2WKPA

Structure of a photoactivatable rac1 containing lov2 wildtype
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
320
structure length
320
Chain Sequence
b'LATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
publication title A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase, cell adhesion
total genus 108
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2wkpA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wkpA02
4I3JA 1HT2E 1OFHA 2PX3A 4N3NA 5FTNA 2ODNA 1P60A 1SHZA 2RGEA 4HLCA 4JVLA 2W2XA 4NP6A 1KI9A 2EWVA 3KQLA 5BXQC 4HJ4A 4AKEA 3E2IA 1N0UA 3GLHE 3TAHA 2D02A 4JYBA 1WCV1 1GSIA 1W46A 2C95A 1WF3A 5FOUA 1Z3IX 5CK4A 3AVOA 5E3HA 5JBQA 1AZTA 1K5GA 2IF2A 5JS7A 1MZUA 521PA 3A1VA 3KFVA 2VP5A 3NG1A 4R70A 3CLVA 3PG5A 1P75A 2XSZD 1M34E 2PLFA 3KKPA 3AF4A 3LIBA 2HJVA 2IA5A 4A92A 1ETUA 4JMPA 2GBLC 3HYRA 4B32A 2QU8A 3EIEA 3ND8A 3GLFE 3FHCB 3HPRA 5HTKA 2ZBBA 1D5CA 1TL7C 1S4RA 2ZTSA 2IXEA 2EYUA 1Q1EA 1XCPA 3QSYA 4I1VA 1OXTA 4BFYA 1CXZA 4C9BA 4HNBA 3CPHA 2FPKA 1Y28A 3L0IB 3RRNA 2R9VA 1A2KC 4JGQA 3TLXA 3DM5A 5JWRA 2BMFA 3HDTA 3WXMA 1Q22A 3JVVA 2IX3A 1CBUA 4KO8A 2H18A 2PT5A 1HYQA 3B5JA 1ZRHA 3T61A 2VLGA 4AG6A 4DSNA 1RRCA 5SZHB 1YKSA 1ONBA 3UG7A 4OK5A 2YWEA 2REXB 2B7CA 3GJ5A 4KV9A 5CM9C 1EFUA 2JJ1D 3AB3A 3REFA 1XTRA 3HWSA 3OHMA 2O8CB 4PTLA 1Q20A 2Q3FA 5JJIA 2NG1A 3ETLA 4W7SA 4AYWA 1WBBA 2DFTA 3KJHA 2IC5A 2JLQA 4QNMA 5B57C 3NHQA 3TKLA 4KQDA 3QNUA 4KFSA 2WWXA 3T35A 2OWJA 3ULFA 1UBEA 4B3DA 2N1BA 4F4JA 1W49A 1QHSA 3CONA 2VHUA 1JEDA 3CRW1 3SI7A 2VF7A 2ZAMA 4JLOA 3P4XA 1T8TA 2A24A 1JAHA 2LKCA 4DLTA 2BASA 4LC0A 3S1AB 1G8GA 3CR7A 2RGAA 2ZRDA 2BC9A 1L7VC 2ZI6A 4UKDA 4Z54A 2QMHA 2HEIA 4JBWA 2XITA 4LHZA 5B30A 1WP9A 2ZM5A 1F2UA 2XTNA 1U8AA 2ATVA 2BWJA 1JQJC 4AI6A 4M9QA 2C2HA 4TYPA 5JS8A 1PLJA 3QXXA 3OAAD 5D3MB 4ABYA 4NYIR 3E70C 2A78A 2WOOA 5KDDA 3ZLJA 1TS7A 3OAAA 3R8CA 2JEOA 3FMIA 1T1AA 1Z29A 3U2QA 1AIPA 1CKEA 3FVQA 2WKQA 5LB4A 5KYKA 4DLUA 3ADCA 1UBGA 4JLNA 2G9NA 3VX4A 3CNLA 2N42A 2PLRA 3JZAA 4ZI3A 2VP9A 1JB1A 2VSXA 1BYWA 4Q00A 1II8A 3H82B 3EA5A 3B1XA 4M4SA 4MRVA 5TARA 2NPFA 4DSUA 1GRNA 2O8EB 3NBZC 4L8GA 2JLYA 3EC2A 4HAYA 2H7VA 1KI7A 3ZYCA 2B7BA 5E7MA 2Q3HA 1SVKA 2INWA 3KZ1E 3QBTA 5EZ5A 4FN5A 3FPAA 2IYQA 3WYGA 3V4RA 1XPRA 1P2VA 1CRPA 5D3QA 5GJCA 3THXA 1N6RA 1QHXA 1BO6A 2XNSA 3LXRA 1M8PA 1F2TA 1WA9A 1UKYA 2PEZA 3PV0A 1W4AA 3THOA 1DVRA 5E95A 5BN5A 2SHKA 2PL3A 5E7JA 4DLZA 3RABA 2ORIA 1G7RA 4QFMA 1OTBA 1VTKA 2FA9A 2D3WA 2AK3A 2FOLA 1D6JA 1XTIA 2O8FB 3ICYA 4Q4JB 5UKDA 4E5UA 3UB8A 3VR4A 1G8FA 2ZS8A 1EFRD 3K0FB 5EZ6B 5CM8B 2Z6CA 4DCSA 3MFYA 2E1RA 3PHYA 1EGAA 4GHIA 5BYKA 2AFIE 1EFRA 4IDNA 1OKKA 4XTRA 2IYSA 5CLLA 1CLUA 4BBTA 1LW7A 1XFQA 4TLBA 3QUSA 1DEKA 1ZC3A 4WOPA 1KI6B 3L43A 2PDRA 1MRNA 4R6LA 3SJZA 1E1RD 3K9LA 3FGNA 3VX3A 3R20A 4X8HA 1S67L 1OXSC 2IHBA 1T3HA 2NTYC 1MOZA 1VB6A 2YWFA 3NBYC 4PSVA 4GDFA 3GMTA 2RGBA 4JLPA 3KQNA 3BS4A 4NXEA 3EX7C 3NTUA 3CLOA 3AVYA 4P31A 3CKLA 2O8BB 5JJKA 3FDIA 1NN5A 4MDFA 4LJ9A 3SR0A 2NQ2C 3LX8A 3EXAA 1EWRA 3TSWA 5L3SB 3PJRA 5EXPA 4NYIQ 1L8QA 4F7WA 1ZBDA 2DBYA 1I2MA 4B3CA 4G01B 2IWHA 2A30A 2WV9A 3BY9A 4KUKA 4KFUA 2PZGA 4Q9IA 2OZEA 4G1UC 3THWA 2JLRA 4C2TA 1TQ4A 1NNEA 4L9GA 1OH8A 1QVAA 2A5YB 2QTVB 2Z0MA 4B34A 1NRJB 2VHCA 2YNMA 4EFNA 1P2SA 3BH6A 4FMCB 2J0UA 2DB3A 1Z6TA 4HZIA 4JT4A 5JI3E 1KO1A 2ATXA 2QGZA 3KB2A 1SKYB 1RRFA 3DOFA 4TLCA 3VU9B 3LIAA 3BXZA 3MJHA 3CWFA 5TY0A 4KLNA 4YMVA 1JPNA 3I8XA 4BZXA 2YKGA 1T3SA 4KYIB 4IVPA 2ZU0C 3WP1B 1RRGA 4NXGA 3ICQB 5HD5A 1N0WA 1E99A 3WNBA 2ZYUX 2UVQA 2JLWA 1H8ED 1MT0A 1O87A 5J47A 4I99A 1FTSA 4D4LA 1H8EA 1AGRA 2DR3A 3NC1C 4W9MC 3VNVA 3A0VA 3LDAA 3PUXA 2PBRA 2A7QA 2NGRA 1NMXA 2CNWD 5DISB 2JJ8A 1W0KD 3LI9A 2RAPA 3PEWA 2CNWA 2YC4C 3MMPA 3ZZUA 4BZQA 2PT7A 1W0KA 3QXCA 1XNJA 3PUWA 3B78A 2IYTA 2LWIA 4E04A 4DDUA 4TLEA 2CJWB 2MSDB 3VQTA 1SHKA 1ZM3A 2O8CA 1R8SA 4B48A 3SYLA 2PMDA 4LJ6A 4JLDA 3VR2A 4C7OB 2NO0A 1IN4A 3T06B 2GXQA 4IXMA 3GLGB 3GJ8A 4HB0A 3RRMA 2XJ9A 1GILA 3SJBA 4TMZA 4OJQA 1E0JA 2BEJA 1CR0A 2FSIA 1H8HD 2CMKA 3I5YA 4HH3A 5KSOA 5LD2B 1T1CA 2QM7A 2AX4A 4HSEA 4H6JB 1P72A 2BBSA 1H8HA 1XFAA 4RKFA 5DO9A 3S1AA 1X1SA 2B92A 2QPAA 4AKGA 1D2EA 1E2FA 5KUTA 1LF0A 4LLOB 4WUJA 1DTSA 1M7HA 3IIKA 2ERXA 2ZUCA 1TQ2A 3KUDA 4CEJB 2QY9A 5F6AA 4WA7A 2VV6A 5HCIA 2YKFA 3AVVA 2DYKA 4PQYA 4EJSB 4LGMA 1SXJC 1OYYA 3TGPA 1D06A 1DAFA 1T9HA 2FN4A 4RFVA 5D3MA 4B3FX 3AM1A 2ZUBA 5G4YA 4YWZA 1EFTA 5EE9A 4OQFA 4DJ3A 5E7IA 4JGOA 1TAGA 4DWJA 4EW7A 1Z0FA 3E4QA 2F3RA 3VOLA 2OBNA 3FG8A 4R9UC 3DZDA 3ZVLA 2J46A 5K8TA 2P7JA 3F1NA 4BFWA 4JYCA 3HP1A 1ODVA 1E2NA 4CIDA 4QGFA 2V55B 3IQWA 1OSNA 3TH5A 4JLJA 4EEPA 2RGNC 4HDQB 3H82A 3SBEA 2GXUA 3MQOA 1XJ0A 5DYIA 5FTJA 2O8EA 5J5CA 1RYFA 5DKKA 2GNOA 3LY5A 1R7RA 3RANA 2F55A 3FKSD 2QMOA 1KSHA 3C14C 1TF2A 4KFRA 4Q18A 1UWNX 3I92A 4Q4AB 1XXHB 5DN6D 3BIFA 4B75A 5AUQA 1U94A 5IU1A 5DN6A 5SZKB 5LBIA 5FFMA 2PR6A 1FP7A 2ZPTX 5J40A 3MAAC 2ZI4A 1N6HA 3D8BA 4NPHA 4GS9A 1BIFA 2ZSEA 3RHFA 2FZ4A 4OQXA 1P2TA 5EE5B 3PUZA 1TNDA 1YRBA 4QGHA 1VCMA 5DI3A 2FMXA 3CX6A 1E9FA 3GQBA 4Q4JA 1AK2A 3GP8A 4QBGB 