2WKOA

Structure of metal loaded pathogenic sod1 mutant g93a.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDAVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biophysical Properties of Metal-Free Pathogenic Sod1 Mutants A4V and G93A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2wkoA00
3L9YA 2Z7ZA 2ZKWA 5CU9A 4A7VA 2Z7YA 1E9QA 1F1GA 3GZPA 2AEOA 1Q0EA 2Q2LA 3GTVA 1SXBA 1SXAA 3T5WA 1PTZA 2WZ0A 5KBMA 3RE0A 3F7LA 2WWOA 2ZKYA 2LU5A 1MFMA 1SOSA 2Z7UA 3QQDB 2E47A 2WYZA 1N19A 3KM1A 1E9PA 1SRDA 1E9OB 2ZOWA 1YAZA 3LTVA 2JCWA 1CBJA 1DO5A 1SXSA 1F1AA 1U3NA 1UXMA 1N18A 4N3TA 4L05A 2AQRA 3GTTA 3S0PA 4OH2A 1B4TA 2GBTA 4A7QA 1SXNA 2E46A 2APSA 2V0AA 2WKOF 3ECVA 1F1DA 1JK9B 1OEZW 1L3NA 2VR6A 2Z7WA 3CQPA 1S4IA 2WZ5A 1SXCA 1HL5A 2WYTA 3H2QA 2XJLA 2WZ6A 3GZQA 3K91A 2K4WA 3PU7A 3L9EA 2ZKXA 1XSOA 4BD4A 4A7GF 1IBDA 1JCVA 1E9PB 3MKGA 2AQPA 1OZTG 3ECWA 1CB4A 4OJAA 1XTLA 4FF9A 3KBFA 4MCNA 4A7UA 3KH3A 1SDYA 1PZSA 1Z9NA 3KH4A 4N3UA 1XTMA 1JK9A 1ESOA 4A7TA 1UXLA 3GQFA 1E9QB 4BCYA 1BZOA 2AF2A 1PU0A 1QUPA 3ECUA 1OALA 3MNDA 2WWNA 2WKOA 1TO5A 2VR8A 4U4IA 3GZOA 1DSWA 3CQQA 1AZVA 1F18A 2VR7A 2AQSA 1HL4A 1FUNA 2C9SA 1IBBA 4B3EA 1EJ8A 2XJKA 3HW7A 2C9VA 2NNXA 1B4LA 1YSOA 3SODB 4BCZA 2AQQA 1IBHA 3HFFA 1IBFA 1Z9PA 2GBUA 5KBLA 1COBA 1SDAB 2C9UA 3KM2A 4A7GA 4MCMA 1KMGA 1P1VA 1E9OA 1SXZA 2JLPA 1OZUA 3CE1A 1RK7A 3KBEA 2GBVA 4A7SA 1TO4A 5KBKA 2AQTA 3QQDA 1OAJA 3F7KA 1SPDA 1YAIA 1BA9A 1EQWA 1IB5A 2SODB 2R27A 3HOGA 3H2PA 2AQNA
chains in the Genus database with same CATH superfamily
3V7AE 2NY1B 1QMUA 1CXFA 5TTRA 3ZO9A 4YSQA 3SJVB 2AZAA 1QABA 4FABH 4FQ1H 5FM5O 2EKSB 2JELL 5KBMA 1DUYA 3QB7C 4HH9B 2BVPA 3KNBB 3CLEL 3CBRA 2BDNL 1V05A 2DWSA 1DJSA 2IH3B 2H4EA 3MNVA 3OF6A 4H0HB 2EDNA 4HISA 3OHXA 1KCSH 3BZ4B 5IROD 1KTCA 3STZA 3N41F 5DJ6A 2R4SH 2HLFC 3LRHA 4V1DA 2BHFA 2DH3A 5IHUH 1FLTX 3SGDI 2EEAA 2A77H 3HG4A 5JHAA 3VRJB 4QRQA 3X1NA 2BMKA 4NAQA 4YE4L 5KJRL 3SPCA 2OL3L 3QNXB 1I75A 3NFPB 5E03A 5F7EH 1GMEA 3WLWC 5H37A 3T0XA 3NBNA 3DUHA 3ZIMA 3HIZA 1KB5A 2QDWA 2E9IA 2VJ0A 5E94A 4RRPA 1GAFL 5KSVB 3FQRA 4ONFH 4O2CB 3NMEA 1CE1H 5FKAA 3U46B 2NR6C 2VZUA 5EIQA 5KS9A 3FAXA 2F6AA 2AV7B 2ZONA 5M94B 3OXSB 4LQFL 4NFDA 4Z7WE 1NFIA 2BZCA 1MHEB 4K94H 4LASH 4OCWH 2V2TA 1A9VA 1QR1B 5EIIG 3RNQA 3GK8L 4EE2A 3FSAA 1X6NA 1BREA 5EBLA 3RB5A 3F7YA 4FA8A 1BXXA 4PJXE 5CP3A 2FL5B 3AWFA 1LDPL 5G55A 5EWIH 1PKQA 2WYHA 3DX8A 3FTWA 3AG1B 2QQNL 1QFWH 3QDGA 5D2NB 1OGAE 5A3IC 3RBGA 2XTJE 2ZWNA 3MXVL 2B3RA 3ARDB 1FORL 2B1HH 3LRMA 1CD9B 1NCDH 3DIFB 1OGSA 5I23A 4APQC 4UTAL 3W0WD 2APTA 3MR9B 3WFEH 4CN6A 2EDQA 5CZXC 5FW6A 3QWQB 4W9GC 1JE6A 1V54B 4IM8A 4MJIE 1E4JA 2VXTL 2OZ4H 3TNMA 3KYOB 3OKDA 4MNQA 2F19H 5IMMB 4PLJD 5IVNA 1NOFA 3PXJA 2Q8AL 1G6RB 1EWHA 2CHXA 3C5ZD 2YAFA 3CHRA 5BQ7B 3W9EB 4IQHA 4AYFA 5EZPA 1GGUA 2YJQA 2ZP0T 3LPPA 4I4WB 2P48B 1W0WB 1VIWA 1JZGA 1E9QA 4CBPA 3NZSA 4OCLC 3RU8H 2VZSA 4NENB 5FIEA 2FVNA 2JLLA 4S0TD 4U6XA 4WTZA 2XN1A 5DCCA 2ZOUA 3OAZH 4Y1SA 4JE4B 2NY0B 5EF2A 5GGSY 5HHVL 3Q44A 1KLFB 1PX4A 4XPGH 4TUOB 5DFVC 3SKNB 1CLYH 3RGBA 5D2LE 1WWWX 1SNRA 1U91A 1ZHNB 2JMRA 4AIZA 4QHNB 1DQLL 3JYBA 4X8XA 1TETL 2X70A 4FFYL 1HWWA 4ODTH 5E6ID 3CZFB 3A23A 4KROD 3TU6A 2Z93B 2NCEA 1X3DA 3EH3B 3MJ9H 4FI8A 5H2BA 1XIWB 3CXHJ 4CC1A 4I0PC 4K23L 1EBAA 2VUKA 2XX1A 1F58L 4U3XA 3WNLA 2DEYX 4P5SA 1CFTA 5DJ8B 1E5YA 2QFPA 1JZ4A 3AFLA 2PKDA 2H7WA 3RWFA 2DKSA 4NN6C 4BZ1A 4Z7VB 1SJHA 5EZIH 3QNYA 4OM0H 3X3FH 5EU3B 3DHMA 5F89A 3U9WA 1KFAL 2P8LA 2X9WA 4J3XA 4MCYA 3GMNB 3RWIA 4RX4D 1MH5A 1AD9A 1OALA 1JXKA 1Q94B 2LAAA 4HWUA 3AY4A 3ZU8A 5A6MA 4MBOA 1KCBA 3KDPB 4Z8FH 1R34A 2D73A 3ULVL 1X4YA 2BRRH 2YLHA 4KVNH 3CCHA 1NBZA 4RDQG 4NZTH 1RZ7H 1ACYH 2PYEE 1XF4B 3KLAB 3MRPA 4LLYB 4YDIL 5EN3A 5JIKA 4CJ1A 2R1XA 4ZFFB 3BH9A 3IDXH 4PJHA 1S8DA 3M88A 1T5XA 2Y7MA 3NQIA 4WWKA 1QHPA 4FG6D 3VQMA 5L88L 5GRUH 4WI9A 4KGLA 4ZW7A 4BCZA 1TNNA 4F91B 1AR1D 1RHHB 1F3DJ 1ZHBA 2DYSB 4UDTB 3OJMB 4ODUA 3VGAB 2IXQB 2CJTA 3IMWA 4FOMA 5FXCH 3LB6C 1MFDH 2MSPA 2C8NA 4KK5C 3VXME 3ZR6A 2LAGB 2NY3C 3EJQA 3CVBA 3RNKA 4XMUA 5IFHH 5BMFL 1IB5A 3MV8D 2YAPA 3NQKA 1DQMH 4FXKC 4LIQE 4JFVA 3L6FB 1DVUA 4NQSB 2CXKA 2XU9A 4Z0BL 1YMHA 1BQLH 1NCGA 1TVHB 1OGAA 3DKHA 3FUJA 2EE0A 3QAZC 1I85C 4JFFD 2WBWB 4HK3J 4JAMA 4PW9A 3U46A 1KJMA 2XC8A 3I3EA 3O4LD 4TVSa 4ZW6A 2K7QA 35C8L 3MLRH 1CCZA 1FCCA 3GIZL 4IIQC 4X8JB 4Z0XA 3QULB 5K59E 3VRIA 3BDBA 3QORA 3CH1A 3BW9A 1WH0A 3FSOA 5IVOA 4F58L 1A7BA 5DD0H 1A1OB 1KPVA 1N64L 2ID5A 3DXAE 5JHLL 5I6PA 2XVBA 4PJGA 1GYAA 1DQTA 3TIEA 1FFPA 3DNKA 1KYFA 1ZPUA 3EKCA 2P5EE 1HL5A 3BZ4A 4NUJB 5EZOH 4JY6A 4PB0H 3TASA 3ZE1F 2RR3A 3E8UH 1S9WA 4NP4L 4AK1A 2P5PA 1BJ1J 3GDBA 5TQ0H 2JI1A 1LO0H 3VXUE 4JO1H 2D8KA 4HU2A 1CLYL 5F1IA 3BAIA 4G7QB 2HTLD 4HKXB 4MCZB 2ZSWA 3D85B 4U0RB 2EYSB 4H20H 3GQFA 3KLHD 1RD6A 1U8NB 4HXAL 1G9NH 3M8OL 3UTQA 3PAZA 5HGHB 4RRPM 3V79C 4LPWA 1DQKA 4WU7B 5E2UH 4LVHB 1Q8MA 4L4TE 4R7LA 3B34A 4EVNB 1K2DA 3ZQ9A 3D9AH 1NC2D 1FP5A 3LZPA 5E4IA 1O9VA 4MJJA 2CCWA 4E9WA 3T09A 2V5YA 4R8WL 5AVXB 2E3VA 5DA0B 3MOAH 3O6FD 2PWHA 4M62H 