L6FB 4P46C 2AEPH 3H2PA 5EU6E 5BUAA 3P30H 2XG4B 3PWLB 2QR0B 2MCAA 2VTFA 1WP6A 2XWTA 3RGBA 3X12A 5CCKH 3FB5A 2Y6TE 2R2EB 3KPRD 1YEFH 5C09D 1UZGA 4QO1B 1RHHA 3EF4A 1OP5H 2GUYA 4MS8D 1L5GA 4BZ1H 1QLRA 3LEYH 2X7LB 5LXGL 3RWGB 2NZ1A 3LRSA 2P43B 3TCTA 5IVNA 4KNUA 2D4DA 4FFZA 2E27H 4MNHB 4C56E 3CFDA 4AK1A 4O2EA 2NY3B 5FIEA 2Y2YA 4WEUD 1NAMA 4FHKA 5BOPA 1I3GH 1Q1PA 4E9SA 5J1AB 4YIQA 1WWWX 4PGCB 1KJ3H 5FB8B 5I2IB 2ATKA 1TJGL 2OMWA 3I9GL 4AMKH 4NNXA 4DWHA 2YAMA 4U2YA 5IJVB 4EQ2A 1P9MA 1NCJA 3UJIH 3SBQA 5EG6C 1KYDA 2NW3B 4DKEH 2SEBB 3RWEB 2CDFB 5F6IC 4AGMA 1KBGH 5B38A 5KSAA 4PY7B 1RZ7H 5IOPB 4QRUB 4AC4A 2IBBA 1RD6A 4QHUA 5E5MA 3RUGE 1QR4A 5FKPA 2P26A 3ATDA 1WHPA 3M1OA 2C3HA 2WTRA 4H1LH 1VB9A 3WDJA 3PWUA 2X89A 2YBRB 1JNHB 3VXUA 3WL9B 4Y16C 1NBYB 1R5IB 2P5WD 4HK3N 3RDTD 2X4OA 1ACCA 4MAUH 3BGFC 1FN4A 1V3KA 3ZL4H 1WLHA 3UJJL 3FTUA 4YHZL 3FN0L 3VD4A 1J5DA 3P11L 3WKML 5IB1A 1XGTA 1DJXA 4BQ8A 1DTUA 1O5PA 2BRQA 4H0GA 3S37X 4CMMA 1BVLB 3WS6C 3CZFB 4QRSB 1OAQH 1MHHA 2BIHA 4PRDB 1YEDA 3QXTA 4PBXA 4C58B 3NCBB 2N7BA 5JYMA 5JHAA 5HDQL 1D9KA 1MCDA 1AGDB 4YO0A 3A6BH 4LQ1A 1VZGA 4GSUA 4ZMNA 5AW6B 3SO5A 4NX0A 2JJTC 3OF6A 3VSQA 2XVLA 4RMSA 1OAUH 5ENWB 3CVHB 4KROB 1RMFL 3PL6A 1WQVT 5IHUL 3EFOB 1HKLL 1LVEA 1S9VA 3GMRA 2LLNA 4HUNB 1CXEA 4NRYA 3OLIA 3BVDB 1R3JB 5E7BA 1UWYA 2WYTA 1EGJH 1JVKA 3IFPA 3VU2A 3TEYA 2ZOTA 5FK9A 3KYMB 5TQ2H 4FKHA 4O2CB 3T8XA 1L9NA 5E99H 3C09C 3DX6B 1AKJD 1HYRC 2ENSA 3HG1D 2GI7A 4N28A 3SE9H 4FYSA 5JQ6H 4GKZB 4HT1L 2UZYA 4X0KA 3WIFB 2WXLA 1QRND 4HKBB 1T1XB 4AM0B 5DJZA 2K3TA 4WNSA 1M3JA 1UXLA 4XNUH 5EPMB 5D72L 5IW1B 2CO1A 4QRQA 5MEQA 5GS1A 2FYYA 5E8DH 2HJKB 4YN3A 1NFDB 2WKOA 3QZNA 5EBLA 3RZCA 4GW1B 4O51A 2YD5A 4MQXC 4O2FB 2QPSA 1UEMA 4WDIA 1FZOA 2P80D 5CJXC 4NC1E 1JG9A 3CFIC 3GMNA 3N42B 4LIQH 2FYVA 2D7TH 4NO3A 4JHUA 4X6BA 2NY1D 1KPRB 3QULA 1FFNB 3Q6GL 1JXJA 3QI9D 3UC2A 3LCYA 4ODUB 1UEYA 4UM8B 4M93C 4A55A 1JERA 1IGYA 4WJ5B 4LF3A 2OYKA 3D2UB 5FYJH 2ITDA 5GIRB 2VL4A 1CR9H 4KXZH 4KHTH 1R47A 3FO1B 2OYLA 5A2LH 1UQSB 1MUJA 1YEWA 3F7YB 1NCHA 4U1HB 1KMGA 1N5YL 1YN7A 4JFFE 3DX0A 3MLXL 5C6TL 4QHNB 1N6UA 4KTEL 4QXGH 3IDNB 5JZ7D 1DN0B 2VMCA 1CLCA 1LO0L 2VN6A 3F8UB 1X5LA 3HR5A 4YHYB 4ZS7H 4QRRA 2ZPKL 5KTEH 3KPSE 4L8SC 4N5EC 3T0EA 4UT6H 3KGRA 2BY3A 4OF0A 4DKFH 2KQNA 4ZMQA 1SOSA 2V7HA 4FP8L 3IFOA 4Y9EA 1DVQA 3B9AA 4GRWH 3RL2A 2D4FA 4J12A 2CJTA 3C2AH 5L2KB 2F53E 4FL4C 3RHWF 5HHOB 4CU7A 4ODXA 1R24A 5LAXA 2HRPL 4UV4L 3TJEH 1T6WA 5FKAA 4ZAKD 5ACMA 2IGFL 1J1XL 3VDBA 3D5OF 1PFOA 1XGUA 3JZ7A 2Y7QB 3VMNA 3M86A 5IBTH 1HH9A 4QNPE 5B39B 4KJWC 2WM0A 5DDHA 4R4FL 1CE1H 1ZVSB 2DIEA 1WIPA 1Q9KB 2NSMA 3PIQA 4MCYB 5SV4A 1QEWA 3BVWA 3K6DA 2A77L 3TCLB 4PJGA 1KTRL 2J56A 5EU5B 3NIDE 3MNVB 4OI9A 3E0GA 3FO9B 4AQOA 1IV8A 1HQ4A 3DPDA 3RZWA 4K94C 1QFWI 3O8XB 3PNWB 3KWWB 5J4MA 2WGXA 4PB9H 4DW2H 2G0KA 4TNEA 2J55A 2ED8A 3QIUA 4AX3A 4F57L 3V4PA 1LD9B 3T77A 5IB3B 1GOFA 4ZMVA 3SDAA 5FYKU 4EIBA 1VGEL 2VOTA 1U3HD 1BQLH 1WISA 3LX9A 2BS8A 1HAWA 4G3YL 3IVKB 2ZE0A 1OY3B 1A8JH 4RGNE 3CX5J 4OKDA 4LCCA 2HKHL 3MQIA 5KBDA 1XO8A 3OJ2C 1PX4A 4XP4H 1MFDH 2H32A 5D1QD 4JCLA 3HZMA 3MKGA 3VXTA 1S3KH 3OKOA 5GGTL 4AYFA 3L45A 1ZGLB 3O2VL 3SCMD 2ARWA 4JJ5A 4PJAA 1HOCA 2LLLA 3FF7A 5GHWH 1N4XL 3TN0D 1A25A 1JMZA 1NCCH 4TVPD 2WZPD 1QNZL 3VFNB 3MFGB 4S1DD 1FAIL 3A23A 1EZVX 2OI9B 3NK3A 5GGRY 3VRIA 3BVNA 3MYJB 3QZPA 3MRPB 4MQTB 4N0CC 1UJ3B 2CLZA 1SY6L 3CIQA 1E5CA 4RAHA 1A2YB 2QL1A 1CLZL 1RI8A 3SPHA 2OXHA 1BG9A 4G9FD 3HB3D 2R0KH 1E5YA 1KCVL 2DLIA 2DQCH 3BPCB 1RZJC 4HDIA 4AT6B 4KWUA 2GJ6B 4FQCH 4MXQC 3RP1A 1RKRA 1BYNA 4YDMA 4Q9QL 1AO7A 2KZ1B 3PV6B 1ZLSL 4DJMA 5DJAB 3KPOB 5LGJA 1XR8A 3L4ZA 5T1LA 3RGVC 3KJ6H 2YZ1A 