2WKOA

Structure of metal loaded pathogenic sod1 mutant g93a.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDAVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Structural and Biophysical Properties of Metal-Free Pathogenic Sod1 Mutants A4V and G93A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2wkoA00
1SXAA 1Z9PA 1JK9B 3GTVA 1TO5A 1PZSA 1N19A 1N18A 2Z7WA 2ZKYA 4A7UA 2WYTA 1COBA 2ZKWA 3L9EA 1SRDA 3L9YA 3SODB 5CU9A 1B4TA 2Z7ZA 2AQQA 2VR7A 3CE1A 3K91A 1IBDA 4U4IA 1FUNA 1OZUA 4FF9A 2GBUA 2XJLA 1DSWA 3HFFA 3HOGA 3MKGA 1IBHA 2APSA 1B4LA 5KBMA 3GZOA 4N3TA 2WYZA 2AQSA 2Q2LA 3CQQA 1YAIA 3KM2A 1YSOA 1BZOA 1QUPA 1E9PA 3KM1A 1P1VA 1SOSA 2GBVA 1HL4A 2AF2A 2WWNA 2WZ5A 2ZKXA 1F1GA 1RK7A 1SXBA 4MCNA 4OH2A 3PU7A 2AQRA 4B3EA 2WZ6A 3KBFA 2AQNA 1MFMA 3F7LA 1F1AA 4A7GA 3MNDA 1SXSA 3H2PA 1E9OA 2V0AA 4BCYA 1JK9A 1S4IA 1Z9NA 4OJAA 2NNXA 1UXMA 2Z7UA 1UXLA 3T5WA 2WZ0A 1YAZA 3S0PA 2E46A 3ECUA 3QQDB 1L3NA 2SODB 3KBEA 2K4WA 1DO5A 1SXZA 3GQFA 4BCZA 2LU5A 3ECVA 3F7KA 1KMGA 1F1DA 1BA9A 1Q0EA 1OAJA 4A7SA 3GZQA 2VR8A 1SXCA 1PU0A 1XSOA 2WKOA 4L05A 1IB5A 2XJKA 2R27A 2AQTA 3GZPA 2C9VA 1SPDA 2GBTA 3QQDA 1E9QB 3ECWA 1XTMA 1HL5A 1CBJA 1JCVA 2Z7YA 5KBLA 2JLPA 1IBBA 2AQPA 4N3UA 1OZTG 3LTVA 2WWOA 2WKOF 4A7GF 2E47A 4A7TA 1CB4A 3GTTA 1EQWA 1ESOA 2VR6A 2ZOWA 1OEZW 1U3NA 3KH4A 5KBKA 1E9PB 2AEOA 3H2QA 1XTLA 1SDAB 1TO4A 1E9QA 3RE0A 2C9UA 1EJ8A 1PTZA 1SDYA 3HW7A 3CQPA 1IBFA 4A7VA 3KH3A 1SXNA 4A7QA 4BD4A 1F18A 2C9SA 2JCWA 4MCMA 1OALA 1E9OB 1AZVA
chains in the Genus database with same CATH superfamily
5DGQA 3K6FA 2GABA 4HLZH 4PBVC 4CC1A 5I6XB 3SE9H 2P5PA 4JFEA 3T3MF 3C8HA 2WXHA 4KRPC 4MASA 1UZ8B 4HUXB 4MGXA 5KBPA 4R4BA 4PJCB 4W9DC 3EF7A 2Z8VC 4KRPB 1F4YL 4NKQB 1PZCA 3T6WA 4P4RA 3O6MH 4Z3TA 4O2CB 5JHMA 3QJOA 4D8PB 2D0FA 3UZQB 1QRKA 1MHHA 4PGDA 3GBMH 3BKJH 1ZK9A 1P4BH 3VFRB 4AKQA 4IRZL 4QT5B 3HOGA 2NY2D 4PJXE 4XWGH 1R5WA 5AL0A 3TFBA 5IFJB 4XNBA 5KEZA 1CFBA 3GSQA 4XGZB 4AYBA 2OW6A 5MEOA 2D7PA 4NNPL 3X3FH 2Q5BA 2J88L 5AW8B 3V4LA 3WY4A 2D2OA 1NEZG 3CCHA 1T3FB 3LRLA 4TUKL 3Q8BA 1T5WB 2KI6A 3U30C 4PGEB 4X9YA 4OCSH 2FSEB 3EH3B 1JVLA 3ARVA 1MWAA 1T7ZA 5CUSH 3LZFH 3U30B 2ZOKA 3KPPB 4BH7A 2Z35B 4Z23A 1CWVA 5E6YA 3AGWA 4ZSOB 1ET5A 3T8XB 1BOYA 1AZZC 1E50A 1L7TH 2YA0A 3BP6A 1AD0A 3SBRA 3DIDA 2EYRA 3SO3B 1E42A 1AS6A 2Y7MA 4BRVA 1N0LB 2ZTBA 4OBSA 4P5SA 3MRKB 1PMYA 2WNKA 3MNVA 3RG1C 2I60L 1E30A 1A7RL 2PO6A 3KS0J 3OLEA 4JJ5A 2Y6TE 1JNNH 2ZWYA 2P8MA 4I2XE 3AREA 1A7QL 2V5MA 3QUKB 1N8OE 4I3SL 1NIBA 2K7PA 4G42B 4G7RB 2QKSA 4V33A 2GQHA 4TXVB 4GT0A 1I3GH 3E8VA 2HT2C 4NQEB 1AFVH 2CCVA 3UYRH 4R96A 3VXMB 3DV4B 1T0MA 3EOAA 5DFVD 3ROLA 1GYUA 3QPQD 2NXZB 3CHSA 2JLPA 5HHVL 2C8NA 1IC7L 1R3LB 3OXRA 4HV8B 2UZXB 4HLJA 1QX1A 2YUZA 4NUJB 1KGJA 1U8CB 1QHQA 3C6SA 3PABB 4AC2A 3HR5A 2ATKB 4GSUA 1FNSH 1P7QD 2GCYA 5TDNA 2Q76B 1ZT4A 1AGEA 1SN0A 4K3EL 2EZ0D 5D7SL 4FEMA 3X3GH 4JG1L 4OLYL 2BSSB 5EZIL 1W8OA 4F33B 2C9UA 3ULSA 2UZIL 1MCJA 1CFMA 3T2OA 4U7KA 3TH2T 4L2YA 4NFBA 5F0JB 4GBXD 4ZJ9A 4AGLA 4IDJH 4Z7WE 4JHBA 4Y1AE 1CD0A 1ZIBA 3QIWA 4JGUA 5F70A 5T3XL 1FNFA 4GQ9L 1QASA 3RA7L 5IESH 1NUNB 1ONQB 1HQRA 3BVVA 4GW5A 4NEHB 1P7KA 1LK2B 3QB7C 4WU7A 4EI5A 3BKMH 1N18A 4FTDA 5K39B 1MXGA 2WINB 1YEGH 3BUQA 2OXGA 3V6ZB 3WELA 4J5VA 5IM7B 4JREB 2O4EA 4GAAA 2VE6B 5KOVC 1WAAF 2HVBA 1E3FA 4OD1L 5C0AE 4ZX4A 2GIYA 1ZOXA 5E1IA 3WD5H 3WJLC 3RY5A 2AANA 5KJRH 2YMOA 3QZLA 4ZDHB 4YGVB 3M7OA 5T1MB 3O2DL 2B08A 2JF1A 1I8KB 2Y1AA 2ZG2A 2MTAA 2L4OA 5I5JA 3GGWA 4JVUA 4N2CA 4UOZA 1U42A 2FD6L 2CHNA 4QXVA 5A2BA 4IYKA 1U8KB 2ZIDA 4M8RA 2WKLA 3IFLH 4MTMA 3JUZA 4GUCA 3P4MA 4FYTA 4HCRA 3IMBA 1TG8A 1EEUA 5HGAA 2GITB 4NXSA 2R2BA 4ZOAA 1RUPH 1RK1B 1IT9H 5TDPB 3O11A 1E8XA 2NY2C 3DVFA 2MOGA 3V0VA 2Y06H 3BMVA 3CZUB 3VFOA 3WIHA 4PB0L 2NY2B 1S7WA 3K1DA 4F7MB 4FE9A 1TQUA 2B77A 3QS3A 4HJ1A 4KUCD 3B2UC 4F8OA 1LEKB 4DERA 4IK7A 4PH8A 4Q14A 5DK0A 2HRGA 1E28B 2GK0A 2R8SH 4OLXL 1YCSA 1SEQH 3O4OC 2Z92B 2MQGA 5I71C 4JM2A 5JA9A 2C7UA 2X4NB 3ARGA 3DECA 4OF8A 5A2JH 3LY6A 3O4OB 4PV9B 5I71B 4PJEE 1EO5A 4HLZG 2YKKA 1DFBL 2Z4QB 1E3ZA 3R1GL 5M94B 3OKMB 4JG9A 3F83A 5DQDH 4Y2OA 3L3OC 3TNMB 5GHWL 3DX8A 1HVXA 4L4VE 3RZCD 3L3OB 5L2KA 1DDTA 2EADA 1RULH 4LAQL 1PSKH 4OCRH 4YBHA 1KGCD 3F5WA 2DKSA 1XMWA 3NSXA 3ZDWA 2XSKA 4FA8A 3UTSD 1JWUB 2F2HA 4UZSA 1U21A 1OE2A 2BVPA 3IXTA 3BMWA 1J05B 2NY5L 1E9QA 3NA4A 1CICD 1A6AB 4X5PA 1KTDA 2XPGB 3QPQC 3C6LB 3K2UH 1OQOA 4LHQB 5D2NE 4PJAF 3FRUB 4XI5D 4EQ3A 1HHGA 5I66A 2VZVA 2XWCA 2VN5A 4I18A 1N5AA 4DTGL 4M1GH 4IOIA 3GMRA 2EZ0C 3EFFB 3OKOB 5JHDE 1P7QB 4FLOA 3VJ6B 3D39E 5BZXA 2YD8A 3FSZA 4GBXC 5A7BA 4JY4A 1AS8A 3ZDXE 2JIXD 1KJ2A 3EFOB 4DGWC 2OLDA 2ZG1A 2YPLA 4A2MA 4UM9D 4GBXB 2HN7B 1IIIA 2PCYA 1NAML 1X5IA 2VMJA 4PSRA 2Z31C 4PG2A 1ORSA 5ISZB 1OSPH 1UM5H 1V3LA 1WBXB 2YLKA 3QI9B 3D0LB 5D93B 3HC3H 2VDOH 4H1LA 2B0SL 5HHMB 3V4UH 4M6NH 2VQ1A 3UBFA 2RFXB 3FQYA 4N1HB 3F04A 4JRYD 3V4VH 1F6FB 1V55B 5IW6A 4Y19E 5DD6B 3GXMA 3RWCB 5B1JA 4W6YB 1D7FA 2ZKHH 3C5ZB 3L6FA 4X2UA 5E6RB 5KSUA 1FG2A 1F4XL 2V5SA 3TP4A 4X6CF 2WQ8A 2A6IB 4TVPD 4NRYB 