2WKPA

Structure of a photoactivatable rac1 containing lov2 wildtype
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
320
structure length
320
Chain Sequence
LATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase, cell adhesion
molecule keywords NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
total genus 108
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2wkpA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wkpA02
5CDFE 2P6RA 4WW0A 2BWJA 1KO5A 4OHVA 3EW9A 2JJ1A 2V6IA 1J90A 4UJ5A 2D3WA 2GTPA 1TF2A 2RGEA 3VKWA 2PMKA 4D4KA 3THWA 5EE9A 4JGOA 1KY2A 1D06A 3AGQA 1HTWA 1PLJA 4LI0A 4QJ3A 5AUPB 3PEWA 2GBLA 4DKXA 3UIEA 3QVUA 1OHHD 2XNSA 4KVAA 5L3VA 421PA 2IEZA 1W2GA 1Z0JA 3U3OA 3X1WA 1SULA 3GJ0A 4TL9A 2K7SA 2ZSDA 1W36B 5C2JB 3Q9LA 3PFIA 3QSYA 1WRBA 1XFQA 5G41A 4TMWA 3H0KA 4FXPA 3GEHA 1JNUA 1ZC3A 3DEFA 3KL4A 2X77A 3NH9A 2ZTSA 4J0QA 2ZI3A 4KITB 1DELA 2OM2A 3QENA 1Z2CA 3W9YA 4LPZA 1AKEA 4LUCA 1F2TA 5CLQA 4D25A 3PUYA 1EFRD 2DBYA 2PZFA 2ZRJA 4LYAA 4F4IA 4Q4AA 3EZ6A 3PUZA 1TPZA 1BS1A 3NJAA 3PR1A 5EP4A 1NVVQ 3A1WA 4S35A 1UBGA 4NONA 3QF7A 5JJKA 1VYTA 2VLGA 1DAEA 3UKDA 2QA5A 2YWFA 1UADA 4Q9KA 3ZQ5A 4M1WA 2I4IA 3TUZC 5EXXA 5DJTA 2ZRPA 3UMEA 1XMJA 1F60A 4DWJA 3F5FA 2AHOA 2OG2A 4MGZR 2HXYA 2A24B 5IS1A 5J4YA 3CRRA 5JMTA 4IVQA 4F7WA 1US8B 2AD1A 1FZQA 1U9IA 1DP6A 1S3GA 2J0UA 4TLDA 4DLYA 1E99A 3U60B 3PQCA 4WN5A 1OE0A 4XTCS 1AS2A 5HD3A 2ZJBA 1OTIA 5LB4A 4AURA 1CIPA 1SHKA 4JSYA 4XOIA 4D4MA 1R10A 5AWFC 5FOSA 3M6AA 2JJ2D 1NBME 4A1FA 5BN3A 4NYJR 1M34E 3O8CA 2J9RA 1RZ3A 3B78A 1O87A 1E0SA 1G4UR 4GW9A 3AB3A 3LFUA 3KUDA 2JHEA 1KDOA 2OCYC 4BECA 1C1YA 2NPIA 2XOKD 5F68A 4B34A 1OT6A 1I4LD 4PQRA 4B35A 4LBVA 5FOXA 1N0VC 3IO5A 1CBUA 5CITA 3T34A 4JGPA 3W5JA 2W6JA 1ZMXA 2ZE6A 1OYWA 3MQOA 5GJCA 1WXQA 3B13B 1DP9A 3BB1A 3GLHA 1P60A 3CRMA 4RD3A 3TAUA 4BLSA 5IRCD 2ZJ5A 2X8AA 2JEOA 4BE7B 3DMNA 1N6KA 1N25A 5I5LA 3ADBA 5CLLA 2FEMA 1K5GA 3H86A 3KXIA 