2WKPA

Structure of a photoactivatable rac1 containing lov2 wildtype
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
320
structure length
320
Chain Sequence
LATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
publication title A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase, cell adhesion
total genus 108
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2wkpA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wkpA02
1JJVA 3C2WA 1RYFA 1YZNA 4PAQA 2PHYA 1FUKA 2FPLA 4LSGA 4Q00A 3AKDA 2WJVA 2XJ4A 4Q4HB 5L3QA 4L9SA 4BLOA 3AVYA 3A6PC 2VSOA 3A4LA 3U6BA 4Q1CA 1M2OB 2RGGA 4XVQA 2ASEA 3BFVA 3JZAA 3LO5A 3LVQE 3U44B 4MDFA 1SXJB 1XD9A 1KI8A 2H8KA 2V8OA 4PC3A 3PHYA 2V6JA 3I8SA 1HT2E 1W1WA 3W5JA 4BLSA 4KJZA 1KY3A 4RKFA 1DP9A 5GJCA 3EZ9A 4KHZA 2JLRA 1OJLA 3OAAA 1OJGA 3RNLA 3LIBA 3HU2A 1YVDA 1E9SA 1YR8A 2OBNA 2BASA 1LL8A 2ZYVX 1QG4A 2QE7A 3CW2A 4PC2A 4EUNA 1KK3A 2FV8A 2ZVQX 3ZDQA 4EPRA 5JWOA 1CR4A 2B21A 4WBSA 1X3SA 4C3ZA 4EERA 2WM9B 4MYCA 3MGCA 3HR8A 2GVDC 1LSXA 1LT0A 1E4VA 2QG6A 1G5RA 3KFXA 3OHMA 4LZZA 1S4RA 4FN5A 3U3KA 2FU5C 3B1YA 2RHMA 1UKEA 1ZYUA 1YQTA 1OB5A 4I3JA 2E9SA 4DIEA 2WJYA 4AYWA 5JJIA 1OT9A 2R6GA 4LJYA 2IT1A 4QRHA 2J80A 3CAXA 2G1JA 3WXMA 5J4EA 2ODBA 2ZI6A 1M1YE 1P2VA 3GD7A 3K3DA 1BOFA 2WKQA 4R2IA 4XT2B 4JVNA 1T4GA 3RS3A 1P0ZA 2X77A 4FCVA 1NKSA 3KJIA 2VV6A 2GVZC 5ANRB 5HD5A 4R98A 3MQQA 3CB4A 2INWA 3LLMA 4IVRA 3PUXA 4EFNA 1XEFA 3KFVA 1NN3A 1MZUA 1VPLA 3ICEA 3AVTA 2WOJA 3LRPA 4ZDKA 2KSQA 3JVVA 1KO5A 2C77A 1HY3A 1XXHB 3AEZA 4V03A 2RGNA 3CIOA 4NE2A 1P2UA 1SQ5A 1RW4A 1D7EA 1UBFA 4YMVA 4Q1EA 5KSYA 5KSPA 4E22A 3R9IA 1C9KA 1N6HA 2IYYA 2BMJA 3GLHA 1T18A 1P73A 2G0NA 1B23P 3GJ3A 2UZ3A 3L43A 3M6AA 2XB4A 1EFHA 1L7VC 5DI3A 5CDFE 3AQ4A 4BGDA 5KHOC 1DG3A 2HYIC 3MR0A 1JR3E 3THXB 3AGQA 1B0UA 3RHFA 1E0JA 4HB0A 3F0TA 3U3MA 2BIFA 4B74A 4IDOA 3VR1A 3TBKA 3HR7A 2FGKA 3MFYA 2OSBA 3AV0B 2FF7A 3QEOA 2EW1A 3QE0A 5FBWB 3VR3A 3TUZC 2VP4A 2HCJB 2ZJBA 5IK2A 3QSYA 5EQTA 2QROA 4KUKA 1NRJB 1ZCAA 2JDID 2WBLC 2Z83A 2AFIE 2D7CA 1KI3A 5FPTA 2Q0HA 1R10A 1XEXA 4JLOA 1UFQA 4CYMA 5A8BA 2XZOA 2IK8A 3CPEA 4I1VA 5EXXA 1D8TA 3PV0A 5HDCA 1ZD8A 1P9WA 4DLSA 3FC7A 3PQCA 2NO0A 1DADA 4WAUA 1ZINA 2WMOB 1G4AE 3NXSA 3I32A 2CHGA 4F4CA 5CB8A 5DLQC 2D01A 4GOKA 2OHFA 1H8EA 2ZIAA 3T1QA 2IYSA 1G4UR 3NC0C 3ZIAD 1IY1A 5DSZA 2ZROA 4H1UA 1IN7A 4M1WA 1O3YA 2AKAB 4LV8B 2GAOA 121PA 5BN4A 2XNDD 4V0MA 1JNUA 4NL4H 3MWJA 3T5DA 1QBKC 4LYHA 5AK0A 3Q7PA 1PJRA 2IW3A 4XVRA 2IYLD 4IXMA 3X1DA 2J7PD 2IX3A 4Q9IA 2QT1A 2ZJ5A 2F6RA 2PYRA 4RFVA 3A0VA 2NZ8A 2OOLA 4IDHA 1W49A 5F5YA 5C4MA 1YZGA 2WWWA 1FX0B 4QGFA 4BFWA 3RC3A 2GEUA 3H7WB 4Z8YA 4YXWD 4JLPA 1MV5A 5DN6A 4Q01A 3FB4A 2ODNA 1EFRA 1OSNA 4OQXA 1KDRA 4FD2A 5FTMA 4NDZA 4BLTA 4A92A 3FYHA 3SEAA 2HF8A 2ZJYA 4HY8A 1SVMA 4DCUA 1LY1A 3FGNA 1WQ1R 1KDPA 5KYKA 3KQUA 2DFTA 2ZRLA 5FL7D 2AXNA 1UDWA 3QI2A 3ADBA 1J2JA 4NKRA 4UNSA 2JLVA 2RHDA 4W9MC 1W0KD 3B1WA 2X2FA 3SW1A 4N3NA 821PA 5EFWA 2OLKA 1G8YA 4LPZA 4DLRA 1GP2A 2LKDA 3VAAA 3ZD6A 3NBYC 1VECA 1E9DA 2IYWA 4MRSA 2QT0A 1P2SA 3ZVMA 1NVVQ 2BBWA 2ZOIA 3DMDA 4OHWA 4N0DA 2VHUA 3VMFA 1OXXK 1IM2A 2JJ8A 4GZLA 1WBDA 1Z2AA 1HYQA 5IDVA 2GEVA 4PPGA 3SFVA 1Q0UA 4UJ5A 1Z6TA 1QHSA 1G8GA 4HHDA 1EWQA 2J9RA 2QHKA 2LWIA 1XZQA 1MH1A 2FMXA 2CDNA 3NDPA 2A24B 1XMVA 1ZIPA 2OCBA 2YWEA 3CO5A 4IEIA 4PZZA 4Q7JB 4OYHA 4QHTA 4TYNA 3UB6A 2ANCA 2HJGA 3KKNA 1W4AA 2FGJA 3VR5A 1U8ZA 3P27A 2ZR7A 4B3CA 1LV7A 3W3AA 1ETUA 2CLDX 3CH5A 2GETA 5G40A 2VYFA 4ZCLA 5F69A 5CYPA 3IILA 2DFNA 1N6KA 1KIMA 1AK2A 3I61A 1AS2A 3KZ1E 1IN4A 4Q7KA 5JZVA 2YWGA 4HAUA 2RH5A 1G41A 4MKGA 4RD1A 1MO5A 3NIBA 1H8HA 4LJAA 1MT0A 1S3SA 2HLDA 4KVGA 2WSMA 1TQDA 3PEWA 2UVQA 2WSSD 2ZS9A 3TW4A 4CEHB 2V9AA 1XJQA 4D2IA 2VL7A 1KK1A 4GSYA 2VSFA 2QMEA 3W9YA 3P7NA 3I92A 2QPAA 4ON9A 1NVXQ 5DJUA 2XOKA 3LBNA 3CNLA 3AUYA 3PJRA 4JGOA 4FXPA 1NJGA 2B7CA 4KLNA 5AJZA 1A4RA 5D3MB 1Z08A 1DAHA 3AM1A 1ESNA 1Z6YA 3VR6A 4LJ6A 2Z5FA 4B3GA 2FE4A 4Q9KA 3T34A 1XJ3A 2Q3HA 621PA 3VKHA 3ZS8A 5G4ZA 1BH2A 4D4LA 3MJQA 1YR6A 5EP4A 1RRFA 1YHNA 5KNCA 1OB2A 4PO1A 2A7QA 3RS0A 3SBEA 4NXEA 5AJVB 2JLQA 4PSVA 1UBGA 4HZUA 2P2LA 1E0SA 4IVPA 2JHEA 2AN9A 1ODVA 2V54A 2IHYA 3H4MA 2QAGA 4CT5A 1EXMA 2P3SA 5GJVC 2GNOA 2CE7A 2FSFA 3RRZA 5BW8A 1VCOA 1E3MA 3BH6A 4GFDA 1L4YA 3K0SA 1Q1BA 3DKVA 3E4OA 2WVJA 3WY9A 3ZQ6A 3O8DA 721PA 3L0OA 4C2TA 5FI0B 2VBCA 1LTQA 4L9WA 4OQMA 1VYTA 3T1OA 4NYIQ 4DDUA 4F93B 4OI2A 3SZRA 5TBMA 4RD6A 2F1JA 3LI9A 1FL9A 1IONA 3UMDA 1CP2A 2QM8A 3CZPA 1G21E 1XJ2A 1E9EA 1WCV1 1S0UA 2F9LA 5E3HA 4O2RA 4TTRA 4AG5A 4GS9A 1CJUC 3FHTA 1OT3A 1G16A 2ZRDA 3EA0A 3UK6A 4MGIR 2O8FB 1G28A 1E2FA 1ELOA 5H8WA 3EXAA 1V5WA 4OL0A 4AYTA 2BMDA 3Q9LA 3RC8A 1YZTA 1E94E 1VYUA 2W2XA 4QHSA 1JJ7A 5EUMA 1RRPA 3C14C 2W2TA 4EW7A 4LYFA 5GADl 4MYTA 4IDNA 4IKEA 4WOPA 2P6NA 3A1UA 4HJ3A 4D82A 1N6PA 4G01B 1V43A 1HE8B 1MO3A 2VHTA 4AK9A 2GZAA 4TMZA 1CULC 1GAJA 1E96A 4M1OA 2WTUA 2O8CA 2ZUCA 3A58B 3I8XA 5FPYA 2IXEA 5HWWA 2R65A 4G0NA 1GSIA 3LQRA 4XTRA 4YDHB 1X8KA 2AHOA 2JLXA 4WL9A 4JL6A 221PA 1OJ5A 2EQBA 4WA7A 1HT1E 4DT1B 1K5GA 2O5VA 5EUQB 2V1BA 