5J9PA 3TVMA 3QWOA 3KLDA 3O3EA 1D5XA 4B3VA 4WUUD 4DFIA 5I16B 1Q0EA 2Z9TA 4NN5C 4Q6IB 3T6QC 3D2UB 3LHPL 4F7TB 3HZ3A 3L7FB 4NP4H 5C08A 4LLDB 1Q0YL 4U2ZA 2A6JA 1BF8A 3DSFL 2HLAA 4JDTL 1ZA3B 5DXWA 1N70A 3GS0A 5MERB 2EDQA 3N5AA 2WXRA 1Z66A 4PREA 4KY1H 4MA3A 3US0A 1CJYA 3JWDC 4F7CB 3L7EB 1Y7VA 1TEFA 1X44A 2XV2A 5ICZA 1KXTA 2H1XA 3ULUF 2FH8A 1BJ1H 2PW2B 4DHLA 1WTGT 1A6UL 1NFIA 3DX6B 3QPKA 4GAGH 1EJOH 3QCVH 3ZIMA 2PXYB 2JKIS 3IGAB 2HTLD 3MRPA 4FFYH 4V1DA 1F41A 5A2AA 5JPNB 3QDGB 4YHOH 1NKRA 3BESR 1X6LA 4KJQD 4N2AA 3ZL4H 4YHZH 5IWLA 5GJSH 3QH3B 5JW4N 4P2RD 4J3OH 3RZCC 3S3DB 5HD8D 1QLRA 3MV9E 5DVMA 2I5YL 2ZAHA 2IVFC 2Y7QA 2C4FU 4F9LA 2PKDA 3MTXA 4HKZA 4BSWB 3M8OL 1S2EA 2WUBL 4TLSA 2Z1PA 4HXAH 3VH8A 4N2MA 3UTSB 3Q48A 1I53A 2VQUA 1NLDL 1WZMA 1CICC 1FI8C 1TIUA 1E65A 3FONA 4U0RB 1E27A 2BOBB 5DHXB 1Y6MR 1BFVH 1CICB 3R8QA 3GIZH 1IBDA 4IOSD 5HGBB 4IBWA 3HIZA 1HEJC 2H1PH 3UBXB 4XI5C 3KPMA 4RCAA 2A77H 3CSGA 1J1OH 1QRNA 4UOW1 4X6DF 3CDCA 2NT0A 4I87A 3CXFA 1QA9B 3RTQC 2DIEA 2VQ4A 2YRLA 5L8LB 3DSNA 4J3XA 2XWJB 5E70A 5KSAA 1IFGA 3WGVB 1WDAA 3FHQA 1UWGL 2GBVA 4JVPA 4S0TD 4EI6A 2WGNB 5I0DA 1QQDB 3F65A 5LLIC 1IFRA 3QCUH 4QRRD 2DPKA 1IEHA 1NC2D 2YMXH 5JPMA 2JIXB 3B7TA 1KWGA 4JANB 3MRGA 2ZCZA 5GS1A 4UM9B 5IROD 2R0ZH 5CJ8A 4ZMOA 4PJIA 1AQMA 1SQMA 4X50A 4KQ4H 5ALCL 3UJIH 3UZEC 4K23L 1YAZA 2R56H 3CN1A 4ANVA 2GY7B 2WTRB 2VR9A 3VFUA 1QLFA 4GSQA 1IAOA 1OGPA 1UOWA 2L7EA 1KBWA 1ZWIA 3BWUF 3GSNH 3P2DA 4MWFA 5B7EA 3RWFB 5E5MB 4G8GE 1KTBA 4WI2A 1M05B 1TXKA 2EYSB 2I07A 5C0BB 1KCBA 5EUKB 4X5XA 3WNOA 5IJKC 5IY5B 1BA9A 2QKIA 5F7KC 3WGUB 1ZHNA 3P0GB 3QFJB 5EF0A 3WFHB 3SQBA 4YSQA 3EHBD 1IKOP 1LP9F 2TSBA 3VFNB 1M2VB 1W72B 3FUHA 3F7RA 4OIFA 3EO0A 5G4NA 3ZZSA 3D4ZA 1FO0B 5KYWB 3SY0B 5KS9A 2AQPA 3A4FA 3UJJH 1B9ZA 5ICXB 4BFRA 1SN2A 2XG4B 2UXVA 2IALA 4BKLA 2BSED 1U8JA 4PUBH 3RX5A 3M07A 1Z5LB 3IFPA 1AY1L 3EYVB 5E9DE 2CH8A 3F8UB 1JFQH 5CP7A 5A2CA 3ZE0E 5F71A 2FTAA 4JQVA 1L3WA 1LEGB 3UEQA 3EYUL 3VFTA 4HALA 3EUUA 1J9QA 1RI8A 4HFWB 5EA0L 2VSKB 5AZUA 5JORB 1JHLH 4RGOL 5TK2A 3PJSA 2WKGA 2VL5B 1DCLA 5LGHH 2HTLC 4IRJB 4AVJA 5HHQB 2X4UB 3EDDA 4CJ1A 2VO5A 2CZNA 3APCA 5GXBB 3WOVA 3AACA 5IFHL 2WPGA 2XT1B 4EDWH 3BIKB 1G1OA 3QWNA 2NY0D 2XNAB 3AS1A 3DGGB 4D3CL 1OANA 4L8DB 4ZUWA 5GGSY 1UASA 5HD8C 2NUPA 1PQZB 4Y9EA 3OHXA 5DF0A 3GSVB 4APXA 2H6UA 4JLRA 1XCTA 2CGRH 1I3VA 5TH2B 3STLB 3JVGC 3U9UA 4AVIA 3D50A 1LO2H 4FFWD 4A2EA 4MX7A 1O7SA 3TIEA 2EXYD 2JCCE 2LV4A 2WVSA 4WW1A 4XVOA 1XGRB 3HZVB 3GXIA 3HLKA 4NSKB 3WFEH 1O9VA 3WIIL 2R1XB 4HA1A 3CN2A 3HPLA 5HGDB 1LK3L 4L9DA 3QA3A 5E1AB 4L1SA 3MCLL 2DV6A 4EF3A 4JFOB 2HA1A 4M9OA 5DA0B 5KBDA 1WAEA 3G5YB 3UERA 4NM4L 5EBLB 4J3SA 1F4YH 4MAUL 3VB9A 5BW7C 1CDUA 5B1KA 3GMQB 4GW1B 3ETBJ 1KIQA 4LOUD 1X5YA 4R2GB 3MRFB 3ECQA 3G5ZB 1CD9B 1L9NA 2DQHL 4IJTA 3GLAA 4IRZH 1IAKA 3QR1A 1A6PA 5IROC 1AGBA 4I1PA 3VXRB 2IANA 5JW5B 3QZNA 4L1BA 4NNPH 2J88H 3N04A 4X7TB 3B9KD 4YFDB 2FECI 5B39B 4TUKH 2EO7A 1GTFA 3IJSB 4Z7NF 1DBML 1QR4A 1F0LA 4EZKA 2CIKA 4WAFA 1JCVA 1J0YA 1MNNA 2GFBA 4Z7QF 3BVNA 3D69B 3WFBL 1A3QA 3HG1A 4JFTA 5DRNB 2EKSA 3FB6A 4BXSV 1AIFB 1OW0A 2EC8A 4M48L 5I9QB 3Q06A 4HUWB 5IEKB 1EEZA 3EHBC 5IQ9A 5DJZB 2R1WA 5CXPA 3P4LA 1VJSA 2OSLA 4A6YL 4C56A 2WLYA 3CFNA 3AC0A 4MB3A 3QWRA 1HWWA 3FCGA 2I60H 3QDJA 1M6OB 3ETBF 2OX5B 3VGFA 1A7RH 3SPVB 4XXWC 2XQBL 4I3SH 4BSJA 1A7QH 1BBDL 1OV8A 3FUNA 5E95B 3NIDB 1V5JA 4KV5E 3OKYA 1ZMYA 2NQCA 3ECBA 1FVCB 1YY8A 3FU8A 3NBNA 4P2QE 3LYRA 5DJAA 5HHVH 1IC7H 1HWGB 1ORQB 1TJGL 4APQD 1OP3H 4PJHB 4HWZA 3WEBA 1JYWA 5E24E 2N7BA 4Y5VC 3UABA 2FWOB 3TF7C 4P5TA 1PD0A 1OSEA 4TLUA 1GCFA 2XPYA 4K3EH 4GT7A 1J0KA 4Z95L 4Y5VB 3HNTL 5D7SH 4JG1H 4OLYH 5EZIH 4YSSA 4XNDA 2CIIA 2HUEA 1KTLB 1QUPA 2UZIH 4JM4L 5EH1A 5KVEE 1KPRA 1XX9C 2AF2A 2NY0C 4ZFOB 2NOYA 1JMZA 2E7BA 2FUTA 2WNWA 4OTXL 5T3XH 4GQ9H 3RA7H 3PPEA 2D73A 2QBWA 4A7GA 3FSAA 5EOCJ 1VB9A 3BI9X 4KKRA 5ESAB 7CGTA 2Y0SA 5D7JD 1UACL 1U58A 2NNCA 3IDJB 2EDDA 4GAFB 2MQ3A 3N6YA 3MNWB 4FFWC 4U1IB 5F9AC 2EXYC 5PAZA 1ET8A 1TENA 4OD1H 4PJDF 2D7OA 1B2WL 1QEWA 2SEBB 3VQLA 3WTUA 4E9XA 4KMQA 3O2DH 5DMIL 3PS6A 5L6YL 1FVDB 3UGUA 2FD6H 2CDEB 3ESVF 3FU5A 2MTPA 4WY7L 1BVKA 3MO1B 1TYEB 4LLUB 3ECWA 1QSFA 2DYSB 4IRSD 4WTQA 3EGDA 3HRZC 3M45A 4G1MA 5FFOA 1ASOA 1WZLA 2EIZA 1PLBA 1YN6B 3GKWL 4LOUC 3VVVA 4DO5A 2Y5TA 2YKLL 1MCFA 4NWTL 2FJUB 1JYXA 1OARL 2WW8A 3CVHA 2DWEB 1I8IA 4HJ0D 4FQ2L 2ZXWB 4PB0H 2WLLB 3B9KC 1T2JA 4FQCL 3IPEA 1MCWW 1VENA 2DLHA 1INEL 2VLRA 3WIFB 1E40A 3B9KB 4RH4A 2DKUA 4OLXH 3ARXA 1G7LB 1NIDA 2XZZA 1YPZF 2YZ1A 3HI6L 4E9RA 3ILEA 3EYOA 5AVRB 5EO9B 1TQSA 5E8PA 1DFBH 1S9WB 3FRPG 3R1GH 4G6AD 3ML8A 3QNZA 1FZJB 1NC4B 4F2FA 2AJ3B 2MNJB 5F6IC 5GHWH 4BM7A 2H8PB 2OQJA 4WI4A 2N0MA 4TNWF 3VFSB 5C07E 2X87A 4Y1SA 4LAQH 5IOKA 1NGXB 3CVCA 3RUGB 1CDBA 4KDVA 2IWEA 1IGJA 2ZXGA 1S7QB 3ULVL 1I3RA 4JZJA 4YEEA 2A83A 4NO0D 1F11B 4X0KA 1YAIA 2NY5H 3FB8B 3T65A 3D4YA 1E9PA 1ZA6A 4C57C 4JPSA 3QZPA 2BVUA 4DCQA 1ZDQA 1RERA 4OIIL 4NM8L 1KC5H 2YGPA 4H25A 3RBSA 4APQC 1T03L 4U6YA 1FIGL 5IEHB 3S35X 4DTGH 4KKCD 2CHWA 1BIHA 4APQB 4FL4C 