1SZPA 2ORWA 3K0FA 3QKSB 1NG1A 2R6AA 1VCNA 4B3GA 3C15C 2L0WA 1XTQA 1W4CA 5AJVB 1FX0B 4RD4A 2X1VA 4IDHA 3QY0A 3I62A 5GVSA 1Z07A 3NOPC 1KI6A 4JLVA 5JCZA 3RS5A 1DAHA 1G3QA 4A8JC 4B2IA 2Z4SA 4EIWA 3K70C 4H9GA 1IY0A 2QI9C 3G6OA 2WMNB 2ZE6A 3GEHA 1KK1A 2BKUA 1T18A 3ADKA 4JLKA 4LBVA 5K8LA 2XEXA 4JVMA 1XEXB 3PVSA 1N6PA 2OEPA 2KBEA 5DNYB 2HF9A 4TL7A 1SKQA 1N6LA 3LLMA 4K81B 2ECKA 1D9XA 4EAQA 4NXFA 1B23P 5L3SA 4LY6A 1GRRA 5KPJA 1A5TA 2C9YA 3ZZ0A 2ZI7A 1S1CA 3K0CA 3UANA 1KDOA 2GF9A 4B74A 2H8KA 1V9YA 4HY8A 2OFXA 2FH5B 4KCGA 3GPLA 4PPNA 1OJLA 1T8UA 2BHRA 3KX2A 4P4TA 4OL0A 2X2FA 2ZOIA 5GJBA 4DLVA 5F69A 1OH7A 1P73A 1NI3A 1ELOA 3G82C 1JR3D 3TSZA 3VU9A 1XTJA 1QDEA 4DVGA 1T5IA 4YMWA 2PHYA 1G3RA 2QRNA 4IKEA 1JR3A 1QHNA 2I9VA 1XMJA 4JSYA 1A2BA 3CAXA 2ERYA 4F4IA 4ACAA 1FMJA 1KJYA 4OHWA 3AEZA 3HJIA 3PENA 4HAUA 4MKHA 3LLUA 2Z4RA 2PJRA 1UM8A 1QHIA 5FPHA 3EWSA 4DT1B 1T6NA 2IYLD 3KJIA 4J0QA 2DHRA 2ZSDA 3NH6A 1NIPA 2OFWA 4BBUA 3W5JA 3TR5A 1GP2A 1S4SA 2O0HA 1ZD9A 3BAFA 3MWKA 4B9OA 5IT5A 1W1WA 1MO4A 1FNNA 2GJ8A 4HIAA 1RRPA 2TMKA 5HCNA 3CRQA 4K8OA 2H1LA 2JGNA 4DLYA 1ESMA 1XBTA 1ZUIA 2V9PA 5ELXA 3TUIC 1UBFA 4D4MA 4DKXA 4PSKA 4OHYA 2QZ4A 3B60A 1R4AA 3VHXA 4OQMA 3P1JA 4DJ2A 1YZGA 5CIWA 3IS2A 3UWKA 2P6NA 1E2IA 4Q9KA 5KSZA 4QHTA 1VG9B 2VV7A 5HKKA 1QHYA 5J4LA 4E07A 5G53C 2PZFA 5LPNA 2QAGB 2ZRLA 3MGCA 3AP1A 3P4YA 5EP4A 4L15A 4C7OA 4F38A 1R0WA 1Z2CA 3EAQA 4JGRA 1E2QA 1C4OA 1NL3A 1HA3A 1OB2A 3GLGA 5IDVA 1VG8A 3VR5A 1E3MA 5JSZB 1SVSA 4TYQA 4ASUA 2XTZA 2GVDC 2AD5A 3MLEA 3GCGA 3QPWA 1OFTA 1RJ9B 3RRZA 2ZRAA 3CR8A 4KAXA 5AK0A 1JR3E 2CL7X 3ND9A 1KSGA 4NL4H 4H6JA 2WWIA 2Q6TA 1UDWA 2FEOA 3UMSA 3NBFA 1P97A 3KKOA 3ICEA 4ZDWA 1P2UA 4A0FA 1W48A 4CEJA 3AF3A 2R65A 2O8DB 2J7KA 3FFBA 5HWWA 1NIJA 5HDSA 1Q21A 4EPTA 1LY1A 3N2EA 4EJSA 3R8FA 1T0HB 4S2EA 3UATA 1UAAA 3X1WA 3QBVA 2QROA 3C7KA 2IYWA 2UZ3A 3E5HA 1OHHD 4MKIA 3BERA 3THYA 5LB2A 2VSOA 4WBSA 4TQUS 1OFIA 1OHHA 1NSTA 4NCNA 4CEHB 4CDGA 4CT4B 1IHUA 2AL7A 1JNYA 4X8LA 5EXSA 2ZR0A 1ZIOA 4C0QC 2IYUA 2F9LA 5FOTA 2ZEJA 1T91A 4I1SA 4HOIA 1QHHB 4ESHA 1VHTA 3I61A 1J99A 4DUGD 2VIIA 1MR3F 2OBLA 2MSEB 3VNUA 3UE6A 3TR0A 1ZVQA 3W5IA 4AIIA 4TZ6A 1G3IA 4YC7A 4HZUB 1KK3A 3C16C 3NHAA 1II0A 2J1LA 4Q4AA 1G21E 1XXHA 4C0LA 4V0OA 2IUUA 2PJZA 5CLQA 2P67A 3BE4A 1EFHA 2B8WA 1SVIA 2HT1A 1RW4A 3E4OA 1MABB 1YR9A 1ZP6A 3AVQA 4O2RA 2JDID 2VYFA 3IGFA 4Z51A 2OSBA 1NSFA 2R6GA 2JDIA 5DHFA 4EXOA 3X2SA 5JMTA 1P7CA 2WHXA 1OB5A 2X8AA 1IAQA 2L4RA 4TTPA 1G7CA 2V54A 4V0LA 3N5CA 1KNQA 1ZJ6A 4JJKA 3NDBB 3QKSA 1Q57A 3E1SA 5TVKA 3P27A 4LV6A 4LPZA 1RC8A 1GNQA 2GHIA 2ZETA 2WBLC 2W2TA 3GEEA 5FL7D 5FBLB 3QVVA 2HV1A 1P9WA 4RCZA 1SULA 1NY6A 2YKHA 1WRBA 4L4UA 5FL7A 3REGA 2WWHA 1YE8A 4JVNA 1G64A 1XEWY 2AWOA 1QVRA 3VR1A 1KY3A 2YINC 2J41A 1YJ5A 3EIQA 2C9OA 3SOPA 3VR6A 1Q0UA 3QJYA 1XEXA 3OFNA 4KJZA 3T34A 3I5XA 1T1BA 1RE0A 5C2JB 1KI2A 1E2LA 1U2RA 1OF1A 5HR5A 1TS8A 2J7PA 1Y3AA 1QHGA 1Q1ZA 1QG2A 1X0OA 2IWRA 4E03A 3U7FB 3CWQA 4BPBA 2J0QA 1MKYA 2J80A 4Y0VA 3BORA 3TAUA 4WZBE 3LH5A 4FMDB 4ZV4A 4EFLA 3K70B 4HI4A 2ZRPA 3DVLA 1F60A 1E1QA 3QKUA 4MKGA 4PC7A 3EZ6A 3ZZTA 1S9DA 4LBYA 4G0NA 3R7WB 3GJ3A 1LNZA 4CT5A 4A6PA 5EUMA 3IPYA 3F1PB 4K46A 5JCPA 3BB1A 2OO7A 2WWWA 3D7MA 4MKFA 3SNHA 3LIEA 3BGWA 3X1XA 3AKYA 1VIYA 1OH6A 2XXAA 1FMLA 1MH1A 2GKSA 1IQPA 6Q21A 3OIVA 1JEEA 1WE2A 2GF0A 1E98A 2D01A 2OCBA 2ODBA 2QG6A 2QMUA 1D2MA 2B6HA 3GLIA 4YMTA 2GETA 4CW7A 3I4LA 3NXSA 4JKIA 3ZS9A 4KSBA 5FUXA 2ZRCA 2RB4A 2P65A 3QF4B 1DO0A 1FPMA 3U3JA 3TW8B 1Z0AA 1PLKA 2W6ID 2P0EA 3EZ9A 1TS0A 4NDZA 4MGIR 1HY3A 1BOFA 4ZIRB 2W6IA 4OQLA 4PO1A 1F9IA 3SW1A 1LTQA 2BV3A 3IKJA 4LWZA 3TNFA 2NO6A 4TN1A 2EFDB 4TTQA 3TBKA 4DB2A 1FZQA 1G5RA 2QP4A 3D3QA 3MQQA 1J90A 4IJMA 4V0MA 4F92B 3PUYA 4A36A 1E9SA 4PPQA 3MCAA 4FW9A 4YMUA 2PR5A 4GNKA 4RY2A 4PHGA 2BBWA 3RNLA 3LAWA 1R5OA 1WA5A 2FGJA 2VP2A 2IYZA 4LSGA 4IVRA 3U3MA 1ZUNB 5KDOA 4QBHA 2ZJ2A 5DE3A 4URXR 5CITA 2IYXA 1M7BA 4YDSA 4A15A 3MWYW 1KK0A 4Q7LA 5F5YA 4PZZA 4M8NE 4EQ1A 1DP8A 4B6EA 4OK6A 2J0SA 4AD8A 1N5JA 2V6JA 1TS6A 4D0GA 4I3IA 5JSZA 4HP9A 2HT6A 4JLMA 4BLSA 1AA9A 3WBKA 1CTQA 1XU4A 2R6FA 1G4UR 1RJ9A 3H0KA 3TQCA 3WMGA 3LNCA 3K9NA 2WKRA 1SVLA 3GLIE 2AKAB 2E87A 2EWWA 4JS0A 2XJ4A 1XJ6A 5EE3A 3TVTA 1VECA 2QT0A 2ZYTX 4B6FA 3P7NA 4DLRA 4CYMA 1TEVA 1G7SA 5AVEA 2HXYA 1D7EA 3WYFA 4P4SB 3NBXX 2ZS7A 3UB6A 1EK0A 2ZQ5A 2W83A 4ARZA 2O8DA 1LSXA 2JASA 3C5CA 3GECA 4XJXA 5EUQB 4W5WA 4BECA 1NJGA 2GVZC 5EE0A 3A1UA 4KSCA 3TUJC 3W34A 1E4VA 2ZRGA 3LWNA 4HLUA 4M4XA 2G6BA 1W47A 1GIAA 2B02A 4O2LA 3UG6A 3WP0A 1G7TA 2KX6A 2MMGA 4H1UA 2ZREA 5FH9A 3FMOB 4KBFA 4D2IA 1P9RA 4QJ4A 2GRJA 3HR7A 1N5IA 3H9WA 3L0OA 2O5VA 3IHLA 4TMVA 8OHMA 2AK2A 1XD2B 1H65A 1QHHA 3TJZA 4Q7JB 4EPVA 3GFOA 2PMKA 4HDOB 4K08A 2QHKA 2C78A 2ZE7A 4QBFA 4HZUA 1D2NA 1N25A 2BMEA 4L9WA 4NTZA 4WN5A 4D81A 5BN3A 1KSFX 1XCMA 2DFNA 3ZJYA 2YOFA 5GJWC 5FBVB 3ZDQA 4GMXA 5C1BA 1W36B 2BVNA 3A4LA 1E69A 1MABA 3A6PC 4D26A 1KI3A 3CH4B 4TYWA 1UKEA 2WJYA 2D74A 4GI7A 1G18A 2KBFA 4Q9JA 1KHTA 3CX7A 1KKMA 4TZ0A 3DMNA 2NO1A 2AFHE 3W8NA 2B8TA 1G41A 1OJ5A 2OG2A 4LCBA 3RS3A 3TMKA 4M9XA 