3H9HA 3W81A 4DP1X 1ZY9A 1KG0B 1AOHA 1A7PL 5GGQH 4M00A 4DP5X 3SBPA 5D4HA 3VQ2C 4CRPA 5IJCC 3ZKXC 2YSSA 3PY9A 3KCWA 2MPAH 4XCEA 5IW1A 2VAAA 1XFPA 2I9TB 4ANXA 2BS9A 5EU5A 2R69A 3KWWA 3ZTCC 5IB5A 4OJDH 3R7QA 5E9DE 1O6TA 4JAMB 4WFED 5EUKA 4OIIH 2Z8RA 4L4VD 4ELDA 2WGNB 5CEYB 1GR7A 2K3TA 3RVUD 2ORBH 4Q58C 4B3VA 1YEFL 2YC1A 2IO5A 4HLZG 4OGYL 1DUZA 4FQJL 1QVOA 5M7QA 1NCWL 9PCYA 1RK0A 1ADQH 1IO4C 1KV3A 4FFWD 5E8NB 3IU4L 2O5ZL 2EXYD 2YA2A 1PLGL 2PYEB 3KM1A 4NHUA 3QFJD 2WB1A 1HDMB 5FGSA 1AKJB 3C5ZA 1D7BA 2PABA 1K3ZA 4KXDA 1BXUA 3Q43A 1U3NA 4NOFA 1A3RL 2J88H 5HHPB 3I50H 3BFWA 4PR5B 1KF9B 4YSDA 4R4BA 4JN2A 3EH2A 5BRZE 5L7XH 4WWKB 2QLYA 3S8WA 1ETB1 3CFBA 5J1SC 3VXSD 3UBXI 4IDLA 5EO9A 1NMAL 1NMAH 2R1XB 4ZFFA 3V0EA 1N0LB 2NR6A 1FIGL 5J13C 1F2QA 1TKWA 4XP4H 4KTGA 1G7HB 3F7VB 3OJDA 1HAUA 2DQMA 4N2EA 2OMUB 5TDNA 5KJRH 3T1FA 1F56A 3HS0C 5LB1A 4HCRH 2V2TB 4AVJA 4HUNB 2CU9A 2AABL 2Z0UA 3B1UA 4NN7C 2H2SD 3A5VA 3HLAB 2ZOOA 2W94A 4PGCB 3L3OB 5C07A 1RJYB 4BIKA 1BD2B 5AAWA 2JIXD 3NA9H 2FECI 2A9BA 4L1TA 2DJ4A 5BVPH 1CFQB 3KS0J 4WFHE 2WXNA 3K0WA 2P52A 5FCUL 3UZEA 5D1QB 3P0YL 1N7MH 1USQA 1X9UA 3UZVB 5DJ8A 5E4EC 4JM2A 1TZHB 4PJBE 4A6YA 4G7RB 4UMGA 4FTDA 3RJQB 3QAQA 3FOLA 2NY7H 5IBTL 3TVMB 1MFNA 4PJ5B 4GQ9L 3CV5A 4EN3C 3U1PA 2OK0L 1UACH 3DXAA 4X5XB 4PJGE 2IOIA 2CLVB 1OAZH 4MNHA 1OLZA 5BUPA 2CGRL 4NRXB 2AGJL 4CVZA 1JWSA 3S37L 1KJVB 5JW4R 2GVYA 1DZ0A 1JPGB 5FM4A 1BHGA 4MQSB 4I48A 2FX8L 3LRSA 2HRGA 3VFWA 2O26U 4LP5A 4Y9GA 5E00A 3Q8BA 1KBVA 2YMXL 4HP5A 1SYSA 3W1ZA 5F93C 2VJXA 3WEOA 5C0RL 5D96B 1ZS8A 3MLWL 3QWOA 5EEZA 1P5VB 4NJ9H 2W9DH 5DA4A 3MA7A 1HHJB 5BW7A 5AVSB 2C4FT 1RJLB 3O3BB 3U4EA 1I7ZB 3T8XA 1IJ9A 2E59A 3AMKA 3GPSA 3OKKB 1C5BH 4XVTH 4M7KH 1I31A 4X0KA 3DYPA 1ZLSL 2I85A 1L9OA 4JPVL 5JLZA 2VQ1B 4AOFA 4N9GB 3WMPA 1Q0EA 2VNCA 3IJSB 4P5KB 4ZMAT 4X9FA 1JDAA 2AXFA 2AMUA 3U79A 3FONB 3IDGA 5BXFA 5LGJB 1LWJA 4MMYA 4C83A 3D0LA 3F65A 4L5FH 4BSVA 3LTVA 3WE6A 5C0JB 3TNMB 4AQAB 1OLLA 5LAXB 1JXJA 2BSED 3VXSB 2VSMB 4HLZH 1ZKAA 4P5MA 1BIHA 4WWKD 1F1AA 4N26A 4H26A 1D9KB 4M7JH 4MD4B 5D1ZC 3B7RL 2X4OB 1OB1A 2CPCA 5CHNB 1RURL 2ESVB 3MLYL 1LJMA 3AWEA 2OMYA 3DMMD 3CSPA 3VFOA 3LN5B 4P46D 3UOAB 2H1LM 3X12B 1JRHH 1IGCH 5DQJB 4DAGL 5DVNA 4HKJB 1FGNL 1HILB 2H47C 4XN8A 3BVWA 1MPAL 3LIZL 3ULUL 2QVTA 2UYLA 4XTRD 1DLHA 3MKGA 4HKZA 5AKRA 4LSSL 3SD2A 3VCLA 3W39B 2JNZA 2BRQA 4M7ZB 4MAYC 1A7RL 3D08A 3RZCD 2LQRA 2VDMH 4B9ZA 5F7FA 1UJ3B 1UJ3C 5F1SA 3ZMEA 5JW4Q 1NFIB 5AZEH 3IMVA 3OXSA 1T4KA 2IWFA 3FC8A 1SHWA 3D0AA 1N4XL 1Y0LA 3LKRB 2BH0A 1IAKB 1RIHL 2XTJC 3OLEA 4A2EA 1IE4A 5F7AA 2WWNA 4Z7QF 4TQEL 3KBPA 4HULB 3DX4A 4GEJA 4K3GA 3UBFA 4Z7UB 2D7PA 5GZND 1WICA 4PUBH 4BA8A 2I27N 3LY6A 1HL4A 1QACA 2XSKA 4WHCA 3HPLA 2PTVA 3LKOB 3K6SB 4XPTL 1CF8H 1VENA 3WEXA 4PJAA 2BNRB 1FZMB 3SCMC 2YOAA 5DJ6B 4U6VL 1DFBH 4AENB 3MJ6A 1XSKA 4HFUL 1BQLL 2CR6A 4M4RB 4RA0C 3IMRA 3RWIB 5ICZB 2WANA 4LCCB 5DRNB 3CE1A 3CU1A 3ECQA 3QI9D 1FFQA 1Y18A 4HHAA 3RX9A 2GITA 1R19A 1TU2B 4GW4B 1CICD 4X5LA 4J3OD 4MMZC 4FA7B 4I1PA 3OKEB 3O41A 4XCNA 3WJMA 3ISYA 3JT0A 4FQIL 5CIPH 3D25A 5KVMC 4P05A 4URKA 1BM7A 1ZWIA 4DKFH 3MJ7B 3GRBA 4OZ4B 1MFUA 1JYXA 4UAHA 4YWGL 1QFUL 1GW0A 1BD2A 5GGRA 4AV0A 4UZGA 3LV3A 1UOKA 5JORA 5DMKB 4ZQKB 4BH7B 3QEQD 2G2NA 2XDHA 1DQML 1BGXH 2FEDC 3HJ0A 4B97A 3MV9A 3FQWB 1NUNB 2FSEA 3QEGL 2F8OA 4RH4A 4BQCA 5KVGE 3AS0A 3VXOB 1WZKA 8PAZA 4OZHA 4ZNEE 2B0SH 3G5XA 1NAMB 2A0LC 3RWJA 2J8HA 3S36H 2M1KA 4LNRB 4BRVA 4DPAX 2DQFA 2C3VA 5FB8B 1GJUA 4FLSA 2ZF8A 1I8LC 4PGBB 3H7LA 3NFSH 1KLFA 1FIEA 1AG0A 1OVZA 4KU1A 5GRXG 5HYFA 4X5PA 2YJLA 4PR5A 1PZAA 1JK9B 3H9SD 1UH3A 3D2UD 2QEJA 4Y7OC 3QQ9C 3P77A 5DUBA 4UM9D 1QNIA 2ZQKA 2Q8BH 2HVKA 4GRLA 5E2UL 1NQBA 5SWZB 2P80D 4JFFB 2EDXA 4F5CA 3VSUA 1A2YA 1JMXA 3NACH 4GP5B 1D5MB 4IHOB 4LDCA 2XKNA 5I82A 4DERA 2PLTA 2H26B 2KZBA 1NGWA 2WW8A 3FTUA 2NQCA 5CD3B 2R39A 3TC9A 1XVSA 4WDIB 4KQ4L 2O72A 1DSYA 4P9MH 1G6RA 5IZ7A 3Q8AA 2HT3C 1U6AL 1VEMA 2QSCH 3QZMA 1SM3H 4WTWA 2JTDA 3ZGHA 5CN2A 4E9TA 4PMFA 5EOQL 5A7BA 4QRTA 1ILSA 2VLJB 5HHOD 1CGXA 3WGVB 3UAJC 1VACA 1ZDSA 2ESVE 4E5XG 3O6ML 3UYPA 2R0ZH 3K4DA 1WT5A 2VAAB 4J3WA 5DDHA 3TA3B 3QQ3B 2FWSA 2WXPA 2MNUA 2YWYA 3AU1A 4Y4FA 3LX9A 4XPFH 5H8DA 3FU8A 3CC5A 5IFJA 1H3PH 3FB7A 4LLMB 3QH3B 1BAGA 3HW7A 2BSEA 1JN6A 2C9VA 3T77A 4JB9L 5HHVH 3O0RH 4YPGA 5C08A 3DSFL 4H7VA 2F7OA 5F88A 1CGTA 1JGDB 5GZOD 3B3BA 1KCVH 3GGWA 4JHAL 3RNQB 5JOPD 1CICB 2ZXDA 3B4NA 3NTCL 1DVXA 3VXPB 1OIOA 4ZQKA 4UQ3B 4ESKA 3SE9L 3I9GH 3ZTDC 4B5ZA 1NCBL 1QYGH 1BZ8A 2WCSA 2G2RB 5CU9A 3BEWB 2QELA 3MJ8B 4PV9B 1LILA 5K1NA 2D03L 3VYOA 5F21B 5FC9A 2ODHA 2JB5L 2MTPA 1EJOH 4BCXA 1JYVA 2DQIL 2A6JA 2RB8A 1OGPA 2ADIB 1ZLVH 1M53A 2ICWJ 4IRZA 3QRLA 1SEBA 3QR1A 2PPFA 4MVBC 2BM3A 2F9BT 3ZTJG 2XZAH 3NVQA 4B9PA 1A7OH 1ZVNA 2R4RH 3TO4D 2HFGL 2Z91B 3ESMA 3B6SA 3G5WA 4OLUH 1A9EB 3RWDB 4GLRH 1OHQA 2VH5L 1OP3K 1WZ1H 5KSAC 1KENH 1OK8A 3OF6D 1U8CA 5EF1A 3R8BB 1WCQA 3JWDL 3GSUB 2YO3A 5DLLA 2GT9A 3BEWA 3PP4L 2VDOB 3U2SA 1QHOA 3QO0A 5GGTL 1AO7A 2VR5A 4LKXB 3FH5A 4XI5C 4NQXA 1JNLL 2K6WA 5B1CA 2DTSA 2AS5M 