2HAZA 3D3VD 5C2BL 2O6FA 1JK8A 3BDXA 1BF5A 2YOCA 2HJFB 1FG9C 3OQ3B 5I76B 1DJIA 1XSJA 4O51A 5EEYA 3CFUA 3NZ8A 1DL7L 3DX2A 3O3BA 5D96C 2D31A 2VB5A 4K07A 3LKQA 1G9EA 1HQ4A 1O9WA 5PCYA 2DI9A 5BRQA 1NAMH 1OAJA 3V6OA 5D7JC 1HZKA 4PD4K 3FPYA 5AYQA 1NSNL 4LVOC 3CLEL 1TJHL 1HXYA 4Y16A 3L3JB 5FA4A 4HJGB 5LBGA 5D7JB 4MQXD 5IFAL 2PCFB 1IZKA 3IPBA 1MVUA 3SE3C 2ROXA 3BH9B 2B0SH 2CNYA 1QR1A 3K4ZA 4QOKD 3BHBB 3G08B 4XN4A 1PAZA 2QGCA 2X70A 3EG9B 3UTTB 3PNWB 2JE8A 3IJ7A 3U4BL 3V4PL 3VD1A 4QMEA 2B1HL 4JZOB 3WAJA 4OZHE 1RLWA 1F4XH 2NW2B 4P3CL 1QUNA 3PGDB 2F58L 1U6AL 1JE6A 3HC0A 4R8WL 4IRSC 3BYYA 4XNUL 2W60A 3PHQA 5DRWA 5I17A 1T1YA 3BZEB 3EDFA 5GZOD 5ELIA 3BQUA 3NIGE 4IRSB 4MXQD 1YC8A 2NY6D 5IB1A 4X5RA 5HJ3B 5T5NG 1VKXB 3LHPH 3MLVL 4YDLB 4DPCX 1VGEL 4HJ0C 5CBEA 4YL4A 1M7IB 4NPYA 2OR9L 1Q0YH 4J3OD 2UWEE 3KYOA 3DSFH 4B95C 3I02B 4TLKA 4JDTH 1AJ7L 1MW0A 4ZO6A 2LU4A 4EN3D 1ML0A 4HCRL 4AMKL 1KSRA 2X3BA 1FAIL 4AXWA 3PXLA 1F3DH 3U6XS 3R0MA 5C7XL 4CNIB 3C5XA 2F0CA 2FZ3A 4ORZC 4AQEB 2DN7A 5JXEA 2C4XA 3T0EB 3VXOB 1N67A 1JXFA 3KJ6L 5EZOL 4CW1A 3AABA 5FYLE 2UY7A 2WXQA 5DHMC 4R3SA 3WLBB 5EBMB 3X17A 3SDDA 1K5NB 3MUGA 4N9GA 2XWRA 4OZGB 3BZ4B 5I73B 3RGVD 1OGTB 2BS8A 4IBYA 2I5YH 1T7XA 2N7AA 4WCYL 4GRLA 4Z1PA 5IBTL 3MMEB 1IV8A 3Q8AA 4W9JC 3EADA 3M8OH 3MRQB 4C54A 1FJ1B 1QFUL 5ABDE 3IDYC 2WUBH 4URKA 1MI5B 3RWFA 1SEBB 5EORL 3VWJD 4KKAD 1NLDH 1D9KD 4CADB 5TD4A 4ZZFA 2OMVA 4BZYA 3V0GA 1FFRA 2E3VA 4JHUA 4QHUA 3RVWD 2NY3D 3LKRA 5GJTL 1INDL 4WFED 4KKCC 5DD0L 3RL1B 4MAZA 4DFHA 3NZSA 3MA9L 4ADIA 4RZKA 5FDYA 1I7ZB 4ZAKB 5BZWB 2AK4E 1QD0A 1CK0L 3D3VB 4IU3B 1XWVA 1UWGH 2NCMA 3QIUA 3MC0A 4XCYA 2WUCL 4D0CA 4AQAA 5CCJA 1XGPA 5J57B 1XD1A 3LD8B 4F2EA 2UZYA 5GRYA 1RZFL 1I1FA 2JKSA 4JY6A 4DPRA 3OKDA 1XR8A 2FWLB 4GW4B 3W2DL 5ALCH 4H5SB 1OT1A 2FYYB 4KO6A 3VXUE 4K23H 3MX0B 4MQXC 4ZFZB 1A4JA 3P9WB 1M3JA 2BOLA 3OR6B 1EJ8A 4AE1A 4B96A 5IVZA 5IHZA 1H8NA 4PRDA 3HJ0A 3QNXB 1VAHA 1WHPA 5EU6B 3LEVL 5EIVA 4BD4A 4ZFGL 3FQRA 1JFHA 1KJ2L 3ZJAA 1H3XA 3KPTA 4KKLD 1FNLA 4QIRA 1DVXA 4JFPA 1CFQA 2VIRA 3EAKA 4QOKB 3WNLA 4OIBA 5BRZA 3GINA 2J1WA 2CD0A 2UY6A 5HHOA 1PZSA 1CGVA 2XCMC 4TQHA 4EIUA 5JR1L 3L13A 3GMMA 4LHJB 5IMKA 3VXNB 3SPHA 2OMZA 3FQUA 2DH2A 2W65B 1QBLL 5AB9A 4NQSB 2BHZA 1ZAGA 1ZRUA 1HHJA 3HAEG 3MRNB 1BD2A 4Y8DC 5F1IB 1D5MA 1WUNT 4LARL 4JFZL 4F3FB 4AX3A 4MXQC 3IGUA 5F8QC 3REWA 2NY6C 4KO7A 4AI7A 4S1SL 4K71C 3DIVA 4NDMA 3FT3B 3B2MA 1SLXA 4J3OC 2BVOB 4PJFF 1AY1H 4K71B 3L81A 3ROOA 1OF2B 4FABL 3HVNA 3MLYL 2X41A 4EN3C 5FGRA 1QFWI 3EYUH 2R4RL 3GWJA 1BW8A 3SKUD 2CO2A 5EA0H 3CC5A 5CHNA 1KGUA 4RFEA 4RGOH 5CJOL 5I2IB 4X83A 1JP5A 4GQZA 4WLCA 3SPGA 3CBKB 3IJHB 3WAKA 1U8OB 4G80A 4L3CA 5AOMA 5IFHH 3ASNB 4GRWH 4D3CH 5HHNA 2HRLA 4HEPA 1H15B 4QO1B 3RGVC 3UBHA 4AZUA 5D5MF 3LNFA 1OE1A 1TZAA 4N9OB 2ZG3A 4NI3A 2ZSVB 3FO2A 4QRUA 3RGVB 5IW1A 3J7HA 3ZE1B 4MNGA 3KL5A 2UZPA 1HYRC 1G5GA 4NYLB 2CCLA 3ARTA 3LKSB 3OWEA 3QHZL 4RDQF 1F5WA 3VWJC 4KKAC 4WHTA 1IU1A 1D9KC 2FYVA 2XFXB 5E0QA 4OFIA 3A4EA 4CGTA 4G9FD 1G5AA 3VWJB 1D9KB 1UXSA 1CURA 4JFHE 3BFWA 3RVWC 3WIIH 2NY3C 5F7YC 1MHPL 4MNQD 1LK3H 5DJ2A 3B5GA 4LOFA 3ARRA 4PJXA 4M8UA 3MCLH 4P46B 4WNQB 2WMPB 4LIQE 2AQ2A 4A39A 4NM4H 4EIZC 3JQOB 5KW9L 2NY1D 3F7VB 3O9WA 2GTWA 4MAUH 4UZUA 5D1QE 5E08L 2H45A 3I9IA 5AOZA 4Q9CA 4X80L 4MQ7A 1S7RB 2F61A 1J7VR 3OPUA 4IW4C 4LFHG 1AACA 1NL0L 1PD6A 2DQHH 4EKJA 3VD4A 1RZIA 3O41A 1QNIA 1JF1A 5TE4L 5LVEA 2EIJB 4DKTA 4HSQA 1A66A 1CFVL 5ANMA 3VSUA 3GSRB 1D6EA 3NCJL 3KZ8A 1FRGL 1DBMH 3MR9A 5J6GA 1DO6A 2AQ3A 2F74B 4L4TD 2J2ZA 4HULB 1CLVA 3OGCB 3WFBH 4KKLC 5IW3A 2ODIA 1MCKA 3CN3A 1MIEL 4M48H 4QLRA 3QXWA 2EDJA 2WWKO 2XIIA 4DP4X 4YSEA 4JFFE 1URZA 2E9WA 4A6YH 5BXFB 1OCCB 2VAJA 4A67A 3DUSB 3UO1L 2AQ1A 3QHFL 2Z93B 4YHNA 4M8QB 5I6PA 3UACA 1EGJA 2VYRE 1XGQA 3ZHKA 4PJAB 3EH5B 1EXUA 3CMOL 4X4ZA 1FL6A 2XQBH 4LRIA 3LPPA 1BBDH 3CMGA 1EVUA 1Q9LB 1HN1A 4XBEL 1HT6A 5E8EA 5T3XD 5I1EL 3PWPA 1C08B 4Y5XC 2QQKL 4BK5A 2XV6B 4RQQA 2X10A 1PX3A 1TLKA 1DO5A 3G6JA 4JO2L 1F02I 1BOGB 1TJGH 2CDFA 2G3ZA 3KJ4C 2Q3AA 2YD3A 2V5YA 4IIQA 2RH0A 1BJMA 1PDKA 4YBQC 1A4KB 4LEOB 3KJ4B 4HX1A 1DQDH 4L8SC 3ZT6A 1O6VA 4Z95H 5E8OB 3HNTH 1IB5A 4YN3A 2F54A 4QHMB 2P4AB 2LFEA 4JM4H 4O2EA 5GGRB 1IFHL 3K46A 4OFQA 4UI2A 5C0AA 2WVVA 4HG4K 1FHGA 1ZGLP 4Q58C 2HFEA 4Q2ZA 4Z3HA 4OTXH 3BLPX 3EXLA 4NZTL 4NOBA 4WU5A 4NIYE 2JV6A 1NDGA 1HI6B 4OFKA 4PLJD 1CDIA 2BW5A 2XBDA 4ANXA 3GTTA 3DVNA 1U9KA 1UACH 3LS5L 4RZCB 4TN9A 4M5TA 5KBKA 3KH4A 3ZE2F 4H13C 5LGYA 1QVOA 5CIPA 1BSIA 4PS3A 3RDTD 2ATPB 4L8CB 2FQEA 4D9QE 1B2WH 3MV01 4WEBL 4X6CB 3REVA 3K80A 4CVXB 1OGAA 3LPFA 1EEYB 3IJ9A 3MV8E 1UD6A 4G9FB 3WNIA 2QVTA 5L4FA 3ZQXA 3X1FA 5I28A 1PZ5A 4GG6F 4AEIL 5DMIH 3JZ7A 3KXFA 1GOHA 5D2LE 4OZIE 3CAFA 5L6YH 2ZKYA 3TFKD 4MNQB 3KDPB 4KZEL 2ORBL 5IMLB 5JW4Q 5E2VL 3SDAA 5J7CC 4WY7H 2CHZA 5GSRA 2NY1C 5LN4A 1MRCL 1LE9A 5BS0D 1AO7B 2DD8L 1UD4A 3FTUA 4Q7DA 4XZUB 3UPRA 3GKWH 5JIKA 2IJ0C 3QXTA 4NKDB 2YKLH 4ONFL 1R3JB 4NWTH 4ES9A 3FO0L 3EGSA 3JTBA 1NFAA 5IQNA 5C0CE 2NXYD 3MBXL 1OARH 4ZXBA 1ES0A 1XB3A 2XA3A 4FQ2H 5DJDB 4HIQA 4UYQA 