4B76A 1UWNX 2VHJA 2OFWA 4EQ6B 1KI3A 1S67L 4AIIA 3FMPB 2ERXA 2Q6TA 4QM6A 3HJKA 2GZDA 3A1VA 3GJ7A 3R9WA 2BCJQ 2V9AA 1UDWA 1FL9A 1OPXA 3WNDA 1NL3A 1E0AA 3BERA 1FX0A 3AVVA 1DRMA 4IHQA 3T61A 4BLRA 4OQFA 4CW7A 3G6OA 1IONA 1X86B 2PMDA 5TY0A 4GCZA 4NCIA 2WPDA 2QJ5A 2Q9BA 2ODNA 4B43A 2CLSA 1RRGA 2BJWA 5TBMA 1LS1A 2BBWA 2Z6CA 4HB0A 1ZW6A 2D62A 4TYWA 1L2TA 3W5IA 5KIZA 3IO3A 5AUNB 3K3DA 2H57A 2PHYA 2ZUBA 1N9NA 1G21E 4E09A 4MRPA 3AUYA 1ZU5A 1KSFX 1ZRHA 4TMKA 2IW3A 4Q7JB 5JEDA 4Q9HA 2P2LA 3RLFA 1E94E 5HZHA 2QROA 3G82C 1KI4A 4MH0R 2HXSA 2CNWD 4GI7A 1CR4A 3PG5A 4PC3A 4ZI2A 3WBJA 1E4VA 4L15A 4Z8YA 2R8RA 4DCSA 4GT1A 4M21A 2QE7A 1XPUA 1ETUA 1G41A 1Z6XA 3C5HA 2B21A 3DM9B 3QPUA 2RGCA 2OWJA 1YQTA 2KI5A 1XD8A 5CJ2A 1KI7A 4XWAA 4XT2B 2BBTA 2G77B 1Z07A 1XPRA 2BV3A 3OE7D 2FG5A 1U81A 2F1RA 4P4UA 3TSWA 3KDSE 1N6IA 1UFQA 2WJIA 4HLUC 1G6OA 3ZIAD 2H18A 4B3GA 2ZR7A 4TTQA 1HT1E 4R98A 3R7WA 3C5CA 2CJWA 2O8EB 2V54A 1OKKA 3CRQA 3RRZA 2EFCB 3QVVA 3WXMA 5L3QB 3A1TA 3FWYA 5BQ5A 3K70B 3VKHA 1T91A 5DO9A 4JLNA 1YJ5A 2IYTA 2RGAA 2EFHB 1S4QA 2D4HA 3LWNA 4MDEA 1GRNA 1XXHE 2R6GA 2H5EA 2JJ1D 1BYWA 3LW7A 1E2QA 1OXVA 4Q1AA 2A78A 4FMDB 3A0RA 4R6LA 4WLAA 3ZH9B 3IKJA 3U7HB 3IS2B 1TUIA 4P3YA 5SZHB 3KX2A 3QF4A 1E2NA 1KDTA 1GILA 3R8CA 4LRYC 2C5LA 1UEJA 3NOTC 4TWZA 3RWMB 3LW8A 1TS8A 1N5KA 5G40A 2RKOA 1NJFA 2QTVB 4C0BA 3T1TA 1DTSA 4R2IA 3SHWA 2GRJA 1ZJ6A 2G1KA 3GCGA 5AJZA 3W6NA 4CEHB 4PAQA 2FSIA 3CLVA 1Z47A 3CKLA 3P32A 1T1CA 1CJVC 2MSCB 4JLKA 2VP6A 4LYJA 5C4MA 3P7NA 4C0SA 5LD2C 4I39A 4WXPA 5DYIA 4IFBA 4AKEA 4DJTA 1E2MA 3DOEA 2DFKB 2Q21A 3U3MA 1FP6A 2GF0A 1F2TB 4MUAA 1QHIA 4KFUA 3C7KA 4URYR 4Z1MA 4C7OA 3OEEA 5FTJA 2OBNA 1TNDA 5JSZB 2M1CA 4KFTA 3EA5A 3SR0A 3L0OA 1L4UA 2CCKA 2DCUA 3BB4A 1TL7C 2OILA 3QEOA 4F3LB 3BAFA 4WBSA 3GEEA 2PYPA 4PX9A 5HTKA 4ZIRB 1N5JA 4D80A 4PHGA 2DWQA 2OWHA 4XVUA 1S3SA 5KNCA 3U4QB 4XH9B 4IDNA 3LLMA 3ND8A 3MXQA 5H1YA 1YR9A 4M1MA 2CHVA 4LK2A 4HLDA 2VSFA 2VHTA 