4M93B 1FYHB 4X4ME 2OJ1A 1YJDL 3EOBA 4GKLA 4POUB 2EYTA 5AWNH 2TAAA 3T4YA 4TN9A 4WTXA 1LTXA 3NESA 2GW5A 2EAEA 2HX9A 3QUKA 1T1ZB 3D4ZA 3QS3A 2FB4L 3NEXA 4LOVA 1IBZA 3CFJA 1CDHA 1IAMA 3DMMA 4P2RB 5T3ZD 3DBSA 2JJWA 1UATA 2X4UB 2BC4B 5IJVB 4APQD 4ES9A 4EN3A 2VDPH 2FHCA 2UWEF 3JTBA 4TLSA 2ED9A 2G5BA 3BN9D 5HI5D 2O5XL 3ET9F 2ENYA 4KVCL 3BKML 2EE2A 1PX8A 4X6EA 3RUGF 5IFJB 4Y4KC 4J5VA 1L9MA 3HAEA 3ZDZB 2Q1EA 5KVFE 1USZA 1XH0A 2K4AA 3NCEB 2AXWA 5DD3H 3PP3H 5CSZB 2VXSL 3NJVA 3DOIA 5E2VH 5TQ2H 3KWTA 3VG9C 4F9LA 4MRBA 3T65A 1AY1H 3TF4A 1TVBB 5HYJB 3ULVF 5C7XL 4UQIM 1Y1UA 4LRNH 2AQQA 3VVWA 4R26L 1QPPA 5LAXA 3VXSA 1XF4A 3KLAA 3MRPB 4UAOC 4J8QA 3WFCL 3V0VB 2EYRA 3PYCA 5IM7B 1NBZB 2R83A 5D71L 3KW8A 4FFTA 1QSEA 4S0SD 2CMRH 3PJSA 1D6EB 1NKGA 3M45A 2I7SA 4WDIA 3RU8L 2F08A 3L4CA 1OL0A 5HJGA 3D87B 2IDQA 2X7LA 3ZT5A 5DFVD 4YNYB 5GQBA 4AZUA 1DJYA 4AL8C 4UQ9A 1T04B 4M3JA 4WI3A 1YMMB 5E70A 2A6IB 4KRPB 1MW3A 2FWLB 4NSKB 2VDNL 3HZYB 4LARL 1NCNA 3R4DA 4PJEB 4H40A 1RU9L 3O8XD 2DWXA 1A66A 4KFMA 2XZCL 5IKCB 1UOLA 1V3JA 1PCXA 4HJJL 3QA3A 5F7HA 1XF2B 4U6HB 1JGVL 4NO0D 4OCYL 3TBWB 4LBEB 1MQ8A 1TENA 1IL1B 3WEMA 5E1QA 1J9QA 4R4ND 4Z7AA 4PCTA 5DHVA 3ZHNA 5J6HA 5D1QD 3IXTA 4LRIC 4W9ZA 4U1IB 4Y9FA 3FB6A 3IJ9A 3DSFH 3GLZA 1L9RA 4L4TB 3JT2A 4PTUA 2Y6TE 3SGKA 5MI0C 5LBVA 3FT9A 5L8KB 2HP4A 1JCVA 3SPIA 3U6RA 5KN5A 4P2OC 4P2OB 2UV3A 4OLXL 1AZCA 1WD8A 1CI3M 3MGAA 1J8HD 3SJVD 4RGND 1F3JB 4F2EA 5E24E 3TV3L 4NJ9L 1E9QB 3MNWA 1OTUC 1FFOB 5AL0A 4D0BB 5IGXH 2VXUH 43C9B 2AF2A 3BDYL 4UBDC 4BHUI 4R4FH 1PVHA 1HSAB 4POZC 3OWEA 3ARVA 4PFEA 1II4E 4HWEH 1YEIH 1I8KB 1KBBA 2QGEA 2WLZA 2DQEL 1AXTH 1VFBA 2PXYA 2Q7AA 4XPAL 3VDCA 4AC2A 5D5MA 3BWSA 3WEXB 3B37A 4PRPB 5DHVH 2EIBA 4HIXH 2QTEA 3MTXA 3LB6D 1L6ZA 2ZUXA 4HHGA 1UZ8A 2DW5A 3ARBD 4LEBA 2IMNA 5HHMD 2HMIC 2W80C 3EJJX 3CFDA 2TRYA 3KEDA 4QTHB 5PCYA 4YXLL 1H0DA 1IKFH 4RISL 4DJMA 3V0AC 1J9RA 3GPEA 1OE3A 3D05A 3X13A 2OSLB 4DZBA 4QRPB 1FZJA 4NOBA 1B3JA 2Z0BA 4N68A 3HBQA 2QQKL 2CRIA 2WP3O 4O51B 4PU2A 1BQHG 2BWDA 3D51A 2FNBA 1UADC 4Z76A 4NKIL 3F7KA 3ZKQD 3MGTA 1DBJL 4UQ2B 3E6HA 4N25A 2APWA 5H94A 5J3HD 3EYOB 4BH8B 1GTFA 2Q76B 2OYKA 1UD3A 2FD6L 5A7EA 1A0QH 1QWNA 4ABQA 3P4NA 2P5EB 4I3RH 3BRDA 2W07B 2IANA 5CCKL 3FMGL 3IDIB 2IC2A 3FQRB 2YBRB 4BFIA 4YJZL 1BEYL 1LHZA 5IT2H 4KXZH 1LP9A 2DM2A 2WLHA 3IF1A 1A6ZA 4HIIB 1J87A 4GBXC 4D8PB 4OF3A 1KTKE 1URZA 2P5WB 5CLTA 3WE6B 5G4MA 4FS0A 4Y8AA 1TDQA 4BWUA 2JB6A 5EA0H 4R90H 2CHDA 2BOCB 2HTLC 3C5JB 1B4JH 4TMPA 5GSRB 4ZFZA 5I24A 1BBJA 2QPEB 2VDOL 4QLRA 3KLHC 2WZ5A 3O6KH 2JJTA 4X9HA 1AP2B 2ICEB 2QJDA 1G87A 5DEFB 3U1SL 1UT2A 5E8PA 1A9BA 3EYQD 5EO1A 5ELIA 5E8OA 1J5HA 3APMA 4MCNA 3IMSA 5J6GB 3GHEH 3FFCD 3NCMA 2BP8B 1KT2B 4OLYH 3FTGB 2VDRH 2NUTA 3UTQB 1ZTXH 3US0A 2UZYB 3OX8A 3CVCA 4FFZL 4KV5F 3MA7B 5I15H 4A67A 4JPWL 1P6FA 4OIAA 3DX6A 4K8RC 3C08H 3P9MA 3ULUE 7CGTA 1S7WA 2GJPA 2CLRB 4YQXH 4M61B 5T1MA 3EGDB 3ECBA 3F2LA 4QI3A 1DJZA 2PTUA 4WUKL 5FM5M 4X0NA 4DETA 2ENSA 1WWBX 3B3IB 3MYZA 2X0UA 4L29B 3OJVC 2QSCL 5CLWA 4M8QB 4RBPK 4XPBH 5JW4N 3APDA 3BP5A 1D6VL 1SJVA 3D30A 4F7KA 1O9WA 5ANHA 3NCJL 3CN2A 4PJ9B 1WUNT 1G6RL 3MCYA 1MDAA 3HUJF 4KRMB 5HGBA 1C8PA 3HNTH 3ZKMD 1T7WA 3EOTL 4J7RA 2FYYA 2J44A 1MCFA 2J1YA 1WG3A 1QFOA 4CSSA 3HKFA 4G9FE 3VXTB 5KS9F 1UGKA 4A6YB 4P5TA 4RGNE 3FCGA 1U93B 2AXHA 2CBPA 4G72B 1TQTA 4PJ7E 2NX5D 4QRRD 5E4OA 4MS6A 1WPCA 1RUQL 3QZPA 2Z1KA 1CFQA 4K7PL 4P59H 3N44B 4WFEE 4Z78B 4Q14A 4Z77B 5IR1B 2EXYC 1ACZA 5TDPA 2NY6B 2AQTA 3AAZA 2UWEB 1W2KT 5AW7B 3NSXA 2IDTA 4JHVA 1XCQB 4HIEA 4Y2DA 2Q3ZA 3HVNA 5JHLA 2Q76A 3QDME 5FAAA 3ZDYB 4NC0B 2BY0A 5ICXB 3BKJH 3T2QA 1HIMH 1BLIA 1A3LL 3C12A 3FHEA 5DJZA 3F7PC 1HZHH 4TSBL 4EPSA 3WLBB 3PWPE 1OQXA 3C8HA 4PRHE 1TJGL 4UT6H 3GNMH 4KKBD 2NY0C 3T8MA 1JXFA 4QXTA 1HI6B 1Y6KR 1BBDH 4K3JL 4TYUA 2I9LB 3LS4L 5LGHH 5F9WC 2ZOWA 3BKCH 3VD5A 5HVHC 5FR3A 1QRNA 4M7KL 3DURB 4CUCA 4EQ3A 1BCIA 4ZOBA 4KITB 3S0PA 2XTJB 4G7YH 2ZICA 3SHSA 3K46A 4RIRA 5DRWA 2PW1A 4J1UA 4G8GE 4YH6A 2XICA 4IIZA 3ARGB 5GRZA 1BFOB 1RUAH 4JMXA 4PJGF 2R1YB 1HXYA 3DRTB 3WEAA 1TZ8A 4PJXB 4KC3B 2H0FA 3EYUH 1J1OL 4PS4H 2YQGA 4APXB 2WN3A 3BGAA 3V0DA 4A7GF 1YEHL 1JTTA 5BVPL 3V6FA 1CB4A 1N59B 4BFEA 4Y5YB 4NNPL 3ZVVA 4P5RA 1U30A 4NWTL 1JZFA 4GAJL 4HCGA 5EFIB 3WUWA 4RQQA 3INOA 1BOYA 3VFMA 4WY7L 4EN3D 4BCYA 5I5IA 3ULUF 4ZS7H 4XMWA 3OG6B 1F90H 5E8DL 3DJSA 3KPPA 1X5AA 3PWPB 4MMXB 5C7XH 1JGLH 1TT6A 1S6NA 1SZNA 3CZKA 4ZPTA 1MIML 3B2UC 2AGJH 3DSNA 1JPSH 5GHWH 3ZDYE 1U3ZA 4E5XB 5MP6L 3AQYA 3CLWA 2FYYB 1T2QH 2BIQA 2FNWA 4J3OF 5EH1A 1UFUA 1FSKC 1FO0B 2UWEE 3HG1A 1UKSA 3OSVA 4M6AA 5BUAA 2AP2A 1CU4H 4G7VL 1KYUA 3VJ6B 2OS7A 3ENEA 3HG3A 4XVSL 4BZ2H 4TPRL 2F54A 1KCRL 3L4UA 3TBYB 1UM4H 1L9PA 4F2ME 1DSFH 4OLZH 3TBWA 1HNGA 3Q9QA 4K3HA 1XL6A 5DJYB 5TE4L 1AGCA 2YPLE 5FWQA 2RAMA 3MV01 1U8QA 4MJ5B 4FABL 1EJFA 3VX1A 3MRMA 3CU7A 3ARFD 1VPOH 5DHYA 2IF7A 3EF7A 2EP6A 1JL8A 4XPTH 2K70A 3SQBB 4JFQA 3CN0A 2ZAGA 2Z92A 1D7CA 1EHXA 3QEUB 4OCYH 3AT0A 4B9KC 2F0CA 3NABL 3SOBL 3ZRSA 1XCWA 2WQ8A 3LVTA 1YY8B 4Y4HA 3SB3A 3SYAA 2YPVA 1A9BB 3DGDA 