5DURD 2X2YA 3DVGB 5B4MC 4G8FA 2M2DA 1MJJA 4FQCH 1QTSA 1F6AA 1OY3B 1G7PB 1INEH 4ODXA 4PTTA 4L4VA 4DOHB 1FNEA 5IJVA 1EHXA 2E6QA 3HI6H 5GGTA 5HP5A 1A1NB 5IIEB 3BN9D 1BZ7B 2HB0A 5BJTA 2JQZA 3HC2A 4QGTA 5TDOA 4JR9L 4K0OA 5FDWB 3W0WD 4BUQA 1UXLA 3RNQB 1PD1A 1ZLUH 4ENED 4ODUA 5JUEL 3ECUA 4XTRC 1UJ3A 4NI6A 2Q9OA 3GSWB 4U1HA 2ZCLL 3WMSA 4NQCE 5C0FA 5DMKB 1PNDA 2TAAA 3K6DA 3F7KA 4BGLA 3ULVH 3GNML 4DO4A 5A40E 1I1CA 2WIMA 2VAAA 4P5KB 4BUGA 5F1KC 2WSDA 3FQNA 4GXVL 5CCKL 4EI0A 4X6DB 3E2HB 2YXVA 3WKQA 3K71A 4F57L 5EBWA 5E8DL 3GMLB 2CNZA 4OIIH 4RMTA 4NM8H 5ESQB 3FSVA 5H37A 5I1LB 3K0YA 4JPIB 1T03H 4OJEH 1FIGH 4LNVA 1HSAB 3B7SA 2JXMA 3SBPA 4ZPTB 3WL9A 4WJG3 3ZN6A 3DROA 2Y23A 4YO0B 5C2BH 2AP2A 4QYOA 4YNYA 2MQCA 3WO3B 2PPFA 4X98B 4OW6A 1SVCP 1DL7H 4FNTA 2LTQB 1TEYA 2A9BA 1FZKB 5DMJB 3WDJA 4CKVX 4Y9FA 5TQ2L 5FS5A 3T0XA 1N9PA 4TSCL 1CT8A 4PLJC 3VFMB 1VSCA 2O72A 1QHPA 4ZOBA 5EOTB 3GUTA 1NSNH 3QZWA 3CLEH 1TJHH 2VKWA 2WYTA 3D48R 4NX0A 4K8RL 5IFAH 1J8RA 2DM4A 1LP9B 1LMKA 4YDKL 2BP0B 3CFCL 3RDTB 5DHVB 3OKNB 1HNFA 4ORGA 5T1KA 4MB4A 1JV2A 4Z77A 1N59B 4J8QA 4WKXA 4Y4FA 4ZUVB 3U4BH 3V4PH 5L7XL 3D33A 2B1HH 1DJZA 1I9RL 2GSIB 3RY6C 3TFKC 4KJWD 1ND0B 4TM9A 1DJXA 3WLWD 4P3CH 4AWJC 4N0FB 2F58H 2Q2EB 1U6AH 4R8WH 3VTAA 2QTVA 1F3RB 2CUHA 3FN3A 1T5XB 3HE7D 4GKNB 4HISA 4K94L 4XNUH 5EU7E 4PV8B 3TNNA 4U3SB 3VFPB 4N8PA 2XWTB 3VI3F 3WHXB 6CGTA 3JTTB 1A25A 4QT5A 5HVGB 1EEQA 3MLVH 2NXYC 4HIIB 1VGEH 2V2TA 4A04A 4LFHD 2OR9H 4OF3A 3QEHA 3D18A 4OVUA 3QJRB 1F90L 1T3FA 4O4YL 1AJ7H 2F8OA 3K7UA 1OL0A 5GZND 2ZXDA 4HCRH 1ZSHA 4PVLA 5ACMA 3U4EB 3KPQA 3ZGHA 4AMKH 1FAIH 3DUUB 5B38B 5C7XH 2NY5C 4G9DB 3GBLA 4GFXA 4W70A 4Y4KB 2BWIA 3G5XB 5HPMB 3BN9C 2Z35A 1R5VB 2LU7A 3KJ6H 5EZOH 3QAZC 3S36X 3CVHL 1OAYL 3TV8A 1G7JA 1DQKA 4RRPM 4BFFA 3HZYB 3T4AA 5I0XA 1S7SB 4ENEC 3PP3H 2AV7B 3QAZB 3U2JA 1NM9A 2NNAB 3W0WB 5GRJL 1IEAB 2VH5L 3MRKA 1OO2A 3L5HA 5I75C 4U0QB 1DSYA 1CDGA 4WCYH 2VLKE 5IBTH 5I75B 1ZSDA 3QUKA 3AXHA 1XSKA 2WOYA 1YDPB 1QFUH 4G42A 1T83A 5D7LB 1S5IL 4Q9BA 1XF2B 1SDAB 3GS4A 5EORH 5KS9F 3KYKL 3L5IA 3C2SA 2N01B 3DHJA 2FX7L 2GHZA 4DETA 1YZZA 5JO5B 4JGJA 4GP5B 3V5KA 5L2JB 1MLBB 3CFEB 1R3LA 4DP0X 1A1OA 2IBZY 3HMWL 1NAMB 3QDME 2UZXA 4LE8A 1QACA 2PYFA 3Q43A 4NUJA 3QS2A 1U8CA 4KHTL 1LO3L 3O6FB 5FA3A 5GJTH 5B1BB 3V0IA 1INDH 2ZCKL 3PABA 3PWVB 1WGVA 4MSWB 4P2OD 3ZDYF 2ATKA 5DD0H 3U6RB 3LIUA 5TF0A 2Z7WA 3MA9H 5CEYB 1XXFC 4XPBL 2ADJB 2BFGA 4KI5D 4YPGB 1CK0H 1RUKL 4JDEB 4LLWA 5BZDA 2WUCH 2WVTA 5KANG 4UYPA 3M46A 4Z7NB 5CU9A 2EJ1A 4WO4A 3CLFL 3IGKA 1ONQA 1KB9J 3GRWA 4M4RA 4EUPB 1RZFH 4P2AA 4Z7QB 3BVDB 2RD0A 1TNMA 3F64A 4HVBA 3OX8B 4YGAB 4L23A 5K39A 3DXAD 3VCLA 5SV3A 1HILA 5D7IA 3W2DH 3VXPB 4CDHA 2CO7B 2F5BL 3BZFB 5I6KA 1J5DA 2VE6A 1T2QL 1B0RB 5F7HA 5AVTB 1FDLL 3BH8B 3LEVH 5FUCC 4ELMA 2F8XC 4ZFGH 4QJ3B 2FQFA 3QGVA 1KJ2H 4YGVA 4ZDHA 1AHWC 4FI6A 5DCCA 5T1MA 5C9JA 5F7UA 3A23A 4JHVA 5IMOA 4M3JA 3GJEA 1ZGLM 3Q7JA 5JR1H 1AHWB 2V0AA 4R7DB 4O02A 4KJWC 3VXSE 1OP3K 1U8KA 3WLWC 4TS6A 5D6DA 3SDYL 1QBLH 4MFHA 1W9XA 4PWGA 4NBXB 1NIAA 3HE7C 4GQPH 5TJWK 2GITA 3IRCA 4H1LH 3FOLA 4FKKA 4LARH 4JFZH 2J12B 1YEFL 4FFVD 2A73B 3HE7B 4XNXL 4BCZA 3BPNC 4HOWA 4S1SH 3HI1B 3LXCA 3VG9B 5CFHA 4BELD 4H8PA 3OAUL 2AJVL 3H9ZA 4M9PA 1H5BA 1U3HD 4ONGL 4PJ5E 2W9EL 4JQXA 1G7QA 3K8MA 1X5GA 2ICEA 3KPOB 4FABH 5C0JB 1DCEA 1VRSA 3MLYH 3QO0B 5GZNC 4J27A 5HDBE 3DI2B 1L5GB 1JRHL 1Q1PA 4KY2A 3UG5A 2R4RH 4IBZA 1MWOA 2L04A 1X9LA 4XHJD 2AJZA 4L3EB 1TVHB 2OKMA 5CJOH 2IPKB 2M1KA 4IU2A 3V8CA 1FFOA 2J7LA 4O5LL 1U3NA 3SEPA 5KOMC 1XCQB 3BT2L 1MLCB 1EDHA 4CC0A 4AENA 4M7LL 4UNTA 1QSED 2GI0A 2JCCA 5I5MA 3LAFA 1Q72L 2APFA 2HKHL 4JFDD 2O93L 4NQXB 3O8XD 4LHUD 4PJDB 4X8JA 3ABGA 4XAKD 2H6PA 5DQ9B 2JCWA 3WNMA 2XWBA 1MVFA 3QUXC 3Q05A 4KTDL 4PRPB 3MA7B 2EXWD 3AXLB 4TTGA 1DVQA 4OU3A 3G5WA 3QHZH 4FA7B 3BYTA 4J2QA 4PWFA 4IBVA 2XPGA 1U3ZA 3MV11 3KYAA 3C6LA 4NKOB 4NNYB 4U3HA 3QT2A 3QXDB 1JTPA 4JFSA 3FO1A 3H9SA 4RESB 2J5WA 1MHPH 1MN4A 1KYUA 2QQQA 1P6AB 1SDDB 3BAWA 1IM9D 4M7KL 4P06A 2WP3O 4PJCE 1NBYB 4P23A 2XJLA 4PLKD 2NTFA 2OMUA 4J3VA 3OKOA 4P2OB 3HS0A 3ARFD 4AIZA 5KW9H 1MJ8L 4KI5C 3SD2A 3VJ6A 7PAZA 5E08H 3HBPA 5AKVA 4AYSA 3N85L 2XN1A 3FAWA 4X80H 2Q6WA 2HLFC 3VDCA 2WAQA 3GK8L 3AXIA 3EFOA 4UQ2B 1M9SA 5GSVA 3IS0X 3GJFH 1GZHA 1E7VA 4LVHB 2Z91B 2HN7A 1NL0H 4M7ZC 1NANH 1G9ML 1M4KA 4F2MB 5K9OA 3BP7B 1YPZB 1HOEA 5TE4H 1YMMD 3FHAA 5C09D 5ISZA 1CFVH 5A43C 5E6SB 4DUXA 3NCJH 1WBXA 1FRGH 3DXAB 3QI9A 3X14B 4B0MB 2E76C 3IN2A 5C6PB 5LBSL 5B8CA 5DZLA 1I3UA 2X0WA 1BAFL 2W88A 4CMMB 1CGUA 1TTRA 1KCWA 1Z9OA 3OZ9L 3PUCA 5FO8B 1OK0A 4M5ZL 1WE5A 5EO0B 2JTDA 4ZSOE 1MIEH 4P59L 3TC9A 5IVXB 1Q1JL 1JZ7A 3C5ZA 4LCCB 4M93C 3SQOL 3MRMA 4LLQB 1K4CA 5G5DB 3QO1B 2YFOA 3QFDB 1DEEB 2NR6D 1WA2X 3MXWL 4I0CC 1E8ZA 2YARA 4P8QA 3UO1H 4LP4A 5KBLA 3NZHL 1CIUA 1BIIA 2BO0A 2QADD 3ARBB 3QHFH 3PAZA 4FFVC 4RGMC 2IDUA 1NOLA 1R34A 2VITB 3ISYA 5I16A 3EOBB 2H3NB 1EJ6A 3CMOH 3D2UA 2YD9A 4F7TA 2DWDA 1ZS8A 2G9HA 3AT8A 4NQEE 2KLSA 5T5NF 3VXME 4XBEH 4WGWB 5I1EH 4QRSA 5J1AA 4PJBB 1TO4A 3CDGA 3H53A 5GGVL 3RE0A 