3K9NA 3HJKA 3OAAD 2UZIR 1J70A 4Q4JB 1KI1A 2JJ1A 4DLWA 3M0EA 4G5SA 2AFHE 2QGZA 1Z29A 3LNCA 3SN6A 4TYYA 4HH3A 5EZ5A 4JVSB 4NCHA 4OI1A 3I3SR 4DWJA 3A1VA 3K1JA 4KXFB 3KQLA 1NN1A 3TGPA 3BK7A 1W5SA 3EZ6A 2PLRA 1MR3F 1R0ZA 2EWVA 4Q1DA 5TDHA 3RS2A 5HKKD 2KJQA 4PTLA 2JDIA 2WJJA 1MKYA 4ARZA 4TLBA 5DE3A 4YDSA 1AS0A 3LFUA 1G3IA 1SVWA 2CLCX 5JI3E 4E03A 4U7DA 4IXNA 1PUJA 1F48A 4OJKA 1XF9A 4PO8A 4YMSA 2HV8A 2PZEA 3MJHA 4MRVA 1E2LA 1TF5A 2PL3A 2A5GA 1DOAA 3W5IA 3SYNA 3T1TA 2RGCA 4PHTA 1TEXA 5FOXA 5J40A 5JFGA 2GJSA 2ZBBA 3MCAA 2V0WA 1KKLA 3NBFA 2XEXA 3TSWA 1QHGA 2KB0A 5HTKA 3D72A 2FFAA 3R8FA 2JN7A 1JAHA 4TL9A 1KI7A 1GRRA 1D6JA 3ZD7A 2QPOA 3IHLA 5K8UA 3DOFA 3F8TA 3IBYA 1DO2A 2CCJA 2R6DA 3W34A 1X6VA 2AXPA 3VHLB 3AP1A 1KDTA 2J7PA 3DPUA 4B2IA 5C18A 1N6RA 2HXYA 2PR6A 5TXGA 3GLGE 1N3BA 1ONBA 3HPQA 1II8A 2FN4A 4LWZA 2DCUA 1G3RA 3BE4A 2D3WA 2V1XA 4I39A 1XZPA 1KI6B 4Z54A 3U7FB 3K53A 1QHIA 2KX6A 4YXWA 4NYJR 2ZRAA 4M9XA 3QKSB 2O8DB 1GRQA 3GLIE 3B7GA 3W6NA 2OG2A 3AF1A 1R5BA 3LWNA 1OXSC 4M9ZA 4DKXA 4AI6A 3QVVA 5FPHA 3B9QA 5AWFC 2ZI5A 4MUAA 3ND8A 5AUNB 1OE0A 1XJCA 2ECKA 5KDDA 3GJXC 2GCPA 4HB4A 2W6IA 2B92A 1GUAA 2IF2A 2QAGC 3C16C 4L15A 1ZW6A 1HE1C 3I5YA 2W83A 2ZANA 1GFIA 1GKUB 2XNSA 4UXHA 3F1OB 3BGWA 2BBOA 2ZYTX 1W36C 1DP8A 4EQ6A 5LD2B 3ICQB 4OHYA 1SKYE 1QVAA 2ZM5A 1I2MA 2L0WA 2QRZA 3GECA 2A3RA 2BOVA 1KY2A 3IKJA 3QPUA 5CM8B 3KKQA 3R7WA 2QP9X 4DRZA 4ESHA 2NO9A 4GMDA 5JRJA 2IS6A 5JHGB 2GHIA 3QUSA 4DSTA 5FUXA 3X2SA 3BWLA 2XXAA 1TS8A 3S1AB 4G5QA 3U60B 1VG8A 2WAXA 1T9HA 2C78A 2OZEA 2QRNA 2YINC 4P4UA 1LS1A 3A1TA 1YJ5A 3MJRA 2FH5B 1N25A 2HT6A 4KU4A 1TQ6A 3ZYCA 1L2TA 4XSGA 1TUEA 2VV8A 1C1YA 1DAKA 3WNDA 4BEBA 4QJ3A 5AR1A 1JPNA 4AKHA 4KSCA 1DRMA 1VCIA 3VU9A 3RSLA 4GOJA 3CR7A 5LB2A 1ZM2A 2PZGA 4GRAA 5CJPA 3GLGB 1XCMA 1SVIA 4KLZA 5HDDA 1GG2A 4D6PA 2C04A 2F55A 3EPJA 2F3RA 2W6JA 1AGRA 4TQ9A 3UG6A 2IXFA 3W90A 3IGFA 2G1KA 2VEAA 1NMXA 3BBPA 5E7JA 3PEVA 1XMSA 3OIYA 3E4QA 4B71A 4EJSA 2ZSAA 1J8MF 1NIJA 3SHWA 1KDOA 1Y3AA 2YWFA 4D0NA 2KWIA 4WUJA 5B57C 3GLIB 4H1VA 3ZVLA 4JL8A 4JT4A 2J46A 4OQFA 2BBSA 2JJ2D 2P65A 4TYQA 2IWHA 1TADA 1XCPA 1EFRD 5FOUA 3K0AA 1U99A 2Q21A 4Q4AB 4ZIRB 4TSFD 4HZIA 2BMFA 2HDNB 5CM9C 4BQSA 4RJLA 1BMFD 2L0XA 3F1PB 3WHKA 3RTYA 4DEXA 4LBWA 4X8MA 5KDLA 4TLEA 1E32A 4S2EA 3VOLA 1U9IA 4M2LA 4B6EA 5B64A 3GPLA 1SKYB 1M74A 5AUQA 4GHIA 1DAFA 1ZC3A 2W0MA 4V0OA 3G82C 2ERXA 5KPJA 4F4JA 5J4VA 4AKIA 1CS4C 4YMTA 2ZSBA 4A2QA 5AJYA 1OYWA 2JASA 3W6PA 1NMZA 3CNNA 4IOKA 2CJWB 4LRZE 2QPTA 2VP2A 3IIJA 3UWKA 2QENA 2GJ9A 4UJ3A 3RAPR 1OHHA 4I1UA 2VHCA 3Q5EA 3KTAB 2H1LA 2YKHA 4KO8A 4PC6A 1GRNA 3N70A 3RRYA 3ETLA 4TL8A 4P4SA 2ZSFA 3A37A 2BDTA 4XWOA 3NHBA 4M4XA 2CHVA 3DOEA 2O0KA 5CK5A 1KI9A 2MMGA 3B78A 1EX7A 1EGAA 3PUWA 3LBHA 4V0KA 1GL7A 1R0XA 1ZMXA 4AIIA 3AB3A 1M6NA 4TYWA 3I73A 1OW3B 1I4TD 2QKPA 4BUJA 2IHBA 3R9WA 1N5KA 3IS2A 1D2NA 4DCVA 1S2MA 2O52A 4PFSA 1FQKA 4TTPA 3DO6A 3ZQ5A 1E9BA 5J4KA 2WPDA 2QP3A 1WXQA 4DCNA 2ZRJA 2O8EA 1OIVA 1QHHA 1SKQA 3LXXA 2VP9A 3QY0A 1E79A 3BRWD 1OKKA 4LV5B 3A0RA 4C7OA 3LX8A 1YR7A 1XEWY 1P9RA 1M7HA 3B5JA 3WRXC 3VNVA 3O47A 1J99A 4LJ7A 3PR1A 1AGPA 1G6OA 3TAHA 3ULFA 3PENA 3MSXA 2QZ4A 3A4MA 1US8B 2A78A 2HLDD 5HE8A 1KOUA 2FJUA 4US1R 1NMYA 4TLAA 1DAMA 1SGWA 3IDQA 1FUUA 2CCGA 5FPSA 4HI4A 2P67A 1ZM4A 2VHQA 4IOJA 1OTEA 1JPJA 1S1MA 2RGDA 1GZSA 2BBTA 4XJXA 2B02A 2XSZD 5F68A 4EFLA 2YZ2A 1OPXA 4A8JA 3T15A 4FIDA 4EEPA 5CIWA 5EE9A 5JBQA 2OWHA 2I4IA 1A82A 1HUQA 4PQYA 4PKYA 1WE2A 1Z5ZA 4BECA 3AGPA 5J47A 2WKPA 3CX8A 2G77B 4YMUA 1TAGA 1K6MA 2C96A 4DHEA 3TR5A 3OESA 1N5IA 1YKSA 2LCFA 3B85A 2W2VA 1ZIOA 3HJIA 4L4UA 1YU9A 4F3LA 2BEJA 3UPUA 3CX7A 4GBMA 5DH9A 1G3MA 4RD2A 4NXBA 2ZUDA 1JB1A 5JSZB 2BEKA 1HEIA 1NY6A 3LDAA 2L1MA 2Z6VA 5FTNA 3WNCA 3GFPA 3MWKA 3CM0A 2H18A 1Y63A 3MFXA 2P6UA 1W36D 2NGRA 3MXQA 2ZSEA 4QG7A 3U2QA 4Q18A 2VRWA 1OTDA 3F5FA 4D4KA 5JS8A 2PMDA 5HKKA 3NEYA 4RCZA 4WIAA 1FP7A 4DJTA 2NIPA 1PVOA 1CR0A 1EFTA 2KBFA 2OAQ1 5EZ6B 3B6EA 1Z0IA 4IVQA 3SJZA 3TQFA 4D81A 3NBXX 3WNBA 1AKEA 4PO9A 5L3QB 5CK4A 2PCJA 3TSZA 4DJ2A 4MN6A 4ZI2A 4GW9A 4P32A 1OH5A 4ZDWA 2ZTSA 2ZRBA 4Q9JA 3SFZA 2J3EA 3F1NA 4RVCA 1JBKA 4NCJA 4EJSC 4EDHA 3QKRB 2E1RA 1GDDA 1E2GA 3SS8A 1WB9A 5SZJA 3TSOA 4LC1A 3RRMA 5DHAA 4HP4A 3SBDA 3GLHE 4C4PA 4DSUA 1Z0KA 1ZM7A 1DARA 4WXRA 1AQYA 3RS5A 4CW7A 1S1ZA 4UNRA 1N9OA 2GK6A 2VP6A 3QXHA 2X1VA 4NYMQ 2DR3A 3Q8XB 3ADKA 1RYHA 1S67L 3HYTA 2V6IA 2WIAA 4A2PA 1KJYA 3TR0A 2GCOA 1CJVC 4CEIA 2ZJ2A 5EE1A 2NPFA 1E9RA 3AKEA 1R7RA 2GKSA 4OKSA 4Q7LA 2C5LA 1V9YA 2EYQA 4WZAE 1S4QA 1U9IC 1W46A 1J8YF 3PFIA 4JLBA 4DJ3A 1DO0A 2ZSDA 3ONWA 4PSAA 3TUJC 3AVPA 1E9FA 2XITA 2VO1A 1KI2A 4OI0A 4NZYA 2WHXA 4U02A 2ZS7A 2R62A 3FKSA 4ASUA 5AVEA 3VFDA 3QXJA 1EW0A 1VIYA 3Q7QA 1F98A 2JJ1D 2QA5A 5JCPA 3QBTA 4B76A 4ZKDA 2ZI3A 2VIIA 4JLJA 2JAQA 4MRPA 4AKEA 1XJ6A 1RKBA 3TLXA 1LSVA 4DLZA 1AQUA 3K70B 2QL6A 1VKJA 4V0ME 3N5CA 3GJ7A 1TF7A 4A36A 4HYYA 4URYR 1A2BA 2VQSA 3ZGXA 4OK5A 5IT5A 4NXFA 4K46A 1ZAKA 3HDTA 3K0FA 3BWDD 4EXOA 5C2JB 5DISB 5F6AA 4RZ3A 4LCBA 4S35A 1Q20A 1CU1A 4DBLC 2A5JA 3ZVRA 4HOIA 1IBRA 3GLHB 3U6KA 1GWNA 