2I3BA 3UKDA 4JKYA 4R98A 4BWYA 2P2LA 1XJ2A 1S1ZA 3CO5A 1TUIA 2GXAA 4UXJA 3ZQJA 4C0JA 3ZIAD 3IQXA 1OT6A 1R10A 3CX8A 4Q21A 1OH5A 3G0HA 2GZDA 3GJ6A 3ZIAA 4ACBA 2ZSAA 2IT1A 1JI0A 4D25A 3LIDA 5KO2A 2Q0HA 2DPXA 1ZU5A 1OYWA 2KDKA 3CIOA 4TL6A 1DG3A 4HUQB 4PO9A 1P6XA 3U60B 1V9ZA 2OUKA 4HB2A 3VFDA 2CVHA 4MITA 5AJWA 3NKVA 1U81A 1XMSA 1HE8B 1E9EA 2F43B 3M0EA 3RTYA 4RKEA 3ECCA 3GJXC 3FYHA 1KSJA 3KX0X 3LD9A 4PXAA 3PUVA 1Z0IA 4NYMR 2PEYA 1ZU4A 1F6BA 1DAMA 3RLFA 5EP1A 1OKKD 2NZ8A 2ZE5A 1AN0A 2ZROA 3QIAA 3LICA 1GWNA 2WIAA 4X8OA 1YQTA 3AQ4A 1HURA 4OQNA 4PAQA 1JPJA 4C0BA 1U99A 3ONWA 1HT1E 2JLZA 1PZNA 4AC9A 4B71A 3A1SA 4DZZA 2CMNA 3FC7A 1KO7A 1NBMD 1XD9A 4JVSB 3HU1A 3R7WA 2DY1A 3F1PA 1NBMA 4QNRA 1WDTA 3VAAA 3CF2A 3Q3JB 4L5BA 4V03A 3NHBA 4GMDA 1G9XA 1TF5A 4RZUA 3UWOA 3W6NA 4DIDA 2BIFA 3VKHA 4Q48A 4DEYA 1U90A 3Q5DA 2ZJ8A 3EWAA 4EDHA 4Q7KA 1Z08A 4HH2A 3U6BA 1P61B 2J5XA 1PUIA 2X19A 3KXLA 5F9HA 2I1QA 2IXFA 4IOKA 1E2PA 4N0EA 5DJTA 4GOXA 4M9SA 1G3MA 4AYXA 1A4RA 5FTLA 5FUYA 2OCAA 2PD8A 1U98A 4JBYA 5B2ZA 3I1FA 3QF4A 1T19A 4IHQA 2GCOB 4CGZA 4Q47A 2ONJA 4A6XA 3I72A 1T4GA 2V8OA 4ZIRA 3ZD6A 4AKHA 4LRWA 3AKCA 4LC1A 2QA5A 1ZYUA 4C4PA 4FWTA 3A0RA 1UDXA 2JLSA 1YVDA 2H57A 5GVRA 3A8TA 2DFLA 1R0YA 3Q85A 3U7EB 1KDPA 2CLCX 3EZFA 2WPDD 2JHEA 1OIXA 1YR6A 2W27A 3DO6A 4OBEA 2IHYA 3BB3A 1GL7A 1GNRA 1K8RA 2WPDA 2ZITA 2VHQA 3B1WA 4KLZA 4LRYC 2VEDA 3O8BA 3TRFA 1S96A 1E9AA 1A82A 1P3JA 1OTEA 2Z43A 2A5FA 1Z6AA 2QMEA 3FFAA 1OE0A 4DSOA 1IN6A 4MGYR 3EW9A 1XPOA 1TMKA 1ZNWA 1E79D 5FL3A 1NBME 5F9FA 4M1TA 4DBLC 1NVXQ 1LFDB 3M4YA 4XWAA 1E79A 3G5UA 3T1TA 4M1WA 4NYMQ 4ESVA 2Y8EA 4Q1DA 2FPMA 5DGXA 4UNSA 1W7AA 1G1MA 5KSPA 3ZQ5A 4Q1BA 3DMDA 3W3AA 4LHXA 3GJ4A 3PIRA 1ZW6A 1XCGB 4MGKR 2O0JA 1U9IA 4D0NA 2IUSA 4D6PA 3L2OB 3LUQA 1ZNXA 2A5JA 4P4SA 5BYJA 721PA 3BD9A 3IPXA 5A0FA 4G3XA 4AG5A 3EEHA 4N0DA 5HZHA 3U7GA 1E96A 4URZR 1E0AA 3SBDA 4GT1A 2PH1A 2VPPA 1MO6A 1OXUA 1UPTA 2MMCA 3B85A 3HJNA 4TLAA 4JT2A 2Q21A 2OILA 4AY2A 5K8IA 2V1BA 4ZI2A 4HHDA 1GUAA 3ZH9B 1F5NA 3U61B 1IONA 1TQ6A 3EWKA 2F6RA 4W5HA 2QWSA 4OI1A 5HE8A 2FFAA 4A0GA 1ZCBA 5J4VA 1DARA 4XSHA 1S3GA 2QGNA 1XD2A 2GA8A 3K09A 2KE5A 1N9OA 5JHGB 1NJFA 3QXSA 4MUBA 4NE2A 5HPYB 1PVOA 4RCYA 5AUNB 1IXSB 2WAXA 2IXGA 4M1KA 2Z83A 3FKQA 1G6HA 3AV0B 3H4MA 3MSXA 3RSOA 3IHWA 1XEWX 3KQKA 4IOJA 1G5TA 3O47A 4BQSA 4EPXA 1W36D 3AGPA 3NOTC 2L0XA 4URYR 4XWKA 4PKYG 3PEYA 3CH5A 1DPFA 4WW0A 2Q3MA 1CEEA 3BFKA 3GD7A 3EPHA 2CLDX 2AXPA 2JN7A 3QKTA 4RZ3A 4Q5IA 3SQXA 1OTAA 3TUZC 4GBMA 2X77A 3LVRE 1UJ2A 5EE1A 1SVMA 1YZQA 1IOZA 1OFUX 1R0XA 2F3TA 2GJAA 1E2MA 2JIZA 4IDQA 1NVUQ 5HZKA 2UZIR 4FI3C 1E2DA 4A0HA 4WLAA 3U5ZB 3IBYA 1E2KA 1VYUA 2FSFA 3RS2A 4A2PA 3RS7A 2FZLA 5FI1B 3LBHA 3PR1A 3UXMA 1G8PA 1IM2A 1KO8A 2QTFA 1XJ4A 4P3YA 3QVUA 5B64A 2QE7D 5FPKA 3B7GA 1US8B 4U5XA 1U8ZA 3BJIC 2BOVA 2QE7A 2ZRMA 4EPWA 4ZCMA 2O8FA 2QPTA 5FBQB 3CW2A 1L2TA 4MRNA 4GZLA 2YHSA 3EA0A 3O8RA 3X1ZA 1U0JA 4IRUB 4NYJR 2DWOA 4PZYA 1XTSA 5CDFA 2HUPA 2LCFA 2R6DA 5EP2A 2QQEA 4YLGA 4BASA 1YZTA 2OESA 4G5QA 4IXNA 3FHOA 4D4JA 1CS4C 4MRRA 4M1MA 5A8BA 2BCGY 2IBMA 1TUEA 4RD3A 4LV8B 1JXMA 4MN6A 2Q9BA 1GKIA 2HYDA 3IDQA 5TB5A 2C9CA 2BDTA 1NWZA 2C99A 2IF0A 3L8ZA 4KFTA 5TDHA 3V00A 4UQOA 1FUUA 2J9RA 4GL2A 4I39A 1RPZA 4HLQB 2GWHA 2F1IA 4TMTA 1Q12A 1WBDA 2G77B 3CPJB 5CK5A 2VHTA 1SVWA 3KKNA 2FX3A 2VH5R 2WAYA 2A2ZA 1QRAA 1OTIA 1MRSA 1UBCA 1DG1G 2V7QA 4MYHA 4ITRC 3HJKA 2O8BA 5BN4A 2CCKA 2FSHA 3GJ7A 2O0KA 4ZKEA 5JECA 1VG0B 2CL6X 3PCRB 4LHYA 1X8JA 1BS1A 2E9SA 4HLUC 1S9HA 4OI0A 4Q4LA 2CE7A 4B3BA 3SN6A 1E32A 5AJXA 2WIBA 4WIAA 1AS2A 2C04A 4WZAE 2GCOA 1KGDA 1G8HA 2IYYA 3U44B 4A82A 3W9YA 2ZJOA 2ZRIA 3NDPA 4TWZA 1VKJA 4JSTA 1HV8A 4TSFD 4XVQA 4M53A 5KPDA 3IILA 1S3SA 2QM8A 2QP3A 3F8TA 3KQUA 4MUAA 4TSFA 5CJPA 5CYOA 2QAJA 2ZJBA 2FDCA 2I1VB 5JWHA 2V9AA 2QRZA 1G8YA 3LVQE 2UKDA 2K7SA 4LJ8A 1G16A 3PFIA 1MV5A 5F2EA 2ZSFA 4IDOA 4AK9A 2VA8A 2D7CA 2GEDA 1O3YA 2C98A 3PITA 5FR1A 4YQFA 2YZ2A 5LDDC 1ESNA 4G5GA 3SU8A 3GLFB 1S4QA 4OYHA 4US0R 4FINA 1I4DD 4QOSA 1C9KA 2YOGA 3TSOA 4DSTA 1CJKC 3AVWA 1SXJB 4QJ5A 1E4YA 4A2WA 3SYNA 1SVOA 1OIWA 1Z6XA 3X1YA 2IEYA 121PA 3CBQA 3KTAB 4S35A 3OIWA 3BH7A 1YHNA 4GW9A 5IS1A 4LJ5A 5F98A 3P32A 1XPUA 1NN3A 2OWHA 4KVAA 1LB1B 4NYJQ 3TK1A 4QG7A 5ANRB 4BFZA 3I73A 3T15A 3VKWA 4MH0R 4Q1FA 3RRYA 5HKKD 2EQBA 3C41J 3HU2A 2CEAA 1N6OA 4GZMA 1R8QA 3HPQA 1GNPA 2QUZA 4XTCS 4HJ6A 1QF9A 4U02A 2CJWA 4UNPA 1KY2A 1EWQA 1GRQA 2OE2A 4BGDA 1KKLA 3KJEA 2J87A 2C77A 3TW4A 4MYTA 2Q9CA 1W2GA 1N6KA 4ASUD 2GEVA 5M04A 4QM6A 1GITA 1P9NA 1VMAA 5J4KA 3OESA 1GSWA 1XF9A 4POAA 3ZVNA 1VYTA 1ZD8A 5L3QB 3L82B 3PXGA 4HP4A 1SKYE 3LRPA 3ZQ6A 3SZRA 4FD2A 4DDTA 2QEQA 3W6OA 1W2HA 3LX5A 1NN1A 1D8TA 2BCJQ 1XX6A 2QNRA 1F3OA 1KJWA 5H8WA 1UWPX 2ZR9A 3QI2A 2ZRKA 4DCTA 2AKYA 3K0EA 3LBNA 3UB7A 4WL9A 1QG4A 1TU4A 2GJSA 1BYUA 1G6OA 5JLJA 4FMCF 2JCSA 1GVNB 1S0UA 3NVAA 2CE2X 4URWR 1S1YA 1UFQA 2EYQA 3B1YA 1WQ1R 5AWFC 2WWGA 1N6IA 2F7SA 2J3EA 2Z5FA 3U3KA 3UK6A 4C3ZA 1DELA 1ZM9A 1VPLA 1G20E 4I1OA 5JJLA 4HATA 4NXBA 1GM5A 1R5BA 3IBRA 3OLOA 1RIFA 3C8UA 4JBXA 1G19A 2ANBA 4HJ3A 1KDRA 2QSZA 