2QQKH 1YEDA 1S7XB 2DJ4A 4POUB 3WTYA 3PHOB 4U6HB 1U3HB 1BZEA 1P9MA 3BWZA 4JO2H 2JJUA 4H0IA 2ZQKA 4NT6B 2PW2A 2MNUA 5I74B 4WF7A 3DX6A 1EZVY 4K5OA 4XHJC 1ED3B 3D34A 2PXYA 1C5BL 4RAUA 3WHE1 3BWSA 5B3SB 3RWJB 3C5JB 4U1SB 1I8LA 2O6CA 5JPNA 2EVHA 1IQDA 3QDGA 2ZX8A 1PCSA 5DZNA 4BBWA 1BMZA 1SJHA 1YNLL 5CSGA 1XH1A 1IFHH 1ICTA 2F7OA 3A0OA 3KLKA 2YJLA 1X9RA 3QH3A 5F7NC 2R2CA 4NZTH 3HRPA 3O8XC 2W0KA 3AB0B 4E9TA 4OFYA 5I82A 5B7FA 1FUNA 2VRQA 4JFDB 4YDJB 1LWRA 2Q86A 3L1EA 2K45A 3LS5H 4LHUB 5DYOB 1J9SA 1L9RA 1UEMA 2EXWC 3HFFA 3FUIA 4PMFA 4BSWA 4HCIA 1ETJA 1FWXA 1NBCA 1UFGA 2HRPL 3KLLA 4HDIA 4YSOA 4BHUA 4EZLA 4AQOA 4WEBH 2ZKXA 3N55A 3PL6B 1YEEL 3RX8A 1PZ2A 2I9LB 1A3ZA 5DA4A 3BOVA 1SLWA 3KL0A 1OPOA 2ADIB 3IN0A 4AEIH 2GYSA 4G1EA 3ARUA 4MXVF 4UBDD 3RWHA 2X42A 2YC1A 4LLYB 4NO5A 4JFVA 3VQ1C 3S3JA 2IDCA 1IM9B 4MJJA 4KZEH 2ORBH 3DARA 5E2VH 4K7PL 3ARFC 4P99A 5ID1A 2YPVL 5F97E 1BVNP 4UT9A 1MRCH 1AXIB 1QLEL 3Q2VA 4KJYB 2DD8H 5FM8A 1AXSA 2Q8AL 4Y4HA 5D1XA 3WG7B 3WE6B 2HVKA 4ONFH 1D2PA 4RBPH 4QTHA 4HJSA 3RB7A 3FO0H 4DN3L 3KPLB 4JANA 3MBXH 2JI1A 1FYTB 1UKSA 4OUUB 1SF3A 1X4ZA 2XQYG 3QNYB 4H8QA 4E9QA 4LKCB 1IE4A 3WNKA 3K4AA 1FNGA 3R19A 3W39B 4RRPA 1JYNA 1WCBA 5IBLD 3ULVD 5AALA 1HOCB 1ID2A 2KYIA 4M02A 5C0BA 5J5EA 2EAEA 1H3WM 5EUKA 1NUGA 3TONA 4PLOB 4PJ7A 4K3HA 1MY7A 3CFMA 3QFJA 3WFHA 1TQCC 4MMXC 3II1A 1GH7A 2XVKA 5A6MA 4GPVA 4JR9H 1P4LB 3GMOB 4RMSA 3VFNA 1M2VA 2OI9C 1W72A 4JQIL 5DFTA 1IUZA 4PJ8A 5JUEH 3LNIA 4MMXB 1FO0A 2NR6C 2PO6D 1Q8MA 2ZCLH 5K1JA 3ARED 3W11D 3LN5A 3I3DA 3KHOA 2XG4A 1CFNA 1K6QL 3HKZA 4A2HA 3SCMA 5KSVB 1UD8A 2WWMD 4WK4B 3GNMH 4L1TA 4ADJA 3FUDA 4M00A 5SWSB 2QADB 3TGXA 4GXVH 2W07A 2CRYA 3ABLB 3FQTA 3H9YA 3KWWB 3L1FA 5CCKH 1WA1X 1X5MA 1UQSA 5CGTA 4F57H 1B0IA 1OKEA 4KO5A 4WI0B 4MZIA 2YRBA 5E8DH 3ZL2A 5BQDA 5JYLA 1A7OL 3ZTNL 4FHJA 1CG9B 2QSCL 3NJIA 3VW3L 4M56A 4HFWA 4Z5RB 5JORA 3AY2A 4L0PB 1EGJL 4K73A 5TFSL 5F3BB 3HE6A 2VM9A 1UOLA 3JWNE 3U1QA 4EO5A 2APBA 3QIWD 2HJKA 2ARWA 5D6CB 1HH6A 3FPXA 4KUZL 3DGGA 4L29A 3SGDH 4EI5D 2ZX5A 3MPCA 5AB0A 1Y6NR 4PB9L 5TQ2H 3WIAA 4XH2B 4ELKB 4L37A 4TSCH 4EKXA 5JOPD 5TH2A 2YD7A 3BUDA 3STLA 3TT1L 2ESVB 2GUOB 3WS3A 4K8RH 3ILPB 2I9TB 3HN5A 3NA9L 3MJ9L 2J6EL 4TNWK 2QV4A 5MENB 3MV7B 1AGFB 3P73A 4YDKH 1Y18B 3CFCH 4MA8L 4PBDA 4X4XB 2QGEA 2AXFB 2FWSA 2KL6A 4BINA 1FF5A 4ZMQA 3AZUA 4JFEB 5E1AA 1RZKL 5L7XH 4UBDC 5H4ZA 1I9RH 1KXVA 1JD7A 2A7BA 4R4BB 2AAAA 3ESNA 1QTPA 2HFGL 2EIKB 2VNCA 4AIEA 2G2RB 5L4MA 1UOKA 4U1LB 3UO8B 3GLEA 2IWKA 4GW1A 4K94H 3UTZB 4NFDA 1OWWA 3B83A 4PGDB 5HVHB 4XR8C 1MFAL 1TOXA 2EILB 3EO1A 4V2BA 1O7DC 2P52A 1T7VA 2CJUL 3U79A 4LXFA 5CFAA 1A8ZA 1UG9A 1OCWL 1WK0A 2EIDA 4U6VL 4WFGD 3VXRA 3HLAB 5MEOB 3SE4A 3V0HA 5EEXA 2FBJL 1VF5C 5JW5A 1WIOA 3CCHB 4QKXB 3H2QA 4O4YH 1F90H 3EJPA 3GRGA 5HYSG 4JM2D 5IBLC 3ULVC 2R7EA 3ARGD 3B37A 1IC5L 3NRFA 1MWAB 4BWWA 2ZOKB 2OL3L 3RI5K 5C9KA 5DRNA 3V5HB 4BH7B 2BC4B 2XV3A 5ABZA 1XDTT 1XR9A 2G5RA 5IEKA 3ME0B 4YHIB 2JKWA 3CVHH 1OAYH 1A7NL 3QZOA 3BP6B 4PP2B 2L7QA 3GD1C 5L2KD 1LTXA 3NESA 2EYRB 4YX2L 4FXGA 3WENA 2PO6C 5D9SB 5GRJH 1CF8L 2VH5H 3MNVB 3FBQA 4HJTA 3W11C 1BDYA 4JJ5B 1M6OA 8FABB 4DVBA 4MDRA 4MRCA 1KGCE 2P8MB 3AREB 1KCRL 2ICCA 2WWMC 2JK5B 2QMJA 5GGTL 1XZ0A 3UTSE 3ZKXC 2XWXA 1S5IH 2E7DA 3S8WA 1EAQA 4QRPA 1AE6L 4R96B 4ZW6A 3KYKH 4JRXA 3ZKXB 2JWYA 4FZ8L 3EOAB 3ROLB 2FX7H 3M6DA 2MJWA 4TNFA 3ZYOA 2NQ3A 3OXRB 1SYVB 2PTVA 3FTYA 3HMWH 3KWVA 4PVMA 1MHEB 2I85A 3U36A 3C6SB 3FTZA 5MEQB 4KHTH 1LO3H 3HR5B 2ZCKH 1ZT7A 4OZFA 3S37X 3VVWA 1ZT4B 3TBSB 3H56A 2J8UE 1W8EA 1J10A 2GC4C 4OV6F 2A9CA 3VXUA 1QKZL 3ULSB 4XPBH 1UXMA 1MAML 2YPLD 3BAIA 3C12A 3ZYZA 1RUKH 3H7LA 3PV7A 2DQEL 2B5IC 3QIWB 1CS6A 4AYDC 2ZUUA 1HXKA 1SOKA 2IXQA 1ZVYA 1HQRB 3HG4A 4GW5B 3CLFH 1P7KB 4WU7B 4EI5B 1JL8A 2EDKA 3VE0A 5JMOC 2ZP9A 3TJHD 1FL3A 1OM9A 2DKMA 4W68A 2C1PB 2OXGB 3A24A 5CU5A 3MUZ1 2F5BH 5EIIG 4DKEL 3MNWA 4WSJA 2XA8L 3QEQD 1RK0A 3RKPA 1T2QH 2EXSA 5IBUG 1THAA 5H35B 1FDLH 3UBGA 3L08A 4JRYE 2NX5A 2VSCA 2XBZA 3CG8A 5BVPL 2WC7A 4Z7OB 2L8AA 1XD0A 2QL1A 4I1NB 1A2YA 1GJUA 1XF3A 3SDYH 4BXVA 1KYDA 2YWYA 3P4MB 4LLUA 4TVPE 3P2TA 5HGAB 4BZ1A 4C55A 5KSBA 3MCKB 1OTUD 1XF4A 2R2BB 5HI3D 4FYSA 2RACA 4PJXF 2D7TL 4OFDA 1WEJL 3N0PB 4B60A 1YEFH 4WUUE 1I1YA 2LABA 3DUHA 4R84A 4N2EA 4MMYB 3MACL 4XNXH 4HMCA 3SB3A 1OALA 1OQXA 1NBQA 3V0VB 4RMVA 5F3FA 1MCNA 3VD0A 3OAUH 3VFOB 5DJ8A 1S7WB 2AJVH 2PP9A 4YIQA 5EZPA 1R24B 1JPTL 4ONGH 2GIMA 2W9EH 2YAPA 3L9EA 4UMGA 4WK2B 2DW5A 4JM2C 5DK0B 4NQDB 3ARGC 1BZQK 2GK0B 3RVUD 3GF8A 3WIFA 1LE5B 4ZS7H 1A21A 1JRHH 4I0PA 2LQRA 4JM2B 2ERJB 5H8DA 5AG8A 2C7UB 3ARGB 3VWKB 4UQ9A 4V1DD 5I1DA 1TYRA 1YY9D 5H2BA 5EFIB 5FW6A 4LDCA 4PQXA 4BE5A 4HIPA 4O5LH 4A38A 5FK9A 4RMBA 4AG4L 3BT2H 3AM8A 2OCFD 1NC4A 4M7LH 1BZOA 4JPVL 4HUNB 2V5TA 1G4MA 1T04B 4PJGE 1JZIA 1M53A 1Q72H 5T3ZL 5SWZA 3TEWA 1MW2A 1RZ8A 2HKHH 2WQVA 5CD5D 5L2KB 3EKCA 4P2RE 2F53A 1VACB 3ATFA 3HC4L 4BEIA 2EUVA 4U6TA 4KTDH 3L5WB 1S7QA 5AFAA 3LNHA 2JKJA 3ZHNA 4B9CA 4X4YB 3DX0A 5SX5H 1CQKA 3IXTB 2X9WA 3UAAA 1S4IA 2BCKB 3CK0L 4U1MA 5DJXB 1KTDB 3NFSL 3O4LA 2XDHA 