2CL6X 3M1IA 2XB2A 1D06A 2V4ZA 4BZPA 1IAQA 4Q21A 3BXZA 1E99A 2JCSA 3GJ6A 5DI3B 2YV5A 4JKYA 1J90A 4O0MA 3RLFA 2BC9A 1ZM9A 3SR0A 2C9YA 3T5GA 4BASA 4DC9A 2ZR9A 4HP9A 2GXAA 1IXZA 2VP0A 1G5PA 2P7JA 4MYHA 1Q1EA 1T8TA 2REXB 2BKUA 2HUPA 3MWLA 4IRUB 5FBVB 2J0VA 1XB2A 2EU8A 2R9VA 4N1AA 1ZCBA 4FCTA 3P1JA 3UIEA 1LB1B 1XEXB 4PQFA 4KFTA 3SJBA 4A8JC 2WWFA 3BS4A 4B3XA 4BFZA 5J4HA 1OTBA 1UBCA 4LJ8A 2WIBA 2JATA 1ZBDA 4Q03A 1M7GA 3QF7A 4DDVA 4B35A 1ZVQA 3LVRE 2JJ2A 2ZAMA 3OEED 4JBYA 5FI1B 4OK3A 1T1CA 1E2QA 1L8QA 5K8TA 1S66L 1DEKA 2GJKA 4KYUA 4TSFA 2J59A 4HUQB 3TQCA 1CEEA 2QJ7A 3U7HB 1NSFA 3H9WA 4C9BA 3GLFA 1IXRC 1OTAA 1BMFA 5A4JA 1Z0AA 1W7AA 2PJRA 2C2HA 5IU1A 1G8PA 4QJ5A 2W6ID 2C9OA 1U98A 1NNEA 2QTHA 5TARA 2AWNA 4WXPA 4BE7B 4DB4A 1DAIA 4PZLA 2GRJA 3EWAA 4LHVA 4DSOA 2PD7A 4QBGB 2JLYA 1Z3IX 1KI4A 1F60A 4FMBB 4EFMA 2OAP1 4KITB 1RRGA 4QM7A 3IQXA 3Q72A 2JLUA 1LNZA 1O87A 2GTPA 1NN0A 3THYA 2Z6CA 1F6BA 4YMWA 3KB2A 4RSGA 4TL7A 1YZUA 4HJ6A 4QM6A 3HJNA 4DZZA 5BN3A 3E2IA 3A1WA 5TVKA 3WBJA 2D7DA 3BH0A 5EXSA 1LSWA 1R5OA 2JGNA 2D4HA 1T0JB 4MGKR 4EPVA 3KKPA 3BB3A 4LOAA 4BFUA 4BZXA 1X86B 4R7ZA 4MH0R 2CNWA 1XTQA 2YKFA 2QORA 5JJKA 1BIFA 2DYKA 2R6AA 2QI9C 2ZYUX 2OFXA 3KX0X 1E4YA 2F3TA 5FBRB 4HDCA 2A5DA 4GOXA 2QM7A 3GJ8A 3FG8A 2KDKA 1OFTA 2Z43A 4JT2A 4QKQA 3AVXA 2W6JD 1W5TA 4LHZA 4NYJQ 2CMNA 4ESVA 2VHJA 4MN5A 2IS2A 4RZ2A 4I3IA 3LQQA 1TS0A 5FOWA 5HE9A 2D74A 1D5CA 2IYUA 3AF2A 4LRWA 3ZLJA 3IEUA 3K9HA 1Q3HA 2IC5A 1E1QD 3CF2A 2QN6A 1G9XA 1EESA 4IEEA 1TL7C 3AH8A 5FR1A 4HDQB 3RDPA 1U8YA 4DXAA 3UB9A 1OXTA 5FUYA 4HAWA 3IBGA 4QHYA 2J7KA 2V7QA 3TE6A 1ZUIA 4O25A 4HSEA 2XSZA 3EIHA 3Q3JB 3PEYA 2W0SA 2G83A 1JAIA 4H6JA 1U0LA 1XNJA 2MSEB 2QY9A 4Q47A 1R8SA 4TN1A 3SE0A 5FR2A 4LJ5A 3N2IA 2C9CA 2ZRPA 2BCGY 1YRAA 1KK0A 3FMOB 4C2UA 4Q7MB 4D25A 4W5JA 4Q9HA 3NTUA 1Q12A 1SZPA 1JQJC 3EASA 3P4YA 2YJTD 2OE2A 1GTVA 5DJTA 1P5ZB 2FG5A 4PC1A 5HR5A 3PUZA 1XFNA 5G53C 3NOPC 1MOZA 4JGPA 2CL7X 4A4DA 3BIFA 1OHHD 2CXXA 4FMCF 4EESA 2ZU0C 3P4XA 4C0HA 3CR8A 2FFHA 1CJMA 3MAAC 4YQFA 3LYXA 4NCIA 1OH7A 5EE5B 5JRZA 1NLYA 2ZI9A 5CJ2A 1MABA 3E5HA 4JLVA 1GKYA 1XX6A 3VX3A 4A9AA 3EIEA 3QVUA 3MWYW 2IYQA 2Q3MA 1I2DA 3TRFA 2ZI4A 5EE3A 3THOA 3L82B 5TV2A 1NJFA 4GZMA 4JYCA 4R3AA 5JECA 1XU4A 1Z47A 1E9CA 4LHYA 3NG1A 2OILA 1XTJA 1XRJA 4P0TA 4YLGA 3WMFA 3BC1A 2VF8A 5M04A 2A2ZA 2WPDD 2QQEA 1G8FA 4JBWA 2OCYC 1F2UA 1AN0A 2G0TA 2MMCA 2ZJZA 3T50A 2RGXA 3VQTA 2B8WA 1XCGB 4NCNA 3OIVA 4HQAA 1E79D 4ZKEA 1OKKD 2PYPA 3KXKA 1DTSA 2WAYA 1HURA 3UWOA 3CNOA 3KKMA 4HZUB 5DI9A 1DELA 4AC9A 4PPFA 2QAGB 4GI7A 4M53A 3FKQA 1N5LA 3B1VA 1R0WA 3HU3A 2ONKA 4IOLA 2XTMA 2ZE5A 3CRRA 4P4TA 4UXJA 1W36B 3QENA 2D62A 3FOZA 1OH8A 1NI3A 2JLSA 2PT7A 4Q4LA 3ZZUA 1W48A 4OHXA 1UADA 4EETB 3QF4B 2HEIA 5HCIA 4BFTA 3J81k 2KBEA 1E1RD 2WMNB 5AJXA 3QXSA 1Z6GA 5LDDC 3E4PA 2GXSA 3U4QA 1E2KA 4PPQA 5TBMB 1RPZA 4QFMA 1FTNA 1XDBA 2G9NA 1KO7A 1T3HA 3VE3A 1SHKA 5C46F 3SQWA 1EFUA 1T5LA 4M8NE 2BMEA 3IQWA 4KI0A 3BORA 2Y8EA 3A36A 4EPTA 1M8PA 1T91A 3P20A 2JIZD 2ODWA 3U3OA 3W3ZB 1PLKA 5FUWA 3WYAA 3IEVA 1KK2A 2A30A 3T61A 4I3AA 4NH0A 4XIGS 3IPYA 4M1KA 4LBYA 3VR2A 3ND9A 5HDSA 2CHQA 3PUVA 1AZTA 1OFUX 5FTLA 3F3YA 3GEIA 1OIWA 4ZDJA 3SYKA 3KL4A 3K0EA 4C0KA 2OT3B 2R2AA 2IXGA 3ASZA 3FMIA 4CEJA 4DLYA 2PBRA 3PYPA 2DPXA 3SNHA 1KZGB 1XTIA 2FWRA 4JSYA 4GCZA 2O8CB 2WKRA 2J87A 1NWZA 3JVUA 1GM5A 3UATA 2AK2A 1KMHA 3A1SA 3RS7A 2DBYA 4LC0A 2J41A 4LPSA 4D0GA 2NZJA 1NF3A 3MG9A 4PX9A 3D8BA 1IHUA 3EC1A 4I38A 3H2YA 2ZRHA 3WP1B 4BWYA 3GP8A 2OWJA 3NEJA 1AA9A 4AKGA 1XTSA 2W0NA 4A1FA 4QGGA 4FMCB 1VIAA 4L9EA 1PLLA 2QJ5A 2GK7A 5EP3A 1KGDA 3EWKA 5UKDA 3NOUC 4O3MA 1E2DA 1DE0A 2QWSA 1GSWA 4TMTA 2V0UA 1NBMD 1G18A 1P72A 1QRAA 1AZSC 1MRSA 3DMNA 4UNPA 1II0A 3UB7A 1UF9A 3QBVA 4RFSA 4R38A 2PZFA 2OUKA 3NKVA 4ARZB 4ZCIA 4TYPA 1UWPX 2DWQA 1W4BA 3GJ4A 3MRSA 5L3VA 1E6CA 2BVNA 1J7KA 1NVVR 4I1OA 1TTTA 5KO2A 1QF9A 3GQBA 1BO6A 4GP7A 3CWFA 3CF0A 2IS4A 1GNPA 2ZPTX 1IOZA 3B60A 3EW9A 3OEEA 1FTSA 3FKSD 4FWIB 5E4FA 4ASUD 5KTYA 2PH1A 4HNBA 4CZ2A 4DLTA 2VSXA 2OXRA 4BRWA 1I4DD 1W2GA 4LRXC 4AURA 1TMKA 4BFXA 1QHXA 3C5HA 3HPRA 4OBEA 4BFYA 2NQ2C 2PDRA 2CMKA 1E2JA 4NPHA 1BYWA 3KXIA 2G3YA 1JECA 2OO7A 2F43A 4FI3C 3TVDA 3LIAA 2EYUA 5CIQA 1G7CA 4QBHA 3K8YA 1AS3A 4LX0A 2GDJA 3L8YA 2OCAA 2YOHA 3FE2A 5HWVA 1E0KA 2OFOA 4WZ6A 2R6CA 3O8RA 3UB8A 5TB5A 1TQ4A 1II8B 3H82B 4JLAA 2B8TA 4D26A 4B44A 4URXR 2P6RA 1D9XA 1ZJ6A 2XZLA 2QU8A 3RRNA 3CZQA 2ONJA 1T8UA 1XPUA 3AVWA 4Q1AA 3U61B 1OFIA 2DY1A 4U5XA 4Q02A 1N0UA 1ANKA 4BBTA 4MGZR 1NLZA 2WV9A 1XD2A 2QUZA 3AP3A 4EIWA 5L3SA 2AD1A 3PIRA 1KYIA 4II7A 4D80A 4C0LA 5KPDA 1F2TA 3B1XA 1S9DA 1NSTA 4MQBA 2ZUBA 4V02A 3CWQA 5JLJA 2WJGA 5F9HA 4DLVA 1OF1A 3AF3A 1KOFA 2I9VA 521PA 4MKIA 4I81A 4HAVA 3X1YA 4WW0A 4QBIA 2FNAA 5BWMA 3IPXA 1QZXA 4WLAA 2CK3D 1MRNA 4PKYG 4KUOA 4EQ6B 2QMHA 1D9ZA 2IUSA 4BRUA 3NBZC 4ZIRA 3ZH9B 5I5LA 2VV7A 3M4YA 1EK0A 4AD8A 3KUCA 1P2TA 2OLJA 3FFBA 1T3LA 1AM4D 1E1QA 5A5GA 4XWKA 5EE0A 2XXAB 3KJEA 4XWAA 3EA5A 3EAQA 5P21A 2V1UA 3QOFA 4TT3D 2DB3A 4US2R 1KO8A 3PXGA 3QXXA 2H28A 1KSJA 4JSTA 2GXUA 3OIUA 2VH5R 4C0QC 4HLUA 