4M3JA 1HXKA 4XPHL 1L6ZA 1Z3RA 2UWEE 3NACH 4GRWF 1FYTA 2R0ZL 3WY4A 4FQIL 1BIIB 3KH3A 4QRAA 2FJFA 1RUKH 2EUXA 4YXLL 4DVBA 2A9NH 4UV7H 3UL4A 3BH8A 5HPMB 2UXTA 1NC2D 4KX7A 2VRAA 4P3CL 2EH8L 4JPWH 1LP9A 2BSDA 2EJ1A 5EF2A 3BIAX 4WEMB 1P4BL 2E86A 3QXUA 3Q1SH 2IH9A 3Q6FB 1H3UA 1N3NA 3MFFA 5E2VL 4JN2B 4YAQB 4HKJB 3Q43A 1P4LB 1KZYA 4PYHA 4KPHL 4NQCD 3BAJA 1PDKA 1JGUL 3VI4A 1G7HA 3K72A 3WN5B 1RK0B 4LEXH 1QYGH 1PFCA 2V8MA 4OJCA 4NAQA 5I0XA 4UU9A 1AS6A 1G7LB 2W95A 4LCWB 4FI7A 1IM3B 2NY6D 3GM8A 5EO0A 5MEOA 3P77A 5D7JA 5KYWB 4H20L 1VF5C 1NANI 4UNUA 2EC9U 7CGTA 4FQJH 3WXVH 3MXVH 2VM3A 4JM2F 3TZVC 4NP4H 4M8UA 1EAPA 1SVBA 1XAKA 5BZDB 2W07B 4MA1C 5EFIA 1AOHA 3FB6A 2G5BB 1AHWA 1OV8A 2C9VA 2Y07H 5SWSA 1K4CA 4GSRA 1OWWA 3T3PF 3ARTA 4LLWA 4CKQA 4ZTPH 4OLYL 3LKNA 4J6RL 4IEFA 3HI6L 4JG9A 1QA9A 3LB6D 1AS7A 4LBAA 3DROA 3FONA 1QR1A 3K8MA 2QDVA 1ZD6A 2BIOA 4JG1L 2G2RB 4PGDB 2F7QA 4JFPA 4WSKA 3NOIA 4ELMF 3VGBA 1TJXA 3QIBC 5INCA 4YDVB 1ODAA 4MMZB 1TJHH 5GSVB 4PS4L 1YDPB 1JK9B 4MAYC 3EO1B 2FHBA 2HTKC 4X9FA 3GBDA 4XXCA 5IR1B 4UM9D 1A14L 2NY5L 3FU7B 5BS0B 1HSAB 2MTPA 3LS5L 3WNPA 4OCMC 5C0GB 3RKDC 3HC3H 4NS0A 4ZFFA 2CJSA 3MBEB 1ZGLM 2F19H 1IKFH 3BP7A 2R2BB 1OP3K 2WCGA 1CFSA 2Q7NA 4FQ2L 5F89B 5C0BB 3PQYD 3DOIA 5FV2A 2IG2L 4HF5H 4BK4A 4IJTA 3D48R 2WXJA 1BFVH 4JDZA 3W56A 5FO9B 1VFMA 5I1LB 4IGBD 2K6YA 4G42A 4L5FH 3DOSA 2RHEA 1T20A 4FEIA 1QFUH 4FYRA 2WO2B 2ZXBA 3NJMA 1J9CT 1IGJA 3Q05A 1H8SA 4MKMA 2Q10A 4I1NB 1XHHA 3OZ9L 3MREB 2VDRB 3I50H 5DURB 4OI7A 4OD1L 1NEZB 4NUJA 4U1MB 4Z77A 1Z66A 3JWNE 4X4KA 2Z35B 4G82A 3NZ8A 2XWJB 3IXAB 3U6RB 2QZQA 3RVVD 4X7EC 5LCVL 1FA4A 5F88B 3ZE0B 4QYOA 4PJ9B 5E4EC 3Q7JA 12E8H 5F8QC 3REVB 2FR4B 3JT0A 3MRCB 4A39A 1P5VA 4JY5H 4TQPA 2XWBB 3AG4B 4AUJA 4PRPA 4AYDC 4Y9CA 4MNGE 4ZI8A 1TUPA 4Z7QB 4WKXA 4OSUH 1JPEA 1N8ZA 3VFVB 5KG9B 4YDIH 4MX7A 4V1DE 5DWUH 1IO4C 1IAKB 3WI9A 2EE6A 3VXRD 3BAKA 5AKVA 1ZA6A 1PG7X 2OMZB 1T3FB 2XU9A 3H9HB 4WU5B 2PCPB 1QRKA 5JIDA 3CFJA 3IMVA 4YJZL 3HC0B 4GRLC 1OCOB 3GRGA 3WFDL 2VR9A 32C2A 4BFJA 2XN9D 3HAEH 4G9DA 4UANA 1IMHC 3LRMA 4OCWL 4P4RA 3VG0H 4I8DA 3M7OA 2BP0B 1HAUA 2JQMA 4UT9A 1SEBB 5SWZE 3RDJA 1EK3A 2XETA 4R6UA 5I1AB 4X50A 3VM5A 1AGFA 1MI5E 2FK9A 2HRGA 4UZSA 4D3CH 5IQOA 1I7TA 4KKZA 4X99B 1QAWA 1U58A 3EGSB 3GRWH 4OW6A 1GOGA 2F0CA 1KLFB 1MCBA 4RZCB 2DMBA 1MFNA 2K3HA 4M1GH 4P9HH 5A2CA 3FTXA 3OAUL 5D7IF 2GFBA 3FQWB 4GSDH 3T0AA 4X6CF 5IJBC 5ADOH 5H2BB 3ULUD 1HS6A 3CAFA 3BP5B 2CK0L 5E6RB 2J6EH 2HPOA 1NCUA 2A83A 4K15A 3C60C 3LD8B 5HTSA 3X13A 4G8EB 5JHLH 3VVVA 5AUMA 4P59L 3U30B 4LCUB 1PY9A 1UHVA 3CDZB 4U3SB 4ZXBD 1BVNT 4QRTB 3PP4H 1MCHA 1SOQA 2JH2A 2P8PA 4IOSA 1TVDA 3O3DB 4L1TA 2VAAA 1RXLA 3N40P 1YNTA 1CLOH 1QFPA 1FO0L 1A5FH 4LDOB 3JV4B 4N8UA 4JRYE 3SZKC 5IFAH 3HE7B 2AJVL 3EADA 3GSNB 3TF7C 3VQ2C 4M8QA 3G6JB 1KB5L 1INEL 2GJJA 3GHEH 1E7VA 4IRJD 5FOBA 2JELH 2DM3A 1EERB 4AQ1A 4XAWL 3FU8A 2QPEB 2F54D 3AY4A 5TE7H 2OSXA 1U3NA 5TE4H 4WWKA 3IJHA 1AACA 3ESMA 1WV7T 3CE1A 4AQAA 2AP2A 4GI8A 2Y1AA 2Q76B 1TYEB 3QEQD 4TTDD 4ZMZA 2XX0A 3RWIA 3ZL2A 1QX1A 5DJDA 3ZY7A 2F7OA 3VXMB 4WO0A 5B21A 1EFXA 4X80H 2VDOL 2G4GA 4GPVA 4MDJA 1HE8A 4P2OA 5D96C 4L9LA 4N8VG 3SIKA 3C8HA 3ASOB 4EQ3A 1A6AA 4QTHA 1KT2A 4B9YA 1GZQA 4I89A 1WRFA 1IQWH 3BKMH 2J2ZA 5GQBA 5HJGA 4G1MB 4E42A 2ZX8A 4I5BA 4XMXA 4P5TC 5L4MA 2O72A 4LKXA 2W8CA 3ARBB 2IPUG 1F4XH 4BFRA 1BYOA 5HGBA 1FV1A 1EO7A 5FGSA 3S34H 1QKZH 2WUCL 1D7CA 1ZHNA 4OZHA 1NTDA 2E56A 3JV5A 5HYJD 2NLJA 3SDXE 3QQDB 1DBML 4ZD3L 1F8TH 1VKXB 3C08L 5ID1A 3CHPA 1JV5B 2JCCB 2ZX5A 1TTUA 1CIUA 4KRNA 2O61B 3MBWA 1HEZA 5KJRL 3FPYA 5HGDA 5KSBA 3ULVL 4Y2DC 1J10A 4MWFB 1CWVA 4WHYH 5LG6A 4GKNA 3MLTB 4TM9A 1OB1B 2H45A 3CFMA 5GGQH 