2CM5A 1VIWA 1QRND 4KOBA 4X9FA 1TT6A 3IFOA 3E6FA 1VFBA 1ZLVH 2XXMB 2E59A 1HHGB 5I66B 2VW7A 1JWSA 4I18B 4M7KH 4XBPB 2IOMA 1HSBB 5KSAD 4IOIB 3GMRB 3UAJD 1I9JL 1OXYA 2FSDA 3GZQA 3IU3A 1JZ8A 4Z7WF 5LNGA 2HJFA 1MJ8H 1G43A 5J11C 3EOTL 5I76A 3IE4A 4JY4B 4I89A 5FC9A 3N85H 2ZUXA 4XX5A 1ETB1 2YPLB 3GK8H 2X4TA 1ZLUK 1JXDA 1NCIA 4QRRE 4CVZB 3CU1A 3NCYS 3MGOA 4N26A 1KBPA 1G9MH 1TDQA 3NJKA 5F9DC 3SE6A 1TITA 3CHXA 2OTPA 1DJWA 2I24N 4KX7A 5E4EB 3TJHC 3UC2A 1KWKA 2GJJA 2Y3NA 4ZK8A 1KB3A 4MAYA 2PCFA 1D3CA 4H1LB 1J1PL 1RLBA 2VQ1B 4NZUL 1UD3A 5LBSH 1KXQE 3BHBA 4AW7A 4PMEA 1BAFH 3PWUB 5B1JC 3OZ9H 5IW6B 1ZLEA 3TZVB 3UTTA 1MOEA 4M5ZH 3T0VA 3ML9A 1AZVA 3GRWL 2G3NA 4P59H 4Y5YA 3L6FB 3ZRFC 3LJ3A 1Q1JH 1YUKB 1N19A 1FG2B 3SQOH 3WN5B 5CF3A 5AQ0A 1FC2D 2R59A 5J9PB 3TVMB 3O3EB 1D5XB 1OTUC 3MXWH 3P54A 5HI3C 3WS6C 5HVWA 3WTSA 3ZKNC 3NZHH 2WQAA 1OIOA 5CGMA 5HJ3A 4OGQC 2IPUG 3LX9A 2O5NA 2DI8A 3O3AB 4NZJA 1OZUA 3CVBA 5C08B 1V27A 5I15L 1M7IA 4KZDH 2A6JB 2YHGA 4IOFD 4YHYB 2HLAB 3W1ZA 3CQQA 2H7WA 5GGVH 4PREB 4MA3B 3NFPB 3MOBL 3CC1A 3RVUC 4NHCH 5ICZB 1KXTB 5DK2A 3NAAL 4FKEA 4PJEF 4WQOA 1TTAA 2X4PA 5CGBA 4AQEA 1YY9C 3VXOA 4ACPA 3MRPB 1ADQL 3T0EA 1C5BH 1B2YA 4V1DB 4DZ8A 3KD4A 2J20A 5IWLC 4HFUL 1BM7A 1NH6A 3WJJA 2EO9A 1G7MA 1VESA 3D8MA 4MJ4A 3A4DA 3MRDA 1YNLH 5FEBA 2RHEA 1QFPA 4F9LC 3BZ4A 1DBKL 2L3BA 3CFDA 5CD5C 4NQVA 1OGTA 1QLRB 2XKSA 3LV3B 32C2B 2Y7QB 4PM1A 5G55A 1PW3A 3WN6A 3P4OB 3U2SA 5JHAA 4NZRL 1MI5A 2FB4L 2HRPH 1IZJA 4CADA 3C09C 1E27B 2DI7A 3GXPA 2APTA 4FLSA 1YEEH 3N0AA 2QPUA 2WLIB 2G5BA 3FTSA 1ASQA 3QEUA 3R18A 4QRTA 3DJSA 4UT7L 5KSAC 1JZDC 3UAJC 4ZUSA 1I7ZA 3DSNB 1M1XB 4HP5A 4ZAKA 4K7PH 5GGQL 3ZDXF 3MBEA 1XTLA 5KSAB 2YPVH 3MJ8A 2FK9A 4HIEB 1QLEH 4XVTL 1Z7JA 2Q8AH 1O75A 2FJSA 5GS1C 1KGXA 5FO2A 1KDJA 4KRMB 4G3YL 5JPMB 3PP3K 4DN3H 1BG9A 3II3A 5K33A 1SXAA 3N1PC 4PJIB 3CBJB 1SVBA 5CEZL 1BREA 5D4JA 3MNZB 4H5SA 2FYYA 4JL1A 3VFUB 1QLFB 1IAOB 4H8VA 1NIFA 1ZWIB 5CWSB 3HG1D 4IM8A 4PBWD 4L5FL 2QKIC 4DP9X 5EU6A 4NLHA 4ABWA 3OG4B 2I07B 3US1A 4FCAA 3NSFA 1KCKA 1YNTF 4X5XB 1CU4L 2QKIB 4HAKA 1PL3A 3KBPA 3S98A 4QJ4B 4U4IA 3KYNA 4C56D 1EHKB 1SJXA 3GHEL 3ABMB 4FF9A 3SQBB 4LP5A 2ZT9C 1DJYA 2X53A 2WYZA 3QWRD 3EO0B 2W65A 1WH0A 4JQIH 3V0FA 1TQBB 3LRMA 3QDJD 4XNZC 1ZV5A 2YD1A 5KS9B 1HC1A 1RIVL 5HJDA 5MEPB 3RUGE 5E1HB 1QOKA 5J12C 1JPFA 1NCBL 2ARJB 3TN0A 4HK0A 3U7WL 1H0DB 4XNZB 4E5XB 4BKLB 1K6QH 4PGBA 4RMWA 1U8JB 5C0DB 5J12B 5FV2A 3V95A 1ZPUA 3NPSC 1KYOJ 3B3IA 3IFPB 3FT3A 1QYGL 2O6PA 4DAGL 1Z5HA 4Q52A 5AW2B 3C8DA 4A2GA 4BCYA 4IOFC 2BVOA 4JQVC 3ZDYB 4HQQL 5CP7B 5C3TA 3VD3A 4FAAB 1V3MA 3T5WA 3LS4L 4CA4A 1KOAA 1OF2A 2BVQB 4OLZL 3WDIA 3M1BA 3VFTB 1A7OH 3WUWB 4P5TD 1M71B 3ZTNH 2QSCH 4M03A 4HU2A 3VW3H 4K8RD 4W93A 1VERA 1SYSA 3E8UL 4UQ3A 3PJSB 2EEFA 1EGJH 5TFSH 2MPVA 1T80A 1ZVSB 3WTTA 4KI1A 1EAOA 1WF5A 1QBML 1XB8A 2DJMA 4NQQA 4QNPE 5F1NA 2HMID 4R7LA 1IKNA 1MY5A 4YAQA 3OV6A 1AC0A 4WK0B 1KV3A 5I0VA 1R17A 3B7RL 4F15B 9CGTA 5GGUA 4KUZH 1IL1A 2D2CC 3P69A 2EDYA 4PB9H 1AAJA 1JPEA 2NUPB 4PI2A 2P5EB 3OHXB 4JDVA 1XZWA 1HINL 4JLRB 4N8VG 1XCTB 3GMPA 2CMRL 2GG1A 3U9UB 4TNVF 1JIBA 3VQ2C 4BQBA 1JNJA 5GRZA 3TT1H 4NYLA 3QYMA 1LM8V 1KG0A 4MX7B 5D7EA 1SZNA 3TIEB 3JBG7 4WW1B 5J89A 1TTFA 4M8VA 3NA9H 3MJ9H 1QW9A 2E4TA 2XFXA 4F27A 2J6EH 2V9UA 5F7MC 1ZTXL 5TPWL 4OBRA 4S2SA 4MA8H 1ROCA 4XCNB 3HPLB 4ZNEA 1CYXA 1F4HA 4YSCA 1PIFA 2ZWLT 3IWUA 5FGSA 3IVKB 4ZUTB 3SGKC 3QJVB 4IMKA 1W80A 1GA2A 1RZKH 4P46A 4WNQA 2WMPA 1QSFD 1BYPA 4HOMA 4G72B 4ZUUA 1QBBA 2HFGH 1JI2A 5CIPH 4MDIA 2AJYL 4ZTPL 5GIRB 1KIQB 2B2XL 2FHBA 2JELL 1MFAH 3J27A 1EFQA 2GIXA 3CN0A 3N42B 5AW4B 3X13A 2CJUH 2A6KA 2WLZA 1PG7W 1AGBB 1OCWH 4HUVA 3QARA 4U6VH 4P4KC 4R90L 2IANB 2G0LA 5DVOA 3QAQA 2FBJH 2VLRD 4M29A 1YHPA 1RIUL 2J5LC 4CN1A 1CBVL 4NCDA 4UT9L 2F74A 4JFQA 2GFBB 1Q38A 2J5LB 3BVNB 1AP2B 1IC5H 1FGVL 1DR9A 3FQXA 1KCLA 3HG1B 2EKSB 2OL3H 3FB6B 3NPZB 4WNJA 4HEPG 5D7IF 1IM3A 1T5KA 5I18L 12E8L 1L9MA 1Z9SA 3SGJC 3TTYA 3EJCA 1NCHA 4B9GA 2VXQL 5IQ9B 3NGBC 1A6WL 2R1WB 2J1XA 1A7NH 4YOKA 4JL2A 2OSLB 4C56B 4OZGE 4ELMF 2X1OA 2KUTA 3NGBB 1EA9C 4YX2H 3CZSA 1A9EA 1GZQA 1CF8H 2E7HA 3DUSA 4MB5A 4UOW0 2IG2L 3ET9F 5J06A 3TA3B 1Z32X 3EUDA 3QDJB 4XNYL 2Z93A 4M8QA 4NB7A 3ZUNC 3IAPA 4PJAA 5IB4B 1KCRH 4YC2C 5GGTH 1ZHBB 4AH2A 5K9QI 3ZE0F 2P28B 3ECBB 1AE6H 1C08A 1GYWA 1YY8B 1W72L 2H9GB 4AL8L 1SPDA 5DJAB 3DA0A 1FO0L 4MS8D 3ZO0A 2VN4A 4ABUA 4P5TC 4X6FB 4HWZB 4W9EC 1YN7A 4K8RC 3IEAA 3IDXL 5BVJA 1A4KA 4LEOA 4UUJA 1I1AA 4FQXA 4BFGA 1J9RA 3D3VE 2LHAA 2CIIB 2HMIC 5GS3A 1QKZH 1RJYB 5LAPA 1MAMH 1SY6A 3U6XA 5GGRA 2LVEA 2DQEH 1J12A 2WYHA 3S3BB 2APWA 3MTRA 4PR5A 3TJEH 2EICA 2WANA 2PTTA 3X11A 4Y16D 2CCWA 4Z7VE 3KG5A 5J3HD 1OT4A 4Z3GA 1U58B 3QZBA 4QXUL 5C0IB 2CO1A 4K94C 4ODHL 4WWOA 2JCCF 1J1XL 3SHSA 4ZQKA 4DKEH 5D1ZB 2XA8H 2QHLA 4X9IA 1BFTA 2ATPA 2WBJB 3OB0H 1P5UA 1QEWB 3FUEA 4NGHL 2IV9A 4N6RB 1Y6KR 4QOKE 4CVXA 2H2PD 1AGCB 5BVPH 3PCYA 1Q0XL 4O9HH 5E2UL 3QR0A 4X6EA 4YVNA 3N40F 3SKNA 2O5ZL 4JZNA 1UWEL 3GSXA 3V6FA 1EANA 4K5NA 3LXBA 2OJEA 3BQUD 4JKWA 1QSFB 5CJQL 4KDWA 2Q10A 2BPBA 