4D0LB 2PT5A 1IY0A 4F91B 1FMLA 4LRYC 1ZC4A 2GZHA 4NU0A 4NYIR 3VU9B 1IY2A 2IL1A 2ZOHA 2O8BA 3T06B 1S4SA 5LBIA 2EFGA 3LIFA 4DIDA 1Z6AA 2G6BA 3T12A 3DEFA 2NMVA 3NH6A 1FNMA 1U2RA 2BKEA 1T1BA 3C8UA 4HEJA 4A0FA 3DKPA 3LI8A 3GEEA 2PMKA 1SVKA 4GL2A 4JL5A 4JYBA 2A5FA 4LLOB 3FFAA 4IDQA 4KODA 4EJSB 3LIEA 2C03A 2J0UA 2AL7A 2GILA 2IUTA 2IYZA 2PEZA 4F4IA 2Z6DA 5HWTA 4RQ9A 1RJ9A 1VDZA 3B8HA 1CRPA 2ZQ5A 1R8QA 1NLFA 2D06A 4WF0A 2IS1A 1EFCA 4IW3B 2RKOA 3K0AB 4LYAA 2QP4A 4Q1BA 2EFEB 3NHAA 4JVMA 4R9UC 2ATXA 1VTKA 1Z2CA 2C95A 2CNWD 3K09A 4D4MA 2OEPA 3PUYA 3BAFA 1Z28A 2B6HA 2QBYA 4B3DA 3THWA 2CL0X 4IDPA 4GHIB 1CRQA 4OK6A 3WMEA 3PVSA 4M0LA 1ZNWA 1PZNA 3TKLA 2F9MA 3X1ZA 4RD3A 2IYRA 2GF9A 4CVNA 2NOAA 1OH6A 4JLNA 1P7CA 2FX3A 2PR5A 2RGEA 1OFHA 1C4OA 4B75A 2REOA 4PZYA 4JLKA 3BJIC 3E70C 2GJ3A 1R4AA 3FWYA 5G3YA 5DKLA 2GZDA 5IHPA 1RIFA 2HYDA 3FHCB 3D31A 4Q4HA 5FBQB 4FCWA 1RVDA 1DG1G 1P3JA 3U44A 1SXJA 1NG9A 2V7QD 5H68A 4F92B 4C0BA 1VHTA 1ZU4A 3KQNA 5CITA 2ANBA 4B34A 1E2EA 1E1RA 5HZKA 2X8AA 4MA4A 2AK3A 3R8CA 5E7MA 4BLQA 2CCKA 2E87A 8OHMA 1ZRHA 4QOSA 1HQCA 1ZNXA 3VR4A 1NN5A 1OXVA 1S3GA 2FEOA 2Z4RA 3NC1C 5F9FA 3EZFA 4NTZA 1E2NA 3TJZA 1Z0DA 3ZZ0A 3CBQA 4E07A 1QHHB 4NHOA 2ZR0A 1QHYA 4ZO4A 4ACAA 1R5NA 2JIZA 4H9GA 4C7OB 1XJ4A 1EG7A 3EZ2A 5DIFA 5HD3A 3BFXA 2ZJ8A 5DNYB 2GEDA 5FOSA 1E9AA 2IEYA 1LS6A 4Q66C 3IIMA 4NBSA 1XXHE 3SDZA 3V00A 1Q44A 4Z1MD 4LGMA 4TMKA 1FP6A 1G7RA 2FSGA 1YZLA 2CVFA 4M1YA 4EQ1A 3UANA 2V55B 4MITA 4B43A 1E69A 3VKWA 5CB6A 3I1FA 1CJKC 3QKRA 1NBME 1UPTA 3SI7A 2EA9A 1NP6A 4A8JB 1TX4B 1Z07A 4M9QA 1FW6A 4XT2A 1CKEA 2AX4A 4B3BA 3C5CA 1GNQA 4JMPA 3R20A 4I5SA 2ZRCA 4R71A 1E0AA 4C0AC 1TEVA 2CE2X 5IS1A 4HJ4A 2VA8A 1ZNZA 2N1BA 1S1CA 2MSCB 1KJZA 3I72A 4CIDA 3FPAA 3GDIA 4CT4B 1IN8A 4F3LB 4O2LA 3X1WA 5E95A 1XXHA 3AVOA 2WWGA 3W8RA 2A5YB 1X8JA 2GXQA 3U7EB 5IRCD 4KBFA 3X1XA 3E1SA 4POAA 4OI4A 5C4GB 4CGZA 2HF9A 2PX0A 1IQPA 4RKEA 1NBMA 2IWRA 1KAGA 1ZUNB 2K7SA 4QC2A 4DSNA 3HU1A 3NOTC 3K3CA 5JEDA 4EPWA 1JEDA 2TMKA 1SULA 1UEJA 4G5RA 3QKTA 4HLUC 1N2CE 1N0VC 2ZREA 3QQ5A 3REFA 2NO6A 2PLFA 3OZXA 1BS1A 1XJ0A 2Z0MA 3QG5A 3THXA 2BCJQ 5TY0A 3OFNA 4RD4A 3U7GA 5HZHA 5CYOA 5DYGA 3KQHA 2JLWA 4DCSA 1UDXA 4WZBE 3RWOA 2O0JA 1XD8A 5HSQA 2ZAOA 4HAYA 3KB1A 3TVTA 3EARA 4M4SA 4N0EA 2A9KA 2I3BA 3F1NB 1COWD 2ZI7A 3GJ5A 3C15C 4GP6A 1E2MA 4BFVA 1WRBA 3I62A 4EKDA 5J4YA 1A2KC 2H92A 2YNMA 3PITA 4PAOA 4I4LA 1EWRA 3N2EA 1OYYA 1T19A 1Z63A 3A0SA 2BJVA 2KI5A 1TS6A 5DKKA 1VB6A 1AKYA 5BYKA 4UXIA 1VHLA 4G3XA 3NJAA 5C1BA 1ZU5A 5JWHA 1W0JD 1CXZA 2FZ4A 2FPMA 2W58A 4UKDA 2XX3A 4YC7A 3EEHA 3P32A 3H0KA 4W7SA 5J4LA 3B82A 5FH9A 3V4RA 4P3YA 2WOOA 3AUXA 3K09C 3PCRB 2GCOB 4CEIB 2QTFA 3DM5A 2P0EA 2DFKB 2HV1A 1I4LD 3LXRA 4FW9A 4X8LA 5SZIA 3QEJA 4HDOB 2QEQA 4LJ9A 3GFOA 2LKCA 1P4SA 3BB4A 1G64A 1ZP6A 3NWJA 3U3RA 5FTKA 2PJZA 3CRW1 4OQNA 3K9LA 5E7IA 4ITRC 3U3JA 3KKOA 4GMXA 3D6TB 4AYXA 2H17A 2GJ8A 2C8VA 2QTVB 3UMEA 4M1SA 2W27A 3CUEF 4HAZA 3L0IB 4TMXA 1ESMA 4C30A 2I1QA 2W00A 3BY9A 4BLRA 1LF5A 1X8LA 2ZJAA 3B2EA 4Q5IA 1N6IA 2AR7A 4TMVA 2FEMA 3DM9B 5GJBA 3G6OA 1FX0A 3UG7A 2IA5A 3TH5A 3GLFE 2D02A 2GWHA 2XJ9A 5CDFA 2CEAA 3WBKA 3H7WA 3L2OB 2CK3A 1SXJC 2MSDB 5GVSA 4MYUA 1JR3A 1P60A 2AKYA 1U90A 5G4YA 3HWSA 4TLCA 5D3QA 1FZQA 2EFDB 1A7JA 2IYVA 4PSKA 4HUQA 1CF4A 5BQ5A 4PPNA 4US0R 2QMOA 1W4RA 4JGQA 1GSXA 3K0FB 2EVWX 3ZS9A 4BLPA 4CDGA 1WDTA 4E04A 4KFRA 3FHOA 4QGHA 4B48A 3FDIA 1S9HA 2GBLA 4NCKA 4ILEA 4L9GA 5IF9A 4TT3A 2GF0A 3LY5A 1VG1A 2P5TB 2XTNA 4DUGD 3AVQA 3LLUA 1GOTA 3G5UA 4JZKA 2VLIA 3SJCA 2VEDA 3EZ7A 1HQYE 1S1YA 1Q22A 1LW7A 4KBGA 2QQ0A 1K8RA 4KV9A 1TNDA 4GPTA 4Q48A 4DDTA 2X19A 5KIZA 2FPKA 3KQKA 1N5JA 3CPHA 4CF7A 4B2LA 1FFHA 3CX6A 3OIWA 3LICA 4LBZA 1MO6A 1NKTA 1EX6A 1KSHA 3G0HA 4ZV4A 3KX2A 421PA 1QG2A 4B2PA 1G5TA 2JEOA 5FPKA 3KUDA 3AVUA 2PEYA 4DLUA 4RY2A 3GJ0A 1KSFX 2WWIA 4JLMA 4KQDA 2A24A 1PLJA 2XGJA 4DLXA 4MKHA 2YHSA 4EPXA 4QGAA 4XH9B 4G1UC 5KU1A 1Z8FA 4UNQA 1IN5A 2FFQA 5L3RA 5CLLA 4HLCA 3CRMA 2SHKA 3AP2A 4JVLA 4Y0AA 5HPYB 2Q9AA 3CONA 3AKCA 5LPNA 1JQLB 4AWXA 1KSGA 3I5XA 3GLFB 3O8CA 1IN6A 1DVRA 2CLSA 4URZR 4J0QA 4X8OA 1GIAA 4MKFA 1UWNX 1P9NA 5AJWA 3VE4A 2QNRA 3QIAA 5GVRA 2IBMA 3SYLA 3V9PA 3K9GA 3CRVA 3OE7D 1RC8A 4HI0E 1U8AA 1TU3A 2FDCA 4CEHA 4AY2A 3R9XA 3W8NA 3CRQA 3LIDA 2QSZA 3H1TA 4HH2A 4PAMA 3THYB 1NVWQ 1OLOA 4FWTA 2CBZA 4KFSA 4B32A 1CIPA 4URWR 3VHXA 2D2FA 2IF0A 1K5DA 4NP6A 1UEIA 1DP6A 5G41A 1UKYA 3BOSA 5D3MA 2QMUA 3LH5A 2WJIA 1P75A 4TQAA 1IJEA 1RFLA 4ABYA 4NXGA 1S8FA 2NO7A 3PEUA 4A15A 1IJFA 2RAPA 5FUVA 4Z8XA 4KYIB 5HCNA 3K70C 2YOFA 2FSHA 3Q5DA 4K08A 4Q9LA 1G7TA 2VLGA 2AWOA 5DYIA 3IBRA 2ZXUA 3P26A 4HATA 4PANA 3EG5A 3IO3A 2RGNC 5KNDA 1KKMA 2RGBA 5BXQC 2YC2C 5JHHB 5EXTA 1SVSA 3IO5A 3V4FA 2GA8A 1G3QA 2M1CA 1DAGA 2F1IA 3OF5A 2OFWA 2HCBA 3TMKA 3A4NA 1TQ2A 1XP8A 3H86A 1KO1A 2OBLA 2ZE6A 1P97A 1ZM3A 3QPVA 1MO4A 4JIMA 1E2HA 2UKDA 1RRCA 1UGUA 1W44A 2DFLA 4FMDF 1P61B 1F9IA 3GMTA 3LUQA 4IFBA 3GCGA 3LV8A 2XAUA 1ZD9A 4PXAA 1KHTA 1QDEA 1RE0A 4M9SA 4B9OA 1G17A 5DGXA 4A6XA 4Z1MA 4K8OA 4BBVA 4NYMR 4E09A 1U0JA 3WYGA 1GL9B 3LBIA 1T1AA 4P33A 4DVGA 