2WKOA

Structure of metal loaded pathogenic sod1 mutant g93a.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDAVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Structural and Biophysical Properties of Metal-Free Pathogenic Sod1 Mutants A4V and G93A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2wkoA00
1PU0A 1CB4A 1F18A 1L3NA 1BA9A 2Z7ZA 1B4LA 2NNXA 1EJ8A 1JK9A 1Z9NA 1OZUA 2E46A 2GBVA 1YSOA 3KH4A 2WZ6A 4MCMA 1N19A 1SXNA 2WYTA 5KBMA 5KBKA 2E47A 2WWOA 1U3NA 1SXCA 3HFFA 1PTZA 5CU9A 3QQDB 1E9QA 1ESOA 4N3UA 1OAJA 2Z7WA 4A7VA 2R27A 1F1GA 1S4IA 3L9YA 1SXBA 3GZPA 1E9PA 1CBJA 3LTVA 2ZKYA 1P1VA 4N3TA 2C9SA 2WZ5A 3HOGA 5KBLA 4U4IA 4BCZA 1SRDA 1JCVA 1E9OB 1SOSA 1TO5A 2APSA 2AEOA 2AQTA 1N18A 2ZOWA 4MCNA 3MNDA 2C9VA 3SODB 4A7GA 2Z7UA 3KM1A 3RE0A 3GTTA 1B4TA 1PZSA 1UXLA 2AQSA 3H2QA 3T5WA 2XJLA 1TO4A 3KBEA 1F1AA 1OALA 3QQDA 1UXMA 2AQNA 1RK7A 3K91A 2K4WA 1BZOA 4A7SA 1SDAB 1XSOA 4A7UA 1AZVA 1SXZA 2ZKXA 4BD4A 4OH2A 2WKOA 4BCYA 2JCWA 3KM2A 1YAZA 1QUPA 2AQPA 3HW7A 4A7QA 3CQPA 1IBHA 1IBDA 3GQFA 2AQQA 1SDYA 2XJKA 1IBBA 3KBFA 4L05A 2AQRA 1XTMA 2V0AA 1DO5A 1JK9B 1KMGA 1IB5A 3ECWA 3PU7A 2C9UA 4A7GF 1YAIA 2VR6A 1E9OA 4OJAA 3ECVA 2AF2A 1MFMA 1SPDA 1Q0EA 2GBUA 1DSWA 1E9QB 3CE1A 2Q2LA 2GBTA 3F7LA 3MKGA 1Z9PA 4FF9A 1EQWA 2SODB 4A7TA 3F7KA 2WWNA 3KH3A 3CQQA 1E9PB 3GZOA 2WKOF 3GTVA 1F1DA 2VR7A 1IBFA 2Z7YA 2LU5A 3ECUA 3H2PA 1OZTG 2WYZA 1SXSA 1COBA 1HL5A 2ZKWA 1FUNA 2VR8A 1HL4A 1OEZW 2JLPA 1SXAA 3L9EA 3S0PA 2WZ0A 1XTLA 3GZQA 4B3EA
chains in the Genus database with same CATH superfamily
3U7WH 4NZUL 4HH8A 3HG2A 4MXVF 4MLSA 3F5WA 2BW5A 4M7JH 1QSZA 1KPVA 3VGEA 1N5AA 3U0TA 3MTXA 3QDJA 1T03L 1JZDC 2WV3A 3QULB 4BFKA 1KC5L 1KOAA 2BRRL 1LILA 1TJGL 4I89A 4JZJB 5F7FA 1HJCA 3B7UX 3QORD 4OUOA 5LAXB 1IE5A 3QZBA 2JTYA 1NFAA 3D4CA 1S4IA 2C9AA 5AW6B 4AL8H 3FU7A 3C5JB 4OD1L 5DSCA 4O2CA 5IW1B 4PRID 4G8EB 4MMZB 1I4FB 4M00A 3VM7A 1ZHNA 4X4ZA 1FA4A 4HISA 1DQIA 3ZT6A 3O3EB 2DWDB 4WO4C 4CMHC 2EYTB 2XG4A 3OLIA 4QOKD 1OE2A 2JCCE 5JNYA 4PJ6A 1M6OA 4PJXB 4UOJA 3UTSB 4KK8D 1WBYA 4FXLA 1XD1A 2W9EL 3FH5A 3NPSC 1DBML 3X13B 3OPUA 1FN4B 1F56A 1HKFA 1G9MH 3O2DL 4FXTA 4XVUD 1QFUL 3DX8A 3HB3D 4PJBF 4ONGH 4TNWF 3PIQB 1XR9A 3SYQA 3VXQA 3ZQ9A 1NCAH 4Z7NE 3BVNB 4W9DC 2LFEA 4D8PB 2I9TA 1E5BA 2FLBT 1UWXK 4I9WD 1FLRH 4G6FB 4P48A 1DQML 4R7VA 3MFGB 1GZQA 5EPMB 4C56B 4JVPA 4A7UA 4CVXB 2EZ0C 2IWEA 3HPLB 3KHQA 4O2EB 1U4FA 3KW7A 1HAWA 5JHDA 5AW9B 2NXZD 2ERJB 2IBBA 3NZ8A 5T1KA 1HVXA 1JXDA 4HIJA 5E24E 1MRCH 1S5IH 1UYWL 3WIHL 2AV1A 4L05A 2DQEH 1R1CA 1CQKA 2V6HA 4ZYKA 1N6VA 1M9SA 2BP0A 4AEFA 4KOBA 1Y6KR 3PV7A 4A2LA 5JQIB 1TQBC 5A6MA 1QBML 1D5BA 2NTFA 4WTQA 4TLSA 2DQTH 4PCKA 2CGRL 3SD2A 1OHZA 2O6PA 2P5EA 3AT9A 3ZN6A 1JNJA 2JB6A 3HRZA 2K6ZA 3UJJL 1VSCA 4NQVA 3LB6D 1EQWA 4CUCA 5DS8B 1S7SB 5KSAA 3B7SA 3UCQA 4K2UH 1L6XA 2YMXL 2NZ1A 3K2MC 5HDLA 4ZAKD 1VFBA 1PY9A 3PRZA 1WLHA 3LQAC 3G5VB 4HUMB 3MRPA 1AGDA 2RHEA 5JXEC 4JEGB 4U1IB 2AK4E 2NSMA 2CO6A 4BRVA 3GSVB 5KYYB 4DO4A 3KPNB 4YDLB 5AW1B 5D1QE 3HKZA 2R0LH 4UQ9A 3GO1L 3LH9A 1YNTB 1XGTB 5J6HB 3BEVB 3TYGH 4BIKA 4F9LA 1NIAA 2AK1L 1MRDL 2MTPA 1HN1A 3CXDH 1TPXB 4ZOBA 5ECGA 3SOTA 4G72B 3VFUA 4GKOA 5CXPA 4ZX3A 5KVFL 2FATH 3ARDB 4Y19A 3ZHKA 2FBRA 3ZU8A 4JHWH 2NY0B 1SY6H 4M6NL 4R4FH 4AQOA 6PAZA 2XG5A 3GXMA 1U4EA 3LDBC 2YK1L 2MCAA 1KJ2B 1J86A 3NRFA 2NY3B 2EACA 4JBSA 4M29A 4DP1X 1IRAY 2NRDA 2OFQA 2OZ4L 5F8QC 1BXVA 5MEQA 1HEJC 5F72S 1IVLA 1G6RH 5CLZA 3C8HA 3EJYD 3WIAA 2MCMA 2ADGA 3TCLA 3SGEI 5D7LA 3D4YA 3GSNA 3C5ZD 3KHOA 1P6FA 5EIIB 4GW5A 1LQBC 3FO2A 4OIFA 3VWKC 1UWGL 3W9DB 1M7DB 3AVEA 2IIJA 2X2JA 2PKDA 3ISYA 3P4LA 4YHMH 3APMA 1N2RB 3DSNA 3PHSA 4NPYB 4C8XA 3SDXF 5I19H 2BHUA 4NXKA 1C5BL 1IFHH 2DICA 3EYOA 4ADJA 3PJSA 1PLBA 1WZLA 3RKDC 5F7LB 1PAZA 4R84A 4GIPD 4NUMA 4UZGA 2CDFA 4G7VH 5B8CB 1YECL 1A6TB 1MQKL 1FNFA 1NCHA 4FQJH 4XO8A 5FX3A 3G04A 4HJ1A 3CFJB 5T33L 5FWRA 2BDNH 5C8JB 4HKBB 4U3HA 1IJNA 2WQUA 3MXWL 1IFRA 4CSSA 3NZSA 4YUEL 1KB5A 5FYKH 3FB6A 4DGYL 3KPRE 1R0AL 1QRND 4K71B 3VH8B 2ITCA 1MFDL 1K5NB 1JP5A 2BSEA 4PUBH 2IGTA 1YEEH 4JDEB 1JDCA 5C6TL 1V7MH 3A4DA 2D9CA 3LNGA 3QR1A 4MQ7B 5ESQA 3RX8A 4KY2A 3VDCA 2FZ3A 3SJVA 4RGOH 4Y2OA 3OLGA 1I1CA 4ICXA 2Q76B 1BQKA 3MMEA 3WGUB 3TWYA 4DZ8B 1JPFA 2WXFA 3FHEA 4UAOC 1UADC 1JZ8A 1UASA 4R6UA 2G2NA 1HHJA 5I5RA 3BVTA 2E0PA 5F97E 2VZTA 2R1YA 3L4ZA 4WFHD 5IMLB 3IKKA 3Q2NA 4IM8A 1Z5YD 3SN6N 1UD6A 1N26A 3H9SA 1FZKA 4Z7WA 2BNQB 4IHBA 2WYZA 4PS3A 3ZUCA 3N9GL 3ZE0B 1JPTL 3N06B 3QNYB 4QMEA 3QQ4B 1T7VA 3PL6C 5DT1L 2BOBA 2X70B 1JG9A 2GAZB 3F64A 4OZHA 3L9RB 4YE4H 1B0GA 1CMOA 1AGFB 5EC2A 1MCIA 2X9XA 3QIUD 4D0DA 2WUCH 1JGLH 1GYWA 2W0LA 3AQZA 3LN4B 1SLUA 4DN4L 3VSUA 3ZKQD 1XMWA 3FQWA 5B7FA 2P8LB 2FEEL 2AAAA 2KPWA 2ZKMX 2O5XH 4ZS7H 1H9DA 3BQUD 2Y5TA 1AANA 2F7OA 1T1ZA 1W72L 4BQBA 3FT4B 3HI1A 3MXVL 1NH6A 3UTZB 2C7FA 4IRJC 4JR9H 1TTBA 2DWTA 4DKEL 1JUFB 1AR1C 3OKNA 3RWIB 1E9PA 1X5ZA 2RALA 4KUZH 1YRKA 3GUFA 4U1SA 4A6YA 4WW2B 1PIGA 1Z9SB 5BUGA 3COOA 3HS8A 4HP5A 4Y16A 5IJVA 2C34A 12E8H 1HKLL 1IC0A 1TZAA 3PWPE 1WFTA 4HJSA 5F3HB 1KJ3L 