4MZ2A 4I4WA 4EIUA 1KNOA 4HWNA 3KW7A 5AVUB 1OWRM 1SXBA 4JFYA 2NLJA 4IGBA 4L8BA 3S36X 3C60A 1MCOH 3OMAB 5CEXB 2NY2C 2OMXB 4XNZB 4N8CH 2IBBA 4PAZA 1MW0A 3C2SA 1RPUA 3O0LA 2G3MA 4FI7A 4OAWA 3W11D 5CN3A 3V0VA 1T0MA 1HH6A 3G6DH 2W65B 4WNJA 2VKWA 2GEEA 5DRXA 1DQJA 3I6LD 2J8UA 1AOZA 3VMOA 1JZ7A 3NH7H 1H8SA 2F18A 4FJYA 3DIFA 4GKZA 5DMGD 1H8NA 2ATPB 1IEBB 1CZ8H 2WUBH 5E8EB 4H8HA 2YBRA 3K6FA 4MS8D 1GYUA 5D7IE 4ZSOA 1AYRA 3TA3C 4ODVL 4FNPA 4HZLB 2ZXGA 2ZKXA 3HB3B 1P7BA 4P5TD 1YEDA 2VMJA 3TJEL 3RRQA 4XPFL 3O3EB 4KUCF 2MIZA 1WZAA 4UT9A 1KB9K 5AW3B 3X1BA 2J2ZA 4IIQA 4XMZA 2WUCH 2NW3A 5F7LB 5B1AB 1RIUL 3P69A 1D6VH 1M9WA 3NIFB 1RLBA 3EJSA 3PDOA 4JHAH 4ONHA 3WLWD 4HD5A 1CYGA 5C0BB 3TEXA 5AYUL 5GJSH 5I8KH 3OB0H 4YHML 1K4DA 1FZJB 1QSFB 3B9KB 5DC0A 5MENB 4J8RA 3DHPA 3RQ3A 2HLAB 5EBMB 1FHGA 2DM4A 2MCPL 3RKDC 2WXRA 2VYRE 2JQZA 5T1LB 1F18A 2Q5BA 3K2KA 5DI8B 4YC2B 3BVVA 1TZGL 3G5VB 3G08B 1L0QA 5I8CB 1AFVH 4H1LA 1LO0L 3PXHA 2FT7A 2BY2A 2W88A 3ESPA 2JJSC 3L3JB 4FXGA 5LO7A 5CBEB 1EGJH 1AXSB 3FQYA 3X3GL 4X9BA 1N5AA 1AACA 4I3SH 1IAIM 2G75B 3GSOB 1GIGH 4GAAA 4DUVA 1XAUA 1ZHLA 2FLRT 3MV11 4NXKA 1HE7A 4D0CB 5I1KL 4IRSA 5EU4B 4A7GA 4MGXA 2EUWA 1YQVL 1G6VK 3BZDA 4Z7UF 5DU7A 1WISA 3V4PA 1FFOA 2QHRL 1PD0A 4XOAA 4XZUA 2HJLA 2ICWI 5IVZB 4K3DL 3MNVB 1JSYA 4Z7QB 2J20A 4X98B 1T2QL 5I76B 2MJWA 1I9RH 2B1AH 3EFFA 2EKSA 1G43A 4NRYB 1FC2D 2OL3A 3VNYA 2J5LC 4GP4B 3IJEA 5I2IA 3FRUA 4ORGB 2CG9X 2XIDA 4R5TA 3L3HA 4ENED 2NZ9D 4HJSA 3TO4B 1SLXA 2X9XA 3ZTNL 3NSYA 3IDYC 4PJFB 4ZMNA 1YEEH 4GMTH 1N19A 2FSDA 2QBWA 3OGCA 1BVKA 4AG4H 2FEJA 3PUUA 1WF5A 4LLWA 3HC3L 4G8IA 4CU6A 1F00I 1R5VA 1IL1A 4IRJC 3L9RB 5F0JB 4P9HC 2EDYA 5TF1H 5JYLA 3CK0L 5DVKA 1NPUA 4PIBA 3SKOA 3LD8B 1A6UL 1H15A 1Q0XH 3VAEA 2YMTA 2O5ZH 1XL4A 2BFVH 4N6RB 4K9EH 2UUDK 2WC7A 4HJUA 5FO8A 4N87A 3ZTEA 5A40E 5FOJA 4AQEA 4KGJA 2BOLA 2W9EH 1ROWA 1NAML 3VH8G 3IBEA 5EU6B 1T80A 1ZK5A 2XZAL 3VWKC 3ILQC 2NT1A 2IAMB 3KBFA 2Y72A 2V2XA 4DZ8B 2C7UA 1FC1A 1MXGA 4PJ8A 2IALA 5B38G 1OK0A 3NCJH 1BF2A 5H4ZA 2A9AA 3IE9A 4KHXH 1YNTB 3PJSB 4PP2B 2X6CA 4DEPB 4FKKA 5HYEA 2PO6B 4C59B 4IOFD 1MCEA 2WVVA 3BZFB 3NN8A 2D31A 2HUEA 3HI1B 1R3LB 3LKQB 1RZJH 1XGUB 4TF4A 1ES0A 2YQBA 5GZOC 4R5XA 1I7TA 1KXTA 2V3EA 5D1ZA 1VFOA 2NNFA 4P2QD 1J48A 3PWUB 2J8UF 1VGKB 4N6RA 4Y2DC 3VD7A 4GKNB 1X5MA 5I1EL 5KTEH 4NC2B 2ED8A 1IVTA 4C56B 3IJ7A 3MV7A 1OTTC 1TJHL 2WSDA 1XCTA 5AYQA 4NQEA 1EUUA 4N1EA 4GY4A 4GIAA 2ZCLH 4FQLH 1WFMA 3EJZC 4HX1A 3ELAT 4OFPA 4WU5A 2EDBA 2WUBL 5JIHA 5BZDB 1OSEA 4LSPH 4ELKA 1KTDB 4ATWA 4HPYH 4NZRH 4TL4A 1W72L 3HG0A 4O02H 3UAJA 4LPUA 3KPOB 3H7BB 1H3PL 1SPDA 4TNGA 3IDNA 2NTFA 1YYMH 5CINH 1RMFL 2BSRB 4JDVA 2ADGA 4ANVA 1CMOA 4LBAA 2VLKD 1AR1C 4N0UE 4PRIE 1NDTA 1P69B 4ZUWB 4LESA 5A2AA 4JRYD 1SJXA 3HI6H 3WJMB 5E2JA 5FYJE 3ATDA 1RFDL 3MV9D 1TCMA 3RGHA 5HI3C 4F15C 3ZL1A 2J5WA 1TU2A 2WKGA 4L2LA 2IOMA 1W72A 3UMNA 1VZGA 2Z31A 2DWYA 4YDVA 4AW4A 3DROA 4F8NA 1GGTA 3MLUH 3ZDXF 3ZYOA 3QXDB 1TZOA 2JCWA 2FJGB 1X5FA 3TN0C 2DLHA 3ZE2E 3L95B 4N0FA 2AEIT 1FYTE 1UXMA 4L05A 2YPKB 3FW6A 2EEXA 2XV0A 3LNDA 1MNUL 2J4WH 2OP4H 3LHAA 4J4PA 3OKOA 5HTSA 2FJSA 4NPKA 1MEXH 2VDNH 2JH2A 3JXAA 4PN6A 1OEZW 1QEWB 2BLFA 1PW3A 4H1LB 4QMEA 1OF0A 3G08A 4PP1D 5MHSE 4K8RH 1R46A 5T1LA 1RJZB 3IS0X 5J12B 4JK0D 2AMGA 3OMZA 1IKFL 2XWJB 4AKPA 2WWMD 1Q1PA 1YNKL 2R56L 2B2XL 2NY2B 3O81A 1WAAF 1TJMA 2E5EA 3MREA 5LNEA 1LWRA 3IJYB 2J6WA 2PO6D 4ZYKA 5HDBB 5FYJU 2Q87A 4EJ1C 4G5ZL 4BKLB 2WQSA 4EQ2A 3WXVH 2C9RA 3WJLC 2RQEA 4OCXH 2HVJB 4X7SL 5FGBA 2J12B 2NW3B 1L6XA 4WIQA 4Y1AE 3ZRFC 2BXYA 3O6LH 4ENZA 5GS1B 4MMZA 4UF7C 5ISZB 1Z0MA 3W39A 4JY4B 1R3KA 4LE8A 1KFAH 2VXSH 5F7DB 4IKIA 1OF2B 5F2FA 2DWEB 3U7WH 2DAVA 5EPMB 1ZV5A 3WMQA 2J1KA 5JMRA 2OMYB 4XP5L 5DEGA 5JPNA 2AABH 2QHRH 1PX3A 3ZE2B 3HN3A 2JXMB 1IGYA 3RFZB 1EZLA 3RFRA 3SOTA 3MO1B 1BEXA 4FADA 3GTNA 1MHPL 1ORSB 4JG1H 3DVNB 1EVUA 1YEIL 3DOSA 5LN4A 4AT6A 1N4XH 1ETA1 5GRYA 4CC4A 1SVCP 5C0AE 1BVLB 3FQNB 4CKVX 3QDMD 3II2A 3K80A 1EDYA 4NO2B 4WEMB 3MV8A 2EIZA 1IEAB 5EBWB 3QARA 4ONGH 1F4YL 2VMDA 1JNNL 2AXFB 1F8TH 1HL9A 3UO1L 4X6FB 2DD8L 4NKMB 3TN0A 2XQ0A 5MEQA 3U7YH 3TJPA 4HIHB 5KG9A 3KAAA 3SY0A 1A2YB 1IZJA 4R7XA 3H54A 3ULVH 1ERNA 3LDBC 4ANKA 2VLJE 2YEZA 1KN4L 1VCBC 3PV7A 3RWEB 1MI5A 1NEZG 5D1QC 1NJ9B 2PPEA 3BHBB 4NM8L 5F7YC 5ADOL 4X6DE 3HRZC 3MACL 2IGTA 4E41B 5TH2A 3OZ9L 5CJBA 1DBAL 4XBPA 3NEOA 3RY6C 1OSZB 3MUJA 1SY6H 3QZBA 3MRJA 4HUUA 3DX1A 4DTGL 4LSRH 5MHSD 1ECYA 3KLQA 2UXVA 1JF1B 1QNZH 3PWJA 4XHQA 5T3XH 5JR1H 4ICWA 3QI9A 5JQ6H 3VE0B 4JFHD 2MCMA 3KL3A 3WEBA 4M7LL 1UKQA 3GBLA 3MOBL 4LDOB 3LKNB 1SLWA 3IT8D 5HDLA 1PLCA 3RVXC 4XC3L 4MNHB 4D3CH 1NGYA 4H1LH 3HI6L 1ZSHA 6CGTA 1KJ2L 5GGRB 4JHWL 1JV2B 2X40A 3KDMB 2YK1H 3DHJA 5T8IA 4HIJA 2F74A 2F54D 3EH4B 3EOTH 3TLRA 2FJHA 3D12B 4PRIA 2C3GA 4F8LA 4WJKB 4KNTA 3QUZA 4HW6A 4IRJB 5J9PA 4Q7DA 5JIMA 3EFDH 4WW1B 2R59A 4K7PH 4KAQH 4P59L 2WP3T 3ZKND 4ZZFA 4KUZL 1PD6A 3BUYB 4HS8L 3B1TA 4AMKH 3DOHA 1DVTA 3UPRB 2WTRA 3L3OA 5C07B 4FZ8H 3OMNB 2A73B 5G5DB 1OOWA 3HLAA 1NGQL 5GISL 3KYKL 3VD9A 3JTSA 2H2SC 3OR7A 4PJDE 