2DWPA 2ZRMA 4MGYR 4V0NA 4H6JB 1H65A 1II9A 2J0QA 1E2PA 3QXCA 4M22A 1T6NA 3D3QA 3EPKA 3EPHA 1N9NA 2BHRA 2CVHA 2O8FA 4BEJA 3I4LA 2RGAA 1X1RA 4JGRA 2XTZA 4U00A 1AIPA 1M7BA 2ZU6A 4D4JA 4MUBA 1NL3A 1KMQA 2FOLA 3VTKA 1N9LA 4HB3A 3SOPA 3FMFA 1HTWA 4LBVA 5SZKB 4LHWA 1XWIA 4OJQA 1Q1QA 3ADCA 3BH7A 1X0OA 2R44A 1Z6XA 3B13B 2GAAA 3QF4A 4L5BA 4JBXA 4M1MA 1E2IA 3RS4A 4XD7D 4LV6A 4M21A 4MDEA 2ORVA 5JJLA 4LJ4A 1G1MA 2NG1A 2GBLC 1WF3A 2YYZA 2YOGA 1G8HA 1CBUA 1SXJD 1CR2A 1LF0A 1MABB 4L8GA 1UM8A 4JS0A 4DT1A 1KTVA 1VCMA 1KO4A 1N6LA 1GNRA 3HYRA 5JMTA 1FPMA 3BERA 2R6FA 5B58C 1TS7A 3JZMA 4Q4JA 4TL6A 3WRYC 1A5TA 5KOYA 1UBEA 3CF6R 1F5NA 4GNKA 4ZI3A 1OIXA 2H16A 3OEHD 3AF0A 4OQLA 1YRBA 2YVUA 3GEHA 4L16A 4W5HA 5J5CA 4I1SA 3REGA 4F38A 5KNBA 2N42A 1F2UB 4B73A 4BBUA 4FINA 1WMSA 5K8IA 1GITA 1COWA 5FTJA 1XMJA 4A2WA 4GS9B 1G3UA 2WWYA 4IOMA 4XSHA 3B33A 3T1VA 5G3ZA 1P62B 4KSBA 4B47A 3QNUA 3UKDA 5K8LA 3UMSA 5J7EA 1T0HB 2H57A 2Q3FA 3CKLA 2J0SA 1V9ZA 2Q9BA 4XTCS 1DAEA 2VTKA 1W0JA 1OTIA 2VPPA 3LW8A 1NY5A 1YZQA 2D2EA 2R8RA 4OHZA 3TIFA 4QJ4A 1WP9A 2V3CC 3K0CA 4HAXA 3D7MA 4JLDA 1N0WA 2J5XA 3BD9A 4WVFA 2ORWA 3L0PA 4IJMA 5H70A 1XFQA 1N6NA 2IUUA 1G19A 3ICYA 2WWHA 5JEEA 5F3WB 3NVAA 1BKDR 4BFSA 2ZYWX 2BV3A 3A8TA 3U4QB 2QE7D 3DL0A 1XMIA 1UJ2A 3CPJB 3LX5A 2VF7A 4NMMA 2RMKA 4WN5A 1NIPA 2BJWA 3WMGA 3UMRA 4XVUA 3VKGA 1U81A 2ERYA 2F1HA 4M1TA 4BZQA 1ODFA 5LB4A 2ZRFA 4UQOA 3UE6A 4URUR 1KNXA 1KAOA 4C0SA 4FMDB 1LVGA 2G88A 2RB4A 5DHFA 4A82A 4A0RA 1UKVY 3FVQA 3SU8A 4EEUA 2YKGA 3B9PA 5DO9A 3ZQJA 3Q85A 2WZQA 3TNFA 4Q1FA 3W6OA 1KI6A 4GT1A 1SVLA 3NDBB 2O0HA 1R0YA 3C4JA 4MRNA 4HB2A 1CTQA 2OV2A 3CLVA 3QKSA 2O8DA 1DS6A 1JXOA 2YC4C 3L0SA 4CEJB 3HP1A 3IUYA 3ZIAA 3BB1A 5KDOA 1BYIA 1XPRA 4RZUA 4XOIA 2NO1A 3UXMA 1Z22A 3OFND 5BYJA 5FFMA 2XNDA 1KMHB 4DCTA 4DB2A 4HIAA 4YWZA 3RABA 4EPYA 4CRWB 4QL3A 1VG9B 2ZRKA 1XBTA 3L8ZA 3F1OA 3K70D 4DUGA 4F7WA 4HLDA 4PR0A 1GVNB 1XFAA 1PV4A 4LHXA 1YR9A 4E5UA 3QKUA 4V0LA 3EX7C 5F98A 4IFEA 5EP2A 3DHWC 1Q1ZA 3AVVA 3O8BA 3H82A 2QSYA 3UMFA 1CR1A 2Z4SA 2ATVA 3EWSA 2GESA 4IHQA 1QHNA 2ZRGA 4GDFA 1Z06A 3SHFA 3WP0A 3WYFA 2BWJA 3NH9A 3S1AA 6Q21A 1S96A 1TPZA 3MQOA 1SVOA 2RCNA 5EP1A 4RFSB 2ODEA 2ZE8A 5ELXA 2REBA 1VMAA 4RD0A 3T35A 2Q9CA 1JALA 4A0GA 1FMJA 3KDSE 5EJEA 4W5WA 1G7SA 2HXSA 1ZD1A 1U0HC 4G5OA 2GJAA 4MRRA 3TAUA 3WHLA 1Z0JA 1GILA 1HH4A 1T5IA 5JI2E 2PD8A 2EWWA 2FFBA 5FL7A 3RANA 3GLGA 1JXMA 3ASYA 2L4RA 3RVBA 5B30A 1W0KA 3B1ZA 1Q3TA 1DPFA 4QBFA 1GSVA 2BM1A 1UKZA 3KJHA 4ZDIA 2PCLA 5FOVA 5IK2D 1L4UA 3ZJYA 3BY8A 4JKIA 3ECCA 5B2ZA 5KSZA 2OM2A 4QNRA 1TUIA 4QNMA 3GFTA 4RCYA 3IIKA 1R6BX 4UNNA 3RSOA 2HJVA 2K5UA 2C98A 1G6HA 1NVUQ 3GLIA 1SHZA 4A0HA 3LW7A 2F43B 3OE7A 3EIQA 5KSOA 2ORIA 4LUCA 4PHHA 5KUTA 2R78A 3ZZTA 1JR3D 2KE5A 4TTQA 4B33A 4TQUS 1H8ED 3MMPA 4B3FX 4EAQA 4Q4AA 3SC3A 3RYTC 2HT1A 1WA9A 1Z83A 5GJWC 3R7WB 4JJZA 3F1PA 3VX4A 4DDWA 3NHQA 4TLDA 1CLUA 1WBBA 3FTQA 2Q6TA 3FMPB 3MD0A 3IHWA 2X2EA 4OHVA 1F3OA 1D2MA 1CJTC 1FQJA 2DHRA 2V9PA 2ZRNA 3KJGA 3VNUA 1XD2B 1G20E 1Z0FA 2FZLA 2FSIA 2VP5A 3CLOA 4NONA 3MLEA 1P6XA 1XTRA 5L3SB 3EPLA 1FOEB 1Q57A 5AVFA 2CJWA 4LI0A 1F2TB 4URVR 5AUOB 1KJWA 4ZCMA 3DDCA 3KXLA 3QG1A 1OV4A 1OXUA 2ZVPX 4PQRA 2QAJA 3KTAA 4Z51A 1OT6A 1JEEA 2FA9A 5JS7A 1W4CA 1LFDB 1W2HA 1VCNA 2H7VA 1Y28A 4KFUA 5F2EA 1GKIA 3LAWA 3PG5A 1WA5A 1RZ3A 1QVRA 2IYXA 3K0CC 2BM0A 2P5SA 2WSSA 4I99A 5AUPB 5DN6D 4HUTA 1M34E 1NG1A 3RH8B 2ZEJA 2WWXA 2ZS8A 1XTKA 1VG0B 1JI0A 3DVLA 3LA6A 4PHGA 5FL3A 1G291 2I1VB 2ZJOA 2C99A 1DBSA 2JA1A 1X1SA 4LDJA 5A0FA 4Y0VA 5J3WA 1ZUHA 4ERNA 2NPIA 2V1AA 1Q21A 3TUIC 4L9FA 2NTYC 4QXAA 2OESA 2GCNA 3C7KA 2AD5A 1KZ7B 4X8HA 3DZ8A 3RWMB 4LK2A 1JR6A 2J1LA 3CH4B 3MUFA 3TK1A 2OXCA 4TWZA 1T3SA 4TZ6A 2DWOA 4PHFA 1SXJE 1U94A 4PC7A 4R6LA 2H5EA 1W47A 2O8BB 2EFHB 1XEWX 5FOTA 5TMPA 1US8A 1HV8A 1UAAA 4LYJA 1YE8A 4LPKA 4TZ0A 1KNQA 2PX3A 3U5ZB 1TU4A 4KVAA 4Q19A 1VYVA 3DZDA 1JNYA 2F7SA 3QPWA 3QJYA 5BN5A 2XZPA 4G5GA 2J0UB 2ZE7A 1ZNYA 4XD7A 2N46A 4R70A 2QGNA 4JJKA 4C0JA 1BYUA 4P31A 1RJ9B 1PUIA 2IYTA 3EC2A 4TMWA 1XPOA 4BPBA 4P4SB 4LY6A 3OLOA 2ZRIA 4K81B 3LD9A 3C8CA 2OCPA 4KAXA 1E98A 5EXPA 2OBMA 3SJAA 2WICA 5LD2C 5CLQA 4HLQB 4AG6A 5H1YA 2J45A 2IEZA 1IXSB 5FBLB 3C41J 3ADDA 3H84A 5JSZA 4ACBA 1D2EA 2ZITA 1N6OA 4A6PA 5SZHB 1A1VA 2QBYB 1GL6A 2WJHA 3BFKA 3IS2B 3TW8B 5JWRA 3THWB 1H8HD 1R2QA 5JCZA 2ZETA 3OEHA 3AKYA 4B6FA 3SQXA 1AJEA 1FNNA 1HA3A 2B7BA 3ZVNA 4R2HA 2YWHA 2JLZA 4YONB 4RZXA 2O8EB 2EFCB 4DEYA 5L8VA 4ZPXA 4KCGA 3AF4A 3CWZA 2F1RA 1TF2A 1YZKA 2XOKD
chains in the Genus database with same CATH superfamily