1G7LB 3O45B 2NY1C 2SEBB 2DQIL 4JKKA 4YDIH 2ENJA 3ZDYE 3NACL 3M7FB 4HV8A 5DI8A 3TBVB 5EZJA 3T5WA 3RQ3A 1MCOL 4YO0A 3L5XL 3NIGE 3O0LA 1ZANL 4CGTA 4FFWC 1YY9C 5C08B 3KGSA 5IV2A 1UXMA 3QUXB 1JCKA 1IV8A 1R9FA 5GZNC 4YWGL 2OL3H 3BXNB 1ETZA 3N41F 4PYGA 4EJ1C 2J21A 4Q9BA 5T3XD 4PJDA 1IFGA 4JPIA 8PAZA 1S9KC 3VDAA 4L0ZA 5LBVA 4XN2A 2OMZB 3NRPA 3WNPA 3OKDA 2PPCA 1DJYA 3IDMA 2VLLA 1A1OA 2DF3A 2ZXWB 1X7QA 4HMCA 4PJCF 1QKZL 1TETL 5E4IA 1I7RA 3HNTH 2B20A 3IDNA 2O1AA 4IJ3B 5L2JA 3HE7B 5E1AA 2UWEE 7FABL 1KYUA 1WDAA 1D5IH 4X7SH 3TBBA 1FI8C 1WF5A 2HXAA 2YAEA 4JGMA 4HHAA 1YEKH 5IUCA 4BA8A 4YBLC 1MLCA 2VGLM 2WXGA 4JQIA 5CLWA 1RMFL 5LDUA 1IE4A 1QI3A 3LX9A 4NJ9H 4YVUA 5JIIA 3VXUE 5BRZE 4HLZG 5I16A 2LQRA 2YWYA 4BM7A 4PJEE 2HTKD 3OV6A 1IGFH 2IOIA 2HCZX 4KXCA 4N2DA 2BRQA 3BKMH 4HZLB 1AACA 5IEHA 1QBLH 4GG8B 6FABL 1N19A 2Z0UA 3ZZLA 4DKFH 1OSZA 1SUJA 1JZ5A 3MV7D 2FEEI 3HZYB 2EIMB 3OZ9L 5D1XB 4OFIA 2DYPB 5AG9A 3BAYA 1GYVA 1MI5E 3RA7L 3T2QA 3GKWL 1QZNA 2F54E 2ZWZA 4J3OG 4QO1A 5F7EH 3QDHA 3V6FB 3WTYA 2CWRA 5IOPB 4EXKA 4U7SA 4QI3A 4BSVB 3CXFA 2DQ6A 2WXMA 4YR6B 4EZJA 2Q8AH 3F8UB 5EOQL 1EXGA 3KYMA 2AJUL 2D7NA 4XPTL 3S2CA 4AYSA 1G0YR 4Z95H 4JZNB 5GGRB 4WGKA 4L8DA 1XQ4A 1A7NH 4R96A 4U6XA 2CK0H 1DN0B 1OY3B 2E9BA 3FRPG 3MNWB 1KBPA 2XZCH 1UJ3C 4MAUL 4MRBA 2HJLA 2O93L 5I18H 3MGOB 1C08B 2W9DL 2J71A 2OTWB 2OZNA 1M2VA 1TCRB 2XN0A 1L9OA 1DHKA 3UMNA 2BZ7A 4YXLH 3U4BH 5L7XH 3SOBH 1IEBA 5LKNA 2ATKB 5ACMA 1O6SA 1U33A 3TF7C 1MIML 4UTBA 1JV2B 3RBGA 2NNFA 1DJSA 4OJDH 3TO2B 2XTJB 3RURA 2O6DA 2K0RA 2UYLA 2XV2A 3HHMA 4LNRA 2XN9A 4POYA 1T1WB 3THML 3GMMA 5H8DA 5DHVA 2OR7A 3CQPA 4HCRH 4MJ2A 2YEZA 4P46C 5DMIL 4UOW0 2H8PB 1KZQA 1RP8A 3SCMC 3ZLQC 1ODAA 2HRPL 3CDZB 5D4JA 3CHOA 1BSIA 1T0MA 3W5MA 4PJBB 3T3PB 2J4WL 1BVLA 1B4JL 2FGZA 2BPBA 3JBG7 3DHMA 5E8DH 1AS8A 2I5YL 4GXVL 4KGLA 1AXSB 2QVMA 3VW3L 4L8BA 3VXNB 5I30L 1MJ7L 3KH3A 3WL9B 2Z64C 1U8IB 2VLRA 2BOCB 4PY7A 3TS8A 3JXAA 3VQ1C 1FNHA 4KGJA 2JB5L 1F42A 4U33A 5T3XL 2Y07H 3BISA 4NERA 3BJLA 2BSTA 2X10A 1NAKL 5FGBC 5GRYA 3S36L 1S7RB 2BFVL 3QDMB 1Q1JH 2DWEB 1T4WA 4F8NA 3H1ZA 1NOAA 4DAGL 4OJYA 4G5ZH 4FQIL 1ZT1B 3QZWA 1U2YA 4RGMB 4B0MB 1AD0A 4X7DC 1PU0A 5LJYH 2F8VA 5F1NA 4TRPL 4CU7A 4I0PB 1UZGA 4M1GL 4XC3L 4ZUUA 5SX4I 1E27B 4NWTL 2JIXD 4AENA 4JVWA 4AM0B 4X7CC 4NO2B 5JPMA 1HL8A 3GRWA 1EEUA 4MZ3A 3HHRB 2PP7A 1KTJA 2MMXA 1KGWA 5IM7A 1KEGL 1VF5C 4Q4EA 1FC1A 5LNEA 4KI5E 3T4AA 3GJFA 1O0VA 1B90A 1X5KA 4LRIC 1O9VA 5C07A 2NX5D 3ARVA 4DP5X 3N91A 2IH8A 1HDMB 3DBXB 4QHNA 1FVEB 3ARFA 5I24A 4UI2A 3VGAC 5ISZB 3L3GA 3R1GH 4G6JL 4GI6A 5I0XA 5IHUL 3EGSA 3GS0A 4R7DB 4NQEE 3HN8A 3L7FB 4A2MA 5EFIA 1MPAL 3ME0B 1F4YL 2Z31A 4ODHH 1OALA 4PI0A 5F3BA 1M7UA 1HHHB 4Y4KC 4B9PA 4DETA 4WWOA 1BZ8A 3CLWA 3LVTA 2IO5A 4NZUH 3ZHLA 1UZ6E 2LT9A 1X6NA 3RRQA 2Y1AA 2ZX6A 4WFEE 1T83C 4QRTA 1T03H 3KPNA 2QADD 3G5XB 3V4PB 2PXYD 1Q9OA 4XMWA 1IBHA 1KC5H 4L9LB 1CYWA 3S8WA 2BRRH 5TTRA 3P11L 5GXBB 3N5AA 2FX8H 3ES6B 3B3IB 4MD4A 1BQHB 3WKNA 1XCWA 4RMUA 4CC1A 1YO4A 2VLJA 3OR6B 4YDVB 3NK3A 4UYPA 4WEMB 1AMYA 4XO3A 3W0WA 4MSWB 3BSZL 1CYGA 1TQSA 1MHEB 4OD1H 3BZ4B 3NSXA 1CDUA 3I6LE 4RFNC 3SDXB 4OZGE 2IALA 4JRWA 1GW6A 2ICEC 4YS4A 1KJ2A 2WLIA 1XDTT 4IOSD 3SGEH 5BVJB 4ZW3A 2B0SH 4E41A 4HWZB 1KBWA 3NZHL 4PWJA 4ZXBC 3V4UL 4ZJ9A 3U79A 2ZWLT 1AOZA 2W9EH 4HT1L 1SOQA 2ZWKA 4KJYA 1DBMH 4WI4A 4LKCB 4CN6A 4LEOB 1ADQA 3BAXA 4H44C 3LB6C 1QFUH 2CDGB 3FQUB 4WWKD 5F6IC 3LSOB 3O6ML 1BAGA 1F18A 3QSKB 4ZAKC 2VDPL 4HU8A 5AOZA 1QSFE 1A21A 4Z77B 1TG8A 1E5UI 2ZSVA 5D5ME 4N0RA 3MCYA 4OLUL 4MDJB 5T5NF 4NPYA 5K9OA 4WHDA 5DVOA 4FG2A 4JFXA 4ZFGL 1ZTXE 3HZVB 1MNNA 3FCGA 2HG0A 4UV4L 2D7OA 2FIKA 2P52A 2R0ZL 3DETD 3KLAB 3M8OL 4OM1L 4UUJB 1TNNA 4XAKD 5DYOA 4U2ZA 1D5XA 3FTWA 5AG8A 5EEVA 4PS7A 3KXFB 1JTTA 1KJMA 3ILQD 4NRZB 4DTGL 3E3QE 2YA2A 1IC5H 3AXLB 4W9ZA 2QLVB 1V5JA 3VE0B 4G6ML 3W5NA 4PJHF 2WK2A 3HIZA 4XO4A 4MXWH 4MJ5A 3RU8L 1IGJB 3AREC 3CUPB 4HPYH 3VGHA 3UJJH 1OCCB 5IUSA 4P2RA 4MDIA 4P2OD 1MCNA 1P6WA 1OT1A 3VSVA 5A3ID 2YMXH 5HDRA 5F7DA 3V0WL 3KM1A 5INCA 3OKMA 2Y6TE 5I28A 3ULUD 3L08A 3NJNA 1FVCB 1FIEA 3KNBA 1FFOB 4Z7WF 2J20A 3RDJA 2VYRE 2XYBA 1IM9B 1ZA6A 1Q94A 2Y6SD 5DZOA 5DD0H 5J5EA 1L9PA 5BW7A 4OD2A 2XCMC 3DOSA 4CMHB 4XOCA 3WFCL 2CK2A 2IAMD 4G8IA 5CCKL 3WEOA 4N9OB 1MREL 4GFXA 1KUMA 2OW6A 5AKVA 4YSRA 2H0FA 5KVFH 4NEHB 5LN8A 1NC2B 2ZIDA 1SEBA 5JORA 4LCWE 4QHMA 3EBAA 3E8VA 5TK4A 1TZOA 2JQZA 4M6NH 4NP9A 3OHXC 2YK1H 4QNPF 1T04A 1ZKAA 4JFFA 3L1EA 1ILSA 3MC0A 2P4AB 5E8EB 1EO8L 2DB8A 2OZ4H 2Q7NA 4ODUB 3G5ZB 1DVFA 2GPZA 3RWGB 5IHZB 3D30A 2YS4A 4TVPE 3T0XA 5EU3A 3UTZA 3L5JA 4Y5YB 4YLQT 2OXHB 3O4OC 3IN0A 3QWRD 3ML9A 1ZLVH 2ZUYA 3Q8BA 4F7CA 1H6FA 1E28B 1DQVA 3B83A 3F04A 4PCSA 3VVVA 1ZLSL 4P9HL 1NFIA 2R29A 3AU1B 4KTDL 4X0NA 2IPTH 4I77L 4WV1C 1UWGH 3K6OA 1TQBB 4WNQA 2F18A 1ACXA 3CHXA 3VRIB 3G7TA 4N20A 2WO2B 2D0HA 2J88L 5CIPH 1I3UA 5BS0D 3X1BA 3I84A 1Y18A 3QUKA 3VXRE 3CU1A 4OF0A 3LKRA 1IC7L 5FO8A 3S5LB 5HYIA 2EDXA 5I26A 3TZVC 3CDGA 3RAJL 4AGQA 2Z93B 4K9EC 1T89A 3RWDA 5T33H 2R39A 4GRLA 4JM2C 4PJ8A 4NN5B 2FHCA 3CK0L 3A6CH 