3QBTA 2W27A 1K6MA 5AJVB 1O3YA 3FPAA 3MD0A 1N6PA 4R38A 2Z43A 5CJPA 4EJSA 5JRJA 4TYYA 4R7ZA 1VYVA 1KK1A 5HSQA 1G18A 2XAUA 1HQYE 5KTYA 3LUQA 1COWA 4UJ3A 4FN5A 2A5GA 2ZI5A 2ZJZA 4LHVA 1LV7A 1HQCA 2KDKA 1UBFA 1XEWY 4TT3D 5J7EA 4C7OB 3IIJA 2QPAA 1AZTA 2ZEJA 4X8OA 3P4YA 4Q1DA 1U8ZA 1E96A 2NOAA 3RS5A 3IBYA 4RCYA 1LFDB 2RCNA 4JKYA 5F2EA 1RRCA 2VLIA 3C4JA 4LJ9A 5HCNA 3OIWA 1KNQA 3TVTA 3HPRA 2Z6DA 2PD7A 1P3JA 4LPKA 3F1PB 1OJLA 3CW2A 3NHBA 4MRVA 3K70C 2OCAA 2WAXA 3EC2A 4I99A 4LY6A 4TTRA 3LY5A 2GETA 1XWIA 4EJSC 3CAXA 1OB2A 2GXAA 2ATVA 4CEHA 4TLCA 1NIJA 3JZAA 4LJ8A 1DG3A 1GTVA 2C03A 4U5XA 1BH2A 1X8LA 4R70A 5CM8B 3B33A 4HLCA 4B48A 2BM0A 2YYZA 2TMKA 4A92A 3A0VA 3B60A 1W4BA 1LNZA 2DPXA 1JR3E 1S1ZA 3N5CA 2VA8A 5J4LA 3UANA 1KAOA 4PHTA 4HP9A 1Z22A 1G3QA 2OBMA 4EQ6A 1S66L 1SKYB 3RYTC 4OK5A 3ICYA 1H8EA 3PVSA 2OLJA 3KXKA 4RFSA 1NMXA 1TX4B 2CLCX 4AG6A 2WJGA 4NDZA 2H7VA 1UJ2A 1WDTA 2JJ2A 3IGFA 5EXTA 4URZR 3LV8A 4DLSA 3LICA 1A2KC 1A82A 4DBLC 1G28A 1IXRC 4PZLA 1E6CA 4P4SB 1EESA 3AVTA 3B8HA 1KKMA 2YC2C 2JDIA 3PV0A 3MWYW 5J4HA 4FWTA 1OV4A 5KSPA 4Q7LA 3L2OB 4CDGA 4PSAA 1IN5A 2CXXA 1VIYA 2IT1A 3BS4A 4WZ6A 2P65A 4K8OA 2J7KA 4V0LA 4WZAE 4JSTA 2ASEA 2IYWA 3G0HA 2ZRFA 4DIEA 5FBQB 3OESA 4DB4A 2PZGA 2VH5R 1XRJA 1SGWA 3AF0A 3I62A 1KO1A 3OF5A 1NSFA 3DKVA 4RZ3A 3T06B 2ERYA 2O5VA 3C14C 5GJBA 2O52A 3FE2A 1WBBA 4BBUA 1N0WA 3BK7A 4GHIB 3AP1A 3L0SA 3K53A 4AC9A 3FFBA 5JJLA 1JB1A 3P4XA 5ELXA 4GPTA 5DH9A 4ASUD 3CWFA 4I81A 1RW4A 2PR6A 4PXAA 2ZREA 2XJ4A 1Z5ZA 4IXNA 3U3JA 2HCBA 3CBQA 3EG5A 4D0LB 4DEYA 3K8YA 1AK2A 3R9XA 2QQ0A 3NBZC 3VE3A 1SVKA 1UBEA 4YLGA 4A9AA 3T1QA 3F1PA 3QBVA 3F1NA 4DEXA 4HAXA 1VCOA 3F1OA 4ASUA 1SXJD 4QBGB 4ZCIA 5F3WB 4M53A 2QMEA 1XD2A 4EPWA 3Q5DA 2V8OA 5DI3B 3A4MA 1R5NA 2ONJA 3VR6A 5KDOA 5CK4A 1EWQA 2IHYA 1T5LA 3NBXX 2ZRHA 2FPKA 5AVEA 2YWHA 4MGIR 1PUIA 4GDFA 1Q1BA 3WHLA 2VP9A 3RTYA 3F0TA 2JIZD 4JBYA 4B3XA 1HURA 3NBFA 4URXR 3IIKA 3GPLA 2IS6A 1P7CA 1FX0B 