1AXEA 2FPLA 2FMFA 3AKDA 2WJVA 3BFVA 3JQAD 2YIJA 1UBUS 3GFRA 1KY3A 1I3CA 2HGVA 1DX9A 2PH3A 3VC1A 5GY7A 2XVYA 3HG7A 2UYGA 4QEDA 3IUBA 3ZDQA 2GAFA 4D9KA 4IKOA 1EZ1A 4YEDA 4TV8A 4RESA 1ZYUA 1EP9A 4U0TA 3Q8WA 4GPZA 2H0RA 3KSIA 3CAXA 4JNKA 1QP0A 4HMQA 3KJIA 4U7HA 5FA7A 3FYSA 5EIHA 4OQYA 4ZDKA 3F3KA 3LRPA 2FUKA 2C77A 3H9EO 2X01A 4CLDA 2L42A 1AMUA 1T6BY 5L51A 3BIWA 1SUAA 3U49A 1PK8A 3V4ZA 3NULA 5KSHA 3Q4GA 5ICGA 1K6SA 9LDTA 1E3WB 3WGLA 3AV0B 5IKPA 2Z83A 1ZCAA 2WBLC 3FM9A 1KI3A 3T7IA 2XZOA 4QPPA 1LD3A 4ENVA 3KPWA 5JG7A 4NC9A 2PKEA 4YP5A 4QDTA 1JP7A 3DCNA 2VCHA 1K55C 4NL4H 2ZQCA 2PVSA 4DEVA 1JB9A 3L4SO 1CQIB 4R3BA 4MJLA 4W5TA 3ZW9A 5T6MA 1J1ZA 1P5RA 3WIBA 3CGWA 1SK8A 4QGFA 5IC6A 5LP6B 1XROA 2IOFA 4CT0A 3EMVA 3FYHA 5FV4A 4EBLA 2HSEA 4YV1A 2Z2IA 4TROA 2ZJ3A 3WGKA 1EK6A 2P69A 2QT0A 2YS6A 3D8NA 3QWFA 3U16A 2QS9A 3OP1A 5I9TA 1WSDA 1Y3CE 2ZC6B 3FZNA 4ZJYA 2QHKA 1YDEA 1CI9A 2W4QA 1XZQA 4JJ8A 5U4QA 5IJZA 4CXMA 2Q50A 3K8OE 2JVKA 4XIFA 4K0XA 5JTTA 1KE4A 4RELA 5AI8A 5E38A 3SLKA 2GEBA 5JZVA 4H77A 4CNQA 1CQJA 1LX6A 1A0KA 3GDHA 4UBOA 2V9AA 4D2IA 1DBIA 1OPRA 5AW9A 2YFKA 1KH1A 1VB3A 3A7EA 3CNLA 3NRBA 4B6PA 2PD6A 1Y33E 3ZU5A 4B3GA 2Z5FA 3ZXIA 1XJ3A 4OREX 5GOTA 3VKHA 4E4TA 1U7OA 2Q4OA 4JFAA 1YFKA 3QFTA 4FYKA 3SBEA 2J9XB 4PSVA 2WYIA 2P2LA 4S2UA 5GHXA 2WG0A 4I3HA 5DRYA 2PUJA 4GFDA 1L4YA 1U1FA 3UAWA 2PKQP 5EKXA 1VMEA 2F1JA 1HDIA 3UMDA 4OHKA 5FOQA 4KE6A 4R1NA 4TTRA 3W06A 2XMZA 2ZRDA 5AIAA 3O4JA 1E2FA 5H8WA 2E2WA 3SS3A 4NLLA 4DE1A 4X7PA 4CE6A 3RC8A 3NB0A 4C08A 3WQHA 2RAVA 5D87A 1HE8B 4J7XA 1XG5A 3ZWWA 2ZUCA 2R65A 2AHRA 5ECWA 4WL9A 3IPAA 3EGIA 2ENWA 3K9NA 2B18A 5CERA 2YN4A 5THXA 4DMHA 3M0EA 4L78A 1PFGA 1HLDA 4CKYA 2P9FA 4DWJA 5BV8A 3EZ6A 3D8RA 4W1RA 2ZUSA 2WJJA 1B41A 3B2QA 1IQ0A 2JFBA 3ZDYB 3JATA 3RTBA 1GAEO 2QUIA 5JFGA 1KIAA 3OF3A 2XMBA 2VH1A 4GG1A 3EDOA 4WKCA 4H3VA 3K8QA 1I13A 4HWRA 1I3MA 1I4OA 1NKVA 1JI3A 3WRXA 4WUVA 1GPWB 2UUCB 3HH8A 5L10A 1GRQA 3FDFA 4JI1B 1R5BA 3FSEA 2W8BA 1C14A 2JS7A 1AF4A 1OE0A 1W96A 2CHEA 2ECKA 2WDZA 4M46A 1ZK1A 5CX1B 2QAGC 2O1XA 4C1NA 4O2AA 5SY9A 2OGUA 5LD2B 1ZI6A 1QVAA 4E2XA 1TYCA 2E55A 1KY2A 1EX9A 2VJCA 5JSKA 2IS6A 3WQSB 3X2SA 4BAZA 4P4UA 4JJGA 1JPNA 4R51A 1SPBS 4GBJA 1K08A 3PKZA 4B80A 1T1GA 1AC5A 4PCUA 3CKMA 5JALA 4IMIB 1QIGA 4H1VA 2AOUB 3OPQA 5FEFA 2PX5A 3EGOA 4G26A 4KHPB 2PT9A 3DZFA 1Q83A 3HLDA 3NV7A 4UOZA 4K8RB 3WL4A 2H6EA 5HARA 2ZSBA 4YRPA 3O3CA 2CXRA 4LQCA 5JLAA 2QENA 1LJ8A 3P9SA 4J0KA 3MWEA 1EYZA 4D9BA 1WY7A 3U7QB 1HDYA 3RF6A 2XYGA 2Q6LA 3S55A 2G9UA 3NWEA 1XCOA 5JS6A 3FVWA 5DWVA 2WIDA 5NULA 1N5KA 1A9XB 1KVLA 2R84A 1WXQA 3BRWD 2RIRA 4DLNA 3R7FA 1M7HA 1W5AA 5IYZB 5KTKA 4DVJA 1KOUA 5H80A 1O07A 3T1RA 4WE3A 1SBCA 4P3KA 2BBTA 4G81A 5BN5B 3B8EA 2OKGA 5TEVA 4JX9A 1LC0A 4KIUA 5JR3A 5FA6A 5DLPA 3TR5A 4OMFG 4C0WA 3GLRA 1FSZA 4NXBA 1TMGE 2ZUDA 3DE5X 1LPSA 3TLCA 1ZUNA 1RRMA 4W8GA 1VDMA 4CMCA 2BLNA 3MWDB 4MQUA 2ZWVA 5L3QB 1DAOA 1D5WA 4MDHA 2WFAA 4ZI2A 3FR7A 4ZVOA 1LW6E 4BCBA 3OPYB 1U6IA 4ZVUA 1E2GA 4ZYLA 3TSOA 2QRVA 4AG3A 3CLKA 4RAQA 1TECE 3QXHA 1QTQA 3G3EA 5MDHA 4XUXA 2WDPA 1JG1A 5ARCA 2EFUA 1P6QA 1WKVA 1HF3A 3MS7A 2QTVA 3PFHA 2ONCA 1VIYA 3Q7QA 4J75A 1MTZA 4JWTA 1XJ6A 1W1IA 1ZN8A 2DUJA 1ORDA 3ILVA 1QCZA 5KTNA 3NTVA 2P0AA 2B4QA 3UWSA 3C5WP 2FK8A 2A5JA 5A5DA 3MOIA 4QVKA 5AM1A 3U6KA 2CL6X 3D4IA 5T67A 2V4ZA 1KR2A 2CVPA 3KYDA 2W43A 3BICA 3FNBA 5T3UA 4R1GA 3MBOA 3GG9A 2HRRA 2BC9A 1KTIA 1DFGA 3R7SA 1KXZA 2AC2A 4CBVA 2GHTA 4CV1A 4RTJA 3UIEA 3SJBA 1E7RA 4ME4A 5CAEA 2INGX 1IY9A 1C0PA 2ZCUA 1S66L 1DEKA 4UC0A 5AVWA 2NWQA 1RWKA 2W6ID 1H3QA 1DAIA 1X77A 3I76A 5I7VA 2QD2A 5EJ8A 2G72A 3IT0A 5ITVA 5LXTB 4ZQBA 2YZ7A 3OPLA 2EKQA 3L9XA 1R5OA 1YV9A 3OWHA 1BE0A 3FRIA 3RT7A 3FA2A 3ITKA 4XD2A 4BZXA 4AMVA 1YLTA 3S68A 3FCUB 4I5DA 2RI0A 3KQVA 4CL0A 3CGGA 4ESVA 1DDIA 2IYUA 4KG2A 3CNHA 1J0CA 4X20A 3ZNPA 3RJUA 1LPMA 4B4KA 4I5GA 4XPIB 2X5JO 1TK3A 1M0WA 1PSWA 4YK7A 2OGZA 2FMTA 4IWNA 2ZRPA 3MBZA 1Z5NA 2JB9A 4Q7MB 1FYWA 4MARA 3HO6A 1FY2A 3NTUA 3OZRA 3LTNC 3EQ7A 1BW9A 1GGJA 4OY3A 4CL2A 2QU7A 3ECAA 1I51A 2SCUA 1H8ZA 5F4BA 1TRKA 1J0AA 3M6HA 1J1UA 5F1GA 4HEA1 4INOA 4AMYA 1XNQB 4BB0A 5IN4A 5CJ2A 5JAPA 3ISJA 2NZ2A 4EMSA 2O8NA 4DA8A 1V3QE 8ADHA 5JDCA 4X3CA 2ZJZA 2VLBA 2B8WA 3BD8A 5A4AA 1C7QA 4LDAA 4NMLA 4IL5A 2ONKA 1BG6A 1W36B 2GGSA 4JIGA 2CVZA 1QKIA 4WSOA 1UADA 3EZXA 3HY6A 1BRMA 2WMNB 1KMIY 1L1FA 1H4SA 5BN1A 3DO5A 4M8NE 2Y8EA 4MUKA 4PLTA 2H00A 3UTCA 1QIMA 1ZGCA 3U37A 2CHQA 1KVRA 3GEIA 2P11A 1CRLA 3DHYA 4BGVA 1KOJA 1KEZA 5HVNA 1KZGB 3HCNA 2QRMA 2TYSB 2HA3A 5E2FA 4N3BA 1AA9A 2E37A 3MKFA 2QV0A 3MQ2A 1N2GA 1TA9A 4Q9NA 3F1KA 4KXVA 2VUSA 3ZE9A 1E25A 5KI6A 1E2DA 1C0LA 1NUUA 4XYEA 1NBMD 3TD6A 2HDQA 3JTMA 3UB7A 2QX8A 3NKVA 4ZCIA 1T4BA 1W4BA 1E6CA 1QF9A 4ND1A 4M83A 1HG0A 5DBFA 1SHUX 3G79A 4KENB 1TMKA 4JB0A 3JYQA 1Z4LA 4I55A 3H5WA 2QR3A 3V3RA 2A1TS 2NW6A 4JLAA 3HLCA 1PYYA 3LL7A 3ONFA 3ZH2A 4I1IA 3U39A 1AF7A 4TRMA 4L6AA 5JH7F 4EI8A 2QYHA 5BURA 4F04A 1KYVA 5I3ZA 1UBNA 3IPXA 5BPHA 4HUJA 1XPBA 2EW8A 2WUDA 2IUEA 3ZH9B 5I7FA 2W8ZA 2I22A 3LY3A 2PM8A 1C3OA 1NGSA 4FWBA 1KRWA 4QLBA 1G9SA 2GXUA 3WNQA 1R3DA 4HLUA 4CKEB 2IBTA 3P2MA 4F91B 3D0QA 2IL1A 1A9RA 2A33A 1Z6AA 2HBYA 1UJ4A 1XZGA 1A88A 3QHPA 1ZHFA 2DPGA 4EJSB 1EM8A 3UK2A 4DZTA 2J0UA 3O1JC 4NDAA 4OH0A 1LI7A 5JYCA 5FBKA 1N2OA 3LP6A 1NV8A 2D06A 1OJ7A 1AX9A 1LVHA 4EW6A 5HL1A 5C4IA 3Q9UA 4X53A 5A3QA 1J9GA 3EF3A 2HO4A 4TXMA 3U1VA 4Z1WA 5CT4A 1ZNWA 2QVCA 2GF9A 1X7WB 1VLLA 2AV6A 4EG0A 1XCBA 4HVAA 5FDHA 1TTPB 1KZ6A 1RIFA 1M2OA 3IRUA 3LY8A 3L4EA 5BWOA 3OQMA 3B47A 3EAGA 5HXAA 3KQNA 5KNDD 2X8AA 3ONNA 3CTPA 5FQQA 9MHTA 4F6RA 3EEYA 4LF5B 1X7DA 