4QR7A 4R0LC 4YUEH 1LO5B 4DGYH 1AHWC 5JPNC 3CSBA 5FV1L 4UTAL 3MI6A 5FO2A 1LYQA 3UP1A 1MFDH 2VDKH 4BHUI 3BQUC 1N6UA 5ID1A 4PBVC 1DE4B 5C6TH 2OMTB 1CN4A 3GT6A 4FEIA 1JTOA 4M9OA 5HHOD 1TSRA 4U4IA 4Y9GA 4BCZA 2WQAA 4NQCA 2QSCL 3P9WB 3MBEA 2AEPL 2A6DB 3B5GA 5C0IA 1NOFA 4FFZA 2J6EL 3L3JA 4JKMA 4UNVA 2XPZA 5CFHA 4H26A 3RL2B 4PBWD 3K7UA 1FIGL 3MRHB 4EIZC 1PZAA 2IQAB 2BMKB 3N9GH 3PV6B 1K2DB 1SJXA 5FOBA 5T1LD 1F1AA 2HG5A 2DYSB 2HJKA 3K8MA 5DT1H 4Z3JA 3HAEG 5TH2A 4AEHH 1YDPB 2VWEC 2K4WA 1EANA 4LGPB 3FMGL 3N1FC 3APNA 2XDHA 3WFDL 2X12A 2J73A 4MA3A 5KS9E 4KXBA 1E65A 4DN4H 3CCHA 3KWXA 2ZOLA 4OCNC 5D96B 3L2MA 5TF1H 2Y7MA 5DFAA 3LS4L 2LLNA 4E5XB 3B3BA 4PGBA 4A67A 3MV8D 5A43C 2BS9A 3GDCA 3WKML 1YN6A 1GZHA 3ROOB 4X4YA 2WLJA 4TULL 1W72H 4Y4FB 1QVOB 3WLWD 5SWSA 3MXVH 2CUHA 1SHWA 4G11A 3K8LA 4N8CL 4NNYB 4FNPA 2XZQH 3WELA 2HB0A 4AQ8C 2Z1PA 5IJCC 5I82A 4OAWA 3ULUL 4QCIB 4MA1C 3BP7A 2FBOJ 5DK2B 2YXMA 1KNOA 1G9EA 3OSVA 3VWJD 2YD2A 1L4IA 4P4KD 3QZLA 5LGJB 4UBDD 3R0NA 5CWSB 1HKLH 3QNFA 3AZUA 4FNUA 4Q14A 2GT9B 1AY1H 5KVDL 4X80L 1AO7D 5M7QA 5JOPD 1KJ3H 4C83A 4NZFA 5FUZL 1I1AD 2DQIH 1S7VA 2A1WL 4MJIE 4S0HA 1ZDQA 2XV3A 4YPGB 1CT8A 1MCOH 3FRUB 4FQPA 4BEIA 3GLEA 1ZANH 3CC5A 2HUEA 4XH2B 4HPHA 1FNAA 2BW4A 1TCRA 1YSOA 4U1HB 4UAOB 9CGTA 4L1SA 5AAWC 2EUZA 4YWGH 2D7TH 3NA4A 5CCHE 5CR8A 2VMFA 2ESVE 2CNZA 2FX7H 2HTKC 4GXUN 2OCFD 3WEBA 3OD3A 1A7RL 3N6YA 3BWAA 3KLSA 1A6WH 1UB5B 3MA7A 2BINA 5C09E 4F2ME 1KPUB 4DO6A 2R2BB 1ZGLM 1E4JA 3ILPB 5EOCJ 3VSQA 2OMWA 5LCVL 3T04D 2FRGP 1QKZH 1TETH 1ZIAA 5BJTB 5KVGE 1F11B 3REWA 3OGOE 5C0CB 2P8MA 3SDCD 1S9XB 2QEJA 3O41B 3LPFA 2GSIB 3VFOA 1HINL 1L6ZA 3VXPB 2C3XA 7FABH 3BVVA 1L0PA 2NDFA 5BQDA 1AIZA 1E6JH 3X14A 1XF2B 3VB9A 3CDZA 2CIIB 1IILE 4DF9A 2C1PA 3ARSA 5FDWA 3SODB 4H88L 1LL1A 4AW7A 1RMFH 2FHBA 1IKOP 4KKZA 5EUKB 4TUJB 3FCTA 3WXWH 2HJFB 5H2BA 1PF3A 4PTUB 5F1IB 3EXLA 2EEBA 5I1KH 1AR1B 3WUWG 5TGBB 2KZWA 3DX1A 1JAEA 2FK9A 2IANB 2ALWA 3GEWB 5SX5H 3GMPB 3NIFB 3X11B 1LDSA 5DJAB 3C08H 3I75B 4EN3D 3VD1A 2FWLB 3K5SA 3KDMA 5SX4H 2UY6A 3DX9B 4DCQA 4QHPA 5F88A 1OANA 3BC9A 1IT9H 4MS6A 1F97A 3N44B 4QTIH 3KL3A 5I1HL 3OKOA 5MI0B 4WUUA 1CF8L 3OZ9H 4CN1A 1D2OA 5A2FA 1XIWD 4JPKL 3H9YA 3RA7H 3FOMB 3MZTA 2HN7B 3MOBL 3SKNA 3O8XA 3ASWA 1PX8A 1S7TA 4AYFB 2EDQA 1E90A 2W80C 1YQVL 4TQIA 1KV7A 2Q3ZA 4HA1A 3H54A 1RY7B 2AJUH 5F44A 4XPTH 2F1EA 3RDTA 3TBTB 3V6OE 1NCGA 2EJ1A 1FRGL 3K72B 4HIQA 4GAYB 3U46A 4YEFA 5AOKA 1WCQA 1MQ8A 2UXTA 3F65A 4X7TB 4MZ2A 3DYMA 3MLSL 3AWFA 2W9DH 1FUNA 2XTLA 4J4PA 4YC2C 5CD3A 2VM4A 3HPJA 3DBXA 3TN0B 3ZTJH 5KJ7E 1WICA 4KVCH 4PJ9D 2DOCA 2IADA 3FS9A 2VISB 5IK3A 3MRLA 3MLTB 3ZMEA 5TDNB 1DEDA 1NGYA 2Q6WA 4A2EA 2WQRA 2OMBA 1T20B 3ARBA 4J5VA 5HD8C 1MIMH 3V4VB 3PXLA 4MQXD 5DVPA 4KK6C 1QWHA 3FO1A 5F9WB 1TXKA 3QUZD 3EFDH 3E1F1 4LOUD 1TTCA 3PYCA 4CJ1A 2VDMH 3OR7B 1YPZF 1HHHA 1R3JB 2GUOA 3QS2A 5KG9B 4G83A 1UD5A 2EDJA 4ZX5A 5DMIH 2LU3A 2VR4A 4N8VB 3VYOA 4F15C 3F7VA 1U8KA 3Q8AA 1J9CT 1H15A 1DUZB 3ZE1F 1UZ8A 5T1DL 3I50L 1BZ7A 4Q6KA 3LEXA 2KLTA 2HRPH 5EBMA 1FZMB 4DPAX 3JWNG 1SY6A 2D73A 1TJHH 4K7PX 1JZHA 4L3CB 5I0ZA 2J4WH 3ULVD 1B4JH 2XWTA 1CU4H 4KAQH 5BV7C 2PYEE 1BF8A 3H8NA 1KGYE 2X1WL 4HF5L 2I5YH 4JB9L 4J3XA 5B4MD 3DVFA 3SPVA 5L2KE 5MERA 3VW3H 3FONB 1RZQA 1JFQL 2YGQA 1MJ7H 4X0KB 1H0DA 2YR3A 4I8DA 3ZE2B 3BP4B 2FT7A 4DK3A 2WXIA 2JB5H 4GW1B 1G6RA 4E68A 4NQQA 1N0LA 1NAKH 1VA9A 3S36H 1XCTB 4LLVB 2BFVH 2DJUA 3DURA 3GTNA 3RTQC 1IEAA 1Y6MR 5J89A 4FQIH 1QSFD 5HJ3A 1CS6A 1YN7A 5IVXF 4JFEB 1CE6A 2YD0A 3PPSA 4ZX6A 2MNJB 4NQDB 5JOEA 2ZKXA 1C7TA 3CLFL 5J9PB 3A23A 5D2NB 3DRQB 2ZJSL 4TRPH 3QDAA 4M1GH 4XC3H 3QFDA 4KOCA 1OK0A 4NWTH 5ENWA 1UJ3B 5BO0D 1I7TA 4DKAA 2IFFL 3NUKA 2VN6A 3WDJA 2V2TB 2GTWA 3T1FA 5DEGA 3DSFL 1EAPA 3PGCA 1TR7A 2R9HD 5AWNL 2NW3B 5F9JB 2ZOKA 4ZO7A 3V10A 4O58H 1DL7L 3QJOA 2GI7A 1U36A 4P9HC 4ZPVA 5E70A 1VFUA 2VERN 4NPJA 5GJTL 1IIKA 2ED9A 2IPKB 4BH8B 3HZVA 4QT5A 4DVRL 1EZVX 4ZZFA 2D7PA 4NT6A 5E00A 4HIIA 2RB8A 3AMKA 5DHMC 5FM5M 3OXRA 1QI4A 4LFHG 3KPOA 3S48A 1KJVA 3PE9A 2E27H 4KO9A 4P46B 5E5RB 2NSXA 1L6PA 4P57A 2MCG1 4F1SA 4K5NA 5DZLA 3ECUA 4G6JH 3QCVH 3V0JA 1YHPA 1BQSA 4P2QB 4TTDC 1KIRB 1KCBA 2YUZA 4JFHE 4HBCH 1EO5A 3L9EA 3UTTD 3GJFK 2P43B 2R0WL 2TSBA 1J12A 2J56A 1U8CB 1MPAH 3P3TA 4UANA 3RX5A 3L95A 3S8GB 3QQ9C 2V17H 3IDGB 2N7BA 4G6AC 3OG4B 5EU6E 3DV4A 2P48B 1T2JA 5AOJA 4HOZA 3MODH 2W07B 2P46B 4XX1E 3ZY7A 4ISVA 2VE6B 4HS3B 1RUQL 5SWQB 4WWKC 3C87A 2BWDA 1ASPA 2OMVA 4CBZA 2AQ1A 4OLZL 1W80A 2IOMA 5I6XC 2FBJH 4JL1A 2Y06L 3BW9A 2WB1A 3LN5B 3ARWA 4MNQE 4HUXB 2E7BA 4WO4A 5GGUA 5TQ2L 2EECA 3P11H 4NLAA 4MB4A 4U1KB 4YL9A 1AQ8A 4JAMB 2EIDA 5DS1A 3IPEA 4P5TB 1NWOA 3D48R 4JY4B 5F7MC 2AJXL 4JDZB 2LV4A 4JREB 3BSZH 2C26A 3L3OC 1CDYA 2R69L 3GSRB 2WWMD 2JJSA 2YFNA 4Z3HA 4PJCE 4PTTB 5HGHA 1GMIA 1VADA 2FSEB 3ZSSA 5ANME 2CBQA 1Y1UA 3TBWB 2MOGA 3IU3B 3QO1A 4JDVA 4LVNB 4WHYH 5F7BA 4EUPH 1E3FA 4FG6D 1PAMA 2FVNA 4OSUL 3NZHH 4PSRA 3I6GB 3V4UH 4FP8L 4X4ME 1SQMA 3HG1B 4HT1H 3EHBD 4KKLC 4J3VA 1EVUA 4W4OC 4XZUA 3EYQC 4DP7X 1BGXL 1TZIA 2Z6FA 3PDOB 5CIPB 2HRHA 3VXRD 