4V2BA 2VR7A 5E7FA 1W0VA 3AREA 3IU4L 2P49B 1IB5A 5TFSL 2EC8A 1NL0H 4OJDH 2IDFA 3WELA 2QVIA 2YRBA 4EIGB 1JF1A 1EJ6A 2A6KA 5CILH 3TT1H 4BUHA 1W6LA 2QMJA 2V17H 4BH8A 3INOA 1ASOA 2FO4B 3D4CA 5EF0A 3DHMA 1N2RA 1JFQL 3FQNB 4NKIH 2V33A 2A6DA 3F7LA 4KC3B 3AU0A 4TUJB 5L0QB 1N6QL 1OGTB 1LHZA 2L0DA 3L5WA 4XO3A 3BPLB 1AR2A 3ARFA 2VQTA 3FYEB 1ZLUK 1AFVH 5IT2H 4XVJH 5FX3A 1MCPL 2VSDA 4CW1B 2PLTA 4F7PA 2VABB 1OGSA 3PGCB 4GH7B 2VDLB 3S37L 3BX7C 3IFNH 5LWYL 3K4AA 2JB6A 1PKQB 4AEHH 4EF3A 2BHYA 2HUEA 1WA0X 1HFUA 2QTEA 3KEHA 3UOAB 3TO4B 4HJ1A 5GZNA 2HTLC 1P4UA 2FJUB 2Y1ZA 3AB0B 3FUDA 4WHCA 2YD9A 2B1HH 4WVRA 2EEBA 3L3OA 3VXUE 1NFDE 3MUJA 1G84A 5IJKC 2B1AH 5I5MA 4WW2A 2OK0L 4HIEA 4JDTL 4DPCX 4XPTH 3MGOA 4PD4K 5LQBH 3DMMD 2C9XA 5DJCB 2XZCL 2P24B 4HHWA 2APXA 2LU3A 3O4OB 4NZTH 2NY7H 5BMFH 5JXAH 4KKRA 2UZXA 4FFVD 5E9AA 1T4KB 5GS2D 2JIXD 1OOAA 4LLMA 1JZEA 3VAEA 4A2GA 3LKQA 1KCUL 1U8IB 2C7UA 2ZOOA 3VI3B 4Z7NF 2DL9A 2X28A 4HG4K 4JFTA 4U3HA 5DVOA 4A68A 5CLWA 3CC5B 3U2SB 2FEDD 2EDLA 2NY3C 5I9QC 5JA8B 1RZFL 1BF5A 2H2SD 3NFPB 1IEAA 1F1AA 1MQ8A 1KBWA 3JBG7 3GGWA 5DJ0B 5TDNA 4BSWB 2OMVA 4J3OD 1YY9C 3TBTA 2DV6A 3O2DL 1F2XK 2JLPA 1MJUL 4HPHA 5A3IC 1T04B 1I4FA 3LNHA 2WJ5A 1MAJA 4LGSB 3WFCL 3D06A 1NH6A 4ZFGH 2XKSA 4Y4KD 1JFHA 2AITA 4S2SA 5AYTA 4AC2A 1B0GA 3M88A 5CGYC 1B3IA 4XODA 3ZJAA 4P99A 3APNA 4PMFA 1Q9WA 3FCSB 1OP3H 5KYUB 1AZRA 1S7VB 2NY0B 5FFGA 4C47A 2J12B 2WBJB 5HHOE 5FDYA 3DV4A 2F58H 3QNYA 2HMIC 2Q6WA 4A7VA 2ZSVA 4ZUWB 3WKNA 4ZFOB 3ILPA 1DBAL 2R1YB 1MWAH 3ESOA 3HTLX 3NA9L 2VM4A 3DX9A 2GQHA 3B3BA 3EJZC 5HYQB 1JCKA 2J8UB 1F90L 5KW9L 3B7TA 4OLXH 5F70A 5DI8A 3MCLH 2WVTA 5CUSH 5IVZA 3X13B 4Y2LA 5HGHA 4DO5A 3WENA 4LSQH 4N2MA 1TJIL 4RFOL 1BMZA 2XWRA 3IDXL 3KBPA 1P2CB 2DIAA 2Z7ZA 5DFVD 2DLTA 2FWOB 2R4RH 4PCKA 2W9EH 1UACL 2QKIA 4D7PA 2X9XA 2OMNA 5GRZA 1S7SB 3OVUB 3CG8A 5JMOC 1B3JA 2PF6A 8FABB 3AXHA 1X7QA 1NGXA 1YPZB 4KROC 1A6TB 5F7FA 4PV8B 3QJHB 1EBPA 3HMXH 3K6OA 5C1MB 3N50A 1Z1WA 3X1BA 2F5BL 2OL3B 5DZLA 3SPVA 3VG9B 4HSQA 1MCWW 3APMA 2EH7L 2HVKB 2QPUA 3V0GA 5I8CA 1M2VA 1NC4B 4NJAH 4PWHA 4H2AA 1OGAB 5B7FA 2C9UA 2C3XA 4QRRE 3S3DB 1TLMA 3T0EE 2FJGB 4L1DA 1ZT7A 3N6YA 2D7QA 4L1LA 1I9IL 3SKOA 3WN6A 1CVRA 1NGZA 2DKMA 3SE8L 4JY4A 1BCIA 3MV01 1K8IA 1RUMH 1KFGA 2A74B 4XPGH 5AWNH 2ITCA 5AAWC 5C08B 4XVSL 2R1WB 5EZIL 1OXYA 5IQ7H 4ABQA 3PWPB 3ASNB 1AXSB 2Q20A 1U2HA 4X5RA 3QEUA 4F5CE 5LXGH 5T33H 3BT2L 1JN6B 3ZTJH 2OMXA 4ZPVB 1A3ZA 3AXIA 4RZKA 3GMPB 4Y5YA 1FH5H 2GJ6E 4JM4L 3NJXA 2UX7A 2ORBL 4FQHB 3C9NB 4KNSA 4CBPA 1FG2B 3QHTC 2K9UA 1G6RL 2OMYB 2ZX6A 2OMBA 5D72H 3W9EA 4B60A 5A7EA 4PJGE 2KYIA 2X4PB 3LH9A 2JTDA 4YL4A 5DD5L 3FPXA 5TD4A 1UOVA 5BZXA 3ETBJ 3RFRA 4BGDA 3I2CL 3R7RA 3V0HA 4GKSB 3IEAA 4WGVB 3ECWA 3AWGA 4NN6B 1SLUA 5EMYA 2DOCA 4PTTA 1L9RA 1UB6B 2PP9A 2Y7MA 5CN1A 3DUUA 1FZKA 3KR3L 4NSKB 1O6SA 2X87A 1BZ7B 1JF6A 3LN4B 4G8FA 4HOMA 3QO1B 4YHYC 1OSEA 4AJ0A 3SYQA 2GJRA 3T2PA 3UTZB 1WD8A 1FDLL 2ITEA 1GGYA 4OB5H 3AY2A 1T5WB 3UJJH 2VLJD 2VUKA 3B9DA 3MJ7B 3GMLA 1YEEH 1EZUA 3AU1B 4I3SL 4N4YB 4P2RA 4XCNA 1H3PL 3WE6A 3WKMH 1LQBC 3BSZL 1E50A 5F97E 1QSFA 2BNRD 4WWOA 4LCWE 3ATBA 3FTYA 3F7QA 2ICES 2Z31A 5EEYA 4AENB 2O6CA 4XNXL 2BVUA 4XC1L 4NUQA 1ZDSA 3ULVD 1QFWH 1AIFA 5IK3B 5HDQH 1MH5A 3W0WA 2VNCA 4OCNC 2BC4B 4HIHB 3U7AA 3B3IB 2YOAA 3GI8H 1YNKH 4OD3H 1TU2B 1I8MB 4KNTA 4GXFA 3TVMA 3L13A 4ELKB 2DKUA 2LT9A 4N90D 3MCKA 4DGYL 5JORB 5BXFB 1HNFA 2HJLB 1RMFH 3UYRH 4AV4A 3PAUA 1HKLH 3LSOB 1FVDB 2AXGA 2VIRB 1AO7E 3MRIA 3O8XC 5DHMC 5L8KB 1J8HB 2X1WL 5I6KA 4IBQA 4UQDA 4UB0H 1KDJA 3X11A 3NZHL 5I0DA 4PBVC 1ZT1A 4AMXA 4ENZA 4PRIA 5B1AB 4AEIH 1HESA 2P5ED 1R3KB 2V5YA 5I8KL 1JWUB 4GIPD 4FD0A 1GY1A 4M7KL 4OGYL 