4LV5B 2GZHA 4A8JB 4DCUA 1X8KA 4DDWA 5AJYA 3BY8A 1F48A 4MQBA 1FQKA 1KJZA 5G40A 2REBA 4X8MA 2XB2A 4BFSA 3T1OA 3K0AB 3ZD7A 2K5UA 3MR0A 4M21A 4NHOA 5AR1A 1N9LA 4KU4A 3AVXA 5FBWB 1DOAA 3PEVA 4B76A 4EFMA 1CJTC 3LBIA 5SZJA 5TBMB 3FB4A 4YXWA 2JLXA 1JAIA 5IHPA 2OCPA 2ZVQX 3GLGE 4KUOA 2A5GA 3ASYA 1M7GA 1OLOA 1FP6A 3H1TA 3SHWA 1NKSA 3LFUA 4AYTA 1JECA 1KI1A 2XGJA 1MO5A 2ZS9A 1W5SA 1EG7A 1HE1C 2NMVA 1OIVA 1US8A 4ZPXA 5GADl 4RSGA 4U00A 5CJ2A 1K5DA 2F1RA 1ZC4A 3U7HB 2GCPA 1T5LA 2OOLA 3CRRA 4V0NA 1WXQA 2CK3D 4FIDA 1YZUA 1F2UB 2PZEA 2IS6A 1E9RA 3RWOA 1P5ZB 2FFHA 4Z8XA 2V4ZA 2CK3A 4URVR 4XVUA 1OV4A 1XDBA 5CIQA 4R2IA 4TL8A 4FWIB 4CF7A 4HB4A 1FX0A 2M1CA 1NF3A 4RFSB 3EPLA 4FXPA 4DEXA 3B1VA 1P4SA 2CHGA 4B2LA 3OE7D 1NG9A 3WRXC 4UXHA 5KIZA 2PCJA 4M9ZA 1CF4A 2ZJAA 5EFWA 1KI4A 1RZ3A 1VDZA 2R6CA 3OE7A 3BFVA 2EVWX 3OFND 2OXCA 3QEOA 4EESA 3OEED 1GSVA 3CZPA 2V1UA 1V43A 2BM1A 2J7PD 3WHKA 1HEIA 3OEEA 1LS6A 1R2QA 4FCVA 5KTYA 1KYIA 1X1RA 3KB1A 1F98A 1XXHE 4LYHA 4Z8YA 4BLPA 1YU9A 3QENA 1COWA 2GEUA 5G3ZA 1E1QD 2V6IA 2VBCA 1W44A 2EU8A 3LYXA 5I5LA 4MGZR 5FI0B 4LOAA 5TXGA 1E0KA 3FHTA 2NOAA 1FL9A 1BMFA 5DYGA 4DCNA 1GAJA 3WY9A 3LXXA 3CRVA 1D9ZA 3ZVMA 3AUXA 1Z6GA 3K8YA 4B3XA 4HEJA 1JR6A 1KZ7B 2JJ2D 1ZUHA 3IEUA 2ZRNA 3O8CA 1E9CA 5J4YA 2LKDA 2OXRA 1CJMA 1S8FA 2JJ2A 5KSYA 3AVUA 2CHVA 3CPEA 5J7EA 3DKPA 1NN0A 2EFGA 1KMQA 4A1FA 2GZAA 1W36C 1PUJA 1GSXA 2ODEA 3GLFA 1SXJD 1HUQA 5KHOC 4WF0A 1JQLB 1Q1QA 2KB0A 4LHVA 2XZOA 2GK7A 4DT1A 2QJ7A 3CZQA 5JWOA 4PQRA 4BFTA 1SXJA 2BJVA 2IEZA 4P4UA 3IEVA 1IN5A 2FWRA 2W0NA 421PA 4BFVA 1NLZA 3KJGA 2PYRA 1IBRA 4G5OA 1OT9A 1KO4A 3SEAA 1XMIA 2RGDA 3JVUA 4Q9LA 3RS4A 3QKRB 1GKUB 3LW8A 1IXZA 1KNXA 3AUYA 1RKBA 3F1OB 4B73A 2MSCB 3THWB 4GP6A 2P5TB 2D06A 3K9HA 2RGNA 3I32A 4UXIA 3K0SA 2FSGA 4RD0A 5IF9A 1KOUA 1LS1A 1W0JD 3DZ8A 4LBZA 5FTKA 2QAGA 5G3YA 1AGPA 1CRQA 3F5FA 4OHXA 2FGKA 1W0JA 1QBKC 2GK6A 1JALA 3GFPA 2XNDD 1VG1A 2J0UB 4PAOA 1TPZA 5TV2A 1Q3HA 2FEMA 3HYTA 3LQRA 3UIEA 2XNDA 5L3QA 1DADA 3BOSA 3M6AA 5G4ZA 1DE0A 4F91B 2F9MA 5JHHB 1ZNZA 4I4LA 4IDPA 2XSZA 3NC0C 2GDJA 1PLLA 3LW7A 5CYPA 3CRMA 1W4BA 3FWYA 4LJ4A 3B6EA 4EQ6B 2PYPA 2FE4A 1X86B 3C4JA 4OK3A 2FG5A 4WXRA 5J4HA 5SZIA 1SXJE 2QORA 3HR8A 2ZE8A 4M1SA 4Q9HA 1M74A 1DBSA 3MWLA 2FNAA 4WZ6A 1CULC 1Z63A 2C96A 5KNCA 4LUCA 2ODWA 3K70D 2XZLA 4V0ME 4M1YA 1IJEA 3CF0A 3I3SR 2QQ0A 3NOUC 4A8JA 3P20A 2RH5A 4Q19A 1XZPA 4CEHA 2DWQA 1Z6YA 2QPOA 3KXKA 3QPVA 2ZSBA 2RMKA 4H1VA 3K0AA 3K0CC 3U3OA 2GAOA 4LBWA 3Q5EA 2JJ1A 1X8LA 4JGPA 2QL6A 3FE2A 4JLAA 1ZM4A 3N2IA 1BKDR 2IK8A 5C18A 2C8VA 5TBMA 2ZJZA 4URUR 3QPUA 4IEIA 2AXNA 2HYIC 3R9XA 4F93B 4PC1A 5DLQC 4WXPA 4DHEA 4C0HA 4LJAA 2W2VA 2G83A 3BFXA 4EETB 1J2JA 4BBVA 5F68A 4V0KA 4PC2A 3N70A 1GZSA 1Y63A 2WM9B 2KWIA 4NU0A 2EFHB 4HB3A 3RC8A 1BYIA 2HDNB 4GFDA 2JLVA 4Q01A 5EJEA 1GL6A 4QBIA 5C4MA 4TYNA 4C0AC 4HAVA 4ZDKA 4JLBA 4M2LA 4OHVA 5GJVC 2ANCA 2GAAA 3H86A 4I1UA 4LDJA 3MG9A 1KOFA 2FJUA 1YZKA 4D82A 1EXMA 2WVJA 1OJGA 3FMPB 2NZJA 3WHLA 3WMEA 2WWYA 5AUPB 5JZVA 1NLFA 1NVWQ 5H70A 3CF6R 1XTKA 3IO5A 4RFSA 2BEKA 1CJVC 1GTVA 1T3LA 2IYRA 2R44A 4PAMA 1X6VA 3QE0A 4IEEA 4C0KA 2FFBA 2FU5C 4M0LA 2CDNA 5JFGA 5K8UA 4GP7A 2I4IA 3F1NB 2QJ5A 1E9DA 3D72A 2OHFA 4OI4A 3GFTA 3MFXA 5E4FA 1NMZA 5C4GB 3SS8A 4NCJA 4ON9A 4DLSA 1GDDA 1K6MA 1XD8A 2OLKA 2W00A 3OF5A 1RYHA 2EFEB 2QENA 4QGAA 4CEIB 1CR1A 2DCUA 4MN5A 1OPXA 1E9BA 1YZLA 2IS1A 4IOLA 3T1VA 4NZYA 3MRSA 4O25A 4MDEA 1YRAA 2QBYB 5JI2E 3B9PA 4GS9B 1JXOA 4ILEA 5LD2C 3AVTA 2FFQA 4RD6A 1Z83A 2BJWA 1N0VC 5DI3B 3RDPA 1Q1BA 5IK2D 4TYYA 4HI0E 4EPYA 2H92A 2W0SA 4DRZA 4JJZA 3ZVRA 2V0UA 5IK2A 1JBKA 3F0TA 1HQCA 2F1HA 3VHLB 3BWLA 3QXHA 1AKEA 5G41A 4DXAA 2OLJA 5DI9A 1DP6A 4BLQA 5HWTA 3UMFA 1AS0A 4EJSC 2ZJ5A 4NKRA 4QRHA 2HV8A 4C0SA 3T5DA 4LI0A 3VR3A 2DFKB 2P3SA 2RHMA 4LYAA 4BLOA 1OTDA 2VSFA 4MYUA 4Q1EA 4Q1CA 1NLYA 3VE3A 2CBZA 2D2FA 2WJJA 1E1RA 2VV8A 2Z6DA 5FOXA 4LX0A 4XOIA 1VHLA 2QN6A 1FTNA 3A1TA 4M1OA 4MRPA 1E2GA 1EFCA 2Z6VA 3AKDA 2VHJA 3H2YA 5P21A 4NCKA 3K9GA 3I8SA 1R0ZA 4LYFA 4PR0A 3Q7PA 5KNDA 4PX9A 4NMMA 1ZINA 3QKRA 3MWJA 1LL8A 3H84A 4R7ZA 1AM4D 1G17A 1IXRC 2O52A 1CR2A 1U0LA 3AP3A 3F1OA 2CVFA 4FMBB 4KVGA 1HQYE 3LO5A 4QL3A 5HD3A 621PA 3MUFA 5FR2A 2VF8A 3UMEA 4E22A 2PCLA 2ZYWX 4B35A 1RFLA 4HDCA 5KNBA 3BWDD 1EW0A 1GFIA 1I4LD 1WMSA 4NCHA 3F3YA 1S1MA 3A1WA 2CCGA 4A0RA 2G1KA 3BH0A 1QZXA 3OZXA 2ZXUA 1AKYA 2QP9X 3RS0A 4KXFB 1LT0A 3QQ5A 1KAOA 4FMDF 5B58C 2HF8A 4O0MA 2IYVA 4G5SA 4F3LB 1DAGA 1L4YA 5FUVA 3OIYA 1AQYA 2G0NA 3PQCA 4BFXA 4EUNA 2ZIAA 2JAQA 1CP2A 1TADA 4L16A 1JNUA 3QG1A 4FCTA 1IJFA 1XRJA 2WJHA 3LV8A 3RC3A 4TTRA 3EZ7A 3AF1A 4EQ6A 1Z8FA 3VE4A 4I38A 2D62A 4HAWA 4HYYA 3SE0A 4XH9B 2VTKA 3L8YA 2G1JA 2JA1A 2D2EA 1TX4B 4TQ9A 1Z06A 2W6JD 2G88A 4GOKA 4BRWA 2ZUDA 3B8HA 3O8DA 1ZNYA 5AVFA 3EIHA 4ZKDA 4XWOA 3WNCA 1UADA 2A9KA 2W6JA 3QOFA 2WKPA 821PA 2V1AA 4UJ5A 1DO2A 5EQTA 3IS2B 1AJEA 2J45A 1ANKA 1G5PA 1T0JB 3L0SA 4PKYA 4WAUA 5BQ5A 1VYVA 3D6TB 5L3RA 2QTHA 1ZCAA 3CWZA 5FTMA 4R38A 2VP4A 4TMWA 1XWIA 5HSQA 3EC1A 2CHQA 4JL5A 1UF9A 1Z28A 2AR7A 5FOSA 3H7WB 3VKGA 3C8CA 1UEIA 3K53A 2ONKA 2H28A 