3W81A 3IJSB 1J10A 3O6MH 3KLHC 1QWNA 2K6WA 1MUJA 1CF1A 2IXQA 4YXHL 3WEAA 3WJJC 1MLBA 1JXGA 4GKSB 2VIRB 2CMRL 1TQUA 4OLUH 4FZEL 1NANI 2EXSA 5K39B 3OMNB 3ULVL 1OP9A 4LHQB 1JF6A 4ZFGH 1QW9A 2WJ7A 3HKFA 2EDEA 1ZSDB 4U1NA 4UV4H 3M8OH 4WFFD 2IAMC 2OL3A 4NDMA 1A7BA 2VZOA 5BZDB 2HLAB 5IBUB 2X88A 3ESOA 4Y4KB 1KIPB 2EEXA 4S1DC 2VDKB 3OAZK 1XWVA 4DTGH 1BVZA 2ITEA 1V3KA 1XF5A 3BO8B 4M93C 4G6MH 4HWEL 5D2LA 4Z7IA 3CDYA 1FL5B 3LRSA 3BUTA 3RU8H 1D7CA 3MJWA 5HYJD 3SE8L 1H3TA 1T1YB 5IIEA 3IF1A 3DI3B 1MG2C 2NUTA 3V0WH 5GZOD 1ZTXL 1U8PB 3D69A 3OKKA 1U8LB 3VD3A 4Z7UA 4KJPD 3K2IA 3RYMA 1PGRB 4L5FE 4PJAB 1B4LA 4TQPA 3PUCA 1PIFA 3TH4T 2GEQA 4LPCA 2ICEB 1FFPA 4RQQA 1AKJA 1P4IH 2CRIA 1ORQA 2IQAA 2UZYB 2FO1A 2WWOA 4ZOEA 2CHNA 5K1VA 4Z23A 4ELKB 5CCKH 2P80A 1Z32X 5GS0D 4ZXBB 1MREH 1YDPA 4YDJA 3O4LD 4QIRA 4JY6B 3SY0A 2OMNA 5CEXB 1FGNL 1WK0A 2V3DA 5EORL 1G7MB 1VPOL 3FT1A 3MJ7A 5F6IB 3N0AA 1S9VA 2ED8A 2VITB 3QDJE 5CU5A 4AH2A 5FYJH 1WYJA 2B39A 1CLOL 4HS6A 4MMXB 2VXUH 4NS0A 5E56A 2ZXBA 2A73A 4W9GC 3VWKA 2QELA 3BKJL 4JG5A 1WA2X 1KIUA 1KSRA 1EO8H 1IAII 3FF8A 2UUDK 4UB0L 1G7PB 2BM3A 1FYTD 3LY6A 2YGOA 3PQYD 2Y2WA 5IMMB 3NBNA 1SJVA 4K9JA 4MDRA 5T5FA 4HDIB 4ZMLA 1MCFA 1FDLL 2GJZB 3KPMB 1TUPA 3U2SB 2Z7UA 2W9LA 2K8QA 3HI6H 3OKLB 2OYKA 1C5DB 4YAQB 1RV6X 1ZLSH 1L9QA 4FQXD 4P9HH 2UVFA 4OR1A 3DJSA 4HJJL 1M4KA 4I77H 2WTOA 3HVNA 1KWKA 3QISA 4BFEA 3CLEL 1IKNC 3IMRA 3LVEA 4LOEA 2J88H 3NJMA 4MMYA 1L0XA 3FT3A 4PHZA 2NUPB 4ORGA 3APCA 3RZWA 4OCSL 4KUCF 4QRUA 3AREB 2V5SA 1RURL 1IC7H 3GMNB 4L4VB 4N24A 1K8DB 1MFEH 2BO0A 1XO8A 1FL3A 3Q8EA 5FM5O 1XF1A 3RAJH 1ACZA 2MPAL 4PCTA 2XV6B 4ADIA 3DC0A 3QA3B 1CO1A 35C8H 1URIA 1J8RA 2HFFB 4MD0A 5EU5B 3GGWB 5E4EB 3PY9A 4IMLB 1FBIL 1MFMA 4WDIA 1XF4A 5JHDE 2XWCA 5DXWA 4AY0A 4UTAH 5FO9B 1MCCA 2VO5A 2H0EA 1JRHL 4ZNEA 4XC1H 1Z5LB 2DBLH 3FPYA 4HCRA 2GJPA 4WI7A 5FA4B 4H1LB 4RZCA 2GK2A 3PL6A 4OKVA 3UC0L 4LPVA 4I18C 3GTVA 2QSCH 1AAJA 4W93A 5BZXA 1N10A 2AEPH 3VFGL 5BJTA 2FEJA 3MUY1 4D3CH 4QPEA 2NDGA 2P5EE 3EYVB 2VR8A 2EC8A 3OB0H 4HJ0D 4MAZA 4NNXA 4U6HB 1RU9H 1OL0A 1S3RA 3FN0H 3MJGX 1FIGH 2EO1A 4ODSL 4P4KC 4LVOB 4UBDC 3ZBMA 2CIIA 4H2CA 4OBRA 4LLWA 5AUMA 3F2LA 3GDBA 2R0KH 1Z66A 3GLAA 1F00I 2PWDA 2WZ6A 1RUKL 3FOLB 4IRJA 3FFCD 1GZPA 3FMGH 2YRBA 1N3NA 3WFDH 2I60L 4Y2DB 4FERA 4R2GC 2BVOB 5MENA 3AB0C 1XGYH 3AT8A 1BOYA 1RI8A 4ODXA 3Q01A 2WLMA 5C9JB 5LWYL 4WV1B 1YC8A 2OCCB 1FO0L 3WKMH 2AFNA 1A6AB 1QLFA 2VZ3A 3L2NA 4TULH 4E9VA 4LEEA 2X89A 4WU7B 3MRFB 4N8CH 4NNPL 3ZYOA 3HOGA 1N68A 1R5WA 3MO1B 4H25A 5DMYA 3ULUH 4Y19E 5G5DB 3GC3A 4M7KL 4CADA 1L9NA 1AC6A 5AALA 2WZPD 1XGRA 4PRHB 4GXFA 4JPWH 2W0FA 5L88H 2ZG3A 2KC0A 3IGAB 5E9DA 5D7IA 4RFOL 4OVVA 4JM2B 3D0VB 3D8MA 4FMKA 1DBJH 3VX1A 1E8XA 1FF5A 5GZNA 1UXLA 4X80H 3SDCC 3WJLA 5TDPB 5GS0L 1OPGL 3W1ZA 4QHKI 3ZO9A 4YIQA 1YPZB 5AENA 5FUZH 5CBEB 4BDVA 3WY1A 3SGJA 3K91A 5D7LE 2GCYA 4O02B 4KX8A 4M1DH 4M7ZB 2ZXCA 1CLZL 1K8IA 4IKLA 4NFCA 5HDQL 2EKSB 1WFOA 3TH3T 2OM5A 2ZICA 4PGEB 2EO7A 4ZUSA 1LLAA 2VDMB 1QEWA 1I9IL 2C9UA 1A7RH 3SDDC 5E6SB 4A7GF 1G5AA 1NM4A 1PDKB 1SMAA 3JUZA 3QXDB 4EN3C 4Z7QE 1DVSA 3CN2A 4BXSV 3MRKA 3G5YA 3NCWA 1SHXA 2Z4QB 4N9GB 5LCVH 5ECJE 3OR7A 5FYJU 4QLWA 4NXSA 1JRHI 1E43A 1LMIA 3RFZC 5IFJA 1ZT4B 2F53B 1HINH 5IVXB 2PCPB 3LIUA 4HD5A 2WOBA 5L2KD 3F7PC 2CHDA 4M8UA 1UWYA 2L4OA 1G1OA 1NGWB 2DM7A 1HL5A 2ZUXA 3APDA 3QUYA 4LCCC 4PJHE 4JK0D 3DDGA 3RI5K 2P5PA 5LDSA 5JW4N 3BH9B 3SJVE 2B1HL 1G7HB 4J1UA 4Q0XL 1HE8A 4MA1B 4L3EB 1UA6L 3TVMD 4OV6F 1ZVHA 4J7RA 1I3GH 4NSKB 2RACA 4TQHA 3H9SE 1GAFL 4Z7WE 2MH4A 4R3SA 4RMWA 4UQCA 1AGEA 1Q0XH 4ZMAT 2A0LC 2EVFA 4M61B 2NXYD 2PWHA 3OPZL 4OZHE 3S4SB 4FYSA 3UZQA 5I1HH 3B6SB 4UOZA 3DRQA 4DGIL 3OZKA 1HT6A 2FLRT 4JPKH 4HX1A 4ZUTB 1YVLA 3MOBH 1QA9A 1JGDB 4H8UA 3OZLA 3QUZC 3U6XA 3BWUF 4GIOA 3V2AR 5I8CA 3PHOB 3TBYA 1YQVH 5BZZA 1KCUL 4UQAA 4D8OA 3UH8A 3PLYA 3KLLA 1D5RA 3D51A 2P5WB 4EE2A 3MX0B 5AOLA 4QNPE 3TO4A 3WIHA 1MKFA 2BSRA 1FRGH 4LDLB 4ZQTA 4KH9A 1BBDL 3IVKB 3V7MA 4ONFL 3ZHNA 1KG0B 1O7VA 3MLSH 4HUUA 1CCZA 1XMEB 4CNIA 1FNEA 4PRDA 5EEUA 2MQGA 1AGCA 1AS6A 2CCVA 3M07A 4R7NB 1H3XA 3T0WA 1IAIM 5B4MC 3NJLA 3GUTB 1WUNT 3WD5H 4OZIF 1DBKH 4JRYB 2CDEB 1O6VA 3LZNA 3L9BA 3SCMA 2OXGB 1E5ZA 1Q72H 1P84J 1T5WB 3FRPB 3IGUA 1TZGH 1YEJL 3CH1B 2CXGA 4DEPB 3QJFA 3X3GL 3E8UL 5D7JC 4U2YA 5IB4B 4IHOB 5JHBA 2VH5L 4NGHL 4IGBC 1OD9A 1K4DA 5DMJB 4HQQL 1FV1B 4B9FA 3LRKA 3GHEH 3NEOA 1L9RA 3WTWA 3R06B 5T1DH 4PJDE 3I50H 2E59A 1KCKA 1JHLL 1S7QA 4P23D 3AADB 3QIWB 3J8F7 3MJ8B 4FNTA 2R9HC 2XVKA 3B2UC 3HUJA 4ZFZA 2YXWA 4EEEA 1CGTA 1F1DA 3SGDI 4AIZB 5C86A 4POUB 3B8SA 4HF5H 2FB4L 4IJTA 4JB9H 5F7YC 2BNUA 4M3JA 1JFQH 4L1HA 2OZ4A 2ZWYA 3DUHA 1N0XH 3GIVB 3Q7JA 3BDXA 4IEFA 2H26B 2FSEA 1ZA3A 4LCVA 1EHXA 3ESNA 3QNZB 2A9NH 1MHCB 4N2CA 3SKUD 5I66A 4Z0XA 2G5BA 3VYNA 3WS3B 3UGEA 1CXFA 2I07B 2ZXDA 1ED3A 4HUWA 5FA3B 4FFYL 3QIBB 3CLFH 1NEZB 2UY7A 2OTUB 2ZJSH 3BN3B 3GSOB 4Q6IB 4X7EC 3D4ZA 4LRIA 1DLHB 4IMKC 4E9SA 1CFTA 1U92B 1CVRA 2R56L 4GKZB 2MSPA 4K8RD 4TL5A 1A3QA 1NANH 5HHNA 2IFFH 3K4ZA 1LK3L 3QORA 3DSFH 3TA3C 2HKFL 3QG6A 