3ZDZB 3FFCA 4Z0XB 3OKEB 1K85A 1XFPA 1LDPL 1QLFB 3K6SB 3K3QA 2YR3A 1LP9E 3L2LA 3KYNA 1OAKH 3IDYB 1G7MB 4IOFC 2X44D 4DP1X 2ADYA 1GXEA 2PPFA 3S5YA 1IGCH 3QZMA 1N9PA 2YPVA 2X9YA 4PJEF 4U4IA 5IZ7A 1XH3A 4XGZA 1WZ1L 1M3IA 3BP4B 4WW1A 1RY7B 5C0BE 1B6DA 3VI4E 1XGRB 4R4BB 4Y4HA 3WKYA 4PJHB 4Y5XA 1MFMA 2OI9C 2QLVB 3C6LC 4N2BA 4D7BA 1SMOA 2VXQL 4QR7A 1W91A 5J6SA 4TNVK 1UJ3C 2NTFB 3RVWD 4FYQA 4FG6C 5E8NB 4RNRB 5KSUA 3ZRFC 4Q9RH 2DQDL 1IVTA 3O6FD 2W0FB 4NPJA 3U6XA 3BO8A 2NY2D 4XMWA 5GRUH 2F68X 1DJYA 1U30A 3K80A 3KBFA 3PQYA 3MJ9L 4ETQB 1OE3A 3EJTA 1MPAH 4IGBA 2HKFH 1AS8A 5SWSE 5A1AA 4KTEH 2H9GB 1BM7A 3LEXA 3QDMB 3T8MA 1E2WA 4N9GB 3VTTA 1JPTL 4KKAD 4X7SH 3DHUA 2OSWA 4EDXB 1E9PB 1WFUA 2VWEE 2WXPA 4NRZB 4QLRA 3U46B 3ZMRA 3NJJA 2YGNA 1OTTC 4FP8H 1E40A 4HPYL 4NUMA 2HWZL 3IDUA 4EI5A 3RVTD 3U4KA 1ZLUH 1I7UA 1JXGA 2J25A 5TPWL 4PJXB 4X7FC 4B9JA 1DFXA 4E9QA 1NANH 2NNFA 3UPAA 2VKWA 4ZX4A 3SE6A 1EEUA 2RCSL 4L4TD 2IGFH 3GBNH 1J1XH 1RURL 3BQUB 2IH3A 1BVNP 2ZKHL 3CPLA 2X4UB 3MV8B 5IMMB 1EHKB 4Q6KA 4N0FA 3WN5C 1UURA 2BVTA 3G5ZB 3RPBA 2AJZA 3KS0H 4JO3H 1L9TA 3BIBX 2K6WA 3DYMA 5D6CB 2BP3A 2ZCHH 2A77H 4LSVH 4P57B 3CH1B 2BFGA 2CO7B 5I1KL 4POZD 4Q9BA 5FO7B 4JHAL 1U8LA 1ROCA 3ARUA 5F9JA 2YXVA 3A4AA 5FA4A 2ZG1A 1CL7L 3FHEA 4ZQTA 4IIQB 4IRSC 4QT5B 3QJSB 4UQ2A 5C0CB 2ALWA 2DZEA 4FZ8H 3FTZA 5IB4A 2WN2A 1BOYA 5I1GL 2FAUA 1OCWH 2CKBA 3PAZA 4G3YH 3TJPA 4XCYB 5CSBA 2HKHH 2V3DA 4AG4L 3HVDA 3SGDI 4NWUL 2YMTA 1PG7L 3SYOA 2VLKD 5JOPE 1SJEA 1AQKL 5D6DC 3DVGB 5EUOF 3V4VB 5CMAA 3GD1C 5GGTH 3ZSSA 1WAPA 1RUPL 1XGQA 3QFJB 1S4IA 3O2VH 4ABWA 4F7CA 4MMZC 4NQSA 3WAKA 4UTAH 1ND0B 2NW2B 3GJFB 1HHGA 2XTJD 1GS8A 1N4XH 1CBVH 5LGHL 2MHAB 4RFEA 4XCEB 3WTXA 4PVNA 4NO0D 1JPST 2UZPA 4OIFA 3HS0B 5BW7A 1E9OA 5JHDA 2O5NA 1G7PA 1XEDA 1SLWA 4G7YL 3C75A 4PYGA 1XGYL 4AUYA 4YSEA 4X6FA 2EICA 4P06A 1KCVH 1XCTA 2VW6A 1H15A 4PJFF 3ZE1B 3L4CA 4DKTA 4ZUSB 1IJ9A 1N0XL 2BOBB 4FFTA 3VACA 1G7QA 4Q9QH 3G6JE 3TO2A 5GSRA 2VUYA 2B08A 2GSGB 4JKPL 5B3JF 2E7MA 43CAA 4KFZC 4XNBA 2DS4A 2GC4C 4IBUA 3ILQD 3DJRA 1WBZB 2EEFA 1TTBA 4YWGH 3W9DB 4ZO6A 1WPCA 4GP5B 4BHUI 1R6VA 3U0WL 3MDJA 3QORB 5HBBA 2LV4A 1R5WA 3HZYA 4NO5A 1RZ8B 2EH8H 4P3CH 4BQCA 5EU3B 1TZGL 3OAZK 4PJ9C 4XBPB 3SDDD 4E5XG 2BP8A 1KC5L 4PJIB 1OKEA 1JNLH 1JZGA 3NRFA 4OQTL 3ML9A 4GMSL 2Y36L 4N0RA 2HLAB 3GXNA 5JPNB 4D9QE 5D1ZB 1BZ8A 3EJUA 4KPHH 4GMTL 2UY6B 2DWDA 1JGUH 4GG6A 3BWUF 4HUUB 4N8VA 1N10A 4K8RC 5ERWA 2F1BA 1T0NB 3AC0A 4B9IA 1PD6A 3U1PA 1DQTA 2A6IB 5FM5O 1NSNH 3ZZQA 1OSZA 4QMEA 2WANA 4K2UL 4QKXB 1UUSA 4W9GC 3X14B 4DFIA 5CEZL 2VLRB 2DM4A 1V3LA 3EYUH 3LIUA 4FA7B 3EFFB 4UQ3A 1IGIH 5HYSG 3PG2A 1P7KB 3IJEB 2BIPA 3GZOA 1U8MA 2FE0A 2GYSA 4PV9B 4S0SD 1JI2A 1DBKL 2JCCE 2E9JA 3ME0B 3ZZSA 5IF0B 2DJ4A 4DSYA 4E0RA 1QTYT 2P8MA 1GAFL 3MRGA 4WF7A 2QQQA 3DVNB 1WS7A 3D51A 2DM2A 1BREA 3LRGA 2CLRA 4KQ4H 4PJ8A 2YUWA 4LHUB 4BM7A 4OLYH 2JK5A 2PABA 3N1FC 4XO8A 3IJYB 2O1AA 3HI6H 5ANMA 5EN3A 5EO9B 3MROB 3WFBH 1IC1A 4KY1L 3SBWA 4D0DB 2PR4L 4I0PD 3MOBH 4KDTA 3AACA 4RMTA 4KO5A 3VFMB 2BSBA 2QVKA 5CU9A 5D7KD 4H0LC 3VDAA 3IDJA 5JXED 4ORZC 2RA1A 2CM6A 1AH1A 4UDTB 2H47C 3VWJD 3LZNA 4OLVL 4A7QA 3EH3B 1T0MB 2IJ0C 1FL6A 2O6DA 2X9ZA 3D0LB 1U8NA 3E6FB 4PS4H 5D7LA 3SE3C 4RX4D 1JCVA 2ESVA 4X7TA 1FFPB 2YPLB 1B4JL 5E00A 1S7QB 5B4MD 4OD2A 3WU1A 3PGDA 4PU2A 3EYSL 1OM9A 3LS5H 3OKNA 4F7EA 4HXAH 5JNYB 1AGEA 1ZKAA 3LD8C 1BQHA 2GSIB 3MNDA 3S0PA 4PJ5D 2B4CL 3DI2B 2ENPA 4HUXA 3U30C 1KGCD 1TO5A 1ZV9A 1FWXA 2WO3B 1M71A 2MTAA 4J23A 1KELL 1NFAA 3RVUD 1TKWA 4OLUL 4WU7A 2HT4D 3BKYH 3IGKA 2FT7A 3C6SA 4ZW6A 4BGLA 3LDBB 3LS4L 4R7VA 4L1SA 4MNQA 5GRVL 3THMH 2O30A 1XTLA 3EW3B 1N26A 2CE6A 2BY0A 3MJGX 1HOEA 1I53A 2D0HA 