2OM2A 1DAEA 2VRWA 2ZJYA 3D31A 1ZD1A 3SC3A 1LF5A 3AKEA 3RH8B 5DHAA 1Z2AA 2GCNA 1Z0JA 2WJGA 3B33A 2YVUA 5DKLA 4M22A 4MRSA 4Q4HB 4XVRA 5CB8A 1XFNA 3RYTC 3SJAA 3LIFA 4R71A 4TMXA 2EA9A 2KJQA 2WZQA 2GJ9A 3PYPA 5FUWA 1Q3TA 3B9QA 3BRWD 2JIZD 1P0ZA 1KMHB 2RHDA 3UMDA 5DIFA 3MD0A 4DCVA 2B21A 3W6PA 5L3VA 5AUOB 4B43A 4R2HA 3B82A 4ZO4A 4BE7B 1ODFA 4QKQA 1TTTA 1XMVA 3W90A 2QSYA 2FF7A 2OAP1 4UNQA 2V3CC 2ZRHA 3THYB 3KFXA 4KHZA 3DDCA 1I4TD 1KI8A 3JZMA 3WNDA 2EFCB 1DAIA 1UKZA 3CM0A 3MJRA 3ZGXA 3AF2A 2WWFA 4UJ3A 1M2OB 3LI8A 3M1IA 4HUQA 3MJQA 1FW6A 1HH4A 2BBOA 3K1JA 1FFHA 1XJCA 4KITB 1G28A 4TMKA 1KZGB 2A5DA 2OV2A 2F43A 3KDSE 3ADBA 2RGXA 3NH9A 1DAKA 3AH8A 2QAGC 4CEIA 3Q8XB 5L8VA 3U4QB 1G4AE 4LJ7A 3V9PA 1ZM2A 1CIPA 3OIUA 1SQ5A 4UNNA 4I3AA 3FKSA 1FQJA 2GBLA 2ZVPX 4PQFA 2HCJB 1GOTA 4GSYA 4I5SA 3PEUA 1IY1A 2C03A 1J70A 1SGWA 2JATA 3QXJA 3DKVA 4YONB 3TE6A 2QBYA 1N9NA 3W3ZB 1OT3A 4AKIA 3A4NA 4TT3D 2NPIA 2ZOHA 1V5WA 2WTUA 1TQDA 3EPJA 4TT3A 3AGQA 2V7QD 3CNOA 1JJ7A 4B44A 4RD1A 5KU1A 2HLDD 2WSMA 2V0WA 1J8MF 2OAQ1 4QJ3A 1GG2A 1J7KA 4KODA 1A1VA 4XT2B 2ZAOA 2HLDA 4OHZA 3T50A 2GJ3A 3X1DA 1FOEB 1J8YF 2N46A 3MXQA 4JIMA 2XX3A 4PPFA 4LPKA 4ZCLA 3RAPR 3KUCA 2IS4A 1ZMXA 3P26A 4PPGA 1Z22A 4PZLA 5H68A 4A2QA 3A36A 1PJRA 3FMFA 2H16A 1LV7A 4QHSA 4CRWB 4YMSA 2KSQA 3ADDA 2GILA 2OFOA 2CXXA 2YWHA 2HCBA 2BMDA 3EASA 4PHFA 3T5GA 3GLHB 4P33A 5KOYA 4HQAA 5FPTA 4I81A 4C2UA 2J0VA 1TU3A 4TL9A 3T12A 1L4UA 5A5GA 1Z47A 5BW8A 3U6KA 2REOA 4A4DA 2DWPA 2YV5A 3R9IA 1GKYA 2AD1A 3GJ0A 4LJYA 4L9EA 2EW1A 2GJKA 1NVVR 1E2EA 1FUKA 2IUTA 5EXXA 4RQ9A 3KKMA 4DJTA 2GTPA 5CDFE 4FCWA 3SHFA 3DEFA 3NWJA 3OEHD 1XEFA 5TMPA 4BRUA 4D4KA 4US1R 1KK2A 3HU3A 2OBMA 2VP6A 4C30A 3OEHA 4NBSA 2C5LA 1NP6A 3EPKA 2WMOB 5FOVA 1DS6A 2R78A 3IBGA 4BEBA 3A0SA 4L9SA 4EKDA 1Z0KA 1KO5A 2VLIA 2R62A 4F4CA 2X2EA 2H5EA 3IUYA 3C2WA 4D80A 4BZPA 2XXAB 5JRZA 3V4FA 4Z1MD 5FOWA 4RD2A 1CR4A 4B2PA 2RKOA 2P6RA 4DIEA 2QT1A 1E94E 2IL1A 3A4MA 4Z1MA 3UB9A 4A9AA 4F3LA 4JL8A 3GLIB 2ORVA 3IO3A 2CL0X 4AURA 1NY5A 5IRCD 3A37A 2ZI3A 4IFBA 2W58A 3E4PA 2OCYC 1OXVA 1KDTA 4Y0AA 5DSZA 1Q44A 4LZZA 3EZ2A 3TIFA 1HTWA 5BWMA 3DHWC 1G291 2CLSA 2YWGA 3KKQA 5DH9A 1RVDA 2BBTA 2WOJA 2ZRBA 3SJCA 4KI0A 4AWXA 4LHWA 2QKPA 2ZRJA 5CB6A 3SFZA 3CNNA 2PD7A 1ZM7A 2XOKD 5C46F 4MYCA 1JJVA 2ZR7A 4DB4A 5JEDA 5FPSA 2XOKA 3B13B 1AQUA 5AJZA 2Q9AA 1BH2A 3SYKA 4HAZA 4PHTA 4LK2A 4ERNA 2H17A 4NH0A 2WJVA 3VMFA 4CZ2A 2ZANA 4Q66C 4V02A 5DJUA 1Z5ZA 3IIMA 1G3UA 1E6CA 3H7WA 4JL6A 3LA6A 4EEUA 3FTQA 5J4EA 1S2MA 2ZU6A 2CCJA 4PSAA 1LVGA 3NEYA 1E2HA 1UKVY 4IVQA 4ZCIA 4GRAA 1NVVQ 1MO3A 1TEXA 4P32A 2GESA 4EPRA 1NKTA 3BK7A 4EERA 2HJGA 2FV8A 4PFSA 4Q4HA 1A7JA 2F1JA 4Q03A 4LPSA 3Q7QA 3DOEA 1LSWA 1VIAA 1EX7A 4XD7D 4TLDA 2L1MA 1KTVA 4N1AA 2XAUA 3SFVA 3NEJA 1KMHA 2XTMA 1E2JA 4ARZB 4GCZA 3K3DA 4XD7A 4YXWD 1W4RA 1DRMA 1CU1A 4BEJA 4IW3B 4NONA 4Q1AA 3IIJA 5EXTA 4B33A 4QGGA 3FOZA 3AF0A 4LRZE 4II7A 3W8RA 2FPLA 2R8RA 2YC2C 4OJKA 3TVDA 2WSSD 4UNRA 2P6UA 1ZIPA 2KI5A 4QM7A 1N3BA 1GL9B 4LRXC 2WSSA 3NIBA 1I2DA 1N5KA 3EARA 2HXSA 1VCIA 4RJLA 1X3SA 1OXXK 1PV4A 2A24B 5HDDA 4L9FA 3UPUA 3KQHA 1C1YA 1ZAKA 2W0MA 4WVFA 4OI2A 1XB2A 2VO1A 4G5RA 3KXIA 2AWNA 2BMJA 4LYJA 2P5SA 5F3WB 3SQWA 4D0LB 2AN9A 1OW3B 4P0TA 3WMFA 4DUGA 3ASZA 3EG5A 1XJQA 3QG5A 3U4QA 4W5JA 5J3WA 1YR8A 4MA4A 2VEAA 2A3RA 2J59A 4XIGS 1FNMA 1II9A 2BKEA 1M1YE 3RVBA 4BLTA 4QC2A 4US2R 3BC1A 4DC9A 3VTKA 3NJAA 4OKSA 1M6NA 2ZI9A 5EP3A 1Z0DA 1R6BX 3CB4A 3B2EA 2D7DA 2IW3A 5HDCA 1IY2A 3RWMB 4YDHB 2OT3B 3DPUA 4HAXA 4BLRA 4B47A 1U9IC 4U7DA 1U8YA 4CVNA 1II8B 3SDZA 2GXSA 4PC3A 2YJTD 4RZ2A 5JRJA 3CUEF 1AZSC 2NO7A 1W5TA 4R3AA 1UGUA 4BUJA 1AS3A 5HWVA 3R9WA 4XT2A 2ZYVX 3BB4A 4GOJA 5H1YA 1N2CE 1XP8A 2NO9A 3L0PA 2BM0A 3Q9LA 5JEEA 1COWD 1WB9A 3C5HA 4Q02A 2ZI5A 4JZKA 4E09A 2YOHA 1N6NA 3THXB 4PO8A 1VCOA 1UEJA 4IFEA 1F2TB 2VP0A 4PANA 2PX0A 3TQFA 1BMFD 2V1XA 1S66L 3AP2A 3QEJA 4KYUA 3RSLA 3WBJA 3DL0A 4DDVA 3U44A 3GLHA 3GDIA 1XJ3A 3Q72A 3WYAA 2NIPA 2R2AA 1EESA 4QHYA 3J81k 1E0SA 3WRYC 3B1ZA 4ZDIA 3K09C 1U0HC 2ZRFA 4PC6A 1XZQA 2ASEA 2RGCA 3DM9B 3KL4A 1EX6A 3K3CA 221PA 5KDLA 2WICA 4GHIB 4GPTA 2RGGA 1DP9A 3QF7A 4RVCA 2YYZA 2WJIA 3LQQA 1B0UA 2G3YA 4QXAA 4O3MA 1IN8A 3A58B 4DLWA 4ZDJA 2XZPA 1TF7A 1NMYA 1LSVA 5FBRB 2JLUA 2VQSA 3ZS8A 3GEIA 1KIMA 4Q7MB 4HLDA 4KBGA 5A4JA 1N5LA 3UMRA 4NCIA 4XSGA 4HUTA 2XB4A 2AHOA 3T1QA 2G0TA 3U3RA 4PHHA 1P62B 3KTAA 1CJUC 5HE9A 2VL7A 4DLXA 3AVPA 2IS2A 1IN7A 1R5NA 5FPYA 4TQAA 2D4HA 1YR7A 2RCNA 4BFUA 4IOMA 1YZNA 4RZXA 1KAGA 3BBPA
chains in the Genus database with same CATH superfamily