1AQYA 2R65A 1VIAA 3FKSD 521PA 4JYBA 3FOZA 1S1YA 2WMOB 1QG4A 1KAGA 4LV5B 3ND9A 4DDWA 4QOSA 2G1JA 1E9EA 2O8FA 2WIBA 1Z3IX 4QJ4A 1VCMA 5DHFA 1P2UA 3ICQB 3H1TA 2JA1A 2JDID 2B7CA 2Z83A 1Q3TA 4JLVA 5FPHA 3KQHA 5K8TA 2HLDA 2BKUA 4HB3A 3W6PA 1E9BA 3SYLA 1MOZA 3WNBA 4BFUA 1ZP6A 2P6UA 2PD8A 2YJTD 3IPXA 1N5IA 2C2HA 5K8LA 1J8MF 1R0ZA 1VG0B 3I8XA 2CEAA 3VKGA 4OK3A 2XX3A 3KFXA 2G9NA 4DXAA 1XJCA 3NBYC 3GJ3A 1Z08A 3VR2A 1E2KA 3W90A 1S2MA 3B1XA 1Q0UA 2R6FA 3BFXA 3D3QA 4DJ2A 5DGXA 1R4AA 4RSGA 2Z6VA 1EG7A 4MRSA 5DIFA 1G8FA 2FPLA 4RD0A 5KSOA 4F4JA 5BWMA 1R5OA 4HIAA 3H84A 4NPHA 1XMSA 1E1QA 5HR5A 4D0GA 621PA 4KCGA 1NSTA 4PZZA 1RYFA 3V9PA 3LO5A 3OAAD 3GJXC 3ZVRA 4B75A 3EX7C 3UE6A 3ZD7A 2ZUDA 2JJ8A 3SFVA 3CZPA 3KKNA 4NH0A 3CONA 2F9MA 5H68A 5B2ZA 3TSOA 1AQUA 4XSHA 2O8BA 4RKFA 4I3IA 2KSQA 1OFTA 2WTUA 2WZQA 4IW3B 4Z54A 5JHHB 1LVGA 1N9OA 3OZXA 4Z8XA 2QSYA 4Q1EA 4TMZA 2YWGA 2IYQA 3O8BA 5JS7A 2MMCA 5L3SA 2A24A 2BJVA 4PPNA 5JRZA 1XTIA 3PITA 3RSOA 5HE8A 1U8AA 3T35A 4WL9A 4MKHA 2CMNA 4L9WA 5HD5A 3TUJC 4A0HA 2QGNA 4MYUA 1T1AA 3B5JA 5FR1A 3LIDA 2QP9X 4EPRA 4UNNA 1T19A 2BMDA 4I1OA 3VU9B 2PR5A 1M6NA 2KBEA 2ZYVX 4LJYA 3R7WB 4CGZA 4Y0AA 2J5XA 4PKYG 1II8B 3VMFA 1U8YA 3GD7A 1JQLB 4P0TA 5E95A 3ZVMA 3QUSA 4BLQA 2P3SA 3A0SA 2VV7A 2FMXA 4ZV4A 1NVUQ 1YZTA 2UKDA 4HEJA 1IN8A 3FG8A 5IK2A 4TYNA 4GRAA 1YZQA 4P33A 1W0KD 5KYKA 4JZKA 3I5XA 1P0ZA 3LLUA 1DADA 4BRUA 4QHTA 4QBHA 2GEUA 2IS1A 2UZ3A 4GBMA 4NBSA 3KTAA 2GILA 2GJSA 5A8BA 3ONWA 3AV0B 4MITA 2D01A 4A0FA 5HWVA 2VEDA 2XZLA 1JQJC 4JGQA 1MV5A 1N6OA 2LKCA 2OFXA 5E7JA 3NEYA 5EE3A 2QHKA 1E98A 2GJ3A 5DN6A 4RD6A 3CF2A 2D2EA 2DFNA 3CR8A 3U61B 3LDAA 3BWLA 2FFQA 1KSJA 5GVRA 3G5UA 2NIPA 2A9KA 4LPSA 1EWRA 1GKUB 3K0FB 2DY1A 5DSZA 4A8JC 4EIWA 1U0HC 4M2LA 2GCNA 1NN3A 1V5WA 3SC3A 1SZPA 1KOFA 4E22A 5HE9A 5HPYB 3KUCA 3LQQA 4OQNA 5DNYB 2N46A 2F1HA 4PTLA 3AM1A 2XNDA 1T0HB 4QG7A 3K0AA 3F3YA 4C0AC 2NZ8A 3MCAA 3AKDA 1ZD9A 3K9NA 1Q21A 1G4AE 3HPQA 