2DYPA 1KPUB 2NMSA 3BFWA 2X4SB 5DZAA 5FGBA 3U82B 2R29L 3C5JA 4IBTA 4UTCA 1LK2B 3HE7C 5DEGA 2ZKMX 4XN8A 4L1HA 4NRXB 1A66A 4JFED 5JDSB 4G70B 5KSBE 3BH9B 1UWFA 3PABB 1HXYA 5E2TL 1MXDA 4JFXB 5LCVH 3IJSA 2J7LA 4R7DB 4N0UA 3TWCL 4K3HA 3N1PC 1JWSB 1ZDQA 3UTTB 2UXVA 3MO1A 5T8IA 3TP4A 1DN2A 3VRJB 2OP4H 1Q0EA 1IILE 4GAAA 3IBEA 3QUHA 1D5ZA 2QLYA 4JX0A 4K7PH 4KZEL 5A40E 1J88A 1BAWA 2IXQA 2OTUA 3TIEA 1Z9LA 1IAIM 3V6ZA 4IS6A 1CLVA 3EOYG 1WF5A 3QDGD 4DFHA 2R1XB 1X7SA 3GSOB 3NFNB 1LO3L 4JDEB 3FHQA 5DSCB 2XY1A 5D5MF 5BRPA 2XJKA 3AG1B 4GS7B 4LQFL 4A6YL 4QHPA 3WS3A 4XAKD 4WTXA 1DVZA 4R96B 3K0WA 4RVBA 4ZMTA 3CVIL 3UFIA 4O4YL 3V5KA 3ARBC 3FT4A 4BZ1A 1SXSA 3BAWA 4G43B 3E80A 3FHAA 5EU4A 3WFDH 2AK4D 5F0LB 1DR9A 4BK8A 4DF9A 4XN2A 1U95A 1CE6A 5F96L 1TQSA 2GHZA 4FEMA 2DQTH 4LP8A 1BAFH 4OGAD 3TA3B 2JE8A 3M8OL 1M9SA 1RJLB 1I1AA 3NDZE 4K94H 4M7JL 3D3VA 4IIZA 4QRPA 1LE5B 1TETL 3V0JA 4JQXC 4H8WC 4LLYB 1EVUA 4Z23A 1M7IA 1ROWA 2AVFA 5CBAA 2E6QA 3KVQA 4NQUA 1S7TA 1EZVY 1CPUA 2KUTA 3ROLB 4XWGL 2AV7B 4EN2A 2WWMC 4B9CA 3VVWA 3NIGB 4XB8A 4DGWC 3L95B 5LHDA 3S2CA 1VIWA 3QJFA 1A1OA 4WNJA 2E8ZA 4WHTA 2LR4A 2CK0H 4RCAA 4H1LA 4B3VA 3G5YA 1ZLVK 3FQRB 3U9UB 3BISA 3DUHA 1J0HA 2FX8H 3A21A 5GRXG 4WHYG 5ESVA 1D5MA 2OMWB 4M62H 1MLCA 3QARA 2CO2A 4NNXB 4OF3A 1A9BA 4AIZA 1S5IH 1BG1A 1JUFB 1YPZE 2Y5QA 1HK6A 3DBXB 3L1EA 3HZKB 3WO4B 4NT6A 1EDQA 2YAHA 1A6ZA 4XNYH 4YPGA 1I8KA 3CXDL 2AANA 2WCSA 3BPLC 1PYWB 2DLEA 2OZNA 1CFQB 2KI6A 3FTGB 3OKKB 4KVNL 5KWYC 1CDCA 2NNCA 1GGUA 3DXAD 3NSDA 1X5ZA 4F2FA 2WNKA 3VGAB 3H2WA 1FO0H 3CCHA 3AQYA 1SJHB 5GRYA 4M4RA 2XA3A 5MENA 3SGJC 1FHGA 4S0HA 3SY6A 1KYOK 2J5LB 1KB5H 3C5ZB 4LOVA 2CMRL 1RZJH 3SSGA 3RFZC 4EN3B 4G7VH 1NCWL 3TO4C 1SLVA 5I17A 1CT8A 3DYPA 5LDUA 3QG7L 1FCCA 3AB0C 5IB1B 3T0DA 1JPFB 2FJSA 3VH8B 4PRHE 1KN2L 2ZXQA 1EGJA 4RAUA 5DCCA 3PRZA 4MCMA 4DETA 4MMXB 2BIMA 2VDRL 3D25A 3DVFA 2V9RA 1P7QA 3HKFA 2EYTB 1WFOA 3OR7A 3ARPA 2BY1A 4M1CC 4GW4A 5DO2D 3O9WB 4YO0B 3O4OC 3PREA 5I1JL 1EANA 2VDOH 4MLIA 2BSSA 2DBLH 4NKOB 4NO2A 4YHPA 5IHLB 4TTGA 4F58H 4PSRA 3V0VB 1ITBB 1S9YA 1TZOA 5JO5B 3VWKD 3WFHA 5CFAA 1F4YL 4PLKC 4F33A 1IC4H 3H9SB 4H25B 4WV1B 3X3FL 2Z93A 5IIEA 3BAIA 4LVHB 4MTMA 25C8H 1M57B 1W9XA 2R69L 1LEKA 3T4YA 2VITB 3R0MA 4TNVF 2AQPA 4L4VD 3VD5A 2OSYA 2XY2A 2YOCA 1DBMH 2QVTA 3D7PA 3HZ3A 4G7SB 1JNJA 4WI2A 2UZYB 2DI7A 1E2ZA 1IL1A 3GI9L 5KJRH 2YRZA 2DIBA 3B4NA 4GAGL 2ZONA 1PZ2A 3N41F 5AB1A 5IFJB 4OTXL 3NABL 1E90A 4MQ7A 3BEVA 4X8JA 3BUDA 2AQTA 4FA6A 4JKKA 5CEZD 5FYLH 5MEQB 2IOMA 4LEBA 5HHNA 4KTDH 4O51B 3IU4H 2NY0C 5TFSH 2WBJC 4W9HC 3L81A 5EN2B 5FYKE 3OG6B 3PV7A 4ENED 3N3EA 2WVSA 1YEJH 1QD0A 4UT6A 1L3WA 2LVEA 2G9KA 1GPOH 4EE2A 3TIDB 4QHMB 1E8YA 2GY7B 3ERXA 4PP1D 1Q1JL 1NMAL 4JFHD 4RGMB 1G9ML 4QKTA 3GSQB 4R4NC 3HFMH 4YDJB 3ECQA 4NQQA 3NDYE 1U8PB 1UXSB 5F9OH 2TSBA 1SMAA 1J8HE 4KUCF 4RSVA 4F20A 3O6LL 2L7UA 3IXTA 2YN3A 3HI5H 4BK5C 2J72A 2ZWZA 3OAZH 3FKUS 5MHSE 5C2BH 3FQ2A 2BWQA 4LARL 4HH9A 2TRHA 4PAZA 3S37H 1XZ0A 4YSOA 5LWYH 3O6KH 3DURA 1O9ZA 4JZOA 4ANUA 2EABA 3ZDZE 2DI8A 2H8PB 1EEYB 3VXNB 4FLQA 3QUYD 4H44C 3VG9C 1K72A 4UNTA 3BUQA 3QIWD 1HZKA 5CEYB 3KW8A 1M6UA 5KS9F 1MRFH 5HYIA 3ZHFA 3CFUA 1E27B 3CN2A 1FIGH 3KXFB 3FQUA 1R3LA 1CTMA 4LL1A 1AD9A 2JFCA 4OGQC 2XZCH 5E1AA 4XE5B 4HS6B 5E2JA 4CN1A 4G6FD 2A74C 4ZFZA 5CD5D 1S78C 2C7FA 1QSFE 2C1OA 1CN4A 3P9LA 3T3MB 3VM7A 1A3QA 4ANWA 3DGGA 1HL4A 1R75A 1T66C 4JM2A 5BUPA 4LLUA 1JZFA 5KVDL 3ARGB 4X7DC 1FGNL 2BZCA 4URTB 1XSOA 5G5DB 3P73A 1BZOA 2Q1EA 4U1IB 3OB0K 3W0WE 4PTUA 1Q38A 4XMKL 2KPNA 4WO4A 1A4JA 2XZAL 1RZFH 4Y4FA 5ISZB 3QEHB 1HNGA 4GO8A 4L8BB 4F9LA 4X9GA 3QUZA 3QIUB 5DHYB 2Q86A 3NFSH 4XP6L 2X4QB 2V7NB 3O2DH 4XXWA 4F2EA 