1LC3A 4HLCA 2A9FA 1FF9A 3A31A 2AVNA 2OVFA 2YMLA 3OETA 521PA 5L9AA 2Y2NA 3NG1A 4R70A 3JW8A 2PLFA 2F4VB 1J2TA 1KAMA 2GBLC 4F5YA 1J97A 3RW9A 4HWKA 3FHCB 3H97A 3CPHA 2P2ZA 3EYWA 3T41A 4BX3A 2XW6A 4GQIA 1KBZA 2AN4A 5SZHB 4OK5A 4OMCA 4FNAA 4WD3A 2I2CA 3OHMA 3ZY3A 5JJIA 4AYWA 1FYFA 2J5RA 3IE0A 3JU3A 1SBZA 1K6RA 5EEHA 3AFNA 1T24A 3SI7A 2C6WB 3T0GA 2AOTB 2BC9A 3F8SA 2DH6A 1PHPA 1L7VC 3QWAA 2IDKA 2W93A 2VG8A 3I9OA 3ITKA 3H3JA 4J1TA 2HO5A 1F4LA 3KPVA 4P22A 2JEOA 3WISA 3BCSA 5KYKA 4B2YA 1U8EA 3N2YA 2V0GA 3B6MA 2Q3HA 3KIPA 3ZDEA 5E4TA 2IOYA 2B1RA 4X45A 4RYEA 4ZTKA 4N5DA 1LZKA 5A9RA 3L4BA 3JD0A 5BQ3A 2OQ2A 4BJPA 2VXCA 1MJGA 4HNVA 2O8FB 2GO1A 4LZAA 1XMOB 4LNHA 4GDBA 3AUFA 1M2VB 3PAGA 4IMIB 1Y9EA 3LZCA 5DT2A 2OGWA 3NOVA 1JWZA 1E1RD 3ZV5A 3K9LA 1GUZA 2DHCA 5FBZA 3CLOA 4X97A 3CKLA 1AU9A 4G23A 4B93A 1FTQA 3QNMA 3RPEA 4Y0UA 4EA6A 2DHDA 4EB8A 1KIAA 3RGGA 1ODIA 1KU6A 1R6XA 1OXBB 5MC7A 2OCKA 4Q1VA 3HBAA 1DXHA 5M34A 2IU3A 2GPTA 2OZLB 3AMVA 2ZU0C 2Z2ZA 2LB5A 1UQRA 5A4IS 3WNBA 3AG6A 4RENA 5J47A 4I99A 5BSHA 1JR2A 3A26A 2PBRA 1A76A 1K6XA 1I51A 1C7FA 3NT4A 2PMDA 2IPNA 3G9QA 4P81A 1RZRA 1W8IA 4DWOA 2WFLA 1OLUA 2YYYA 1DRWA 5GIOE 4BHTA 3NYQA 2PZ8A 3DCYA 3MWFA 1YM1A 5FA8A 1B1AA 1EM6A 2YWRA 1P72A 1Q7TA 3C87A 3S1AA 2B92A 4AKGA 2HFJA 4AUNA 1DTSA 3HXTA 3OZEA 4LDZA 4QEKA 4OEHA 1QUEA 1EFKA 3ZWPA 4R0NA 3FSGD 4YWHA 5E7IA 3EEBA 4D92A 1JDSA 1TAGA 5FQQA 2F3RA 1JLRA 2J46A 1UK9A 4M46A 1OSNA 4W8GA 3DVAB 4E21A 1KFCB 5KS2A 4FHZA 4KFRA 5L3ZA 5J2UA 4G0XA 2CUZA 1JIVA 1SUEA 5CT4A 3HJFA 1S6YA 1LBHA 3VV3A 1VGVA 1VE3A 1M0TA 1SK8A 5MHTA 1P2BA 3OP1A 1TM5E 2Y2VA 2OHVA 3HEMA 3OZ7A 1VCNA 3IC5A 1RTTA 3ZX5A 2JAHA 4A8JC 3K70C 1U1GA 3LDGA 2ZE6A 2PV0A 5JQGF 4MS1A 4LQ4A 1XEXB 3NUZA 2HF2A 1N6PA 4EO4A 4EAQA 1PEAA 5TR7A 3ZZ0A 1QYXA 1PZHA 2FPGB 3GGDA 2VJWA 4OL0A 4PF1A 3T3EA 2EXBA 3CHYA 4Q4CA 2VTDA 4ER3A 2VBFA 3OUZA 1DRVA 4JSYA 2UWXA 3GFSA 1KJYA 4EWFA 3PENA 4HAUA 2APJA 2R7MA 3SPXA 4G4GA 4I50A 1GP2A 1RDFA 1JKMA 4HIAA 1QH1A 4KKVA 5HSGA 2PANA 1UBFA 4DKXA 4PSKA 1AXRA 4QHTA 1NY0A 3B6KA 4IXWA 3MGCA 4PLFA 4L15A 1K3UB 3EAQA 3GLGA 1E3MA 3EXIB 4OXNA 2AD5A 1P9LA 3R3ZA 3AXSA 1QQAA 3OPVA 4NL4H 1KSGA 2W6ZA 1NR7A 3AIOA 2FLWA 1L7RA 2C4NA 3DMTC 2VPWA 3W4JA 4LFAB 2QROA 2IYWA 3TYXA 1D7OA 1AA6A 2VSOA 2JFNA 4PIMA 4CDGA 2XIQA 1ID8A 2ZEJA 4I1SA 2VIIA 2OBLA 5EJIA 2C42A 1N3YA 1L5FA 1AO3A 2QUBA 1ZX1A 1A27A 4YFMA 3ZK7A 2O3QA 5LQCA 1PCXA 5AKGA 1FMCA 4UARA 3A27A 4YRSA 5JMTA 3ENVA 1EZZA 4V0LA 4GBJA 4NULA 5K3FB 3DEAA 4YRDA 3P27A 2NU6A 1GG9A 1EP9A 4CLHA 4KTTE 1Q2QA 2RH4A 2PR7A 2C5SA 2Q4DA 1YL7A 1VSTA 4R31A 2VCEA 1U04A 1RKXA 1TS8A 4OQDA 1X0OA 2FEWB 3RGWS 4BGEA 2PAVP 4ZV4A 1DXQA 3AHHA 3ZHZA 3FTFA 1LNZA 4CT5A 5JCPA 3HL9A 3T5TA 3SNHA 1OAKA 3BGWA 1VIYA 3UOAB 2EEZA 3D6VA 4WZ5C 4O4IF 3QVMA 4CR6A 2COUA 4QUIA 5C37A 1QP4A 2P68A 4AJ9A 3MINB 2NVOA 5LP6C 2MR6A 3RHTA 2DC1A 1MAWA 4CMKA 2EFDB 2WEKA 3NBUA 3D3QA 1NUPA 3BFDA 3V8QA 3OI7A 1WA5A 1I1HA 2RI1A 1RM3A 5ARDA 1R6DA 3RFTA 3D0QA 4P54A 1N5JA 4IIJF 5ITWA 4FLMA 1X14A 4Q3NA 1HL7A 5C1PA 1AA9A 4DVJA 4NI5A 5HUHA 1J07A 4R6XA 1PSWA 2AH5A 5LMNB 2HXYA 2PUHA 2HR1A 1YLYA 2O2JA 3EHEA 4CQJA 2NUTA 1KFBB 5EL0A 3C5CA 1T4MA 3HACA 1W47A 4AXBA 4AN0A 3OBBA 3GZTB 1B1CA 3QLUC 2PMKA 2I4MA 2N0SA 4HTFB 3S68A 3N4IA 5EHNA 4MUHA 3K72B 3AHIA 1JDJA 3B3QA 1LTHR 3F4KA 1PJLA 1KKMA 2VUHB 3DMNA 2NO1A 2AFHE 3RS3A 3BZWA 1NQXA 1A4IA 4BWYA 4E2ZA 3PZBA 2GXAA 3H83A 4ETXA 1ERQA 1OT6A 4O2BF 1WMAA 2VK2A 4MWGA 1OYWA 2M32A 3L7JA 3CVWA 4X61A 3K16A 3G2MA 4BTEA 2AC7A 3DKIA 1L5RA 1V47A 2NZ8A 1QWOA 3C8ZA 3C39A 4DE0A 1E58A 4XQCA 1QFJA 2RHCA 3MT7A 5LOVA 4B71A 4KAFA 3NHYA 2CZCA 4V03A 1QYDA 4I55F 3KXLA 2CMFA 4AT1A 3PC6A 1K98A 4MA5A 2PKQO 5BWOA 1Z75A 4Q47A 3K7EA 4ZIRA 4LRWA 4GGOA 3T7RA 1YVDA 3GRFA 4FD3A 2CLCX 1YR6A 5JMPA 4KREA 4R54A 4AB1A 1UXIA 4IP0A 1W25A 1G5QA 1RQNA 4H2DA 1N1EA 2X0FA 3ESZA 4CCAA 3O31A 3ASVA 3BF8A 4FQ7A 1MIHA 1HTZA 1MVOA 3L2OB 3LUQA 1T5OA 1ZHOA 4G3XA 4EI9A 3GXBA 3GRUA 2EQAA 3RJTA 1T3GA 3R7NA 2ASVA 4EF4A 3ZI0A 1ISRA 5CA0B 1S3GA 4I4TB 4OQQA 5E2AA 1NWHA 3MSXA 2H1HA 1V4BA 3AGPA 3GFVA 3PEYA 3HY3A 4K9SA 3NTRA 4L8FA 1GPAA 1JVBA 1QYRA 5JSFA 4M7RA 3QW2A 3A10A 2EF1A 4I46A 5ESXA 3G79A 3DBLA 1H23A 3FPBA 4N7RA 2Q7XA 2JK0A 1YS9A 3DZJA 4MQEB 3SYRA 1LQ2A 1YK1A 1QB7A 2XRZA 3GAZA 3WKCA 1EK5A 4BASA 2YXDA 2E0IA 4MICA 4HRVA 3S81A 3DBAA 4PCVA 2IF0A 1KXZA 4I39A 1Y5MA 2B9EA 1PK9A 1TRKA 5DU2A 1NYRA 2OQVA 1WW3A 1J06A 1WZ2A 2CL6X 4I66A 1X8JA 2PE5A 2CE7A 4R8SA 5CTAA 4NOKA 5CHMA 4DE3A 3TSCA 1LPBB 4L95C 1P29A 3DL4A 2Q5QA 2A9VA 3RIEA 3F73A 4FYPA 2IQIA 4YQFA 3HZRA 3AXTA 3ZWWA 4LX8A 4YJ3A 9MHTA 2GYVA 1HD8A 2FN3A 1SVOA 3PX3A 1QE5A 3A3JA 5ILGA 4Q82A 3HXLA 4UE6A 2HMVA 2FUG1 1AHHA 2ON6A 4MS3A 1MOQA 2HU5A 1VZ3A 2ZB3A 2BFFA 4ROTA 4UW9A 1NYYA 4HP4A 3LRPA 3AGDA 3G85A 4KG6A 1KJWA 2R1TB 1TC1A 3DDOA 2A88A 4N5MA 3KLPX 3NVAA 2V6BA 4D9JA 1VL8A 3WK5A 3R3YA 5DNWA 3QU5A 2J9FB 4MROA 1NOIA 3E18A 3ILSA 4TS1A 2AYZA 4MVJA 3UMGA 2D59A 4S2NC 4EFMA 4MGHA 3NCHA 3SHWA 1NKSA 4F2WA 1AURA 1RQGA 2RH8A 2NMVA 2A2LA 2HRZA 1YT4A 4OLJA 4NETA 4HGQA 1M5TA 5IC5A 2HO4A 1NHWA 2M1CA 3K8QA 3BMNA 2XRYA 3OTGA 1CW2B 1EK1A 5HZMA 4RWZA 3OFND 5EIBC 4BMDA 5K3BA 3E2MA 2BISA 1SQSA 1E1QD 4R4JA 5L4NA 2IWDA 4JJFA 4QEDA 2NOAA 5DYGA 1XPJA 5C53B 3UPTA 3NCKA 1RHKA 1T9CA 1KZ7B 2CYCA 5IZCC 4G3VA 3LKDA 1Z68A 5DJ5A 3R5TA 4L51A 2KB0A 1N34B 1D4ZA 3B7WA 3M6FA 3R6DA 4ZVUA 1QX4A 4HKTA 1WNTA 4JJIA 5K3AA 1Z6PA 4BFVA 2XQGA 1DBIA 2X02A 2O9CA 3GFGA 4KQHA 2X9LA 1HOTA 1UP4A 2O59A 2FSGA 5LN1A 2NYAA 2CXQA 1YVUA 2NVWA 2W4MA 1XCBA 1B8PA 2PWAA 3LQRA 5REQA 1J39A 4D7AA 1KP3A 2Y99A 1YRYE 2VKTA 4F3CA 3C70A 3A6DA 3T8YA 3C3WA 2COKA 