5ESVB 4K5LA 1S8DA 5LG6A 1DL7H 3H0TA 4K0OA 3CV5A 4G2AA 2CBMA 2CIKA 3O3BA 4WI5A 1ZLDA 1ZHLA 4L2YA 5CJXA 4DVRH 5ALBH 2X7LA 5GJSH 4CC0A 4QOKA 4IKNA 4CVZB 3DUSA 1A65A 2BERA 3HMWH 1U8MA 2YD8A 2C9PA 3OG6B 4QRPD 5D2LF 3TWCH 3EBIA 3O6FB 4LSRH 4H40A 4MQSB 4XCEB 4HSQA 1BOGA 4IW4C 4LHUA 1QO3B 3TV8A 5TDOB 4IS6A 1N6QL 5L8JB 4YSCA 1T83A 2BZCA 3H7LA 3TBSB 4O4YL 5HVWA 1YUHA 3HN3A 3QZPA 4Z7UF 4FD0A 5DD3L 1J0JA 4GSUA 4L1TA 4OTXL 5IGXL 3GBEA 5LUMA 5B1CA 3U36A 5BZWA 5ELIA 3MHZA 5BV7B 2Z92A 3AG3B 5GGSB 2IBZX 3ROLB 2AJ3B 4BKLA 3WHE0 5L4JA 1RUQH 2CO3A 43C9A 4PVLA 2V0AA 3NDYE 2M8XA 1J1OL 5HDWA 3EFOB 4OLZH 1HI6B 1KXTA 4EI5C 4M48L 5FECA 1MIEL 4LLDB 1NCCL 2Y06H 2AF2A 2H6UA 4DUVA 1MNUL 3GM0A 4P3CL 5TQ2H 4HAGA 3QHFL 2XN9E 3SQOL 2EIEA 2J57A 4HKZB 1A9EB 4AYBA 5HYSG 2AJXH 5E8OB 3KMDA 3S7GA 1IAIH 5A2BA 5AW4B 1WS8A 3EG9B 1W72A 1TYEB 3G08B 3X1EA 4EAEA 2VUKA 2LU5A 3IJ8A 1A9BA 4UM9D 4ZAKA 2XI9A 1CXHA 1TJIL 2BY2A 3FB7A 3EFFB 4P06A 4X99A 1ND0B 1K4CB 1PJWA 1OTUD 2UZXB 4LKXA 2VZUA 4X8XA 5FGCE 1CL7L 4N85A 4FNRA 3WSQL 3LZRA 4FP8H 1ZHBB 4XPHL 2R23B 2CCLA 3O3DA 2EUVA 4YHZH 3PHQB 1BGXH 2VLRE 3ZDZE 4RBPH 4AIXA 5AVXB 4F2FA 4WF7A 4MB1A 1PD6A 5CZXC 1KLUB 5A16B 3X1GA 5GZOC 2WVVA 3U1PA 4KJPC 4ZD3H 2VXTL 2CMRH 1IARB 2AXWA 2RBLA 4WHYG 3FTXA 4H13C 1ZY9A 1JDDA 4EUPG 5ICZA 3BD4A 3D5OF 1XSIA 3GIZH 4APXA 3CGTA 1B4RA 4G8GA 2OYMA 5F7KC 3GMNA 4X98B 4AZ8A 4PY8J 1FH5L 1NBYB 4FLHA 2R1XB 2A9ML 1V54B 2GUYA 4OGQC 2CKBL 4JO5A 3TF4A 4TKWA 1JVKA 1TYRA 4RGNE 3B8YA 3I2CH 1M1XA 4LLAA 5AZUA 4PJGA 3C5ZA 2ICWI 4HWEH 5I6XB 1A4KB 4Z7OF 3MNVA 1MCPL 2OQJB 3NFPB 3UJTL 2P5ED 4YSPA 3SE8H 2ZAGA 2DKUA 1U3HB 5C07E 4HVBA 3ZHDA 4K8RL 1J8HA 1WH0A 4UU9A 1GY2A 2JH2A 3D25B 2HLEB 1QMUA 3PWUA 3LEVL 5KSAD 5T3ZH 4ZFOL 2X2UA 1KBKA 1ECZA 3L3OB 5F96L 1P5VB 2WKOA 3HE6B 5LVEA 4OIIL 3OHXA 1QFWL 3NCXA 3CFQA 4ABWA 1KXQA 4JKLA 4L1LA 3CN3A 3X12B 5EEZA 3MBXH 2DL2A 3C6SA 5I1IL 2EVJA 3RPBA 7TAAA 4NO0A 1NJ9A 3QEUA 2F5AL 2GIXA 5J12B 4ZUVA 1M9WA 4I4WA 5DC4B 3LH2H 3GB7B 4W4NA 4A39A 2W0PA 3MUGA 5PCYA 1ACYH 4W9LC 1HHGB 1FGNH 2GBUA 5EORH 4JFQA 5J06A 1U21A 5JA9A 4QRRA 4FQCH 3D85D 5ABZA 2BVYA 4HK0B 1CLOH 5DK0A 3ZOAA 2JKNA 5FKAB 5TE6L 4A7TA 5C9JA 5E6RB 1QNZL 3BKJH 3ZE1E 1KFAH 4BELD 1XF3B 2GFBA 2YA0A 3STLA 5EUOF 3TTSA 4WU7A 1I9RL 2NY4C 3C60D 3T0EB 1BLNA 2VLJE 3INUH 4U6VL 3C2AL 3QFJD 3S88L 1FDLH 3W0WE 4H2AA 1XGUB 2WTRB 3STZB 2C4FU 1HSAB 3O3UN 1PQZB 4KMLB 2ZXEB 3ZL4L 1QR1A 3TZVA 2KDYA 4NC2B 4IBUA 4RIRA 4PD4K 1CXKA 2N4IA 1HNGA 5D7LD 1JWSB 4JFSA 3QIUA 3CLEH 5E8PA 4YX2L 1D9KD 2MNWA 4M93B 4R0LA 4E41E 3FQTA 4JLRA 4X5RA 1AHWA 3OVUB 3S3SA 4Y1AA 2XWJA 3UAAA 4YSAA 5JPNA 1HXYB 3TNMA 3FUKA 3R4RA 1RURH 1FG2B 4K3JH 3MTRA 3C09C 3BQUA 3CZJA 5BOZG 3SDYH 3PGFL 3FU6A 4LLMA 1F2QA 2DWXA 1P84K 2X6UA 3UYOD 2F7PA 3VSTA 1P7QB 2MPAH 5EO0B 3A6OA 4Q2ZB 5ACLA 1RK0B 1X5YA 4HBQA 3WO4B 5SV3A 2HVKA 1HHIA 4LCYB 4FOMA 1RHHB 1FBIH 1S9WA 2YQGA 4NYLB 3REVB 1F0LA 4UNTA 4S2SB 2AJZA 3KPSB 1JRHH 3BN9C 1C1EL 3X17A 5C0BA 4YK4B 3F7YB 1Q9WB 3L16A 3ZVVA 1XZ0A 3EOTH 3UC0H 4CL7A 1W0YT 2Z4QA 4NQSB 2VN7A 2J55A 1RZ8B 2CO7B 3CNKA 1FNGA 3Q3GB 3INOA 4LBEB 3VFGH 3A0OA 4QHLA 1YMMB 1HIML 2ZZUT 3DECA 4JFDD 1T6BX 4DGWC 3DK0A 5KOVC 5KVEE 4HGWA 5IVNA 1XCXA 4DZBB 2LAAA 1M05A 2IQ9L 3WN5C 2E8ZA 4AE0A 3TFBA 2ZPKL 1JZ2A 1DJGA 1Z3RA 5HPOA 4OF8A 3N0PB 4P2RE 3GXUB 3HLAA 5DTFA 5CP7A 5D9SA 2FX9L 1XBDA 1I8KB 2ZP0T 3N1MC 3K6SB 3OMAB 3RGVB 1RUKH 4AQ8A 1KCLA 5HBBA 1QFWI 1B0RB 3DA0A 2AQQA 3C6LC 3OKEB 2I60H 3CFKA 2CO2A 3OBAA 5K9KB 4CKVX 3DIDA 3KPQB 4UIKL 1U2HA 4BWUA 5LGYA 5IMKA 5DJZB 1ZGLA 1OGTA 5LWYH 2YD9A 3KGRA 5IBTL 4JUSA 5B3SB 1G7QB 1LEKA 4EDWH 3T0DA 1FO0H 4PMEA 3PGDB 4LMQE 2QKSA 3WE6B 2ZP8A 5E94A 1GTFA 4M4PA 4LIQE 2IG2H 3HAEB 2WBKA 4G70B 4NNPH 4B96A 3FHAA 2WBJB 3S96A 4APQC 5CFAA 4ZMZA 3HC0A 3RL1B 4M7KH 4PSPA 3ORJA 1AD9A 4OZIB 1QHPA 3DIFA 3DVNB 5DVLA 5JLZA 2OJZL 4GO8A 1SFDA 4RFOH 4JFFE 4BGDA 3CIQA 5AAWA 5E6IB 4TYUA 2IGLA 1A1NA 5GS0H 1OPGH 4AT6B 1X9RA 2LVEA 1U41A 1NPNA 2ZUQC 5J6GA 4FQ2L 4TNEA 5LBGA 1JF1B 1AXTH 5I6OA 4UQIM 4YHIA 2Q7YB 4H0IA 4XP6H 5DFVD 1BYPA 1KG0A 3RUGA 5C0FA 3MROA 1UURA 4I18B 3SSGA 3T2LA 1CLZH 2X4TA 3ARTA 1ZHKB 4HK3N 4WTZA 2E74C 3ABLB 3MV7A 5HDQH 3VXMB 2CR0A 5GRZA 5AZEL 4MAYB 5IF0B 3VD0A 1JPSH 3MZGB 1URZA 4MXQD 4OZFG 1IBGL 1NAMB 5HYSA 5D71L 5G55A 1RZGB 2E7LC 2XVGA 1P1VA 2MHAA 4NO3B 3G6AA 3QEQA 4JM4L 2CLRB 1NKOA 3CH1A 5B1JC 1N9PA 4NBXB 2F58L 4B50A 5DURD 3RHWK 4E9LA 5HDBB 2VLKD 1DLFL 3V0EA 3B2VL 4G9FD 1BF2A 5D93B 1GS7A 1FFRA 4NKDB 1UA3A 4GXUM 3U2IA 3GNML 4V11A 3LOWA 3HI5L 4QYOB 2RQ8A 3D3VD 1LJMA 4R2GB 2K9FB 1KXHA 3EO1B 5CEZD 3AB0B 3FZUD 1J18A 4LOVA 3SGDH 1PZSA 5E2UL 3BGMA 4ZMTA 5AVWB 5DMKA 4K55A 2RGSA 4OB5H 3BSZA 1NC4D 1P2CA 4Z78A 1OP4A 2DDQL 3OB8A 3GBNL 1QHQA 4OW6A 5CBAA 4NQCE 1HWGB 3PXHA 1JHTB 2B1HH 1HWHB 2EP6A 2G0KA 4YJZL 2L04A 2OR9L 3FU8A 4GP8B 5CS7A 1J0YA 3M1OA 4EUPA 5C2UB 4MNGA 3KWVA 4GUOA 5AZ2H 5HHMB 5K69A 1GAFH 2JF1A 3U9WA 4AWJC 4JM0A 5A40E 2QSTA 5CJOL 3VFTA 3IJEA 4M9PA 3QJHA 4GNKB 3QUML 5DRZA 1RJYB 4O00A 1AI1L 1I7UA 4AYMC 4ZS6D 3H3PL 3OPZH 4YZWA 5AD0A 1L5GA 1MW1A 2IWFA 2P7TA 