1MJUH 1MJ8H 2DJUA 3N5AA 3WIIL 3ZTEA 4ELMA 4W6WB 5HDBE 4HJ0D 2WQWA 2WWNA 4NN6C 2EDRA 1XWVA 1YEIH 3ZTJG 3QNZA 1HHIA 2HG0A 5JW3L 3HFFA 4IKNA 2YARA 3AVEA 1JYXA 3MJ6A 2Y5TA 4PRIE 3P0YH 5JW5A 1FFTB 3MRMB 1T0OA 3U83A 4P2QD 3L3GA 4X83A 1W6WA 3ARDD 1MFEL 3FFCE 4JJ5B 4LPWA 3WD5L 3JSSA 3D87B 1GC1L 2VDPH 4QLWA 5I8EA 3B2DC 3QPXL 3UTSD 1HILB 2VR8A 1PVHA 2LU5A 1FJ1B 1V7ML 4K9EC 2EVIA 1YCSA 2NZIA 1WSST 2O5ZL 4OZGB 2CLZB 5HDWA 2IAND 1T83A 3NA9H 3RWHB 4U7SA 4H8WL 4U31A 3ZT7A 2WLYA 5DFWH 1SN2A 1HHHA 4HV8B 2AW2A 2CU9A 1G7IB 4IHBA 4EMZA 1F90H 2I9LB 3MV9A 5L88H 5DZ9A 5CJQL 4RIRB 2W5PA 1CXIA 1VAHA 1S5HA 4RFOH 5LXVA 5ESQA 4M9PA 1HXMB 2D2CC 3G5VB 4AGLA 3FSVA 1A7NL 3RL1A 1BAGA 1UACH 2FZ3B 3GLZA 1YY8A 4CKVX 5LGJB 2EDFA 3P0GB 4Y5VA 5DK0A 5C0CE 3BHBA 1A0QL 3IK2A 1FFRA 2E0PA 4N5UA 3CZKA 3RWDA 1Q9LA 2JWYA 4IK7A 2D7NA 4BSJA 2G30A 3UX9B 1UOWA 3F5WA 1Q0YL 5D2NB 4KRPB 3KPLB 4EUPH 1BD2A 1DVFB 1CF8L 3DX7A 2ZWLT 1ETZB 2E6PA 4JO1H 1WC7B 4UINL 5LNGA 4ODSL 5IHBA 3MFFB 1GSMA 4IMLA 4X4MA 1BV8A 1J18A 2NXZD 3T2OA 3W11C 1BEYH 3CFQA 4JRXB 4EKXA 1XL4A 4YHMH 2ADFL 3CLWA 2HG5B 4A2FA 2VDLL 8CGTA 2B16A 1KEMH 2ZCLH 3BVVA 3Q0HA 4HWBH 1G7HB 3H42L 4FQPA 3EO9L 4BCYA 3IDYC 4AQ8C 1F97A 4UZGA 4Z7VB 1ESOA 2Z91A 4XVSH 2HFGL 2A6JB 1Z9SA 2J3SA 3OJVC 1ZE3C 1WG3A 3L9YA 1J9QA 2UY7B 5D9SB 2APBA 4UUJA 5I1EL 5DJ6A 2CD0A 4XXDB 2Z4TA 3BIKB 5JTWA 5KANI 3RJQB 1HL8A 3ZE1E 3ROOA 1NPUA 4KNQA 4FTVD 4JM4H 2R0WL 1EEZA 1G94A 2ORBH 2GT9B 3T5WA 2CLVA 1IEHA 3FT3B 3QVAA 3H3PL 3QR2A 1A6PA 3FB6B 5ABZA 5CFHA 2A1WH 2CJ3A 3LN9A 3MUZ1 2DMGA 4NQDA 4XWOC 4ADIA 5KOVC 1RHFA 4D94A 2BHUA 2BLFA 2JKLA 5E6IB 3I2CH 4ZSOB 4CVXB 3ZUCA 1KULA 3VSUA 1YAZA 4IKLA 3U1QA 1J0ZA 3B2UD 3L5XH 1WUNT 4KMLB 2YD3A 4JVPA 3MNWA 1HEHC 1ET8A 5BZWB 2Y69B 1JGEA 1FZJB 5CBEA 2PCFB 3I6KA 3VSTA 4JFPB 1WBXB 3TH3T 3UTPE 4X6CA 1FAKT 1JYVA 3L1OL 4E5XA 3G9AB 4LRNL 2HFFA 3QXVA 3LKOA 3CZNA 4XPFH 1NFKA 3NESA 3FRPA 5F7LB 5DJXA 5DD1L 2X70B 3CN3A 3HNSL 4D8PB 2E7DA 2WAHA 3U2IA 3LH2H 3D39D 2OMUB 5FUZL 5E8OA 4ZDHA 2EDQA 3L08A 5BO1H 1EO5A 3SJVB 2YXFA 4DP5X 4ZFFB 4KK5D 5AENA 1MZYA 2N59A 1OVZA 3BP7B 3I3DA 3O4LD 3PGFL 4NHUB 3F01A 1TTFA 4FGMA 2ADIB 4XNXH 1IQDB 5H35A 1BF8A 5C0JB 3OX8A 3VGDA 1KIUB 4U6XA 2ZUSA 3BQUC 4NBZB 4J4PA 5JHDE 5DEFA 5BRZD 1JZHA 3A5VA 1SYSA 2X4NA 2W60A 2YMXL 1MEXH 3B43A 5HYSA 5HI4C 2MQ0A 5JIIA 4IBLT 1W8NA 3HG0A 5D4QA 1XD0A 2A38A 4DGYH 3ALXA 3N85L 5I0YA 1GGTA 3U9PH 1QG3A 3UAJC 2HH0L 1TJMA 1VZIA 2FCBA 3L3HB 1MCNA 1JHKH 4DZBB 1QVOA 4TQIA 3SGDH 4FJ6A 4LDEB 4XP5L 5CGBA 2A4EA 3PHAA 1H3TA 1FORH 3AXLB 3OB8A 3UROR 4IIQC 4CU8A 4K3DL 2ZG2A 5I8KH 3B7RL 1C5CL 2OR8A 5EZOL 2H2PC 4OF6A 4QCIA 5DFAA 3V6BR 5EULV 2EEDA 4OGYH 4RRPM 2V5MA 3F6JA 2Z8VC 1LYQA 1HTYA 2XT1B 2D0GA 1QASA 2YPLE 3FMGL 2EIDA 4H2CA 4PRPB 3S4SB 1B4TA 4Q2ZA 1KEGH 2OBGA 4G8GD 3HAEA 4GXVH 4ZW3A 4W4OA 1WITA 1OIOA 5GRWA 4M3KB 3L9BA 3VUAA 3IU3A 4B41A 1EHXA 2YRLA 5IHZA 4GBXA 3BVUA 5CINL 4APQD 1XB8A 2NNAA 1WZ1H 4GG6E 5F0JB 3OLGA 5E1GA 5JW4Q 4R3SB 2QSVA 3GRWA 5GGUB 4MB4A 3GBMH 2GI0A 3HS0C 3ZIYA 2VXQH 5C0AD 1O0VA 1XTMA 2YD6A 1TTGA 3S3BB 3CDGB 2X4TA 4NKQB 1CDUA 2F74A 4RFNB 1HYSD 2ZWKA 2O4EA 3QCTH 4JRWA 5JMRA 2GTWB 1DHKA 2J6EA 2KPWA 2LOEA 2NYYD 4PJ5A 2VMJA 3QUXD 1ZWIA 4AXWB 5JHLA 1KLGA 5I1DB 2GHWB 5IW3A 5JOFA 1R33A 3MJ9H 4A67A 4HS3A 3QHFL 2E7CA 1NAKL 5KVFE 2PO6D 3PU7A 4KUZH 4N24A 3WXWH 5DJ8A 5F72S 2EKSB 1ED3A 1ZVHA 4PG2A 3GSVA 1MNUH 1LNUA 4XP9H 3UTTE 5T1DH 4TVUA 2DWYA 2X88A 1SXCA 3QORC 4UQBA 4R7XA 1YUHA 4X4XB 1GGCH 2ICCA 4QHLB 2GIYA 1Y18B 1N8OE 3N44B 2VL5B 1HINH 3KNBA 3C6EA 4WCYL 3RTQD 4JFEA 1UA6H 1FE8L 2V9TA 2C8NA 5D7LE 3TJHC 3L3JB 4JAMB 4HGWA 4JFZL 4OJYA 5TPWH 4Z7WF 5JPNC 2ZKWA 3O3UN 5D1ZC 3MA9L 4ATTA 4JFYB 