4Q9HA 2DULA 5A5EA 2CB9A 3SE7A 2ODWA 2JFWA 3K4QA 3CUSA 2W6NA 5F1PA 3CZDA 3QA9A 3K0CC 4LBWA 3H8JA 4UBOA 1Z6QA 1BKDR 2WFLB 4B6GA 5TBMA 1OLUB 3B38A 5C8XA 4ZAFA 1SXHA 1GEEA 5DLQC 1H1LA 3Q8WA 2JFOA 5T64A 4AZVA 3I9MA 4DCCA 2V8FA 3IX4A 2O0LA 2GAAA 3PYLA 4DABA 4Q7EA 4M8IA 2E89A 3A6FA 5TVGA 1T10A 4GP7A 3WRVA 1XRNA 2OHFA 4OI4A 4U0XA 3TKAA 2FP3A 4PQEA 4M0KA 3IT9A 1QSGA 1FCNA 2EIHA 4O63O 1TPYA 4YCSA 4AFNA 1GQ2A 3QX8A 3N0TA 4O25A 4DR1B 3B3XA 1MHPA 1J0DA 3L1VA 3F2VA 1T4CB 4JJZA 2QS9A 4IFIA 1AV7A 3H17A 2TYSB 3RG8A 1JVJA 5E1MA 4XQEA 1EDEA 1VLVA 3H2SA 3ANSA 2XYGA 4OPRA 5DGIA 2BFDA 1JDNA 1Q0TA 4MNRA 2NZXA 3O84A 5FOXA 4XI9A 3C98A 3M5DA 5I7VA 2PGOA 4RIEA 5F52A 3PBKA 3K9GA 1R0ZA 3FGOA 1BXRA 3H84A 3W2GA 1AM4D 2RGUA 2XUHA 1GAXA 4FR0A 1JIXA 2H2HA 621PA 5LYYA 3HUUA 1XLUA 4B35A 2FQQA 1ULSA 2JHAA 3IF6A 1M33A 2D0DA 1WCYA 3E58A 5TPZA 3B8EA 4F9EA 1CUIA 2IYVA 4FBGA 4X93A 1RJWA 1TADA 3DDUA 4FCTA 2QL9A 5DIZA 4I38A 3ZU6A 3GRKA 1QH1B 2HA0A 1C3OA 2FOXA 2EFUA 1V26A 3A7DA 4FZRA 3KLNA 4Q0MA 1T0UA 5J63A 4D97A 1ANKA 1G5PA 5FIUA 1JEOA 5BORA 3P2YA 4FFSA 2RHOA 5BQPA 1YLWA 1ZSYA 3C8CA 1UEIA 2OM2A 3TQIA 1P1FA 5EMNA 5DHAA 4EHDA 5LWQA 4FDUA 1N8SA 2BEVB 2C4TA 3SY8A 1WQ3A 3GT3A 2X9GA 5C8ZA 3B9QA 2ROQA 1OWLA 3GVXA 4YCDA 3WIEA 3MD0A 4H27A 1RLJA 3ZG0A 1RWKA 4KHZA 3AL2A 4UUMA 5AW8A 4XCXA 4HUQA 2BBOA 2FW6A 1FFHA 4Y8VA 1ZSVA 3KDSE 2RIPA 4EK9A 4J4BA 1PQPA 3BEBA 1FQJA 4XUCA 5CNIA 3CINA 2QBYA 1DCKA 3FNHA 5EESA 4K3UA 1NXQA 3A4NA 3A4YA 5IDYA 2G9RA 4ARIA 2NU6B 1OWMA 1WXEA 5CMLA 2R1ZA 3N76A 4IIDA 2BMDA 1MIOA 4KQKA 5A5GA 2HSEA 4RS3A 2Y27A 4RHYA 1I9GA 5CB0A 3W0LB 5CYGA 1Z0KA 3T1QB 1ESZA 2P9VB 4MXDA 3UV7A 2FLVA 2IPMA 4R2MA 3E4PA 1U5BB 3VPCA 3TRDA 3KKQA 4KNWA 2D8AA 1Z73A 2XOKD 5JXJA 3SYKA 3ZDXB 4OJMX 3MWEA 1SU6A 2H17A 1A7UA 3K0BA 3OF2A 1FVFA 4AULA 2R4TA 1Z82A 1LVGA 1M2EA 4IVQA 4ER6A 1PS8A 2OYSA 1AKRA 1JZTA 1I30A 4Q03A 3RUHA 1WPRA 4N1AA 2PWYA 3D7RA 3AF0A 3UWMA 3EGDA 2FY8A 1CJBA 5FT9A 1VCIA 3O3NB 1JAYA 2WU4A 4PAWA 1YZYA 1YB1A 3LP6A 4LZOA 5TC4A 2BM8A 1IDN1 3BC1A 6PFKA 4DY6A 5CA0F 4I4TF 4YRFA 3IS3A 4BQEA 2QD3A 1OGIA 3O4RA 3TTVA 3LFHA 2GXSA 4YBRA 1TKCA 4EY6A 3KQTA 4RMNA 4DQUA 2G4LA 4E09A 1I5OA 2PBFA 2IKSA 3RTGA 5BPHA 2XWSA 5A05A 1CZKA 1MC8A 1P4HA 3U0BA 3U44A 1R9JA 1FVOA 3WR5A 2WK0A 3RYFB 1U0HC 2ZRFA 4U2GA 5JJ5A 4L85A 4GPTA 4QXAA 1P5FA 1DLJA 3A9WA 4ALLA 4G0VA 1IEVA 2R60A 2VQSA 3ICPA 4E08A 5JNTA 4GI1A 4MR8B 3VYUB 3DW0A 1N9GA 2VL7A 5KOHB 4LYEA 3L77A 2C94A 1YI0A 3W79A 3WXBA 2RGEA 1YOBA 2WF7A 4YBZA 4GH5A 1ILEA 1XR3A 5KREA 4BVAA 4OXKA 1LEHA 3DWKA 3TWOA 5LWHA 4JMPA 2G25A 2O23A 2F1OA 4ZARA 2R4UA 5HTKA 4DZTA 1D5CA 4FHGA 1H6BA 2YVKA 2G76A 4BFYA 1FS5A 5A62A 1QH8B 2WY2D 3M6LA 5JWRA 4EHLA 4O2BA 2WTMA 3U7QB 4ZEVA 4DLNA 2YWEA 3RV3A 4BMOB 2CDAA 1A9PA 5IBCA 1JX6A 3HL0A 4QNMA 4XVHA 2QN9A 1H2HA 1NF9A 1FDTA 3HN6A 2POQX 3OJOA 4YVFA 4CG0A 1WP9A 4CLCD 4CQMB 4MMYB 4JI1B 2R4QA 1U8CB 4KX5A 1Y81A 3T5MA 4DLUA 3W4PA 4MO9A 2PLRA 2VSXA 3KU1A 1GRNA 2XV1A 3EOIA 3TCKA 1XVTA 5KQLA 3DHNA 2IX9A 2QSUA 4IEFB 1YDHA 3G30A 2WT8A 3M4XA 4X95A 2XNSA 1ARZA 3LXRA 3C7VA 3PV0A 3BJMA 5IBPA 3P0JA 5CG1A 2BUCA 1O4VA 3VV4A 4AZ3B 2FXIA 3RF6A 4IDNA 4CJXA 1GYPA 4RLSA 1QOPB 2VZWA 2F90A 1WU7A 3CZCA 1NUQA 3GMTA 2QSJA 3AY7A 5KNDD 1N7GA 1H1TA 3CNEA 3EQ7A 3VOTA 2OPBA 4JYAB 2PGDA 1U3UA 2QF7A 4Q9IA 2PZGA 4L9GA 4OUKX 4Q6WA 5K09A 1Z6TA 3STYA 3PHCA 3UMYA 4ICIA 5TY0A 2YWCA 4U9HS 3ZG9B 5A92A 3U9SA 4FP9A 2H1IA 1IH8A 4UEWA 1O6CA 3HB4X 3MHPA 1E5QA 4OM7A 2QTCA 1WXDA 3VNVA 2A7QA 3HLEA 2YYSA 1SQFA 3MMPA 4B48A 2BFFB 1TGVA 5G1NA 4XWGA 4TRNA 4J94A 3EIUA 1CR0A 3S5JA 3AYZB 4EDFA 4GE3A 4RKFA 1WP4A 2AOTA 1X1SA 1NNSA 4LLOB 4JXWA 2UZ1B 5HCIA 1MXFA 4CPKA 1YNOA 1X9HA 2ZUBA 4AY6A 4OHCA 3WO1A 5KJCA 4H6VA 4XB6B 2UVDA 5TT0A 1G8AA 5BP7A 1XJ0A 5LZ7A 5KTOA 1TF2A 4ZAZA 1JKJB 3RC1A 3S0JA 1WVMA 2CWDA 4NPHA 2ZSEA 4NMLA 5FQKA 2DJ5A 3R0IA 3GN1A 2F8MA 1X7HA 1I7QB 1M2VA 4DMUB 4ZQGA 1K4KA 3R5FA 4G0OA 4NAHA 5IKOA 3CMMA 1OI2A 4A73A 4E1AA 4XDZA 3HO8A 5JE8A 1AD2A 4BNHA 3NHLA 5JJBA 3LCJA 5K8LA 1XTPA 2FFRA 2HF9A 4O08A 5KPJA 1XJWA 5LU8A 4F6CA 1V9YA 1EIZA 4KCGA 1OJLA 3E7DA 2BHRA 3QUCA 1RXUA 4DLVA 5F69A 1HO3A 4BNKA 1ELOA 2OZLA 3VSDA 10MHA 1QHNA 3T4PA 1VKZA 1EUCB 3AEZA 2CKMA 5AP9A 1BAPA 1V8OA 4O33A 1T6NA 4J0QA 4Q34A 1SCDA 3ROGA 4C14A 2QTLA 3JVIA 4UD2A 3P1JA 5KSZA 1VG9B 5J4LA 5G53C 1C9EA 3S7TA 2YBDA 3AP1A 3ILXA 4FGSA 5CT9A 3W5UA 2GVDC 2XCOA 1PS9A 4G84A 1DKLA 2RBEA 4U6NA 3T1XA 1I2CA 3GARA 2ZW9A 5DCLA 4EW3A 3I6MA 3X1WA 1MAHA 3BERA 1OFIA 3FLMA 4I50F 2F9LA 1JSXA 1YI1A 2YW9A 3DVAA 3W5IA 5A2GA 2XZTA 3Q7EA 4MGEA 4UA6A 4QQ8A 2WHEA 5GHYA 3AVQA 4RS4A 3OX2A 4EXOA 3GJRA 3A2NA 1BN7A 2P7IA 2OORC 1DFIA 1ZJ6A 3MTGA 4A0QA 4WTOA 2HBQA 1PW5A 1VBFA 4RPKA 2ZETA 4YT4A 1ORTA 3DO5A 1FS6A 2X9NA 1KPIA 4PBTA 1QVRA 3UB3A 1MB2A 3EIQA 1K57C 1XEXA 1ISIA 1ONGA 2IW1A 3D7LA 4U0KA 4K88A 3SOZA 2WP8J 2FPGA 5U4QA 5JR3A 4OVDA 3QKUA 1GFZA 1S9DA 4EH1A 1CUVA 1CDDA 3SS7X 4KQMA 2JE5A 4LE0A 1U8XX 1ADYA 2QR2A 5IPFA 3QBDA 1JEEA 4FX5A 1F2DA 4AJIA 1HY3A 3ZD9A 4OQLA 1P1RA 1TEMA 1FSYA 4E7OA 4MARA 4IJMA 3QVXA 3PLAE 1GRCA 3HS3A 4TPKA 5FFFA 3RT9A 3AC0A 2IYXA 3WKBA 