1EMTL 1M05A 1U36A 5E95B 4MQTB 2ROXA 4XNXL 2PCPA 1PLBA 2GTZA 3GKWL 5I19L 4V2CB 5EZLA 3MLXH 2RFXB 3ARZA 4N8UA 3T0EB 4PRBB 1S7TA 5TQ0L 1PEWA 4GOSA 3H1ZA 3NZ8B 4QT5A 1L7TL 1M7IB 1K5NB 1GGCL 3FUIA 1N0XH 1XB8A 2GK0B 3FFDA 2IDCA 3WG7B 1T1WA 4YQXL 3O9WA 3GMRB 3LZFH 1NL0H 1IUZA 4J3SA 4XWGL 1LO4L 1IBHA 3RWHA 3S3BB 2QHLA 3IDJA 2B77A 2AK4B 2NY1C 4TTDD 5I6XB 4PJFE 4HXAH 4JG9A 1QRNB 5LG6A 1KZYA 4R0LB 3T3PB 4LQ1A 3TBCA 2NZIA 1A6PA 2BJML 5F8QC 4AW7A 3REWA 1EEZB 3D06A 2NUPA 1P9MC 1KIRA 5EOTB 2VLRB 1YZZA 1MFEL 2IDSA 3QAZB 4GW1A 4P57A 3B43A 1D5ZA 1AE6H 2V7NB 4GSXA 2ZOLA 3VGHA 3EO1B 2LW3A 5EN2B 4ZFOA 1QTPA 1RULH 5DLMH 5JOFB 1NIAA 4HGWB 4L8SC 1NGXA 4LCIH 2WZPD 2Z7YA 3EYSH 5BS0D 1J05B 2X9ZA 2DL9A 4PS4L 2W59A 1FDLH 1M6OB 4U2ZA 3E6FB 3ATBA 4OF7A 4A2GA 2ZT9C 2VZ1A 1IKNA 3MBEC 3L2LA 3F7LA 1ZSDA 1I1YA 2ZKYA 3AAZB 1C8QA 5SWZD 5DC9B 5DJXB 4KKRA 2OI9C 3VX0A 1A25A 3DVIA 3MHZA 1E27B 3G6JE 3PGCB 5IHZA 2R0LH 2N1TE 2GUOA 2HKHH 1GTNA 3BC9A 3KEHA 5CSBA 1MFAL 2X4QA 2BDNH 1SJEB 1FE8H 1OHZA 3B7TA 3SCMB 4PG2C 3U1QA 2Z7WA 1G7JB 4DGYH 4YWGH 3AY4C 1DZBA 4Z18A 3AQDA 4L4VB 4Y89A 4Z5RB 1BZ7B 1G9ML 2CBMA 4U1MA 2V2WA 4NI3A 4N90E 5KSAA 5TE7H 1PG7H 3L5WA 3RJDA 3EGDA 4KNSA 4AQ1C 4HF5L 3AWGA 4W9CC 1JV5A 1CVSC 2COVD 4AYEC 5F7UA 5INDA 2R2BB 2YD5A 5AVVB 2JQMA 2OYLA 6PAZA 5EEUA 3T3PE 5LDSA 2YAEA 2NW2A 1U92A 5JPMC 4H8PA 3TVMC 1J1OH 3PAVA 3GMMA 5DJDB 1WT5C 2BOBB 1ZHKA 3MROA 3NIGB 1SEQL 3MRCB 4ZFQA 2VR3A 3HJEA 3QUYD 4MAYD 2YD1A 1MAKA 4EI6B 4AUUA 2PCFB 3CQQA 3HC0A 3KXFA 4NQED 3RWGA 2O5NA 4PJHF 3QZNA 4HV8B 3WFBH 3GZKA 1W72H 1R17A 1E4WL 3FFCA 4CW1B 4F7MB 3C5ZC 4LCUA 3IDYB 4WVRA 3A6OA 5T3XL 1MJ8L 4JQVC 5JW4M 4KPHL 5I6MA 1XEDA 2XTJD 5IBLC 3MLSL 2DYPD 4OKVA 4GI9A 5IJKC 5D1QA 3K2MC 1MJ7H 1TJHH 2WLYA 3FUFA 1KMGA 2BVOA 1LVEA 4JN1H 4CU7A 1M1SA 4NKQB 25C8L 4MQ7B 3N85H 4QGYA 1QO3B 1IILE 3UEQA 5FYKU 1G1YA 4PBDA 3ASWA 1U95A 2G5RA 3N04A 1KB5H 1F3RB 4X9GA 3QC6X 1D2OA 3V6OE 3LKSB 3BQUB 1UA6L 2WO3B 32C2B 3SCMD 1AH1A 4K7PY 1UTDA 5CU5A 4BH8A 1FNSL 2MEJB 1S5IH 2Z64C 3PL6A 3Q48A 3R7RA 5I9QB 4PWJA 4PJBB 1XGRB 1AAJA 1Z5HA 3CVHH 3G5YA 3WAKA 3ZKSD 3G6AB 1CFNB 3FRPB 2H6OA 3O4OC 3OPZL 3QVAA 1UD8A 3QI9C 5I75C 3LEVL 2XQYG 5E6IC 4FNRA 3LJ3A 1OARH 1CICC 4E36A 5DQ9B 3GYRA 3ARBA 3OLDA 3VDBA 5LQBL 2OJEB 4HXBH 4QRRB 4NCC1 5HHPA 4GAFB 3KPQB 5IK3B 2R1WA 3VI4F 1V27A 2ADFL 1KBGH 5INCA 1ZXQA 3LNHA 2F19L 1MZYA 1FGVH 1KULA 4X4YA 3D1MC 1ND0B 2VQTA 3NJIA 2F7QA 3EOAA 4LVOC 1KTJA 3BUIA 1XB3A 4Z9KB 5EEVA 1Z2KA 3N41B 5D5MB 2W0FB 4M8UA 3ALPA 3NJHA 5FOBB 1XTLA 1JXDA 4QHUA 4OQTL 4YLCA 1I8LA 3DARA 2R0LL 4PRNB 3X2QB 1UCBH 1FL3B 5JIIA 4FZEL 3LQMA 4FZEH 2P8LB 4G2AA 3AT8A 2DQDL 3Q06A 1NANH 1G0DA 4N2LA 4NQUA 1TYEB 5IB5B 1A1NA 2CR0A 3LSOB 2Z35A 3FFCB 1I7UA 3KLDA 4U3HA 1AHWC 4KY2A 4PBXA 2C4XA 1HHHA 3PE9A 5T5NG 3EYSL 3Q6FB 4LZKA 1P1ZB 1YPZB 1XCXA 2DLFL 3WJLA 2DBJA 3VFNA 3N43F 4LLVA 4U0QB 5D1XB 1B0WA 5ERWA 5HY9A 3EH1A 5MERA 3ULSB 1QP1A 4ZPVB 1AQHA 1B0IA 4OI8A 1HOCA 5DD6B 4OZHF 5C07D 2NY3D 4JZNB 4HWBA 1UWFA 1DJXA 2EDFA 2XKUA 3T0VA 1XBRA 2NNCA 4I18A 4JS7A 3SYCA 3L3DA 1EXUA 3RWCA 1XGQA 2MHAB 1RZQA 3MJ9L 2BNQB 2AKRB 2ARJB 2AQ2A 2EIJB 3BDYH 4HHWA 4XC1H 4QYAA 3KBHE 4JFEA 1C08B 1FDLL 5FYLH 1CGVA 1HFUA 2I60H 3BIKB 4KI5E 1MLBA 3FO2B 1T03L 3O3UN 3G6JB 3KPSA 1KLUB 1XH3A 1M9SA 4L4VA 4OF8A 2JKJA 3RL2A 3F05A 3BJ91 3CZEA 4XN4A 3RIKA 4OV5B 3BH4A 5HJBA 4TQEH 2A6IA 3W11C 2HG5B 3S34H 4JRLA 4D9RD 3LQZB 3IBOA 4I89A 3UGXA 4U1LA 2C3XA 4QOKD 3FYEB 4ECNA 2J7LA 3PIQB 4ALAL 3CMOH 3ME0B 5C0AB 1NSNL 5DMGC 1KENL 4PJ7B 2Z7UA 5I8EB 2E47A 3Q1EA 1SYVB 4X6DF 3SE8H 1U2YA 1E5ZA 3I50L 3NH7L 2YRPA 1ZE3C 1YLBB 3GJFK 4PYHA 2P3YA 4OTXL 3V0JA 2IIJA 2FGZA 1I3VA 2QVIA 4IBQA 4LF3A 2HRHA 3GBMH 5C0GA 5CILL 4MAYA 1W8EA 2WCGA 2G9KA 1NBVL 3L81A 4QHLA 4JRXA 2WBJD 4IBUA 3QUMA 4FYSA 4UT7H 5SX4H 3TBVB 4K4KA 1T89A 1TTAA 5D4QA 3TT1H 1BXAA 3QJTB 4Y1AB 3P1VA 3IAQA 3H2QA 2Y22A 1IVLA 3KJ6H 2ZUVA 3MOBH 2OJZH 3BPCB 3QDMA 5LCVH 2O6CA 3LZQA 2VXVL 3UTTA 2FEEL 4PJCF 2FL5A 3HBZA 2FCBA 4E9QA 3P30H 1FORH 3NCYS 2E6QA 4XMKL 3MGOB 3WO3B 5AZ2L 2VDRL 3KR3L 3N85L 2Y06L 4GO9A 2V9RA 2VDKH 2XHNA 1H3GA 1JYNA 3VTMA 2BVQB 4XCYA 5T3XD 1MHCA 3BAWA 3IFOB 5F3BA 2YXVA 5B4MD 3EGSB 2EYTB 5F7KC 4PRBA 5C70A 1EIBA 1I4FB 2IGFH 3UZQA 2NNAA 2X0VA 4KRPC 4QRPE 5DXWA 4NQXB 3GB7B 3JWNH 3WFDH 4NKOB 1B88A 1YEJH 1R3IH 1PGRB 4K7PX 1OE2A 2E76C 1FFNA 2H41A 4PJEE 1OAQH 3TESA 3DO7A 1H6UA 2GTWB 4HAGA 1CE6A 1PAZA 3SOBH 4PHXA 3P3YA 2VDLB 2N7AA 3O6MH 4MWFB 3MCKB 3MRBB 3RZCA 1WIPA 4P23B 1XR8B 2IVFC 4C58B 5C0RH 2ZX5A 4Z7OB 1FL5B 4PB0L 5BW7C 4UQAA 3DYMA 2F5BL 1VJSA 2AJYH 3QXWA 6FABH 3U83A 3DI2B 1ZEAH 4PJ8C 1RY7B 3W2DL 1F6FB 4DPCX 5C0CE 1NDGB 1FVCA 1TTCA 1MZZA 4P3CL 4PGZA 5ISZE 2A4EA 2VOTA 3CVHB 4DN4L 5AALA 4Y16B 2DTML 1UD6A 4R83A 3WKMH 1OAXH 3OSKA 1EK3A 3JBG7 3SDCA 2QSVA 4LAJH 4B50A 1LQSR 4EKXA 3O2VH 1N9PA 3SDDC 4C55A 5GGVY 2YAMA 1N5YH 1CQYA 2KLSA 1HAWA 4W9EC 5IUSA 1MCWW 3QQDB 2W8CA 1JF1A 1S7VA 4R2GB 2J56A 4XXCA 4Z7VE 4KKPA 3S88H 3R1GL 5TH2B 5FV2A 3F04A 4L5FE 2EIMB 4HQQL 4IBLT 5ECGA 1AS6A 1NCJA 3PLYA 1H3TA 5HDWA 1ZLWH 4NFCA 4GO6B 1T22A 