3PR6A 4M86A 4MS4B 1T25A 3ZCXA 2QNBA 1Q44A 4FE7A 2VQ6A 4MITA 1E69A 2PYZA 1CKEA 1GNQA 1ECBA 3IQIX 3QU5A 3I72A 2AUMA 5SYMA 3K73O 5H16A 4Y0OA 5K4AA 4O2LA 5KTPA 1GUBA 5I8WA 1XXHA 3UNXA 1R3UA 4KBFA 4AJ1A 5C4GB 4JNCA 5BMOA 3CUWA 4ZPJA 4N7RA 4QC2A 3HE3A 1MNAA 3LWDA 1UEJA 4Y7CA 5F64A 5ES3A 4NZZA 1BS1A 3ZGOA 3THXA 2A9KA 2Z3ZA 4B5LA 3BHIA 1R6TA 4S24A 5LMNB 4Y1RB 1T19A 3Q8MA 2IOQA 2KI5A 1AKYA 4J2HA 1U0BB 4UXIA 3A05A 3DAYA 3VR2D 5JWHA 4NZMA 4ZI7A 1M1YA 3CKKA 5FH9A 1MEEA 5KOJB 1MCZA 5SZIA 3QEJA 5CVUA 3U3RA 2PJZA 4JOCA 4OQNA 3FWKA 3D6TB 3PUIA 1Q0QA 4KE8A 2WF7A 3RFXA 3H1BA 3HUEA 4L0CA 4O1MA 1YC2A 4DIOA 3UG7A 4MYUA 2O59A 5D3QA 3L6RA 1JT9A 4HUQA 1CF4A 3I0ZA 5JY1A 4X44A 2R5NA 5IT0A 1K5PA 1T5HX 5HKLA 3JD1A 2DX7A 3WTCA 4KV9A 1HQYE 3G0BA 4GPTA 2NUAB 3DDSA 4G2NA 3L49A 1QG2A 1G5TA 3DW0A 2V7XA 3O7WA 4KQRA 2G63A 2QUKA 2XGJA 1P0PA 1J3WA 5CEJA 3CCCA 2ILTA 1L5GB 4ETNA 1ZVMA 2R4UA 3FR8A 2PUAA 4KO2S 1HORA 4KQ2A 2IV3A 4BV2A 3K9QO 1DVRA 4X8OA 3RWBA 4DMUB 3EXG1 2VPTA 3P9CA 3T3PB 3LIDA 3UJCA 4RACA 2MHCA 1CIPA 1PS0A 4M54A 2D2FA 2IF0A 2XT0A 2WQ6A 5A7HA 1I2CA 3HJFA 1HXHA 1S7GA 3K70C 4X41A 3GEPA 2HC9A 5IXSA 4PANA 3EG5A 3V8MA 4KMRA 2R7MA 1KKMA 1ERQA 2RGBA 5LZ4A 4DSAA 2QLBA 3KK0A 1P97A 1ULZA 2BI8A 1I01A 1U0OC 2M7VA 5KS2A 4E3ZA 1G17A 1EM6A 3RUEA 2E4VA 3JQAA 4TX1A 1FRQA 1J2TA 1T8YA 4KQ1A 1LPBB 3VZCA 4YRNA 3EPHA 2OFFA 2YJ3A 1JBEA 1U5BA 2ZU6A 1L3BA 1NL3A 4NWIA 1N9LA 4HB3A 4RJ2A 2ZAGA 3HDHA 1RXVA 2GAAA 4GPD1 1FRFS 4LV6A 4LJ4A 1XNGA 3N74A 2BEUB 3IVXA 2YYZA 3SNKA 3C3WA 5CB4F 1CBUA 1L5OA 4I6JA 5LA6A 3IQZA 4Q4CA 4UBIA 2IY7A 1GNRA 3JZMA 3VYWA 1F4LA 3KSBC 4OQLA 5E8JA 4HX2A 4ROTA 5J5CA 4G0UA 4BLVA 4BBUA 1I32A 3FCAA 4PR3A 5EJ4A 4XSHA 3HABA 4QXRA 3NCHA 1M3SA 4QAQA 1G21A 3KSMA 3DE2X 1FF9A 2PQMA 4O4LF 3LUJA 3PT5A 3E5NA 2VZEA 3AQIA 4EY7A 3DL0A 4UA6A 2BMAA 1GARA 2YBEA 2XW6A 3L8HA 1N2IA 1LVGA 2VEOA 3L3BA 3KTFA 1E4DA 3EFOB 3C6YA 3ZCVA 2ZYDA 5KWJA 3MQ0A 4E3NA 1R9NA 3TL3A 3T3GA 2W48A 2D6FA 9GPBA 5DT9A 2I7XA 3WFZA 2Q6KA 2SKEA 4N6OA 4TLMB 4DYVA 2XBMA 1PKEA 1GCIA 2HLPA 3UE0A 2PMFA 4M1QA 4I8XA 2JKRM 3K05A 1BHQ1 1P0IA 2ATVA 2LB5A 4MJ7A 2XMDA 1VPTA 2FPSA 2REBA 2XHEA 1JALA 4EUVA 1NP7A 4Q3DA 2HU5A 1D1JA 1D6SA 1JIXA 5JI2E 1O0CA 4OB6A 5B30A 3B1ZA 1Q3TA 3ZJYA 2OM2A 1TUIA 3UB3A 4EMUA 1Y98A 2ZRQA 3DT9A 2G8LA 3OE7A 4ZJ1A 4MUGA 5CT6A 3MMPA 4AJKA 1QQTA 4TM8A 3KLMX 3OE4A 2Q6TA 1VETB 2JFYA 5L6LB 3CJMA 2DT5A 4NONA 1W6RA 4OU4A 2FPXA 4ZEXA 1PW1A 3DDCA 3CEPB 3O95A 1VP3A 2E4YA 3GWZA 4TYMA 1GUFA 1QGOA 5JAHA 1BGXT 1NUPA 2I5PO 4KWHA 2Y27A 3RH8B 2ZS8A 3D8UA 2PL9A 2JBFA 5U47A 3H83A 1C8VB 3MJTA 1HLUP 2ZUFA 4U7GA 1ZUHA 3DNMA 2W6CX 4P54A 2CMHA 4DR1B 4TZ6A 5HW0A 1X8XA 3C6KA 2PXHA 3TM4A 4RSMA 4Q19A 1VYVA 3M82A 4ZOEA 4MV0A 3QW4B 5FATA 1ZNYA 2OECA 2H1WA 2ZVJA 3DV0B 1S02A 1JAZA 3G2QA 4C04A 5EECA 2IEZA 5JSZA 2CFIA 3F6PA 3TKYA 4HGYA 3JR3A 3X2EA 1JH8A 2EBHX 3D4PA 4YONB 2J9FA 4DEYA 3PE4A 3CCFA 1C4KA 1BSGA 1FVFA 3C2WA 1RYFA 2A9PA 1YZNA 2GWRA 2XJ4A 3EVNA 3U6BA 3FH0A 1SXJB 2H8KA 3GT4A 5K1ZA 3SP1A 1VGVA 5I4IA 4RKFA 1QIKA 3HU2A 4C4RA 4Y2FA 1LL8A 1WDKA 2Q8QA 4FIZA 4FNOA 1AOXA 4L5JA 5ADHA 4ZK2A 4G5HA 4AUNA 3ANXA 3C0KA 3OA2A 2XUOA 1K7YA 2FU5C 2RHMA 1TO2E 3NM5A 3P4UA 2WJYA 5JJIA 1SU4A 1N4AA 3WHIA 2J80A 3WXMA 3K15A 3VSLA 1BH6A 3DTVB 2ILVA 1T4GA 4FCVA 3A3YA 2EKDA 3WI7A 1XVIA 4DUPA 2BLLA 3JVVA 4V03A 1HMYA 3RUCA 2CVQA 5CGZA 3D0KA 1HPLA 4QAJA 1Q2UA 2CJFA 3GJ3A 2UZ3A 3ANNA 4CWAA 4N65A 5CDFE 5KHOC 1ZCZA 2I7DA 1B0UA 4EY3A 1ILEA 1FTWA 2EC5A 3LXUX 1WWKA 5HIJA 1OWOA 2C7PA 5GLCA 1FCJA 4WNAA 2CY0A 2DCFA 3RYHB 4RGYA 2IYSA 1J1IA 1IN7A 1O3YA 3F4BA 3ZY3A 2XQVA 4LYHA 3C2QA 4R3WA 4LF7B 3SSMA 3W4JA 4IXMA 5EZQA 1NBWB 2GM3A 2DRIA 2QT1A 2YHIA 4RMGA 1YDWA 2CUNA 3IPLA 3IR5A 2V45A 1GGHA 1L4NA 4RH1A 5C8YF 4Q01A 1FK8A 4OQXA 4FD2A 5FTMA 4P3OA 1TJNA 4Q3EA 3EWIA 4I5FA 3D3NA 2OLKA 1BDHA 4BNMA 2EZ9A 2CW5A 2R1TA 3ICWA 1Y6QA 1CZLA 3M1LA 3RYIB 2VHUA 1YMQA 3D6HA 1AQLA 3QP9A 4ZU3A 2J9RA 3T41A 2BT4A 4IEIA 3MSCA 3GNQA 2G6TA 3UB6A 3ONDA 3R6TA 3FOCA 1LV7A 5HQ3B 2HZBA 4LDZA 2V8CA 3I01M 2RH5A 3CW8X 5COQA 4AVYA 4MP6A 3JQGB 4CEHB 5BOSA 4KIGA 4RH3A 3VHXB 4L0MA 3EK2A 1NX9A 2JLBA 3H18A 1S7CA 5D3MB 1DAHA 2WTAA 1ETHA 4N03A 3O9MA 2PRFA 4UW9A 4QX6A 3FVRA 4WZ4A 3F71A 1YB5A 3IS3A 1EHIA 4IBOA 4CKZA 2HFJA 1U9ZA 1MUUA 4Y6QA 4X1YA 1LDEA 2WJ4A 3M3PA 1Y4DE 3ZE2B 2J85A 4RJTA 3ZQ6A 4C2TA 2JD2A 4YJ3F 5CBPA 3QX3A 1LTQA 4L9WA 4CCSA 3SZRA 3A1EA 2Y2MA 5AM2A 5DW0A 3WZLA 2GX5A 4LXGA 3LDFA 1GTRA 1VYUA 2W2XA 4YAFA 4P53A 2QQ5A 1ODKA 2VYND 1U0FA 3O74A 4HQ6A 1K2WA 5EVIB 1JH9A 1XK7A 1DT3A 3STUA 3QVSA 2V1BA 1PWGA 5HPIA 2UZIR 4DV6B 1XNHA 3EYAA 4JVSB 4NCHA 1NI4A 4BVBA 2KLHA 1J2RA 4DIUA 4QJGA 5BQOA 4IGFA 5LQJA 4G4SO 3SMVA 4BO9A 4E03A 1Y1PA 5EJ5A 4Y2PA 4KE9A 5H7XA 2AF4C 4Q4DA 1PU2A 4NCBA 1KKLA 3DFZA 4Q0MA 1MG0A 2R1ZA 4YCJA 3RROA 1Q2QA 3ZD7A 1FJXA 3F8TA 1DO2A 4WY8A 4ETMA 2J48A 2VKQA 3BE4A 2R7KA 5K5EA 4XQ0A 2JZCA 1QO9A 3HKCA 3RODA 4S1TA 4MVJH 3KNZA 1O4VA 2YVAA 3W05A 4QYSA 1NXOA 4JD5A 2JIPA 2W6IA 2IF2A 4L15A 5IP5A 2MR5A 2ZANA 3R3WA 5D3ZA 3KPUA 3FI9A 1JFSA 4Y6OA 3DOOA 4W6ZA 3OBFA 3H7IA 3FSJX 3SYTA 2HA4A 2BFAA 2JKVA 4PS1A 