5HEKA 1DP8A 3DEIA 3J7AC 1XMXA 4D0GA 3B3JA 3CB2A 4P93A 3RUIA 4X6YA 2JHFA 2EWWA 2QUIA 4N41A 3TVTA 3NOXA 4B6FA 2IP2A 4A5SA 3LM8A 2ZT7A 1ACMA 3D5TA 1YDEA 3LZDA 2XH8A 1HZZA 1FS4A 1A7KA 2ISCA 3EIXA 2Q3LA 3TW6A 2MMGA 3EUWA 3VBCA 2GRJA 4I2VA 3U62A 1IB0A 2YS7A 3JQCA 5ENVA 1D2CA 4K08A 2C78A 1XAGA 3SMVA 1VIVA 2PMBA 4GMXA 3E8MA 2D74A 4GI7A 1ECBA 1KHTA 2R68A 3USZA 1I80A 3BE8A 1E5VA 1HKUA 2KLBA 5K3FA 1V5FA 3CO5A 5EMJA 5FBKA 1VE9A 1PHRA 3CX8A 2PUDA 3TZCA 1JI0A 1AC5A 3SOIA 3LDUA 4HUQB 2UYGA 1UT6A 2OA0A 3NRBA 2W8BB 2AVXA 4N3GA 4ZOBA 3FYHA 2HQBA 1PGQA 1X0VA 2O5CA 2Y2UA 4DC1A 1GWNA 2RK4A 3Q7IA 2LXNA 3Q6IA 4QDUA 2A6PA 2Q3JA 4L9RA 1ZG3A 2ZKLA 4UBKA 1RXWA 1GZVA 4MW0A 3ZWVA 1KGSA 2H2DA 2H2AA 2GZ2A 3ROQA 3FR8A 5TQJA 1X0XA 3MFQA 1CF9A 1K7XB 4IKPA 1PDWA 3BM6A 2PS9A 5F7JA 3MINA 4A6XA 1TA0A 1Q16A 3HZOA 3QV2A 1MC1A 3STHA 4CM9D 1UBUS 3ZOKA 4OOEA 1GFWA 4KLZA 2VEDA 1N2JA 1HC7A 2O2DA 4GD8A 1ZNWA 2AN3A 2B83A 4RPCA 3AV3A 3HYSA 1E2BA 3OCWA 1K56D 3II6X 1G8SA 1WZEA 4IIVA 1DT3A 2Z3VA 4H7KA 1U0FA 4IJ6A 5JYOA 5ENDA 1RQXA 4KQIA 2F6RA 3NIGB 2QWSA 2CJYA 3PBOA 5IJAA 3EDOA 3FXAA 2WJ3A 3EGCA 5AQAA 1G6HA 4HTFA 4BQSA 5B7GA 3B7PA 1ULUA 4KXQA 4URYR 4AUMA 3Q2IA 3EMDA 4C7BA 2Z09A 1SD5A 5JASA 2GJAA 3F3KA 4LMBA 3RF7A 1H22A 1M6KA 4BAUA 2ZQ8A 1G8PA 4O2AB 4NQZA 3H05A 3QVUA 1X92A 3GJZA 4F3NA 2QE7A 3O8RA 1HTTA 5AKIA 4PZYA 5EP2A 5DLYA 4H4CA 4GQAA 4ZYUA 2I55A 4Y3UA 3AKZA 3NEPX 3GQZA 1Q92A 5FWXA 3CPJB 4NESA 4CKCB 3NIWA 1MRSA 4RJTA 5JZOA 1EFDN 5E7QA 3KKZA 2FSHA 4YLYA 2QNIA 3A6LA 4BKQA 1FY2A 2WIBA 4QJBA 4UATA 4WIAA 1KGDA 3U44B 4A82A 3ZY4A 5A7FA 2ZRIA 1GKKA 3K71B 1QE0A 4XVQA 2DTEA 3ACDA 3TQTA 1KRHA 2M7UA 4GD3Q 1FLAA 1B3BA 5IANA 1G16A 1PW8A 4EQZA 1WPGA 3EGOA 1NQWA 4UVGA 1R88A 4TLLB 4U7WA 1CZUA 4FINA 1K27A 3BH7A 2BM9A 1PR1A 4HV4A 4QUBA 4HH1A 2BD0A 1QFYA 4GBGA 1R8QA 2QUZA 2I72A 1EWQA 3RVNA 1U7DA 2Q9CA 1S5PA 3OPXA 2X40A 4UEOA 1BDIA 1JIKA 4FD2A 1SIWA 5KOIA 3LX5A 2PO5A 2HMTA 3A6EA 1SCWA 5CA0A 1UWPX 2AKYA 1J09A 3LBNA 1QG4A 3ZGVA 5KQMA 1Y7TA 1BYUA 4ZO6A 1GVNB 5AWFC 2F7SA 2EXXA 4HATA 3OLOA 4LV5B 3QUTA 4UHKA 4P4LA 1W88B 4RC9A 2CB0A 3T1OA 3PNLA 2K5UA 4CQHA 4ZAGA 2VPTA 3CMCO 4BNGA 4Q3AA 1CJTC 3LBIA 4XYLA 3G8DA 2A5GA 2HDQA 2BGWA 3LFUA 3Q7ZA 3GQVA 3PHHA 1K0FA 2JPDA 4UBLA 2HZ7A 3GPBA 4U00A 1K5DA 2F1RA 4MQEA 2NZYA 1T5LA 2OOLA 1WXIA 3VGJA 1BLCA 2JIDA 4XVUA 4J43A 2PSDA 2FP4B 2X8LA 4G0QA 3CGGA 1LDEA 4M9ZA 1FP4B 4RVFA 4DGQA 3ML1A 4X9XA 5E9WA 1HEIA 1E61A 1NNUA 1VHQA 2AJLI 3V55A 2VDKB 5KYNA 3RVLA 1JHAA 4ERXA 3WE7A 1MEEA 1ULHA 3AUXA 3BA6A 4WMLA 5IFLA 2W2PA 5IW8A 3P97A 2P9EA 2WA2A 4KQEA 1SXJD 4WF0A 4DT1A 2V4UA 3FA2A 4KDEA 3JVUA 2ZQZA 1RKBA 4RMHA 4V0QA 5B55A 2BMVA 2QAGA 3F7MA 1AGPA 4JU9A 4EBBA 3R77A 3ETHA 3LF1A 2FW0A 1PFKA 3KQMA 4B82A 3KVYA 3E9QA 3SXPA 3OPYB 2M6SA 1WIWA 2R1TA 3CRMA 1W4BA 1UPBA 1KR2A 4OK3A 1GUYA 1Q50A 2FNAA 1Y4UA 2J9FA 3M1AA 4RH0A 5FO1A 2GAOA 2GN0A 4FFRA 3N2IA 3GVCA 3DL2A 2QYOA 4JITA 1T35A 3IR7A 1G8JA 5F68A 4AMVA 2EERA 2V0NA 2FQYA 4BN4A 4HX9A 4GFDA 2Z2KA 4DV1B 3UNWA 2KYRA 1ZGGA 3MWDB 2OHOA 1B76A 1V7ZA 1ENYA 3WS0A 2WVJA 1OJGA 1Z7GA 4S1NA 1TVEA 2PMCA 2WWYA 2I4NA 2Y3IA 4BQIA 1GTVA 5K8UA 5JXIA 2BFEB 2I03A 1GDDA 5CPBA 2W00A 3QGMA 4XYEA 5JROA 1FSZA 5H0IA 4GZ5A 1LK0A 1IELA 2OKGA 5I01A 2VDUE 1N2BA 3H11A 2BJWA 5AIBA 2GEJA 2C4WA 3F0TA 5IP5A 2Q1YA 3OJXA 2FPOA 3UMFA 4C0SA 8LDHA 2YWBA 2WJJA 3DDNA 4OHRA 1VHLA 4KLAA 2HNKA 4PR0A 4LFCB 4D8TA 4DAOA 1Q77A 3ZG7B 3OFSA 1WPXA 4CLDA 1JMKC 1MO2A 3V1UA 4ZO8A 1WKVA 1IU9A 1CR2A 3AP3A 1ZAYA 3LO5A 3TOSA 5KNBD 1ZI6A 3O3OB 3RRFA 4AZTA 3ZNQA 4HDCA 1E62A 2P1ZA 1WMSA 2W8ZA 1NW8A 4GPIB 1S1MA 2QTBA 1Y48E 2CCGA 2G1KA 3SBOA 4JBIA 1KAOA 1VP3A 4ENWA 2WYHA 1JNUA 3BL5A 4G26A 2XD9A 1WWKA 3R6LA 2ZB7A 3AHCA 3O8DA 4RK5A 4UJ5A 3IODA 2O7NA 4XOUA 1DO2A 1VZ2A 3DDWA 4CFSA 2P1DA 4ME4A 3O9ZA 4GR9A 1PFUA 1CQWA 5FTMA 4RHFA 1UOOA 1UF9A 1KDWA 3PB3A 1C4XA 2I3GA 4HTAA 1N9BA 3VVLA 3M34A 2Y1DA 5DTTA 4HEQA 4EZEA 3PBQA 2YVUA 5CB8A 1EMDA 4Z4EA 5JYBA 1U60A 1UK7A 2HB6A 1KMHB 2ZSHA 2RHDA 4L78A 3F98A 3RVDA 4G25A 3TXAA 1I5QA 1XHLA 3JZMA 2J3LA 4TTAA 1DAIA 1D6MA 4S24A 3M1IA 1HH4A 2HP5A 5CERA 4D6YA 8ABPA 4QUKA 4DDMA 2DZDA 1ZM2A 3ONDA 1W1UA 3DDZX 2ZVPX 2HCJB 4GSYA 3W3ZB 4PGAA 3NVMB 1R4NB 3Q7RA 4TT3D 1GSAA 1MUUA 4Z9BA 3I12A 1AUXA 1T4CA 1GPWB 2OAQ1 5EZYB 4KODA 5EKSA 4QATA 3Q7TA 4OHZA 2ETVA 2ONZA 2O48X 3W7BA 5A90A 1FQWA 4DJEC 4AJOA 3FETA 1DCFA 2ZIEA 4EUFA 5AI4A 2YWHA 4HO1X 4P33A 4PYQA 1IB6A 1TW2A 3V7FA 1GKYA 1XXLA 4CETA 3BREA 5GTDA 5K1ZA 5A3RA 5TMPA 2OBMA 4NBSA 1KYWA 3IBGA 3A0SA 4J0FA 4IJ5A 4KI7A 2C8LA 3WAKA 3C2WA 1TJ4A 3ZG8B 1QJ4A 2QT1A 3UCXA 5EWLA 1EGMB 5F82A 1GPNA 1SOVA 4UVIA 4AURA 5JARA 3FDXA 3IMCA 4LWQA 1SC4A 3CUWA 2BBTA 4FBLA 1ZM7A 5C46F 4RO0A 5JEDA 3TLJA 4Q7QA 5K01A 5DK4A 1Q95A 3UO8B 1HE2A 4U2DA 1T2UA 3E2PA 2NTEA 5AQBA 1QC5B 3WS2A 1ZZGA 4HH0A 4EERA 2BEVA 3Q7QA 1JU3A 2QRQA 3OQHA 1NONA 4QGGA 2NTNA 1B15A 4G2NA 2HDWA 4QM7A 4EQIA 4RANA 5HDDA 1MF7A 3K92A 1BMQA 4OLAA 1C1YA 1NW5A 2SICE 2WIDA 4OI2A 4B8ZA 1D1QA 1ES9A 3GDOA 4TKMA 5E4JA 1NQAO 2EJCA 1XJQA 4RIIA 3U81A 4ALMA 3RVBA 4LRYA 3IVAA 3TLAA 1KE4A 3SSMA 2YIMA 1CETA 4C08A