1IM3A 1AGDA 2ZWLT 4DOHB 4DK5A 1TQSA 4OLVH 3K71B 3ZRCC 5JZ7D 3G5ZB 2VLKB 3T2NH 2X4TB 3T0WA 5KYWB 3GNML 1A3ZA 1FNFA 2VLLA 3EG9A 2FBRA 3KPMB 3EYUL 1DQIA 5K9JL 2VH5H 3WKYA 3UXFA 4NO5B 4F9PA 1GGCH 1A3RH 2J88L 5FKPA 5GGSB 3V6OC 1GHFH 5CAYB 4WNQA 4NWUL 1EAQA 3FSWA 5CJOH 5KOVC 3DOSB 4QCIB 4A2MA 2J21A 3V4VH 2XWTA 3PCYA 1NBYA 3B7SA 2VM9A 3VD4A 4P04A 4E42A 5I1KH 5GPRA 3K6IA 3DRQA 3H9SA 2H26A 5KYWA 1UB5B 1UUNA 5FHAH 3KGRA 4FNUA 1OAUH 4D9LH 2H3NB 3R0NA 3WBDA 5EORL 4YHKH 2KPWA 1RZ7L 4YDIH 5F6HI 1I8AA 3TPUA 5HVWA 5T3ZE 1WDAA 5HP5A 1JBJA 1OO2A 4L3AA 4WHDA 1AGEA 5DWPA 4GXUN 1I9IL 1IAIL 2AEPH 3NIDF 1IC7L 2XWRA 3ABKB 3ILDA 3MRHA 4NZRL 1VGEL 4WSJA 5DS8A 5G2NA 3VYPA 4YHZH 5FYJH 4F8TA 1NCAH 1XGTA 3G5XB 2NXYB 4JJ5A 4KDVA 2VE6B 4CSPA 4MX7A 4JFFE 4QRFA 4BJLA 1YPZE 3CPUA 1CUOA 5LGYA 4BRJA 4NNXB 2P8PA 4J3BA 1OT4A 1CDUA 4RMRA 5J1TC 3SDCB 2Y1ZA 3LNIA 5KBKA 2L7UA 5E0FA 4P0DA 1QI4A 4LEOB 1HKLL 2RHEA 4A1RA 2BO0A 1ICTA 1JGUL 2AV7A 5AKSA 4EUPB 1OT1A 3MSPA 4O5LL 2AQNA 1RZ8A 2YK1L 3BP4B 3QG6B 4OJEH 4LFHD 1UM6L 3CVIL 4V2BA 5D7IF 5AAPA 1KJ2H 1AJ7L 3P9LB 1QPXA 1SXAA 2YUXA 5HPMA 4HYTB 5DMJB 4QO1B 5E9AA 4YXHL 1B4JL 3GSRB 3KE0A 1M2VB 4XBEL 4PP1C 1IQDB 4ODWB 4OZFB 4Y5XA 1AY1L 4IJTA 2Q0ZX 3G6DL 3TFKD 4F1SA 1IC5L 1NUGA 4MAUH 5JNYB 5J3HC 2GTWA 5E1GA 2VKXA 2WWMC 4QHMB 5CO1A 3B56A 3G7TA 4FTVB 1JWMA 4R7NB 2OR9L 5BS0E 3GBDA 3C60C 2R7EA 5DJ0A 2Q8BL 3DX7A 3Q0HA 4ZO6A 3BDXA 4YHPB 4C56E 2QR0B 1NM4A 1CTMA 4YSUA 2AHIA 3IDNB 4HWBH 1DUYB 3FTYA 4FNLH 1JZHA 1UYWL 4LEOA 4R7DB 5CZKA 3H7BA 2CBTA 2PP7A 2J55A 3ZE0B 4ZS6C 1G9EA 3QNFA 1DEEB 2KPNA 3SKMB 3STBA 4KQ4H 4P9ML 1QTSA 4DGVH 1UUSA 2UY7B 1OCWL 5C0EB 4M6MH 3VDAA 5T33L 2XFGB 1A47A 1HHKB 2DOCA 4RESB 4ZBJA 3VWKA 3U82B 4OGQC 4JFDD 5KWYC 1NCCH 1T5WA 2BCMA 3TT3H 5BV7B 3LD8C 1MRFL 3GI9H 1F41A 2Z1PA 4YDJB 4G9DB 5EEXA 2X1OA 4ETQB 1HKFA 3K2UL 4LCIL 4XVUD 5E1AB 5D2LB 3N0AA 1T20A 4ILDA 4QXUH 1BWWA 2OMZA 4HKJA 4UM9B 5C0DB 4OUOA 3IRZA 4JQIL 3VFOB 4FFVC 3TWYA 4JPIB 1XMWA 1W9XA 1MF2H 5E4AA 1OB1B 4OR1A 3KWUA 4J3OC 3F5WB 5I1HL 3IYLW 4MDJB 4CMHC 1RIHH 3ZR5A 1JNJA 2ATKA 4R9HA 3KPNB 4NQQA 3QFDA 2KKQA 4ZQTA 5GGSA 4YXLH 3RVTC 1GKOA 1S9YA 1RUMH 4QUOA 1MFAH 4X42A 5KSBA 2WQRA 3ES6B 4HLEA 2E9JA 1H8OA 3DV6A 2A83A 3MRNB 2V8MA 4PI0A 5F3HA 4L18A 4NZTL 1RZPA 3H9SE 3PABB 5CCHE 2WZAA 3PP4H 4H44C 4RSYA 4QTIH 5TDOA 4G7SB 3OLIA 2AAAA 2EVGA 3RP1A 1DR9A 4K8RL 2Z9TA 3GXMA 4XPAH 4X0KB 2Z31D 4Q6YA 1QFPA 2HB0A 1MCHA 2IPTL 4ODTL 3C75A 2VM4A 3EW3B 2A1WL 3D2TA 3LH9A 1FNLA 3P2DA 5D2LF 5K33A 3D07A 1Q90A 2VDRB 2OSYA 2ZKHH 2HSIA 1F6AB 4L23A 2GFBB 3U4BH 3FCSB 4BZ2A 4G1MB 4UNUA 5D93C 3H6JA 2NYZA 4ZPVA 3QUYB 3DX3A 1LM8V 1PPIA 3UTZB 3TZVD 1A4AA 4RBPH 2ARWA 4K3EH 3L3HB 2N1KA 1M6UA 2VSCA 4M5SA 2EC9T 1F2XK 2EVFA 3TIDA 1T3FB 2HH0H 5A16B 4BFKA 5LKNA 3V5HA 3TWCH 4PRHB 1BW8A 2CRYA 4AI7A 5E1IA 4EDWL 5AB1A 4ANWA 3FU6A 3A4DA 2CO7A 3QJZA 4U33A 2APVA 1TETH 3FU0A 3CX5J 1Y7VA 4KPHH 4OV6F 5ESQB 5JW3L 4EDXA 1NIBA 4JDZB 4I88A 4O2FB 4BSWA 5LAPA 2ZE0A 3UAJD 4Z23A 3S5ZA 3L4TA 4NXSA 3IS1X 5EDXA 1A4JA 2QTVA 2IV8A 2ZYSA 4AE1A 4UQDA 2ZWKA 1EFQA 2EUZA 4XMLL 2DQUL 1LE5B 1EDQA 3RZCB 2HJKB 2ZOTA 4LL9A 5I8CA 3QIBB 3WTSA 3C5SA 1UM4L 4IU2B 1N2RB 2NZ1A 1KCRH 1J9SA 1HCYA 5D7JD 4V1DE 5FYKE 4GI6A 4AMXA 1EEYA 4F93B 4KJWD 1C5BL 4XVTL 5GGUA 1BPLB 3MN8A 2QADC 4RWHA 4E0RB 3RUGA 1KWKA 5E56A 3MCLL 1U3YA 1MCJA 2ZCHH 2ESVD 1OB0A 1YNLL 4P4KB 5D7IB 3AU0A 3RPIA 4DP9X 3T6ZA 4ODSL 5HGDA 2XZCH 3KYAA 3TJHC 3B2UD 3ESVF 3UTSB 4U2YA 2WBJA 3HFFA 1OGTB 1G9NL 2ZUQC 3HE7D 4JPWH 3ZXAC 4HLJA 3IVKA 1LMIA 2FO4A 1JOIA 5DGRA 1GZQA 4Z7WA 4W6YB 4UTAH 3HS8A 3FZUD 3RY6A 1IAOA 3TS8A 1IM9A 2MMXA 1GY2A 1WEJH 4HUMB 4OJFH 2CLZA 1U8KA 1EQWA 2AK1L 2VDLL 4G59C 2YWZA 4I18C 3SQRA 1EZVX 3V0GA 3KPRB 5FECB 5HYSB 5E51A 4HS3B 3AB0B 1MJUL 3D39E 1TZIA 4ZDHB 2ADJB 3L1FA 4G42A 4Q9BA 2VL5B 1E9PA 1N5YL 2VR4A 1UWEH 1O7SA 2EQDA 3MFFA 4LLQB 5F97E 4AYGA 1ZDQA 4GXVL 4GP8B 5KYYA 4BWTA 3GSXB 3SQOH 4R97C 1BJMA 3NZHH 2HFFB 2P45B 3NT0A 1CF1A 1REIA 3C60B 3IFPA 4GI8A 5LGHL 1S5HA 1U8MB 1CGYA 3MV8E 1ZA6B 1K72A 5AEAA 2A6KA 5DK2A 3F84A 5FFOA 1CGUA 4XBMA 3WJJC 2CK0L 4PJ5D 1HZHL 4AZ8B 2NW2B 4AWJC 1MRFH 4YHMH 1RPQA 3HR6A 3TVMD 1Z7JA 2LVCA 2R9HD 1A7OL 2YXWA 1AYOA 3L17A 4JQIA 4ZI8A 2QMJA 3P73B 4OLUL 5AUMB 2NX5B 3DBXB 3QUYC 2BNQA 4KK6C 3BH8B 2PETA 1JI1A 3Q8CA 3P4MB 2E4TA 3OLGA 2R8SL 1EXUB 3CDGA 5BRZB 5IWLA 1EANA 3ULVD 2BIIA 3CFCH 1WBZB 4CU8A 1HSBB 2ZSWB 3LS4H 4J3OH 4L0ZA 1Z9LA 3MLTA 1IQWH 1T1XA 4S2SA 5A6LA 2FX9L 1P7QB 2G3ZA 3M1BB 5J1AB 4I3SL 3V4LA 4FA6A 3CFEB 1SJEA 2TRHA 2XZZA 5J6SA 3EBAA 1T83A 1Q38A 3IK2A 3RYMA 3LN4B 4NZUH 4WO4C 2VDPB 5E2WL 3CG8A 4QYOA 1I7UB 4F24A 1AGFB 1E65A 2QPFA 5AW2B 4M6NL 2IEPA 4NUQA 4F7PA 5ACZA 4TQIA 1KYDA 1M71B 2K6ZA 3ETTA 4WHYG 1C1EL 1LK3L 1ZE3H 4XHJD 4YBQC 4RCAA 2Z4TA 1HYSC 3K1DA 4EDWH 3FQ2A 2Y7QB 5JPMA 4FQXB 3MTRA 3VXRB 1ONQB 1M3JA 2LU4A 1K8IB 1S5IL 1JFHA 3QJUB 4RSVA 5ID0B 2ZYRA 2BSTB 1F11A 4FAAB 4V11A 4XX1G 1YMHB 4KO6A 3U7YL 2AJUH 1UVQB 3J2PA 5CZRA 2YEQA 2ITCA 1W80A 1RK1A 1AMYA 2VIRA 1EAPB 1MJ7L 2YFNA 4PD4J 2R1WB 3WDIA 2ALWA 2XLLA 2Z8SA 2OX5B 