3KR3L 5BPPA 2CUMA 3RJQB 4QRQA 4TTGA 3D18A 4DGIH 4IRSC 2OTUA 2X0WA 3CFCL 3WUWB 4HLEA 3F12A 3AITA 1KENL 4N87A 2GBTA 4V1DB 5HI5C 1LE9B 3BEWB 2PPAA 1T2QH 3E2HB 4YHPB 2X4PB 1MH5B 1LWHA 1R19A 2Z0BA 2CXKA 2X4SA 3VCLA 1KCUH 1R3HB 2C5DC 2RJMA 4BQCA 1N64L 1V3JA 5HP5A 1HQRA 3Q13A 4MWFB 3TEXA 4R83A 3RG1C 2AJYL 5SWSE 4FTVD 4UM8A 1BG9A 2PF6A 5J1AB 3SDDB 2JLPA 4PJ5A 4BHUA 3N85L 2XPGB 5ETUA 1CGWA 2X4OB 4WI2A 2JKTM 5DEJA 3I3BA 2X2IA 2WSDA 4OLVH 2DW5A 3VU1A 4OF3A 1J5OL 1XEDA 2XNAB 1JVLA 2PMZA 4AKPA 2D3JA 1QLEB 1PZ5B 1CFNA 1NSNL 4A38A 1D5MB 2XZAH 4HIHB 4XE0A 2BS71 1GKEA 2JIXA 3I6SA 4L29B 1EFQA 4PVMA 4M43L 3QQDB 1BF5A 5E5MA 3AU0A 3TBSA 3FN3A 4NKMA 5CUSL 3HA0A 4LCCB 4FKHA 2CQVA 4A7VA 1YEJH 5D8JL 1GGUA 1I75A 3X3GH 1CURA 3EOAB 1CICD 1LGVA 3NEEA 4AXWB 4X6DF 3W11D 2VH5H 1GW0A 3WHXA 1XL4A 1H3GA 4NGHH 1WHPA 5IKCA 3H85A 2TSAA 4A6YL 3MLZL 4HQQH 1DDHA 1WWWX 2C7UA 2NX5A 5C0DA 1T0NB 2B8OT 3IPFA 5ICXA 1ZE3C 2YIHA 3UERA 1JHLH 3IB4A 3V5DA 3KYOB 2KMWA 3RTQA 3POCA 1OB1B 1I9JH 3QH3B 3II1A 5FUOL 3WIFB 1IAOB 1S7UA 4ZNCD 5HYJA 3UBXI 2HFEA 2P8PB 5HGDA 4DP6X 2Q86B 1OSPL 4U1MB 4B53A 2BIOA 4HKZA 4JQXC 3O3AA 2VO8A 4PWEA 4GRWH 2PR9A 4TOYL 5T1JA 2GY5A 1XSOA 4NIYE 1ADWA 1MVYA 2P26A 3MCKA 1U8OB 5EBGA 4JW3A 2UZXA 4Z7AA 3R7QA 1D5ZB 2A9BA 4MBRA 2J25A 4FFYH 2W38A 3DOHA 2BXZA 2GK0B 2CH8A 5KYWB 1VEPA 2ITDB 3SPJA 3TPUA 1SLWA 2AQRA 5F1OB 1FCGA 2G75A 1LO2H 4NZTH 1JWUA 3U9PL 3UTSD 5J3HD 2R56H 4QF1A 3WJMB 1EJOL 2X38A 5CEZL 3M7OA 5ITBL 1LK3H 2ZX7A 3CZEA 1ZLVK 4WK2B 2DEWX 2XFXB 4D9QE 1U30A 2QGCA 3PFUA 1XGPB 1A6ZA 1BQUA 4NENB 3CWGA 2WIIB 1F3JB 1OT2A 2WINB 1QFWM 1RUAL 4G6FD 4PCYA 5DJXA 1OGAB 4WUUE 2WZAA 4MCZB 4IOSA 4PV9B 4XMLL 3AROA 3ARGB 1ZV9A 1GGIH 2GJ6B 2XBTA 5JIQA 2OSLA 4F58L 3BUQA 1GC1L 2VABB 2R2HA 5EZIL 4N68A 4UTAA 5C0AA 2FJGA 1BFTA 1CGSH 3K8KA 4JANB 4QXWA 1TOXA 3HCVA 4WWKA 1N6QH 1DQQB 3ARFD 1KXVC 5LBSL 4OLWL 1VJSA 4JGUA 4O4YH 1ROCA 4Q89A 3EJQA 3GS7A 5I74B 4ZO6A 5KBMA 1H8NA 1SZNA 2AITA 5DD3H 3KCPB 1H3PL 4OTXH 5IGXH 4OV5A 3DJRA 3U6XS 4W68A 5KOMC 1DYZA 2Z31D 3S98A 2M1KA 3QC6X 5IZ7A 4G6KL 1F4XL 4W70A 3L9YA 5EUOB 1CFSB 2NLJA 4NO5B 3G6DL 3HS0B 4WSGA 5J0BA 5IB5B 1UVQB 1TQCC 1EA9C 2HZHA 3POHA 1HFUA 1GY1A 1MNUH 3KAAA 2VDRL 1GSMA 3MREA 4P3CH 2PWFA 5JR1L 2LLLA 2G2PA 4ENED 4KDVA 1JCVA 1J48A 4N0FA 3QHFH 4GI8A 3SQOH 1WGVA 2OMXB 2GEEA 4W4OA 4GH7B 4KITB 1HHGA 4HEMA 1PKQA 5GGQL 5I8EA 2VLJD 3L3HA 4UT7H 3W0WD 3A67H 1VACA 2BP8A 3ARDD 3BH8B 4UMGA 2NY0D 3HJ0A 3WJJA 4HEPG 5I1CH 1YY8B 1S7WB 2DQJL 3WTSA 4ALAL 1JZ7A 4I1NB 3V9EA 3DV6A 5F1SA 2NY3D 5I1JL 1HXMB 4XMVA 5DO8A 4UDUB 5ES4B 1SXZA 3WSQH 2C1OA 1PNCA 4IU2B 4G1MA 4XPHH 4E41D 2FTAA 3E38A 2HKHH 3CFEA 4HLJA 5LN4A 3K71B 1EEZB 2IAMA 1PQZA 3PWVA 4Y9BA 5CNHA 3UO1L 4QTHB 1H8OA 1AQHA 4ZT1A 3IWVA 4HSCX 3IDXL 4JZOB 5KSVB 4YHYB 4W1TA 2R1WA 5A2IH 4LB8A 4OM0L 2H2SD 1WG3A 2DI9A 2VXTH 3QQNA 1KGCD 3O9WB 1DJXA 4U3SA 2D3LA 2WHVA 3P30L 3QWQB 1HXYA 1OSYA 5E2WH 3FQRB 4PW4A 4BZ1H 4PVBA 3VD7A 4OU3A 1FH5H 4M56A 1JJUA 4NI6A 4XCFL 2A9MH 1XB6A 2CKBH 4YGVA 5JW4R 4LPWA 1VFAA 4Q2ZA 1XH0A 2ZQKA 4U31A 5E8NA 4PB0H 5HI3C 4B3VA 4HMEA 5KBDA 2K7QA 4Y88A 2VDOB 1OLZA 2H32B 4M7LH 4D9RE 4P5MA 2EH7L 4EDXA 4JY5L 1F13A 1U91B 5LCVA 3FCBA 4XR8C 4ZODA 1MCPH 2DPKA 3UJTH 4CW1A 4WUKL 4Z9KB 5AVVB 4KDTC 2RCSL 3NK4A 5ID0B 1RPQA 5D6DC 1WFIA 5FYKE 3Q2WA 5BS0A 3WKPA 3CZUB 3C60C 5C0RL 1ZE3H 3P0GB 5CJ8A 1Z3GL 1OPOA 3LEVH 3L6FB 2B9AA 2ZYIA 2X1XR 2YPLB 5F96H 4D94A 5MEOB 2PCXA 4GUPB 5E9NA 4LDCA 2J8UA 1QSEE 3LHPL 3R8BB 2ATPB 2FGWH 2XKNA 3RNQB 4AIEA 1JIBA 5LGHL 2V7HB 1QFWH 1DP0A 1OV8A 1NCWH 1TTFA 2NY6C 1BJ1H 3BZFB 5E4OA 1H3VA 4F7EA 3LMJL 3WV0A 32C2A 4LEXL 2IC2A 2V7NB 1D9KC 2PYFA 2BNQD 5BNXD 3K6SA 1J8SA 2HT3D 4FLOA 3ABZA 2YD1A 2NW2B 4WJG3 5F8RC 1VGKB 1OAQL 3FUHA 1A22B 3IPBA 4MCYB 5CLTA 5CZRA 1A7OH 2H5UA 2ENYA 1JYNA 1F4HA 4MRCA 5DJ0B 4AQAB 4FNSA 4DKTA 2DM2A 4TQ8A 2B16A 3QRFM 1GOHA 5HHOA 5J13C 1CQYA 3P2DA 5EBLB 3CIAA 2R15A 3JUYA 4G43B 1QNZH 3L13A 3PGDA 4EBQL 2Y9RT 5AB9A 3KBHE 3ESUF 2KPNA 5SX5K 4GRMA 4I85A 1I9RH 4B9YA 1D2PA 2DLEA 4I5BB 4EVNA 2XACC 1BPVA 4U6VH 3C2AH 3MGTB 3S88H 3RVTC 3RWHA 3ZL4H 1RK7A 1IGYB 5T1LA 2QDVA 2D0FA 5E08H 2EIZA 3GEFA 1CG9B 4KROC 4FQ1L 4NM8L 1E67A 2O26U 4NN7C 5J57B 3KS0H 1G6VK 1BPLB 4QY8B 4IBSA 3M86A 1PEZA 3BPCB 4YX2H 1Q38A 2FJUB 1N59A 1G7IB 3ERXA 3EGXB 1MF2L 4N8PA 3RUGF 2A74C 2ZAIA 1NFDF 3MNZA 5CSZB 2MFNA 1T4KB 2FUQA 2XKSA 1B9KA 3MV8A 1MSPA 3UBGA 3ZKMD 1NBVL 4RETB 3QC5X 2R59A 4UQ2B 1E9QB 1X5MA 2CBOA 1X9QA 1U8HA 3CFUA 2DLHA 4AQ1B 4JHAL 1DSFH 3A6BL 4PV8B 3IN2A 3T3MF 3UGUA 5C08D 1KJ2L 3L3IB 3QUXD 1VHPA 2EYRB 4GRLD 3VWJA 2FO8A 2YKLL 4P4KA 4L1BA 3UAJD 3TLRA 1C1EH 2IVFC 4AC4A 3P4NA 2W65B 1EEYA 2CLRA 1QZ1A 2YN5A 2YAQA 1AO7A 3ZGHA 2BVPA 1MWAB 3FUIA 2NT0A 2F7QA 1G7JA 1MY5A 4ABQA 3TJHD 1I1AA 4XXCA 1HIMH 4W9HC 2YOAA 5IB3A 2ZXAA 3V5KB 1KLFA 3D0LB 3H7BA 5BXFB 5I76A 2XY2A 3IMSA 5D2LE 1U93A 2NNXA 2IQ9H 4OJCA 4PRPB 5I75B 2ZPKH 1X5AA 4EMZA 3HE7D 4U1GB 4GKNB 1RCYA 2FX9H 3KYNA 3DX6B 3HR5B 2I9LA 3KL0A 4Y8AA 2NY4B 1AQDA 1JK8B 1UOWA 3PF2A 1YYML 4R5TA 4Z7UE 1R47A 5EC1B 1LNUA 1W0WB 1A5FL 2YBRA 