3BEDA 3SZMA 4KU4A 1J49A 3AUUA 1TM1E 4EZEA 1N8SA 3O8QB 2V4UA 4EHAA 4KKVA 3GLGB 2X3FA 1RKUA 3HLFA 4U2KA 5E7JA 5J8XA 2E5LB 2VUTA 4QTYA 5EKSA 4OQFA 2BBSA 3AU9A 5EMHA 2VKSA 1JEYB 1X87A 1TADA 4IUCS 3FHLA 2Q21A 1NU6A 5K05A 5CM9C 4X1LA 1ZI8A 3Q41A 2Q6VA 1U9IA 1UH5A 2O7VA 2QX6A 4NR0A 2JASA 4TWRA 3IIJA 1WMAA 4S3MA 3KTAB 4E5SA 1P18A 3SF0A 3ON5A 1V9LA 5JU6A 1PW8A 2G70A 4PAGA 4LGCA 2N9UA 1W59A 5FAQA 3TW8A 2CLEB 2HJWA 2O52A 1E9BA 3F3SA 4OJNA 1BQ3A 3WLKX 3ERCA 3LIPA 3S44A 3M1AA 2E85A 2I8AA 3OVMA 1X70A 1JWLA 5D3KA 4H6VA 4KZAA 2OVBA 1DDGA 2EFXA 5F68A 3PPVA 1IDN1 2H1IA 4A8JA 1YOVA 3F9CA 1A82A 3DF7A 3V39A 3CURA 3NBAA 3VKUA 3MWFA 1F0YA 4OHOA 2XYVA 1G3MA 4O4IA 2Z6VA 1X19A 2Q3JA 2P79A 3FTDA 2EQ5A 4HFRA 1EHYA 4GB7A 5HKKA 3ZD8A 2R3SA 1CR0A 3IA2A 1HG1A 5A03A 4PO9A 2BH2A 3QJ5A 4A6DA 1EVIA 2V1ZA 5KYGA 1SG6A 3EYWA 4RVCA 2VJBA 3D1LA 1K97A 1E5QA 3SS8A 4C1BA 4MVJP 4Y2GA 3SBDA 3U4HA 3VYUB 3R24A 3FMGA 2P9VB 4JI5B 2XE8A 3AUJB 4GO1A 3UAOA 4C7JA 4Q7LA 3AY0A 4PX5A 1E9FA 4NXNB 5BNTA 2XITA 2IHNA 2FB9A 2Y0EA 2M6KA 1JAXA 1E60A 4YACA 3HB7A 3QBTA 4QUEA 3NNNA 5J63A 1O96A 3K70B 4YJHA 1N4DA 2GBGA 4BJ6A 2VTDA 1JG4A 3T0IA 3W2GA 5CTJA 3CLUD 5J2TF 4DBLC 3T3DA 5DTTA 1NLUA 2JCSA 4DA7A 1GGKA 3ME5A 2A0UA 3OJOA 5DULA 3HKDA 3IAHA 1Y7HA 3HI6A 4RJIA 1OYVA 4Y18A 3W2HA 4PQFA 1XEXB 1TCAA 1OTBA 3E58A 4AO7A 1TM7E 2YVKA 3NYIA 3RC9A 3HB4X 1L8QA 3MRXA 1CEEA 1BMFA 2W22A 4FMPA 5I9NA 4DDSA 3TZEA 1AZLA 4QBGB 4KLCA 4EJ0A 5FFFA 3IH9A 4C4ZA 1LNZA 4I08A 3BTUA 1NVKA 3RFCA 3RC2A 2YWJA 5EHXA 1MORA 1JHUA 4DCMA 4JC5A 5K6RA 4MGKR 3OTQA 4EPVA 1A50B 3ELYA 4WCFC 3FWLA 4YRAA 5JJKA 2RD2A 4RIIA 2QM7A 4XX1A 2Z43A 3PPYA 2CMNA 2CFTA 3NEAA 3EOZA 3ZLJA 3G5AA 2WT8A 3NAQA 3RDPA 2DU8A 2HHAA 1U7ZA 4QHYA 4FEYA 2VWQA 3V4LA 1XTZA 3SE7A 4JUBA 2G83A 4QQRA 3NRJA 4RYEA 2CB0A 5ALVA 1J06A 3IHKA 5HR5A 2CXXA 4FMCF 4KR6A 3ENNA 1U2ZA 3HEAA 2PYIA 1OH7A 1C5KA 4HHEA 1HK7A 2ZI4A 3AMVA 5TVGA 1J20A 1Z47A 3AOEC 3DWKA 1Y1QA 2PL5A 3T7AA 4B9AA 4KLRA 1ML3A 2LCQA 1F38A 1JIJA 3L7MA 5H4HA 1C50A 3STXA 2KBEA 1W4ZA 5AJXA 4BMPB 5JROA 3DBHA 4CLCE 5I48A 1GYPA 4XCVA 2WKIA 1DCTA 3GGSA 4CCYA 1QRSA 5A92A 1S4MA 1SHJA 3WYAA 3RCBA 3EFHA 3T61A 1QR2A 3L1HA 3VR2A 5LFAA 4IF6A 3EXIB 4HRAA 2XZTA 3QYAA 4QXQA 4DXCA 3RS8A 2HEGA 4LC0A 2IPAB 4K7JA 3DA8A 4D9IA 1J97A 4DAOA 4I38A 3U3ZA 1Y8RB 4A1FA 4L9EA 3GPIA 1B8NA 3ZY4A 3BREA 1M2FA 2Q9MA 4FJ1A 1RJEA 3BCUA 4HPJB 4G0XA 2H59A 5A2GA 1BO6A 3D8HA 3DW3X 1FTSA 2L19A 2GPWA 2Z2XA 5A05A 4DLTA 2VSXA 1Q7BA 1TD9A 3EDCA 3PRKE 2OXEA 3W3AH 1SZJG 1IU9A 4QBHA 1PR6A 1L7EA 1E0KA 3I5UA 2OD7A 4C3VA 3H82B 2PUTA 3OM8A 4HGZA 5ELLA 5ILQA 3DDOA 4N54A 3C97A 1ENOA 2WV9A 3OZIA 5LQKA 4C0LA 5KPDA 3A3FA 3B6KA 1RZRD 1T36B 4W5OA 3QFRA 3TOZA 4WW0A 4FT4A 2JBAB 3D2AA 4RIFA 3H1FA 4F9FA 1RMQA 5EMMA 3EAQA 3TG9A 5DNEA 1V71A 1JZQA 4N6GA 3OT4A 4II3A 1NT2A 5BW8A 3LI8A 2NV6A 3Q3GE 2JHPA 1H2AS 3EE6A 3HLGA 2GILA 3DLAA 4PLHA 1DP4A 1P5HA 1GVHA 4LYAA 4JVMA 1IJBA 1U28C 1X9GA 4R9UC 2EIHA 4BTLA 2QX7A 3MLAA 3IAAA 2C61A 1RM0A 4RD3A 4CVNA 3MGBA 2XR0A 4B4ZA 2XCQA 4EVQA 1J8FA 1DZ3A 4B2YA 4FYJA 1RVDA 1YJXA 3JS5A 1P3JA 4I6GA 3DZGA 5H68A 2H5LA 1HDRA 4MWTA 2PGNA 1L5YA 5E7MA 2EEPA 4G85A 4J8PA 2C5HA 2CV0A 3IOCA 2FEOA 1T9CA 4YT5A 1IK4A 3A6DA 4PGAA 1JSZA 3DKRA 4H9GA 3A0RB 1L4LA 1NUQA 5CP8A 4U8HA 1ZHHB 5DGDA 2FEKA 3KE8A 1DNPA 1EQAA 2XT6A 1L1EA 4GKKB 1M1NA 3HYCA 3VKWA 1L0DA 1VJ5A 4BVLA 1LGYA 1E0AA 4BNYA 2C4UA 2CE2X 3DWIA 4Q39A 2Q9NA 1U9YA 1EQ2A 4F3LB 1GZUA 3PUHA 2GMWA 2HSDA 1X8JA 2XGGA 2YHAA 2VAWA 1KAGA 1FTGA 2VBFA 3A9UA 1LK7A 1WTAA 1R16A 3Q12A 1M76A 3IPRA 3KPVA 2JLWA 3EIFA 4DCSA 1DQPA 5BWBA 3HCAA 4CQMB 3ROTA 1MPXA 1YSPA 4UTVA 3LJKA 1ZZEA 1FIKA 2OPHA 3PJFA 4FW9A 3GFOA 2LKCA 2C5AA 1FTQA 4WN9B 1QOQB 3OCYA 1N77A 3UMEA 1NPTO 3MT7A 3ONVA 4C30A 2BKAA 1LF5A 1M6VB 3AFIA 3GLKA 4GX0A 3VISA 4AFNA 2C1EA 2NN3C 5KTOA 2R47A 2OPBA 3WLMA 3EXEA 5G0VA 3SF8B 5E3IA 4F86A 3AWIA 3TJMA 4RK6A 1THGA 4OUDA 1O54A 3DXYA 4JAVC 1QV6A 3SJCA 3R6WA 1LW7A 3GR2A 4I46A 5MHTA 2Q1XA 1FFHA 4JXSA 1D6MA 3N3BC 1WQ3A 3KUDA 3OZCA 4YO8A 4MQ6A 3VNSA 3LPMA 4UDXX 1ZIXA 3TIVA 4KVFA 2CFCA 5E7QA 5CHUA 4FKZA 4G1UC 3AJ9A 3BTVA 4AZ3A 1K54C 2I1WA 3K1AA 3CRMA 1KSGA 2IWCA 1XO1A 1DG9A 1VKNA 3OE7D 3ITDA 1RC8A 4HI0E 1U3CA 1E1CA 2NXJA 1H0KA 2C2WA 1RZUA 2EDCA 3HHEA 1RFLA 4LECA 4XCXA 4BAGA 2IW1A 2BE7A 2AWOA 2ZXUA 1JVNA 3UA4A 4D98A 4EA8A 1FJHA 3BMOB 1T2VA 1MD9A 1NATA 2MJLA 1YDFA 2AOTB 4RSHA 3GMTA 4U2GA 3SZUA 4PXAA 5DGXA 2VJKA 3MQ4A 1NJ2A 1ORVA 1JFRA 3L40A 1T1AA 1JDBC 3ROQA 3RGGA 4BEJA 3PB3A 1X1RA 1B15A 3KAPA 3SOPA 3IH8A 1X0OA 2BPOA 1ENYA 2BKLA 1DL5A 3ZDCA 4UZSA 1WF3A 5FD8A 2YOGA 4PYJA 1L5RA 4JS0A 3OLQA 4PAWA 2H2DA 1F8UA 3KD3A 4LW8A 2C8KA 3E2MA 2R6ZA 4PBSA 4F38A 4L4YA 2R87A 2YX1A 1I36A 3MW8A 1Y54A 5IH7A 4Z4CA 3RJTA 5J7EA 1QIDA 1DAEA 1E3EA 2C7QA 4JLDA 1JU9A 4REQA 4RHUA 2IFTA 4IF4A 2F8TA 1T43A 5A4DA 1RACA 4GBED 3U4QB 3E48A 2FOIA 3JD2A 1I2AA 4RETA 1NIPA 1U81A 2YFHA 4PW0A 3E05A 5FWXB 4ZYVA 4L8VA 2LGJA 1HYEA 2FRDC 3KCQA 2C0PA 4FTXA 3AR9A 2NU8B 4YP9A 4XOIA 1H3NA 2LUOA 1VLQA 5ERXA 4R69A 2E82A 3EVTA 1LK5A 2ZWIA 2NUPA 3EVFA 4BD0A 1VLHA 3N6IA 4RF5A 4X45A 3UMGA