2P5WA 1AO7A 3DETD 4RIRA 5IP4A 2EIZB 3QBTB 2AXGA 2D7TH 1WEJH 4DP1X 4NKDA 2ED6A 3MACH 2BY1A 4LZKA 1HHIB 1VADA 3CVHB 1I8IB 4JO8A 1HAUA 1OK8A 4LPTA 1E9OA 4PRIA 2ODHA 3P77A 1JPTH 1U95A 3RVTD 3CIAA 4BIKA 4MHHG 5IGXL 1G7PA 1HCYA 1WS8A 2A9NL 2VLRB 3US9A 2IH1B 4L0YA 3RIFK 4LSQL 2ICWJ 3DVIA 2A4ZA 3GLDA 4LBEA 4X4KA 3SN6N 3EYOB 3GQFA 1EVTC 2H0EA 5E8PB 5IIEA 3NRPA 4LQ1A 3SDDD 3KLHD 1BZ7A 3ZMEA 2B59A 3QNZB 4AG4H 3JV0A 4ZFFB 5FDWA 4HT1L 5FV1L 1WAAE 2WV3A 3PHAA 3PRZA 4RFOL 4JPVH 2I69A 2OQJB 3GSWA 3HPJA 5T3ZH 4NAJA 4QEGA 1VZIA 2YWZA 3OSVA 1IAIM 1KDIA 1QI5A 5DMKA 5C6TL 3ZE1E 5AVWB 3HC4H 1IGJB 5FGCE 4C83A 2HT3D 4IBUA 1GMIA 1I3RB 4JZJB 4KV5F 4P5KA 2PF6A 3EZJB 3WBDA 3ZMRA 1QFHA 3GM0A 3IJEA 3M1CA 4HH9A 4RBPK 3CK0H 4X6DA 4JW3A 1E9PB 1ZA6B 1KIRB 2H41A 2VZ1A 4ZPVB 2YAHA 3NFSH 1QABA 2IQ9L 4HD5A 3LPGA 4WI7A 1DVFB 3VRJB 4MS8C 5IHLB 1WFTA 3FB5B 4H25B 3EIFA 4OKVB 1ECYA 2W94A 5ESQA 4U6YB 1HSAA 1LVEA 1KB9K 3D2TA 1OGSA 4WFEE 3RIKA 3LIZA 3FSOA 3QIUD 1I9JH 1DTUA 1JK8B 4YO0A 4MJ6A 4X98A 2WIIB 3ZTEA 5E5RB 1BVZA 3EOTH 3S3PA 1HS6A 1UH4A 3TPUB 4L0ZA 3O3BB 2CA4A 4HBQA 1NFDA 2WK2A 1FZKA 3V6OC 4U3XA 4ZMLA 3LEXA 1W0WA 4LSTL 3LKQB 1BXAA 4Y16C 2J21A 4ICXA 5EDXA 5J3HC 3EJZD 3GO1L 4L1LA 4D2NA 4DEUA 4XE5B 2Q7NA 4Y16B 5JTWA 2GBUA 4IQHA 3CBRA 3WNPA 3RLSA 4RNRA 3NK4A 1IGFL 5E2WL 3WO4C 1LP9A 1J1PH 1MCQA 4HC1A 1QR1B 1PBYA 4NZUH 3OR7A 5BRZD 2B15A 4ZFOL 5HHOD 2H2PC 4XHQA 3ZZ1A 4MDJA 2YRZA 2VLJB 3HAEB 4H88L 3GRWH 4X8XA 4Z8FL 1ND0A 1BD2D 5IF0B 5C1MB 2IV8A 5E94A 1U30A 4N0FA 3BQUC 2D3JA 3HC0B 2COVD 4ZFQA 1CXFA 3MLPA 3BSZA 5I17B 2W60B 3PHQB 2VM4A 5DRWB 4FNQA 4PV8A 4I1RA 4NBYB 3LZQA 3QQXA 3VFPA 3P30L 5IB1B 3JTTA 3V9EA 4KO9A 1OP4A 4YZFE 3S5LG 1UKQA 4CMHB 5C3LD 5CBEB 2AJUL 4NPYB 3CZGA 2D3LA 5I15H 1E5AA 4Y9BA 4B9YA 4OT1L 4RFNC 1J86A 4UILL 1DVTA 3AQZA 3RVTC 3VB8A 4HJUA 4F1ZA 1SMAA 3DTDA 3S96A 3MOBH 3ZKSD 3QQ3A 4RFNB 1GGIL 4AXWB 3GXFA 4H7VA 3QJFA 3DUUA 3NAAH 2FZ3B 5JIDA 1AMXA 1WIUA 5IJDC 4Y4KA 1OAUL 1QMUA 1R3IL 3G5XA 4XPFL 3RPKA 5HPMA 4OGXL 1ADQH 4OM1L 3KLHC 2UY7B 5EEUA 3DBSA 3NP3A 4HFUH 1C12A 3HZYA 1T21A 1S7SA 3ZR5A 3SDDB 3MUGB 2AV7A 4J2XA 4XVSL 2NNAA 5I19L 3QE5A 1U8HB 4PJ7F 1DBKH 3WJLA 3X1GA 1GKOA 1KZYA 3QHTC 3ESOA 4GRLB 1J5IA 4IHOB 1J18A 3NJJA 5HYJB 4FQIL 3PQYB 1UFUA 1U93A 1YDPA 4NZRH 1HZHL 2FGZA 4R5TA 5LN8A 3TTSA 1XF2A 2FB4H 4FYRA 3AQYA 2PYEA 3H42L 3NEEA 3DHUA 1FSKB 2OMVB 1G9MC 3DYPA 3D9AL 4FQLL 4G9FE 4PWEA 4QHUB 4LCWA 5KUKA 2VN7A 5DHYA 3CZEA 3LKRB 4MNQE 3QUMB 3O6FA 5C0RL 1A02N 3O9WD 1RV6X 4UT7H 3TEXA 4AIOA 1U8QA 4OZ4A 3QIUC 1Y1DA 4P9HL 3MUY1 5FWRA 1HAWA 3Q01A 1A6VL 2ADJA 5GGQH 4JDEA 3HS8A 2D9QB 4D0CB 3HG3A 4AQAB 2DBLL 1JBJA 3IDGA 5HBBA 1G0XA 5AVVB 2UZYB 4G3YH 1RK7A 1CR9L 2MCAA 2WXNA 4JY6B 4JE4B 3AITA 2CUAA 3ARDD 4HAGA 1CN4A 2UYLA 3ZPDA 3DYMA 3OKDB 1XR8B 3DJZA 3DKHA 1IBZA 3P2BA 5CEZH 1FCGA 3P4NA 3VXPA 2HKAA 2P8PB 5IHZB 5IVZB 2DQMA 4PRDB 4QGYA 3I50L 3PFUA 2CPCA 1ZTMA 2F1BA 1DJGA 1YYML 3T2NL 1EUUA 2HP4A 3VD9A 4L5FH 3J8F7 3JWNH 1BFOA 4L4TE 1XCWA 4N90D 3FQRB 3QG6B 2HCZX 1KN2L 2ZP0T 1DDHA 1CFQB 1CU4H 2K6ZA 1ZVNA 1U8PA 3U1SL 2UY6B 4YSAA 3NSYA 3QJUB 2DOCA 3GHEH 2YAMA 1MDAA 4CN6A 2Y5QA 3GMMB 5IMKB 3WJMA 4KTGA 2AMGA 2OMZB 1OSYA 5IREA 1AZRA 2COQA 4WI3A 4W9FC 1TZGL 1LILA 1HHJB 3NIGF 4Q6KA 3ZRCC 1BD2B 4F8TA 1RIVH 1D5MB 2JJTA 5DQJA 5EZJB 3QQ4A 1NCBH 5CZXD 3U7WH 2A73A 3NSCA 4G43B 4ZO8A 1XL4A 4WJ5A 3PWPD 1IJ9A 2HFFA 2UWEF 5IOPB 3LH2L 4NDMB 1QYGH 1CB4A 1ACZA 4DAGH 3GPSA 1WWWX 5T3XE 1J8HB 3WTWA 3BGFB 4HQQH 2GJ6B 4EN2A 3ROOB 3LS4H 5DUJA 5I1IL 4N20A 5C0JA 3B8SA 3QO0A 3P02A 4OLZH 4ZZKA 3HW7A 1KEGL 5FIEA 4QR7A 1X9UA 2E6PA 3L3GA 3MROB 4RFEB 5AOKA 4ZI8A 3E8UH 5AAPA 1B4RA 2F54D 1KCVL 4L3EA 1TVHA 1B90A 3AVEA 2BIHA 5HDWA 2IPKA 2Z31A 5JIHA 5T33L 4UWQB 1QBMH 2WJ7A 1MLCA 4L3CB 2ZXAA 2ZE0A 3FU0A 4YK4B 5HHNB 4P3DA 3I3BA 2W5PA 1Q94A 4FTVA 3CZJA 4MCZA 1X6NA 4NUPA 4NQXA 5IUCA 4PJDA 2VR7A 3FO2B 4PV1C 1WYJA 4QRUB 4PRPA 1HINH 5IW1B 3VMOA 4KKQA 5AUMB 1FA4A 4MNGB 2AHIA 4XB7A 2CMRH 5IQMA 1O6SA 4LU5L 2EDFA 4I88A 5CZVL 1JGLL 4N3TA 4AM0Q 1OGAD 1R5IA 4WHTB 5KUMA 2CJ3A 4QHKJ 4KJPC 2WCSA 1ZTXH 5TPWH 3KXFD 2YLHA 4NKOA 4XMVA 2DJSA 3QXDA 4XMLL 3BEWA 1I8MA 1HCVA 5DEFA 5DJ2B 1SDDA 1CUOA 4PJXB 3SPJA 5IB5A 3SDAD 4WENB 1QPXA 4AQ1C 1NEPA 2R29L 4XXCA 5F3HB 5CCGE 3MNDA 3WMQA 2ZYHA 2WN2A 2XU9A 2ENJA 1FFPB 5LGJA 2DS4A 3O9WB 5AAMA 5ENWA 5AVYB 4MQ7B 5BS0E 3JV4A 2AJYH 4ZTPH 1CXHA 2B2XH 4U1JA 1RHFA 3W9DB 2JELH 4ZXBD 4AJYV 2XVLA 1E2ZA 1GSMA 3ARDC 1RZIB 1YG9A 2OYPA 1RFDL 1AYOA 1JF1B 5I1GL 1EZSA 2CO4A 2H3KA 4GO9A 3DPBA 1F4WL 4R90H 3AG2B 3BCFA 1WBYB 5T8IA 1D6EB 1O6TA 1BQHA 4WWKC 5HJGA 3TBVA 4L4VD 1RIUH 3WY1A 1IEBB 1P2CB 3ABZA 3D05A 1W16A 3GS7A 3GIVA 2QVMA 3MR9B 5J6GB 1CBVH 1HNGA 2C9VA 5DC0A 2P46B 3EH1A 4JRLA 2J2ZB 4UT9H 2GBTA 2VDNB 3SDCA 5HHPA 3BRFA 4Y88A 2V3EA 3ASOB 3ZY7A 3UDWA 5FO8A 1PKQE 1Y0LB 4I2XB 12E8H 4XP9L 3HZKA 1XEDA 5I18H 1SNRA 1DP0A 4WUKL 4KKZA 5IQ7L 3FT2A 3B8YA 3KNBB 5E2TL 2VXQH 1ZLVK 3VTTA 1BEXA 1L9PA 4LCCA 1A6WH 4LLQA 4V2CB 3W0WE 2IOIA 4MVBD 3QO1A 5BCAA 5M95B 2ID5A 2AI0L 2KDGA 3SZKC 4JNXA 2YBGA 3AAZB 1SDYA 4N5UA 