3B7RL 3EOBA 3RWEB 4ILDA 4UIKH 5DFVC 1BFOB 1D6EB 3D39B 4N3TA 3CSYB 5IBTH 4D0BB 2KQNA 4XVSL 2XQYG 1XV8A 4FXKB 3SDCA 5DJDA 3HB3B 4XXWA 3DJTA 3JSSA 3QPKA 3C09B 1C12A 3QDGB 2B2XL 4LNVA 2YFOA 1E40A 3Q6FA 1WCBB 3JT2A 4N6RA 2DYPD 4YHPA 5D1XD 1MH5A 3FTUA 2OJZH 3GMRA 2J5LB 2YUWA 3TT1L 1R3HA 2B3RA 2VDLB 5H4YA 4ESKA 1GKOA 2Y7LA 5IR1A 4MWFA 4E42A 4IKJA 5KAQG 4JFZL 4R97B 4X6DB 3FQNB 1L9TA 3FUEA 1B88A 2QPSA 3SDDA 4EN3A 2Q9OA 4UV7H 5JW3H 2CU9A 1YG9A 4XVTL 2IMNA 4G8FA 5DRXB 2K78A 2GHWB 4ZTEA 4NI3A 2UZPA 2IGFL 4IIQC 4I48B 4RMVA 3RFZA 1S3KH 5AZEH 4AK2A 4K73A 5HJBA 2WLLA 3VFPA 1NBCA 3MRDA 1IBGH 3JYBA 3L7EA 3O11A 5HY9A 4M8QB 3BVUA 3QXUA 3M17B 4JKPL 3B7TA 4OI7A 3MJ6A 2VAAB 4UCFA 2D3VA 2F58H 1T80A 5CEYA 3K6FA 4QD2E 3K1KC 3P9MB 4HEPA 3DTXB 3Q5TA 1E50A 2LHAA 5C0JA 2XTJD 3GNMH 4X6EB 4IOFD 1I8MA 4M62H 1HHKB 3DHUA 3GMLB 5E2UH 3VQ2C 1A25A 3GLZA 4QXTA 3VYPA 1A7QL 4ZNEE 4PJ9A 1XGZA 2HVJA 4MJJA 5SWZB 2R69A 1NDTA 4M3KB 5FM4A 1PZCA 4J8RB 5GRWA 4Z7OE 2DDQH 1J9QA 3JTTB 3GBNH 1JK9A 1F6FB 3FUDA 1I1RA 5DRNA 2Q86A 1IU1A 5KBKA 1GGTA 2WAHA 1KGUA 2FQGA 1A8JH 4X8JA 3HTLX 5AEAA 4KKPA 2F7RA 2OR9H 3PNWB 4NUJA 2B4CL 3VQMA 2FO4A 3D06A 2UX7A 4IU3A 3QUZA 2Z35B 3OC5A 4GQ9L 2O6EA 3UZVA 3SGKA 3T71A 1DVYA 5JW4M 5CJOH 4ETQB 4OCRL 2J44A 4L4TA 4ZDHB 5GRXG 3QUMH 1IEHA 1AI1H 1BIIA 4BUQA 4ELMB 4H8VA 3QDMD 2MJWA 4MS8D 2XZZA 4HJGB 3HZMA 2ITDA 1MFAL 4TUUA 4DN3L 5CAYB 1NLDH 3CFCH 2YPVL 4YHNB 1KENH 3RVXC 5MENE 5IROD 4B9JA 5C6WH 3ILEA 5H4ZA 3TYFB 5TE4H 5I17A 3UBHA 4GAJL 1X7TA 5DC9B 3H2WA 5EB9A 3O8XD 1TQTA 5DHYB 4MVBD 1N64H 4NHCL 3S37X 4GT7A 4JO8A 2YMOA 1H8SA 2BVQB 3FB8A 5DJYB 4AUUA 1UOVA 3U4EB 2FQDA 3N85H 3CFDA 5EUOE 3P4OB 4OGYL 3CG8A 1F5WA 4L3AA 5D7JA 2GB2A 3BQVA 3OWEA 3X1NA 1QRNB 1CFQB 4IGBA 5D7IE 5E9DE 2N3JA 5EU7C 5JDSB 1J5OH 1MFNA 1BREA 1EVTC 3B7YA 1NSNH 3VFRA 1Q9KB 1BEXA 5CLXA 1R3LB 2EEAA 1XTMA 3KWWB 5H94A 4M43H 4JO2L 5ISZD 2HH0H 4NAMA 4F33B 5GGVH 4E0RB 1LEGB 1YAIA 4NUQA 5CUSH 3RWJA 2X42A 3GPSA 5D8JH 3NTCL 2RD0A 3QQ3B 5JXAL 4FQQB 3BRGC 3DTUB 1VEOA 3S6CA 2UZIL 3WFBL 3SKOB 2DD8H 3APFA 5TD4A 4F8TA 1XSKA 2GTZB 1TU2B 4I2XB 2Z1KA 3ECBA 3KVDD 1K3ZA 3QYCA 5J3HC 2O5ZH 2XIBA 4WJ5B 5DUBB 5I1LB 1BZ9A 1KB9J 4BK4A 2GC7C 3MRGA 5JHMA 5CHNB 3T65A 1TNMA 3S35X 1L7TL 2FD6H 2OX5B 1JZ6A 2JNZA 3TP4A 5HPMB 5FUOH 1I8UA 3BSGA 4X6CB 3U7YH 2R4RL 1NGQL 3CZFA 1OSPH 2ZUSA 2P47B 4YQXH 4X9YA 4IRSB 3MSPA 4L37A 4U4BA 3ULUF 4TNGA 4IMKA 4AGNA 2OR8A 2NY7H 1OZUA 2ERJC 2HX7A 4YSQA 4Z8FH 3BH8A 4LSQL 5C0GB 4R5XA 5FK9A 3TA3A 3GSXB 5CN1A 4X83A 4GT0A 2VN5A 2V3FA 2X3CA 3S9DB 1GMEA 2WQVA 2AAVA 1KPRB 1S5HA 4JO3L 4KQ4L 3VO0A 1UXSA 3Q5YA 3U9PH 3K71A 2QMKA 3H9HB 4KX7A 3KJ6L 3IS1X 3MRMA 5AVRB 4UT9L 4JG0L 2X4QA 5ITBH 2BJML 4JZOA 2WO4A 4Y4HC 1WFNA 2GJJA 5DO2D 4ODTH 2APVA 1CTNA 3PABB 5DEFB 3NCCB 2O6FA 1T66C 1RUAH 1IM3B 4KI5C 3T9WA 1HCFX 4F37F 3ZGIA 4AGPA 4XMLH 3MOAL 3VTAA 1N5YL 3MRBB 1R4XA 3MRQB 1EZLA 4OCLC 4F58H 5ANHA 5GIRB 1AFVL 4KNSA 3L3KB 3C5SA 4JPQA 1T22B 1BDYA 2I69A 1OOWA 1R17A 4N2EA 4B95C 5LG1A 3KXFD 4F8LA 4JQVC 2AXGA 2K70A 3GFUA 3NN8A 3GXIA 1U8NA 2WMPA 4OLWH 5LBSH 1R3KA 2QGEA 1T3FA 4EI5A 1X4ZA 2VXQH 5IWLC 3S97C 4NFBA 4R26L 2NY2C 4AMWA 1H3PH 5IY5B 1EUTA 3VXOB 3HNSL 1WPCA 2J8UF 2NY3C 1NICA 1SYSB 2QGDA 2XQYA 2YJQA 2CPUA 4ABUA 5CLYA 1TLKA 2WQXA 3VXSA 4W9IC 5B7EA 2EXTA 1SPDA 4G6KH 3KPLB 3L5WB 4MB5A 1LWJA 3WTXA 4ZSOB 2AQ2A 3QXAA 1IAKB 3G6DH 3BZFA 1IM9D 5C0ND 1XH1A 3OB0K 4XP5L 5FEBA 3L4VA 4WO4D 1ORSA 3QI9B 3H42H 4H0LC 2H0PA 1SXSA 4BQ9A 3BLKA 1ILUA 3Q2LA 3G6JB 1FO0A 2YQ3A 1QD0A 1REIA 3IRZA 1EJFA 1W16A 5FYLL 5GGQH 3VFNB 3ZXAC 5I73C 4MLIA 2F61A 1BVNP 3DK2A 3TNNB 1MJJB 3H6AA 1NFDB 3BUBA 5GZOA 1UKSA 1FSKC 5KVFE 2JK5A 4Z1PA 3IS0X 4JPVH 5B8CC 4PGDA 1A2YA 1BZEA 1MW0A 3HUJE 1R5VB 1YA5A 4MCMA 5I1JH 3OX8B 3DO7B 4DVBA 4U3CA 4P2AA 4E9TA 4G1EA 2EZ0D 4HULB 4PJFF 3DXAA 3SPHA 1G84A 2CALA 4C59B 2WP3O 4KZCA 1ZJAA 3T3MB 2BNRB 4K71C 4XOAA 2JTDA 1DJWA 3UO1H 1X3DA 3MLUH 4XGZA 4OKDA 3LQZB 1A9VA 4PLKC 3N40P 5CR1A 3LNEA 1DBBL 1W6LA 2WOYA 3O4LA 4LHJB 2ZKHL 4NRXB 3IETB 3TYGL 5IMOB 4OM0H 5KZCB 4NQXB 4QRSA 1SDDB 3CPLA 1CZ8L 3V4PL 1XSJA 2OV0A 1MFCH 3P30H 4PIRF 4GS7B 4JHWL 1F6LL 3AFLA 1H19A 2PLTA 1MY7A 2G30A 4CMMA 3GSUA 4AE1A 1F6AB 2ARWA 4PJIB 5FGRA 4DQAA 5J1TC 2VM3A 2F7IA 3C75A 2HT3C 3PQYA 3V0VB 1BXUA 1U8JA 4MX7B 1MWOA 2NNCA 2NSQA 3QPQD 3E3QC 1HL9A 4XX5A 4G9DA 5DJ8B 1UB6B 1J8KA 2H1XA 4E9QA 4PRNB 5F9OL 1MVUA 1OW0C 4DJMA 4PRIE 4XCYB 3U48A 5E23A 5JXED 4DQOL 4XRCB 4EI6B 5AKTA 2RCSH 2A6JA 1HSBB 4O2FB 4QOKE 5ITFA 3UMTA 3AABA 2Y7QB 5CINL 3FO9B 2ED7A 4KKAC 1KCWA 4ENZA 3SKJL 4F37K 1BEYL 4RDBA 5F89B 4EF3A 1Z3GH 1ZWIA 1P1ZB 2EO9A 2VDPB 1WWAX 3GQFA 2G9KA 4K94C 5LQBH 1A0QH 1IFHL 3MYJB 2H47C 4NM4H 5KW9L 3LHPH 4PG9A 2HMID 4U1LA 5LGHH 1OT4A 3PWNB 1BXXA 2F8IA 1FZOB 1QLRB 3LMJH 4P5SA 4WW2C 2BCKA 4AJYV 3BZEB 2WXLA 4UINL 3IGFA 4OQTL 2UX6A 3ELQA 4DERA 1OAQH 3LKQB 3RNKA 3RIFF 2B9BA 1KLGA 3MRJA 1NFKA 4K07A 4XMUA 1TKWB 4ZFFA 1TZHB 4X6DE 3VFSA 4Z7NB 2QTEA 1SMDA 4KVPA 1FQ9C 5EOTA 4PUBL 3T8XA 4KKRA 3GZKA 2IDFA 4HIEA 1JXKA 4ADGA 4EBQH 3VMPA 2B4CC 2FIRT 1OAXL 1WAAA 3NESA 