2CIKB 4L8CB 2WLMA 4DOHE 4KKBD 2EXWD 2RCSH 3OHXA 3IYLW 4B50A 1ZVYA 1RURH 3AS3A 5H4YA 3D09A 5SWQA 4PBDA 3B9KD 3LMJH 3ULSA 5I82A 1J48A 3NCXA 3EJSA 4DK6A 4FMKA 3U7YH 1XGZA 2W9DL 2CDGB 4OJAA 2BZDA 3MRNA 3SDCD 4FZEL 2WXOA 5I1KH 3E6HA 1I31A 3ELAT 5LNEA 1QBMH 4CC4C 5D4HA 3TYGL 4F7TB 43C9B 1Z9MA 3TOPA 5FUOL 4KTYA 2D7OA 2P7TB 4AQ1B 5C0ND 3BGAA 3MRHA 5EIIG 1MCCA 3SPIA 1BQ5A 1QABA 5I1GH 4S1QH 1N19A 4PP2A 2PN5A 4PGBA 5KUKA 3CVHH 5I16B 1UB5A 3HS9A 1SVZA 2VW7A 4NEHB 3OB0H 3TXAA 3MX0B 3QUML 2B3RA 4N1EA 4NWUH 1CFVL 4ORGB 3V9CA 1CG9A 1AQKH 4HJGA 4FG4A 2I5YL 2RJMA 4HIJB 1RUPH 4LHQB 4LLDA 4OV5A 4L3EA 3MLRL 4C4BA 1GY2A 1K8DA 3UTQB 4AYSA 1UADC 1KXTA 3P0VH 2PWFA 3KPRB 4ALAL 1Z5YD 2PWEA 4UBDC 5C09B 3D0AA 4NI6A 2X2HA 3L3IA 5CHNB 1OTUD 1TZAA 3TV8A 1PSKL 2BSED 1AZCA 4FXKA 1JGLL 3NCYP 5CWSB 2R7EB 5CEXA 4G7YH 2FSEA 1XGYH 2ZUYA 1ZHNB 1BBJA 3MRKB 3ZO0A 2CNZA 5BV7B 1P5UA 3GSWB 4HWEL 1N0XH 3D9AH 1AY1L 1KIRB 1HZHH 3LDBC 1HEZB 3LYRA 2B15A 4ZS6C 5EU6D 3BLPX 5AW2B 3UIZA 5A6LA 3B2XA 4U6YA 4LB8A 2B8OT 5T1KD 2Z7WA 5IW6A 1P7BA 4Q58C 3KS0J 5TF1L 4FFWD 4E9YA 4RAVB 5JDJA 2YPKB 4RWHA 1WZKA 1TZIB 3IDMA 3ZDXB 4A1RA 4YGVA 3D3VE 4QRPE 5E94B 5A16A 1OOWA 1DANT 1MJJB 5B8CA 4BJLA 1K5WA 1TZGH 2OZ4L 1U92B 2VZUA 4C56D 2JKTM 2P5WB 2J5WA 3V6OC 3P02A 3RDTB 3K4DA 1G4RA 1K5NB 4NDMA 4E41A 1JZ7A 2Y36H 4DN3H 4OBSA 2EDXA 1HDMB 4W1TA 1X9QA 2GTZA 5HJ3A 1BZ9A 4HG4J 3LIZH 1BBDH 4M6MH 4N5ED 1VEOA 2XVKA 2OX5A 3FJTA 4JCMA 4F15B 4GUOA 5EO1B 4YHKH 4UT7L 3A4EA 1JYWA 2V2TB 5EU7C 4AGOA 4YX2L 1JZ2A 1BMGA 2HT2C 2C34A 4P9ML 4GS7C 3MJ8A 3BD4A 4KVCL 4JHWH 1NBZA 2PW2B 3AMKA 1T1YB 2I27N 4PUBL 2Q7YA 5GGRB 1GAFH 1JK8A 3NYKA 3TNNA 1E3FA 1JHTB 1ANUA 4JPIB 4NAJA 2AJUH 1U8HA 2YSTA 3S6CA 3ZT6A 5IMLB 5CZXD 4ZX6A 2BW5A 1CC3A 3EH5B 5IB2A 4PRBA 3CWGA 1NGWB 1ZV2A 3HUJB 3TA3C 5I19H 1AKJB 5EIVA 4KTGA 3HG1B 3TNMA 2YGVA 1DJWA 3MC0A 1NMCB 1SM3L 4ZOAA 2BVYA 1QRNB 2NQDA 4TOYL 3Q44A 5DXWA 1V7NL 5IEKB 1XH0A 4BUGA 1KXVA 2XPGB 2BWDA 6PAZA 2AC0A 1HC1A 2ZJSL 3Q2WA 4IKJA 3TBVA 4I4WA 1NFDF 3FCUB 3RB5A 1WTGT 4NNPL 2HJFA 3K2IA 5DEZA 4DUWA 3OAWA 2HPTA 5GZOA 2QSCL 3C8DA 1KCSL 3EYSH 3N42F 2XIBA 1KG0A 2WLHA 3IWUA 3QCUH 4M02A 1P6FA 3LKSA 2Z1PA 5DVLA 4CDGC 2CRMA 5TDNB 2NY1B 1QEXA 4TQHA 4NFDA 4WY7L 3V4VL 4ATWA 2B2XL 4PR5A 3QK0A 3LEVH 3QI9B 4K07A 3CFKB 1AC6A 4GRMB 4OLUH 2LLGA 2DQIH 4ZNCD 2GKIA 3WO4C 1MWAA 5CZVH 3UTOA 1OT4A 4HC1L 5TDPB 4LIQE 1G7JB 1V3JA 1DQJB 1A3RH 2F08A 3VGAC 4JG0L 1MXGA 7FABH 5I30L 3H0TB 4FQXD 5C0IA 2WTPA 4MDIA 3BC9A 5F7WC 5KJ7E 3KXFE 2J5LC 3C5ZC 3CBRA 2GBVA 5FYJE 3MUGA 3O41B 2FEEL 4HEMA 4EN3C 2ZTBA 3SKJL 5I23A 1KLUB 3TWCH 3SKNA 4X2UA 3OGCB 1DJZA 3HMXA 4GLRH 5E9DA 2ZYHA 4N9OB 5IFHL 4IBSA 1LEIB 4I48B 2VDQB 3T3ME 5KN5B 2BDNH 4R0LB 2R9HC 5K9QI 4KHXL 4KOBA 2R0LL 3R06A 1JIBA 4MMXC 4KQ3H 4UOZA 5CXPA 3APDA 3RNQA 3E8UL 5IVZB 2XZQL 4DCQB 4U1KB 2PETA 4KFMA 1G9NL 4OAWA 4F24A 1JI1A 5GS0C 3O9WC 1QW9A 3OSKA 5HD8D 4IBVA 2J1KA 3NQIA 3PHQB 4JFFD 4ZAKB 2C3VB 1F00I 1I9JL 5HI3C 1LO3H 4QD2E 2IC2A 3JTTA 1LE9B 1M05A 5DJYB 1NMBH 4DKAA 4GQPH 1G1KA 3HN5A 3KPSD 4WV1C 4XTRD 4KO6A 4LVHC 3CVIH 3MVSA 2WAQA 5F7NC 2QQLL 4JFUA 5D1XE 4NXSA 4KXAA 3D6GA 3W57A 3AROA 1TEYA 2F53D 4PGEA 1TF4A 4WQOA 3QCVL 1MRDH 2OXGB 3KHQA 3M8OH 4LASH 4V33A 3V9EA 4MD0A 4P23D 3T4AB 2FL5A 5DT1H 1U3HB 4MSWA 1TVBA 4PJEA 5CF3A 4D0BA 4UF7C 1OP9A 4G6MH 3UEQA 4JRFA 4JMNA 3TZVD 1F58L 1YMMA 2XVGA 3JT2A 2BHZA 3CVDA 2V0AA 5HDLA 1ZTMA 3EFDL 5D1QB 1S46A 3B2VH 2E9WA 4W9FC 3TURA 4P4KA 2F5AL 1CYGA 3DX8A 3SCMB 1BVOA 3U0PA 4L1BA 2BERA 4MHHI 3TN0B 4AJVA 4MVBD 3LNIA 3OLDA 5FA3A 3ISYA 1E4KA 4QTIL 1T0PB 2WPGA 5EORL 4HS8H 5C3TA 3UIYA 4LBEA 2V5SA 2BCKB 1MJ7L 4XVTL 1XAUA 4N1CA 4NM8L 3VCLB 4RGMC 4AH2A 1A7PL 