1S2EA 1UOVA 2YMXH 3DURA 5I15L 2OJEA 4QRRA 1QLFB 4Y2OA 5EC2A 2UUDH 2Q7NA 1D5BB 1W91A 5L2JA 4X4XB 3QJFA 4JFPB 3FHAA 1KGXA 2NZ9C 3MI6A 5GGUB 4ENEC 1OOAA 4DP7X 4HJTA 1EEYB 4G82A 2ZOKA 4QRAA 2DQ6A 4Z95L 1KIQA 5HD8C 3ECVA 1CGWA 3ARFA 3HAEH 4H13C 1DQQA 3SD5A 1D5IH 5FYKL 5IIEA 2PPAA 3PQYB 3DVGB 2WYTA 4FG2A 2XJLA 3Q5TA 2EE6A 3C2AL 2B39A 5B38B 5I6OA 5A2CA 1T21A 3NABH 4WI0B 1X5YA 3QDHA 3HI5L 4JO8A 1ETJA 2B4CC 3A6BH 3EJPA 4ZJ9A 1E6JL 3F58H 4PLKD 4JRYE 1NMBH 3B2VH 43CAA 1CG9B 2Q2EB 4MCYB 4BSWB 4YAQA 4YHYB 1UD2A 4M1DL 1MFDL 1PS3A 1Z3RA 4NP4H 1ZT7A 2XQYK 2YXMA 1N67A 2YGPA 3T6WA 4ZFGH 5ILTH 3PWVA 4HCRL 2DQJH 5AAWC 2PTTB 4E41E 4DUWA 5IHWA 1AGFA 5J11B 4IBWA 3MAWA 4MBRA 4K55A 4AH2A 4BINA 4LU5L 5F9AC 5HHOA 4GG8A 3VWKD 4NN6B 3L5IA 1PJ9A 2B1HL 3TT3L 5FO9A 4X4ZA 5KYUB 2AZUA 1OV8A 4H88H 1P2CA 1KJ3L 4GUQA 1BMGA 4MDRA 1KXVA 4AEIH 1C5DB 4IHBA 4Z7WF 3BEVA 3UDWA 1G7LB 1FJ1B 3KMDA 3BZEA 4OFKA 1NGPL 3V6ZB 3UP1A 3CPLA 1FV1A 4WFHD 4EO5A 4AIZB 1Z9MA 3GHBL 3I74A 1EGJL 5AUMA 3X3GH 3MUY1 3TNNA 4RLDA 3VGDA 1RFDH 3MRQA 2OBGA 4Y2DD 1S9VB 4IMLB 2QQQA 2UZXA 3X11B 1VFAB 4LVOB 1WBXB 3D8MA 1UZGA 1QQDB 5DUJA 1L0XA 1CTOA 4QXGL 4HJ0D 4NZJA 4PUBL 4GBXD 3BSGA 5I19H 4K9JA 3SE3C 2UY6A 4G8AC 3DX2A 3T2LA 4ZXBD 4HFWB 3AB0C 4TLTA 4JM4H 2CA4A 4ZW3A 4L3FA 3GXDA 2XXFA 2VLRD 4Q6IA 3MLYH 2M83A 4HUXB 4P2AA 4HALA 1A6ZB 1MHHA 2YGOA 4HIIA 4EI5B 1UM5L 5FPIA 2WXFA 4QNPE 1G7QA 4IDJH 1LO3H 4J28A 2G0KA 4P2QB 5C0NC 1KEML 1N8ZA 1IGYB 2R0WL 2KBGA 1DVFB 4QY8B 1QRND 1UFGA 3SPVB 2Z4QA 4DKDC 3R0MA 3LPFA 3QQNA 3WSQH 1SJMA 3EYQC 4MA7H 3D69A 3VH8A 2AQ3A 4HS3A 1GGYA 1MJJB 4KOBA 2WMPB 1M6OA 5J56B 1EBPA 3IDMA 1YMMD 5IROA 2OMWB 3UBXB 1NUFA 4W9DC 2AJVL 4XMPH 4JY4A 4XNAA 1S7QB 1JFQH 2V7NA 4P57B 4RGOL 3NGBC 3IJHB 5HHXH 1CTNA 3BGFC 4K8RD 3VXMD 5AVWB 2VC2L 3UCRA 2BW5A 3DX8B 3AW5A 3C6SA 4O51A 4JQVA 2DYPA 4OGZA 3WNKA 5AD0B 5JOEA 5D70L 4G70B 3L1OL 3GBNL 4X6CE 4LAQL 1TPXC 2XIBA 4EZMA 1UQSA 2RBLA 3V4PH 1BYOA 4TNVF 3QWRD 1E5UI 2D0HA 3RDJA 3OM3B 1R3IL 1K6QH 1C7TA 1JK8B 4AJYV 5AB9A 5BJTA 1VZIA 3SGKC 5I73C 4GUPA 1GZPB 3KJ6L 4LRNL 2BERA 5ICUA 3OD3A 3U6XA 3TCLA 4MJHA 2PCPB 4LDEB 4YFDB 1GZHC 4KKQA 4Y4HC 3LZOA 5L4IA 3HR5A 4F58H 4K5NA 4G80B 3KLKA 4PPTA 5A2FA 5LDUA 3FCTB 1NIEA 2EDLA 4PJBF 3DGGB 4N28A 5LBSH 4XO8A 4GRLD 1HYRC 2JCCA 2NY5L 1LD9A 1TXKA 5E23A 2YKLL 2WK2A 4WEEA 2V4LA 1BVNP 2DQTL 1B4LA 3GSRA 5FS5A 3U1SH 5I1LA 5IB3A 4YLBA 2QPDB 4UANA 4X5WA 2XXGA 1A6TB 3NUKA 2K0RA 1LE9A 2UZXB 3X11A 1CXEA 5EIIA 1HQRA 4JL1A 2Y3NA 3L3GB 4KTEH 5D55A 3ZHFA 1WBYA 1IGMH 4QRSB 4RNRB 2NY0D 2Q7YB 3VUAA 1MWAL 2JE8A 1FL6A 5CLYA 3VXQA 1B0RB 3LCYA 5EF0A 4V1DD 3LN9A 4HJ1A 4LSRL 5EUOE 4DTGH 1GC1H 3ARXA 4P2RE 2P8PB 4U1IA 4LVNC 2VMFA 2JJUA 3WNOA 4IS6A 5C09B 4G6JH 4AKQA 1QASA 4NZFA 3IGAB 5EWIL 4MA1B 4YHNA 5F8RC 4DGIH 5JZ7C 2VWEE 2KI6A 5DC2A 3HG1E 1Z9OA 1F6AA 2HKFH 2NXZC 2G60L 5C3IA 4OLVL 5C86A 4JHUA 1HXMB 3NIGF 3OXRB 4YO0B 3V8OA 1TCRB 4F1ZA 3H9ZA 3WKML 4HBCL 4JJHA 3IAGC 5T1DL 4MSWA 3D6GA 2DB8A 1R24B 1MFEH 5K9OA 5D7JA 2GJZB 2WIIA 2BCKA 2YPLA 2W38A 1U8JB 1YEKL 5BRQA 3ARDD 4Z7NF 4OZGB 4XCFH 4KNQA 4OB5H 4JM4L 3WFDL 3EBIA 3NIDE 2HJFB 4CADB 3B5TA 1VRSA 4B9GA 5F1NA 3ZDZE 3SDAA 3V52H 1CQKA 4FZ8L 4ZUUB 3AREB 5I75B 1L3WA 1YNTA 1JPFB 3K5RA 2I5YL 3SDXB 4Q2ZA 5D9SA 3BVUA 3F8UB 4MNGA 4TTGA 5EDSA 3WO4B 1L9NA 1SN0A 2E6JA 3HB3D 2IAMA 2ATKB 3OB8A 1IFHL 3MC0A 2J6EH 3ILPB 4PGJA 1CD1B 4YDLB 1M56B 4F9LC 2LGNA 4GG6A 4B7IA 2JXMA 3NFNB 3L5XH 4KMTL 3UTSE 1PU0A 2BW4A 3FTZA 5SWQA 5IEHB 4MJIB 4OZGA 1DJIA 4JB9H 2AEQL 2YD0A 4OJCA 1I8IB 5C9JB 5BQDA 4RX4A 2GEQA 4F33A 1M4KA 2G5BB 5F0PB 5HJ3B 3TOPA 3VD0A 1JUFA 4UTBH 1A5FH 2XUWA 4AVIA 3OV6A 4APQA 2OW6A 3ARFC 3FUMA 5IW6B 5E7FA 1PZCA 3U4BL 1SVZA 4L5FL 4WFGD 3GJFH 4BKLA 2HVBA 2NT0A 2VN6A 1IGFL 3OHMB 3JVGA 4FHKA 2FZ3B 4HEPA 2NXYC 3BIAX 1RIVL 5L8LB 2EDJA 2R0KL 1VKXA 1SXZA 1JHKL 1OZUA 2XN9A 2HH0L 1OM3L 2J6EA 5IESH 2IBZY 2VMEA 2R29L 2B08A 3PREA 4A7SA 3D3VD 4XP1L 4M1GH 4WO4A 1DDHB 2AITA 1YAIA 2BVYA 3D2UB 4LSTL 3IXAA 4BXVA 5C0FB 3LIZH 3TFKC 4XZUB 5GS0D 4WV1A 5JDSA 1AGBA 4KWUA 2VN3A 2NY1D 4KO9A 4TNEA 4TTDC 1XT5A 2AEOA 2KZWA 3LEYL 3ROLB 5I17B 1OW0C 3N5AA 1JWMB 4R7NA 1R5WA 4DP2X 4A04A 4QHKJ 2CHNA 1AD0A 4ZMOA 2X38A 4UDUA 3VXNB 3MLSH 3QXDA 4XMPL 4MS8C 3A22A 4F8OA 3U2JA 1UG9A 3BVTA 4OT1L 5CD5C 3WN5C 4PHZA 4I13B 2M8XA 4U1KB 2CDEA 1NGZA 2BVTA 2A6JB 3GBML 3WY2A 5IHHA 5DVLA 3RTQB 3VG0L 1XF3B 5E1HB 3RA7H 2GBTA 5IB1A 4A7QA 5I18H 4FTVD 3QDAA 2FLMA 1SQMA 5C0CA 3DTXA 2G2RA 4C56D 3PNWA 5K9QG 3P4LA 2IPTH 2WHVA 4FFZA 2ZG2A 1RSFA 1RVFL 3DDGA 3QHZH 4WO4B 3O6KL 1HT6A 1OSYA 4KRLB 5AB2A 5F3BB 2VABA 1WHOA 4M6NH 2XX0A 1INDH 2W0LA 3K5SA 4J3VA 4P3DB 5DS1A 1SLVA 4ELKB 5CKAA 1JCKA 3HNTL 4ONOA 1MCIA 4NPJA 4WENB 2ROYA 4YBHA 2GI0A 3GUFA 3IFNL 3GHEL 1HTYA 3FUHA 3TBSB 2VUYA 1QBBA 5F1OB 3NJFA 3NACL 3GJEA 5FA3A 1IC4L 1ILUA 1B3IA 3HZVA 2DEWX 2JSFA 2EO7A 5I28A 4XP4L 3FO1A 4OZHE 1CT8B 3MQIA 5K1JA 5FGBC 4FLHA 4F7TB 2X4PB 4YHLL 2Z6FA 3RHWK 1DYZA 3GZOA 1IAII 1TQUA 4GRWE 2ETWA 1ZTMA 2D31B 2EXWC 3HI1A 3S6CA 2YOCA 1JDCA 1NC2A 1PFCA 1HWHB 4JKKA 1GW6A 5HYSA 2BHUA 3EO0A 