5LXVA 3QUXC 2W8CA 5FPIA 1IZKA 3FAWA 1CB4A 4I9XA 3DWTA 1RK1B 5JHLH 5IQNA 2FWUA 2FYYA 5GSRB 4GG6A 3RKDD 3FFDB 4R8WH 4A2HA 3MACL 3BGFB 4NRYA 4KXDA 3QO0B 2X6VA 3FFCA 3I6KB 1WSST 3LPGA 1GPOL 3UACA 3VG9C 1IUZA 3I02A 1QUNB 1MF2H 1JGLL 3FQNA 1F58L 2R2EA 4IJ3C 3HE7C 1JVOA 5DJ2B 3IBOA 3OTTA 2DMHA 4QTFA 1NBVH 1SJHB 2Y5EA 2Y25A 1FJ1A 4RNRA 3WLBA 3U0WL 4QHKJ 1V3LA 3FH7A 3UABA 2YHGA 1INEL 4XN9A 4O5LL 5FS5A 5F2FA 3QNXB 4JMXA 3CSFA 4JHAH 2AK4B 4JN2A 2BIHA 3PNRB 3UPRA 1NCDL 2WZPA 5IQ9A 3WN5A 1PPIA 2C9VA 5D1QB 4G8GE 3WMSA 1G0DA 4CSTA 2NY6B 4N0UA 2J7LA 1RJLA 4GQZA 3TEUA 1G5GA 1KB9K 4EIGB 1K6QL 4PRAA 4ZRGA 3GS4A 1UCBH 2JMRA 3PCYA 3C6LA 3RWCA 2PXYB 4NZ8A 2HT4D 2F1AA 3UBFA 2C8NA 3BIKA 4YDIL 5D1XC 5C0CD 3BDYH 1LP9A 1QR4A 1PX4A 5F0MB 1EHAA 5EZPA 5JW5B 2R83A 1RZPA 5GSVA 3AQYA 1T5XB 4J8RA 1J8HE 1UM4L 1ZS8B 1IB5A 4M4RB 5IG7B 3SYOA 4NBYB 1NCBL 5CGMA 3EYFB 4APQA 4Z76A 2VQUA 8FABA 5FLVA 1A5FH 1QTSA 3NSCA 4CDGC 3HBQA 4YNYB 4IRJD 3UFIA 5INDB 1Z2KA 3LQAL 4FFYA 2TRHA 4KROB 2CBPA 1AR1D 4P3DA 4F20A 4L18A 2P24A 3R19A 4LL1A 4NN7B 2ZF9A 1KXQE 2WWNA 3ZW3A 4O51A 4XVSH 1UCTA 4QHUB 1BX2A 3WFHA 2QDWA 4OZGF 1IBFA 4JO4H 4ELMA 5DD6A 5DWUL 4JMNA 1A4CA 3ULVF 2RFXB 1RJCA 2CBTA 2JJVA 4R7LA 2FL5A 2B2XH 3IDIB 3F58L 3CVIL 4YHNA 3RPIB 4CU8A 4QRRE 4HC1L 1RPUA 4LF3A 1M71B 2N01B 2KBGA 3RIFK 3PWJA 6PCYA 1BQRA 2G2RB 2G9HA 2WSKA 3TT1H 2K9UA 4LQ1A 2C3VB 5I1EH 4FFWD 4IOFC 2X4UB 2XICA 1YY9D 4MZRA 3KPRB 2ICWA 5E9DD 3EKCA 4WFHE 4OZ4A 2HWZL 2XTSA 3TIEB 2A6IA 4BFRA 5GZND 3GXDA 5I6NA 5JIKA 2YQ2A 2E7LA 3U4EA 4JDTL 3QJUB 5ACZB 4XVTH 2I7OA 1OP3H 3D2UB 1TENA 1RXLA 1P9MC 4FI7A 5B1JA 2TRYA 4LCIL 2O61A 4JO1L 4PWGA 2GI0A 2IGFH 4BRJA 1QBLL 1FE8L 2PABA 2WN2A 2XHNA 3BHBB 2Z91A 3I74A 5CF3A 4EPSA 4WHTA 3BUYB 3FCSB 3TN0D 2HUHA 1WBZB 3B9AA 4LE8A 4Y1AE 5DD5L 2KERA 1JV5B 3P77A 4P2OB 4WZ9A 1HZHH 3VTMA 4GW4B 5DQJA 1HCVA 4S1QH 2E76C 1F45A 5BQ7B 3LKNA 1LEGA 4JKPH 4K94H 3C8DA 1ITCA 3E9TA 1P5UB 2UXVA 2H1PH 2Y3AA 1LD9A 2W94A 4XBGA 4AQEA 2NR6C 3VUAA 4XCCL 3CVHB 4JJOA 1RL1A 2Q8AL 1KGXA 1LEIB 1HK6A 4PPTA 1LHZA 3SDAC 3B43A 4RGMC 2KKQA 2PO6B 3MBWB 5I6MA 1S7XB 4Z95L 5DUBA 5IROC 3RJOA 1NKGA 4OZFB 2AVFA 3GSQA 1NDGA 4I0PC 1VGEH 2QT6A 5C2BL 2HLFC 4BFJA 5C0BE 4IDJL 4RMTA 4CSPA 3WFBH 3IXTA 4GJTB 3MGAA 1H5BB 3ZKXC 2YD4A 1R5IA 3TCTA 2VWEE 4LVEA 1QP1A 2ID5A 1ZS2A 3FT2B 4WU5B 1SDYA 2ZF8A 1HOEA 3SOBL 1M3JA 2ETWA 3OAYH 1PCXA 2B4CH 1MW2A 2FT8A 1JN6B 2YMTA 3EO0A 3DX4A 4LLUA 3Q1SL 4TVPH 4LCUA 2NQDA 1Z0NA 3IJYA 4GQ9H 4UIMB 5GGRY 3U0PB 3UBXG 4GOSA 1I1YA 4ZZKA 5JZ7D 2N7SA 2XBDA 4NCC2 1JZEA 4L8SB 3SB3A 4OCRH 3BPOB 3PWPB 5CP3H 5FKPB 1A1MB 5AVSB 3MQIA 2XX0A 1Z9PA 1A14L 2AEWA 4LAQH 2BSSB 3ABKB 3F84A 1U58A 4B0MM 4FQHA 4N0CC 4P23A 3HNVL 1GL4B 3ZDYB 3UYPB 1EAQA 1SEQH 2YPVH 1YEFH 3NPZB 4NQDD 4ONOA 4TNVF 1VESA 4AI7A 4JHUA 2D4FA 2HKAA 3NIGB 4KKCC 1ZPLA 3U6RB 3PP4L 4P4RB 2EYSA 4Z3EA 4PBDA 5A2CA 4X6FB 4P59L 3SY6A 1ET5A 4NHCH 1CXEA 3U9UA 3V6OC 2CKBA 2QGBA 5HJGA 3ISRA 1WFUA 3ZT5A 5FWQA 1SXNA 2Y07L 3AAZA 2E7DA 4WVRA 3CZSA 4GUCA 1A3LH 1JGVL 2PN5A 1MG3C 4L9LC 1Q1JL 5FW7A 2VL5A 3TA4D 4C4BA 4CA4A 1I8IA 1RZIA 4R4BB 4UQDA 4G42B 4ZX4A 4NKOB 5DRWA 3V5HB 3IFPA 4XNQA 2UWEB 2HRGA 4P46D 5LAPA 4JFYA 1HJBC 1KCRL 3VMOA 1UTDA 4B27A 5GHWL 3FYIB 3FUFA 4BINA 1P4BL 3WCYA 4KV5F 4P2QD 1FH2A 1ACCA 4RAHA 1F2XK 5DQ9B 3RUGE 5GS1B 3NTCH 1RULL 4Z5RB 1TEGA 4KC3B 4NJAH 2UZIH 3NVQA 3TX4A 1E9OB 3MV7E 3J2PA 3VXUB 5BRZB 1DJZA 3ZMNA 4Y0GA 4JQXA 2AEQL 5T1MA 5I71B 4PJEB 1N18A 1RZ7L 1XD0A 2WCGA 3IRPX 4QRPA 5HHPA 5FB8B 1HZKA 1L7TH 1BM3L 4PJFB 3QEQE 4AUYA 2OSWA 5KAQF 2VAJA 4KY1L 2GVYA 1NQBA 3ZHFA 1NTDA 4U7KA 4JRFA 1W8EA 1UGNA 3G6JA 1MI5B 1E7VA 4E9RA 4LEBA 1YAZA 4P5TD 1J5IA 3EIFA 3TNNA 2H2PC 2WVUA 3S3CB 1BWMA 2CE6A 4YHLL 1X44A 1ZLWK 4RAVA 5GGTL 3VFWB 1MZYA 4I0CC 4HMDA 1YMHA 2BIMA 2WXPA 3SO3C 3V4VL 1P7BA 3EJUA 4JO3H 3DVGB 4KQ4H 4Q8BA 4AZUA 1JXFA 2H45A 4FS0A 4FULA 2XN1A 1KTRL 2E9IA 1O75A 1IQDA 4K7FA 4NPKA 3KJ6H 1CWVA 4Q9RL 3LXBA 2JWYA 3HG1D 4UT9H 4E2OA 4JG0H 4MNGE 2AC0A 4FXGB 2WXJA 2BJMH 2X4RB 1I1FA 5AW8B 2FX8L 3CXHK 2AKRB 3HHSA 3X1FA 3UJIH 1LO0H 3T6XA 2E8YA 3GYRA 3J27A 1KXVA 2YAHA 3DGGB 2BSDA 4BJLA 4UM9A 3SQBA 3MV9A 2LR4A 5C0EB 3F85A 3JT0A 3EUUA 3MOAH 2CRYA 5C0NC 1N5YH 1E4KA 4A2DA 4F7MB 1X5HA 3D52A 3NJGA 1AFVH 4PJIA 3RPKA 1C5CH 1P4LA 5L4IA 4F7PB 3NSDA 4M5ZL 4HYTB 1UWFA 4BV1A 1QW8A 4F7TB 4BUGA 4TNVK 2B0SL 43CAB 2JLLA 4TM9A 4D0CB 1ZVSB 1FVDB 4Y4KD 3L3DB 4OQ1A 5HYQA 1G1CA 4LHUD 4S11A 2D31A 4PJ5E 1LK2B 3MLYH 4KRNA 4R26H 4XRCA 4GPVA 5EO1A 1IBZA 1H6TA 3QJSB 1PW3A 4NHUA 3HNSH 5K9QI 5I1AA 1HH6B 2ICWJ 4WEEA 4Y5VA 4ETYA 3EH1A 4LRNL 4O9HH 3ZYIA 2ZSWB 1MW3A 1JWMA 3IJ9A 2WP3T 5I15L 3BESR 2FR4A 4QKTA 4GBXC 4WKXA 2EXWD 4ODVL 1DQTA 2M2DA 2PUQT 1S2EA 2VKXA 4Y5YC 5I8KL 2CLZA 2DMBA 1I7ZA 1RQ5A 5DD1L 1FP5A 1EFXB 2QV2A 3JV5A 5AAMC 2JCCA 4U05A 4XP5H 5HI4C 3VRJA 4POZC 4PW9A 1I3RB 2XQYK 1A4JA 2MRYA 3B2DC 1IC5L 1TVDA 2DWSA 1U8QA 5FYLH 4ZXBD 3TEZA 4L8CA 1SJEB 4MXWL 4ONHA 2NX5E 4MJHA 1DFXA 4HPYL 1HOCA 3W2DL 1XHHA 2VZVA 5HGAB 4OUUB 4Y4HB 3T6VA 3QPQC 5FDYA 4DEWA 3RWFB 4QWWD 1XIWB 5FYJE 2MOQA 4GG6F 1LMKA