1MCJA 2CCWA 3MRLB 4N87A 1N67A 4FFYL 5IV2B 4LLVB 3MA7B 4RGND 3CU7A 3GWJA 3BRDA 1S8DB 4G9FB 3HB3B 3OKMA 5EOQL 2I69A 3D85D 3JWDC 2JQZA 4G6KH 2BH0A 3HE6C 2WQSA 3SKUD 2QTVA 2ZF9A 2VSMB 3UYPB 5I8OL 2FD6L 4M6OL 4ZNEA 1GCFA 4HU8A 1MFAL 1YEGH 5EC2B 5EEUA 4FXGC 4JRXE 1CGWA 3GINA 4L8DA 5DK2B 4NUGL 5ADPL 2RFXB 2FQFA 2Z4QB 3QG7H 4XCNB 2AABL 3V5DA 3WDHA 4OLEA 3AAZB 1NC2B 4JQIL 2IF7A 5EOTB 3TV3H 1OSYA 4OT1L 2VDRH 2AK1H 2MOVA 3MRRB 2KC0A 5G55A 1MH5B 1QPPA 4K5MA 5I1JH 4NQCB 4Y1AA 4R84A 4NNYB 4QF1B 1KPVB 3ARGC 2ZICA 3DPBB 1ETB1 3UC0H 5C0EB 3F83A 1CICD 2ITFA 3L4XA 3K81A 5D2LB 5EB9A 2IDUA 5I5JA 5KBMA 4EBQH 3V4UH 4YBQD 2NY6B 3QUKA 5ICXA 3X3FH 4I3RL 4ZSOE 3OXRA 2ICWB 1VA9A 2YGQA 3R1GL 4K8RH 5CD3A 1RULH 2NR6C 5FR3A 5ITBL 1IAII 2IDQA 4N2EA 2YWYA 3X3GL 2VMFA 3DO4A 5B7MA 5H94B 2RGSA 2MCG1 4TULH 4Y19A 1PD1A 5D1ZI 5EUOA 3IF1B 4DZ8A 3EIFA 3BLBA 1E4WH 5E23A 3K2UL 1ZT4A 5KYYB 5D1XC 4KGJA 1WBYA 1B88A 4QRBA 2WVUA 1B0RB 4F37K 1GOHA 1HIML 3HNVL 2X3CA 4GQQA 3SJVE 2AKRB 1KIQA 4X4ME 3RIAK 4MXWL 2XQYK 1UATA 4N2DA 2EADA 5IROA 2IV9A 1Y6KR 1MW3A 2G9HA 4N6RB 2V9QA 4F8PA 4BKLA 4YXHH 1A1NA 5ETUB 5E6SB 2CHXA 3ECBA 4PJFA 1J05B 4YK4B 3TM6A 1A7OH 3DETC 2ARJB 1MW0A 3RY4A 2EE2A 4LLQA 3P3YA 3CNKA 1TZHB 3I9IA 4MJHA 4UM9B 4Q74A 3RY6C 3T2NL 2BNQA 3ZN6A 2OKMA 1NBCA 1GGBL 3MV7A 4JGJA 1C16B 5L6YL 3VXSD 1L0QA 3EJJX 3FL7A 3PQYB 4NKMA 2CGZA 3ZLQC 4FFZL 3O6LH 2IAMD 4IGBB 2BIQA 1NAML 2FBOJ 3F12A 3L48A 2VDML 4NQDE 5BRZA 5INDA 4AY0A 1PQZB 5DUBA 4JJOA 1JGDA 4XVUC 4TRPL 4MJ5A 3S5LB 3HCVA 3TBSB 1A21A 4HPOH 3WE1A 3V5HB 5D2NC 5J56B 1SQ2N 4KRPC 3BAEL 3MRJA 4WSGA 3R7QA 2D31A 4PQXA 5D7IE 4LSTH 1DVFC 4NZUL 1PNCA 2BMKA 3GSUB 1T1WB 4OY9A 4X6CE 1NLDL 1DEEA 3N1QC 3ZE0F 1KTJA 1I7RA 3AABA 4MJ4A 3G6AA 4F2MA 2MKWA 2MQCA 3B83A 3N9GL 4HKXA 5J57B 3GSNH 2KLRA 4OUOA 1JTPA 4PVMA 3SKMB 1Q0XH 1FL5A 1JXFA 1UWEH 5I76A 2DQGL 3WY3A 4DQOL 4Z7QF 2AJZB 4FXTA 4BFIB 5KVDH 1DQQB 1FGNH 5DFTA 2Y7LA 3QQ4A 1XIWD 4TQ8A 3H3BC 4XZUA 5IB5B 2LFEA 4FNQA 4XMKH 5DQJB 4CN4A 5GGTA 2XZAH 5C8JB 3DSFH 4HGKC 3VXRB 4UTAA 4CJ0A 3KWUA 3TH4T 1DBJL 1EHLH 3KYOB 1CD8A 4JREC 3BN9D 4KI5E 1RERA 4JANA 4P46A 2VLME 1FNEA 1IBHA 1IBGH 3WIIH 5E6IC 3DTDA 4HUVB 5SV3A 1XF3A 1ECYA 1UVQB 4X6DB 2VR5A 1NGQL 2XN9B 4HULB 5IVXB 2VSCA 5MERA 4UCFA 4QOKA 1QSEA 2OA9A 1QUNA 1IFHL 3EBGA 4NYLA 2G60L 5BO0D 1MY5A 5L9DL 1K4DB 4GJTB 1MFEH 4KZDH 3AT9A 3F62A 1HHGB 1KBKA 5I1IL 2WIIA 3H7LA 3QPXH 2XQ0A 1TZ8A 1RV6X 1S7RA 3FT0A 5ICZB 4WI7A 4CSTA 4B9KC 1VCAA 5DMYA 3RLSA 1ZHKA 1GHFL 2BVPA 3TBCA 4F3FA 2VRKA 3ZTNL 1I8IB 3UGEA 4H8WH 1A6WH 3A4FA 4N3UA 2FATL 1OALA 4IDJL 2W0LA 2C9QA 5CJQH 1MLBB 1YN6A 3QJVB 4OGXL 5HVGB 3KGTA 2BJML 3HIZA 4M6AA 3I75A 1A7NH 1GYVA 2N4IA 3HMWL 1RVFL 5GSRB 3B8YA 1IC7L 1MI5D 1P7HL 4ZXBB 5T3ZE 4OM1H 4G8IB 4U2ZA 4Y16A 2GITA 4I2XB 4TLTA 4N2IA 5K59F 3S3JA 3QWRD 5B7EA 1LMKA 1L6PA 2CO6A 3INUL 1T89C 1BGXL 4M56A 1BM3L 3FS9A 3G6JF 4M8VA 1A7QL 1DBBL 2FB4L 5E56A 4PWJA 5KJ4A 2FX7H 2AI0L 1AOZA 3VFUA 3WS6A 4GW5A 1JZ5A 1MCSA 5T3XL 4U49A 3H85A 3JWDL 4UINH 1DLFL 1DUZA 2X0UA 4ODSH 1E4XI 4IRJB 3JVGC 3PWVB 4CSSA 4HAGA 2WYIA 4JE4B 5MP6H 2F54B 2ADFH 4LP4A 5DTFA 2VDLH 4ETYA 4NC0B 2FRGP 4KMTL 3BP6A 4YE4L 4AIEA 3PHSA 1MCWM 2JJTA 2BS71 1VADB 3EO9H 3QISA 4MJID 5E2UH 3OMNB 5D5MA 4HETA 1EMTH 4IU2A 5GISL 5I6NA 2PYFA 2DWTA 4PJ7B 2HFGH 4PWKA 1KCLA 3QEQB 3U36A 3NTCL 2XG5B 1Y1DA 1CZ8L 4UZUA 1S9WA 4G6AD 2VH5L 1MHPH 2D2OA 4JRYD 2CA3A 1JWMA 1N68A 2R0WH 2AEWA 5F7MC 4NJ9L 3ALPA 3P40A 1J5HA 2BCMA 4XO5A 4PLNC 3MRGB 3GHBL 1DP0A 2PXYD 4LAQL 3ZYZA 2DQFA 4MD4A 4RFNC 5BVPL 4LKCA 2EYSA 1OHZA 2WXFA 1KIPA 3CK0L 5F1SA 1AP2B 4OZ4A 3DO7B 1X6LA 2Z0UA 5FC9A 4EEEA 5ANMB 2PP7A 3N43B 5HYJB 4LFHD 2JCCF 3CSPA 2WV3A 1AC0A