2PO6A 1X7SA 1HC1A 2IH1B 4XAWH 1IC0A 3NJLA 2XG5B 1HQ4B 3P0YH 2J73A 5KSUA 4EOWL 3VFGL 1ZV9A 2C7UB 4PJ8B 3QJVB 4OB5L 4L9LB 4WEUD 1XBDA 3FQTA 5H35B 3MX0B 5BZZA 2XBTA 3QPQC 4U1LB 1I1CA 4BK8A 1RZFH 5FA3B 3JWOL 3IPBA 1JPFA 1PJWA 1BD2E 1Z5YD 2WCPA 4N0RA 2HG5A 2WIMA 1TYRA 1EMTH 3UTSA 2I5YH 3WS6C 2A3TA 4N0CD 4UV7L 1F1GA 2CK0H 2EILB 2CDGB 2DV6A 2BHYA 1WFJA 3T5WA 3WNMA 1D9KD 4I3GA 3I75A 4Z3IA 5DK3A 3RWJB 2F8XC 1K3IA 1FV1B 3RGVA 3V6ZA 4DK6A 2GSGB 1DQDH 2XG5A 3L2NA 2ZX8A 4ERSH 3ALWA 3FU7B 3BEVB 5BRPA 3N55A 3QUHA 1BMWA 1DEDA 2ZXAA 4BH7A 3UABA 4OZIE 2X3CA 4M9OA 4P9HL 4DP0X 4YHNB 3NJKA 3NZUA 4ZAKA 4QHKI 5FUCC 2O1AA 5DUPL 3N40P 4FERA 1QLEL 4HT1L 5HDBF 5T1KA 3DSNB 5KVFH 2XN9E 3QPXH 3GLEA 2BNRE 1MDTA 2OL3B 4MD5B 4XE5B 3TURA 4QIRA 1IEHA 2DQCL 2X2YA 1QLRB 1XGPA 3BFOA 4J12A 4R0LC 4X98A 5K1VA 3I6SA 3DTUB 3CSYB 2JKIS 5MEPA 4GAGH 1KCWA 5C0FA 5DO8A 4XH2B 2ICCA 4FF9A 4JO2L 5EC1B 43CAB 4W1TA 3FUNA 4AENA 4KJWC 1O5DT 4FULA 5FOBA 2WQAA 1T6BX 2ZJSH 1HESA 3JWDC 4HC1A 1IGJB 4WUUA 1N6QL 3ZL2A 2W0FA 4FKHA 5EUOB 2F7PA 2W9EL 4PLNC 2H32A 4WGWB 1BVNT 1UA7A 1YEWA 4LP4A 4ZUSB 5I30H 2EDKA 3CFUA 2PW2A 1P4LB 1FYTA 3SYQA 5DUML 1UENA 3F83A 4J1UB 1DSWA 3IPFA 4AX3A 3C8KB 3CN3A 5IB1B 4H4NA 1U58A 3CK0H 2CUMA 4J8RB 4F7EA 3ULAB 2ARJQ 3BP6A 4NWUH 4KX8A 4G1EB 4O9HL 3V4VB 1QSFA 5E99L 2NNRA 1DN2A 1SHSA 3FZUC 1KDIA 5IVXB 3B7UX 4OIFA 4XP1H 4MA3A 4AV5A 3MA9L 2Z34A 4PSRA 3CN1A 5CWSA 1E40A 4PBVC 5GS2D 1BD2D 2A9MH 4RFNB 3SE4A 4FQHB 3SBWC 5GXBB 1RZIA 4M93C 2ICEC 3G5YB 4BK4A 4I0CC 3IFLL 4ZTEA 2K9FB 1A0QL 2E7DA 3GSQA 4F3FA 3RX7A 5A2BA 2E6PA 1VERA 4YGVB 2BVEA 1KIUB 3SE3A 3INUL 3QZOA 4LEXH 2ED6A 5TGBB 5L8JB 4GT7A 4X8GA 1D7FA 1RAMA 3QRGH 3QFDB 5TDPB 3MXVH 4ONFL 4QRPD 5ENWB 4R7VA 3WIHH 2ICWA 3AREA 1ONQA 1DCLA 3VFVA 3O3AA 2J8UB 5AOKA 4R3SA 5GRJL 1FVDA 1UB6B 2ZX7A 5EB9A 2C5DC 2QPSA 1FZKB 3FT0A 4KKZA 3SPVA 4YE4H 1BZDA 1EZVY 2IQ9L 3FS9A 2JI2A 4RMWA 2KLRA 2F53B 2X4PA 4XXWC 3TEZA 2Y36H 3L3KB 3QFJB 4U6TA 3MXWH 5BZXA 3S35L 3SDAC 4AL8H 4Q9QL 4N5UA 4JZOA 4UNTA 5I8EA 2DDQH 3VFRA 1UH4A 4YDJA 3ME0A 5C0AA 1MCLA 3A4FA 4P3CH 1YNTF 2EIDA 3F00A 4QHPA 1B4TA 5I66B 4M8QA 1WAAA 1HHIA 5CBAA 4XNXH 1I8IA 2HT4D 1F97A 4LOFA 1QRKA 5KS9E 3T0EC 1LK2A 1T0NA 3PGDA 3M1BA 2CHWA 2DIAA 4HIQA 1JWUB 3RIAK 1ZT4A 3QG7H 1F13A 3GZQA 3U4EB 4AVKA 3GUTA 2PPDA 3HRZB 3S3PA 1Q9KB 4YS4A 4OF6A 1N0XL 2YKLH 4W9IC 4AKOA 2WQUA 4OSUH 2VABB 2B14A 3PAYA 3LRGA 4W9FC 4QOKB 1P4IH 3BKCL 1YMME 1TZGH 1WTLA 3JWOH 1CJYA 4A7TA 1R47A 3U9PH 5F1KC 3H3PH 2AI0L 3PAUA 4L3EA 4O2EB 3GHBH 5C0CB 5DEFA 1ZT1A 3GUTB 4ATTA 2XV3A 1Q9WB 1HOCB 1YEGH 2CPUA 1UYWH 2Y6SD 3GMPB 3HG1B 3S8GB 4O02B 1XQ4A 3OTTA 5AW9B 2R29A 4L8CB 1FA4A 1HYSD 4YBQD 4XHJC 1URLA 2WIIB 3H55A 2ADFH 3QXAA 2HWZL 3PQYE 4FLQA 2VZOA 4QOKE 1JDDA 4LGRB 2D0GA 1INEH 4BFBD 4DGVL 1IBBA 3VGEA 3X1GA 4Z1PA 5B4MC 1KGYE 3MFFB 4LLQA 3TCXA 2EH8H 4EIGB 1PY0A 1E0OB 4KRPD 1ZT7B 4NYLA 4NJAL 2GUYA 3BD4A 1MPAH 3MNZA 4LU5H 4JY5L 3GI8L 4YIQA 4L9LC 1WZMA 5LXGH 1IGCL 3SGJC 2AERT 4IOIB 1I7RA 4YDZA 2ZXBA 2FR4A 3AADB 3P9WB 3EBGA 5DZLA 3VMPA 4FXTA 5FF6A 3EO9L 4UQ2A 2E9GA 4P06A 3W56A 4R8WH 4B9IA 3AITA 1HHGB 3BAXA 1J8KA 2O93L 4MYPA 4JX0A 1LNUA 2ORBL 1L0PA 1QFWI 2JTYA 5E2TH 3VXQB 5E2TL 3ULUC 1J1PL 5EU7C 3U0PA 2FJFB 4MFHA 1SN5A 1E30A 1GOHA 5HHQA 4NPYB 1YVLA 4PREA 4DPBX 2HUHA 3US1A 2WWOA 2NDGA 2NY6D 1EZUA 1A14L 4RWYH 4I1RA 4OLZL 4L4JA 2WBXA 3BQUC 1NM9A 2XBDA 1EFXA 3C9NA 1T7ZA 1A7NH 3VNZA 4WRLA 4KXAA 5BCAA 1GKEA 3EDEA 1EEQA 1RK0B 4IBSA 4WFFE 2YSTA 4PLKC 4XP9H 2CMRL 5ADOH 3ZKNC 3C5SB 1FH5H 3P11H 3T3MF 2A73A 4JZJC 4AIOA 1P4BL 3HE7A 4JLRA 4Q56A 1NCTA 1J1XH 1KIPB 3BUYA 3CUPA 1P6WA 2C3HA 5D6CA 2MOQA 3UP6A 5IVXE 5B8CA 1WIUA 3MNMA 5GZNA 4OCMC 4WAFA 3HS0B 5F1NB 1QLEB 3RTLA 1NCIA 2WKLA 5IFHL 4OKVB 1U0QA 4NPYA 2VLLB 2B1OA 3LEXA 1GGBH 3D39A 4E9VA 25C8H 1JPTL 1A6VH 3IKCA 1CE1L 5EV7A 4EIZC 2JWYA 3QIUD 2CO7B 4K71C 4X6CF 1QSED 2VCOA 3EDFA 1N7ML 3FRPG 3CZSA 5JPNC 3QRBA 3FT2B 1HCZA 2FWOA 3BAYA 4C54A 4ZS7L 1E4WH 5IV2B 4QJ5B 1Q0YL 3VFSA 5F96L 5I5MA 3D33A 4M03A 1ZHKB 3MROB 2GABA 4JZJA 4LBEA 1P7QA 4FQQB 2C9SA 1EJ8A 2CO4A 3VA2C 1JZDC 1LDPH 2A74B 5FA4A 3UBXG 4Q9QH 2Q86A 4XX5A 1P84K 1UKTA 1PQZB 3EDDA 3NRPA 5JHDB 3QEHA 4MJ2A 2ZUQB 3H0TB 2L0DA 3VRLF 4ZXBC 3KM2A 1LO2L 3FT3B 3V5KB 2BSDA 3MBED 5EO1B 2ZUUA 4K7FA 4WKZA 3IKCB 4H1LG 3BT2L 3TCTA 2VW4A 4KQ0A 1TO4A 2P5ED 2PNDA 3FT4B 3OC5A 1S78D 2EABA 2NSMA 3QYCA 2ZXCA 2IWKA 4ZNCD 3N6YA 2Y36L 1UCTA 3L9YA 5E6IB 2LABA 3A24A 3OR6A 4B9YA 4LSQH 5ABAA 3ARGC 3FBQA 3U36B 4URTB 1MCSA 1JVOA 4BYHA 3V9CA 3MCKA 3DGGA 12E8L 5GS1C 2N59A 4XOCA 3DV4A 1ZCRA 1UJTA 2R2EA 3ZUNC 4ADJA 4HUVB 1PSKL 1NMBL 1IM9D 3FXIC 5IB2A 2V17L 3QJFB 4GSDL 2X2HA 4X9YA 4W93A 3SO3B 4LK4A 1D5BA 1OCWH 2QGCA 4XPGL 1OF2A 1VLXA 1EAJA 4HMEA 4QDGA 3VGBA 3EJYD 5EC2B 3ZN6A 5F7DA 4CL7A 2EZ0C 3VXRE 3UADA 2DI8A 1ADQL 5CCGE 2F53D 1YN6A 4WHTA 4JZOB 4L1DA 2VLRA 4MNQD 3SJVE 4HK0B 4PRPD 4BFOA 3L9EA 4UIMA 4G3YL 2AV1B 1OAXL 2JJVA 3GSVA 2GKIA 3BUTA 2PPCA 2YGQA 1ANUA 1EZSA 1PCSA 3MDJA 2BWIA 3LVEA 2YZ1A 5EZJA 4GKOA 1FNAA 5AKVA 4I87A 1F6LL 4FQ2H 2XTSA 4HZ1A 4R97B 3KPRE