2EH7L 1PS3A 2IG2H 4LRIC 4JEGB 4PRHD 5EU3B 5CZXC 4YHNB 4XNYH 1XGQB 4J3BA 1A4CA 2VITA 2XC8A 4JKMA 1EXUB 3HTLX 5ICUA 4KH2A 5AYUL 2A9DA 2EEBA 4UIMA 4DKDC 5HPOA 5E8EB 4BK5C 4RMUA 2J8UA 1ZHLB 1QG3A 3Q1SL 1NA8A 1BBJA 4LKXA 3RTQA 4S0HA 4QY8B 4RQQB 1SMOA 1W72H 4Y1AB 4AL8H 4IIQC 1CD8A 4K4KA 1FO0H 3G6JB 2CDFB 3CDZA 3JWNG 3QISA 3LKOA 3U0TB 1TFHA 4IIQB 5HDOA 4NUMA 3OPZL 2OV0A 3IDXH 4QAMB 2YN3A 4KNQA 3O0RL 3VI4E 1ED3A 1G9HA 3G9AB 1YC7A 1CCZA 3TBYA 4DP5X 2XLLA 2K9FB 4YLBA 3HHSA 4AEEA 4WHYG 4O2EB 5E00A 5F7WC 5F88B 2YPKA 5C0AB 2WVVB 4PWJA 1RZKC 2HFEB 1YVLA 1SXBA 4WU5B 2CLZB 2VW6A 1NDGB 4NC1C 4TQIA 3LSOA 4LEXL 2AV1B 2WO2B 4Z6AT 2CJTA 2HKFL 2VJXA 4QXUH 4ODHH 2PR4L 2MQ0A 1F4AA 4KTEL 1W6LA 4N2GA 2CUMA 1J1XH 1VCBC 2GY5A 1YMHB 3DHMA 5T1KD 1G6RB 2GW5A 2DQCL 3TCLA 4NGHH 3REVB 1K72A 4MJHA 4Y4FD 4DVRL 5FUCE 3PL6A 2X0VA 4LEBA 5FYJL 1Q0XH 4WKZA 3KXFB 5E2UH 1SXZA 3LH9A 5EF2A 3AJ7A 3SDAC 1OAXL 4UNVA 2NRDA 4UQBA 5ECGA 2O5ZH 1UWEH 3DGCR 4B5ZA 4QRAA 1KBBA 4FLRA 7PCYA 3F6JA 4YBLB 5GSRB 3F7PC 5CJQH 1CI3M 2XJKA 5L8KB 2RALA 4W1TA 4Z76A 5TQ0L 3UPRB 1XV8A 4XOCA 3OM3B 3MCYA 2G3XA 1NEZA 4ZXBC 2X2HA 1M7UA 1CMOA 1R3KB 3EGSB 3GPEA 2E5EA 3VSVA 2FJFA 4PJEB 2E6JA 4TRPL 2AEIT 1ES0B 2YXWA 1FYTA 1BVNT 5T3ZD 2WD0A 4LKCA 2R1YA 1ESOA 3F6IA 3IGFA 1MJJB 4U1GB 4XC3L 4BHUI 1KENL 3L45A 3W39A 1EIBA 4F24A 5IGXH 4ODXB 2A9NH 3KYMA 4PJGA 4PTTB 5AG9A 2WXJA 4L4VB 2FHFA 4XZ4A 5IJVB 4LSQH 2CO3A 3BO8A 2VWEC 3FO9A 4FG2A 4MMZA 4EXKA 2FQDA 2Y22A 2IAAC 3FT1A 3MI6A 1TZHA 5TDOB 1N3NB 1UJ3C 1RU9L 1YEWA 3DOSA 2WB7A 1R4XA 3N2JA 1TMCB 1P4LA 4HT1H 3GMOA 2PNDA 2EXTA 1CTOA 4PIBA 4RFOH 1UJ3B 3QVAA 2FJGB 4U1HB 1BCIA 3MRJB 2OMTA 2A5UA 5D2NB 1T7WA 2AXWA 5C6TH 1EMTL 3OTTA 4FGMA 4ZMWA 5KSVA 2EKJA 3NACL 4ZS6D 1OB0A 3FQNB 3ZTCC 3H3BC 4OFVA 3CHRA 3UBXG 4WWNA 3D0VA 2NXZD 5JHDB 2VR5A 2YBRA 3FOMB 4H40A 4GI9A 3K71B 4QUOA 5EBWB 1MQKL 3FCBA 4JRFA 2PP7A 2IQ9H 5FLVA 3MQIA 4ES8A 2DRUA 3DRTA 1GJIA 3KHQA 4XN8A 4EDXA 4QRRA 4KVNL 2IF7A 2JXMB 2BS9A 1NC2A 1JGDA 3KBFA 3CSTA 1AG0A 4GUQA 3QULA 4QYOB 4YNYB 1UOVA 1SQ2N 4DGUA 1A22B 5A1AA 2IIJA 1UGNA 3EBAA 4OJAA 4KI5E 3LQAL 2P24B 3MRRA 5D6CA 3AT9A 1E5YA 1E4XL 4HWNA 4HGWB 1WHOA 1BAWA 3CSYA 4F2ME 2KHAA 2ZD0A 2UX7A 3HUJA 4BKSC 3QG7L 4LSTH 4NJ9L 4XH2A 4YUEL 2K4WA 1CT8B 1ULVA 4MQSB 5T1LB 4KAQL 2FX9L 1YNTB 3RNKA 3GO1H 3GUTB 1FGNL 5EUOE 3DXAE 4A68A 3M17A 1KFAL 1JMXA 2DWXA 2QR0B 3H9HA 2ESVA 2GUOA 5AWNL 4JGNA 5LCVL 4I77L 1IGFH 1ZE3H 2EDMA 4F20A 3C08L 5E2WH 5LNDA 4I8DA 4YPJA 4AQZA 1SY6L 3K2MC 5I6XC 5LGKA 4MLSA 4ORGB 5D2LF 5T1KB 1JV2B 3LKPA 4OZIF 4XBGB 4AJVA 1H3GA 5IVXE 3L4YA 4Z77B 1OF0A 4Y4FB 2KZKA 5CR8A 4H88H 4XXWA 1KBVA 2VTFA 4PYHA 5IMMA 4Z8FH 4WJKB 3JVFC 2G5UA 2H2SD 2OXHA 3MOAL 4PJ6A 4ZW5A 3IS1X 2AITA 4HS6A 2VN6A 2G2RA 2VJ0A 4NAMA 4PJFA 3SSGA 4U1LA 2WY3B 1AQKL 3UTZA 2AEQL 1WG3A 4M62H 3TNNB 3F58L 5I0YA 3NJFA 1UM4L 4L3FA 3P30H 5E99L 3B7UX 5DWPA 3DMMB 4ESKA 4NBZB 2GPZA 1IBBA 4GRWE 2CK0L 2AJUH 2V2TB 3HLAA 4PJBE 3QEHB 3D18B 2DWYA 1D6VL 2AZAA 3G6AA 3PGFL 4OT1H 5DLML 4UILH 4LLAA 4HU8A 4AUUA 1WSST 4G70B 3C2AL 1ITCA 2JNZA 4KK5D 3AADB 1GGIH 3KPQB 4TV3A 3L9YA 2R23B 1IGCL 1V3JA 4GIPD 3V5HA 5GGVY 1OAUH 5C0EA 1O5DT 1AC6A 1R3IH 1Z1WA 2BC4A 4P48A 2VZSA 4XPFH 5D5MA 1AVAA 5FM5M 4NS0A 4A2DA 4OGXH 4OM1H 1INQA 3SO3C 3ME0A 4YHIA 1G7JB 3T4AB 2Q1EA 3ULUL 4OGAD 4KC3B 3TJPA 4PP2A 5ABAA 1L0PA 1QSEE 3CQFA 1MCCA 4XVSH 4YDZA 3STZA 5I19H 1UATA 2NW3B 5D9SA 3JYCA 1EZUA 4JFDE 3EBGA 1T6BX 3HHMA 2BWDA 1T83C 4XAKE 1RMFL 5D55A 5IK3B 3TV3L 5F7LB 8FABA 5ID0B 5AZ2L 2WXPA 1ZSDB 3NEOA 4ZS6C 4RWYL 1PGRB 2JK5A 3IM1A 4FQIH 1A8JH 2EDXA 4KXZI 4LF3A 1HZHH 3F62A 4FERA 2NXZC 3C6LD 3H42H 4S10A 1KPVA 2BP5M 3H9SD 2Z7UA 3RAJL 4FQLH 3D9AH 4S1RL 1ETZB 3V5KB 2XXFA 3HRZA 1NGWB 8CGTA 5CEZD 1A1OB 2DB8A 4UQCA 4E9YA 1SYVA 2PYFB 4LPYA 3ZSTA 3AGVA 5FA3B 1MHEA 2E9IA 5MEQA 1FBIL 4N8UA 5C0RH 1KZQA 2B20A 3TBSA 4KQ0A 3ESMA 4P9HH 2BVYA 2JMRA 4EZMA 1A6VH 2HSIA 4LLWB 5BZDB 4PAZA 3B2VL 1MCEA 4XO4A 3G7TA 2DBLH 5FF6B 3S48A 2P42B 5B39G 1JZ2A 3VYOA 4WO4B 4FG6D 1H6TA 1CR9H 4M4RB 2HTKC 5I8EA 3QJTB 4K7PY 5ISZD 2YSSB 5F7DA 1MCWM 4JREC 3PWJA 4TQEL 1E6OL 3QI9D 4ZBJA 3VCLB 1HILB 5D7IB 2OTUA 4WHCA 1YMME 2C1PA 3LIZL 1CTNA 3I85A 5HHMD 4LPVA 5C09E 5HYEA 4R9HA 5IHUL 1LWJA 4AGNA 1MZYA 1OD9A 3I50H 3AUWB 1YYMH 5E6UB 5FO7A 3T2NH 1P84J 3EOYG 4ELMB 5H35A 1JJUA 1MCPL 3ILDA 2ZOUA 1CE1L 3FU3A 5C9JB 1KN2H 1X7QB 3C5ZD 5ITBL 5IMOB 3U1SH 4JHZA 2ZUYA 3GJEB 4J3TA 4LT7A 5D6DC 2APVA 3GDCA 4ZO9A 2H0JA 5H94B 1NDTA 4O02B 4G59C 4AK2A 1P4IL 1BJ8A 1GGBL 2H2SC 3K3QA 4Z7UA 4I5BB 4B9KC 2V2WA 4JE0A 1XH2A 3IFNL 1TZGH 3IJ8A 3VDAA 3ZE0B 4X9GA 2V3FA 3MCKA 3FOLB 3GEFA 4HC1L 3D2UD 3U0PB 4MA7L 4G5AA 4NENA 5SWSE 3FFCA 3SGEI 3BJLA 4MMYA 2NDFA 2Z4TA 4AW4A 2IH3B 4JQXC 5I24A 3LH2H 3FT9A 4N2DA 2O61B 4FRWA 1JWMB 5DS8B 4DO6A 5J13B 1WQVT 3GC3A 1H5BB 1T0NA 1WUZA 1G7QB 1NIEA 1R24A 4FULA 2ICEB 5IQLA 5I1IH 1FIEA 4NQDA 3Q3GA 1XL6A 4KK5C 1LE5A 3BSZL 3U7YL 1KEGH 3D1MC 3L4WA 4LB8A 1FQ9C 4MJ2A 2PXYD 1PF3A 3BKCL 1NJ9B 4M6ML 5EULV 5KVDL 3VWKA 4F8NA 3IE9A 3OB0K 3HNVL 5JZ7D 2AJZB 3QDGD 1KCVH 1LXMA 4IU2B 2WBWB 5EFIA