4LC1A 5FFMA 4E07A 5G53C 3MLEA 4ZKEA 1WF3A 1Y28A 5EP1A 4Q1CA 1RFLA 3NDPA 5EQTA 3ZS9A 3GLIB 1GITA 1OSNA 3BH0A 5FTMA 4C0KA 5TB5A 4YMTA 3RH8B 4B3BA 3O8RA 1OB5A 1JPNA 4LHYA 4EPVA 2HV8A 2XTNA 5D3MB 3T5DA 1S0UA 2EWVA 1KJYA 1KDRA 1SQ5A 3IHLA 3F1OB 1BMFA 1E1RD 2PCLA 4V0ME 3SEAA 1S8FA 5CB6A 1RJ9B 4AYTA 3U44B 3TJZA 1LF5A 1P62B 2W2TA 2O0KA 2YWEA 5TVKA 3AF3A 2IX3A 3TW4A 2B8WA 1T0JB 4A15A 1TQ4A 3E70C 2WJVA 2OCBA 2WJHA 1ZD1A 2WOJA 3UK6A 1VCIA 1RJ9A 3Q3JB 3P1JA 4W7SA 3H7WA 1D2EA 1F48A 4DLXA 2V7QA 2J80A 4BASA 4QFMA 3BIFA 1TAGA 4MA4A 1FQKA 2BEJA 3RC8A 4EETB 2H17A 4B2PA 1NMYA 1Z0KA 4Q19A 2VP4A 4DSTA 1I2DA 3LVQE 4HNBA 1FW6A 3B2EA 4PPGA 2GK6A 1YZNA 4IVPA 5HDSA 2IL1A 2ZRLA 2HF8A 3DL0A 3OIYA 3LIEA 3W8RA 2EWWA 3RS7A 3IILA 1H8ED 5EJEA 3U3RA 2A7QA 2O0HA 4M22A 5AJWA 3PEYA 3GLFA 2GNOA 3LIFA 4C30A 3VHXA 4B6FA 3U5ZB 1OW3B 2P0EA 4P4SA 4HH2A 1WB9A 1ZIOA 3RVBA 4HDOB 3BB3A 4NYIR 4OL0A 2I3BA 1JECA 4PC6A 1P9WA 3BC1A 3EIEA 3CLOA 2FV8A 4GNKA 2JCSA 5FUXA 1KJWA 1Z2AA 3IBGA 2OBLA 4Q4JB 3NOPC 1NIPA 2AFHE 2WVJA 2YOHA 1XTQA 1TF7A 2R44A 1F98A 3D72A 2R6CA 4M0LA 3RRNA 3RSLA 3GP8A 2HF9A 2NQ2C 3ASZA 3FHCB 2CK3A 1T8TA 3NOUC 1QHYA 1ZVQA 2DFTA 1W49A 4EW7A 4JKIA 4US2R 4EAQA 2VP5A 2D7DA 4XT2A 1SVIA 4DLUA 4FD2A 5BW8A 3CNOA 3Q72A 1VTKA 2YC4C 3SFZA 1M8PA 1VYUA 3MMPA 3VR5A 4TZ6A 3RNLA 2CL0X 2CDNA 5SZKB 5EP3A 2RGDA 5TXGA 4M1OA 3K0CA 2PX3A 2VIIA 4K08A 1MR3F 2IYRA 4RFVA 2ZM5A 3RC3A 4OQXA 2L4RA 4C0LA 3K9LA 2CK3D 4CIDA 1KHTA 3A58B 5JI3E 2J41A 2B7BA 5HKKD 1XCPA 4FINA 1G3UA 1XX6A 2WSMA 1IAQA 2V1UA 3VU9A 3TGPA 4PHHA 2IYSA 1W0JD 1RVDA 2AWOA 4L4UA 1TEXA 4WIAA 1SHZA 3LXRA 1UGUA 5JZVA 5KSZA 4IOJA 4IXMA 1A1VA 1ZM3A 4CVNA 4G5QA 1AIPA 4I1UA 1ZC4A 1G16A 4JJZA 1J99A 1NY6A 2ZRKA 4ZI3A 1TF5A 4HDCA 1P97A 1CP2A 1R0YA 3K9HA 5AJYA 4JL8A 5L3RA 3NIBA 4RKEA 1YHNA 721PA 4AKIA 3EZ9A 4JYCA 3DOFA 4NCJA 5L3SB 1YZUA 4N1AA 3SS8A 4W5JA 4DVGA 1E69A 1XJ3A 2R6DA 4BBTA 3T1OA 5BYKA 5LPNA 2WWIA 4RD1A 4JMPA 2HDNB 3BFKA 1RIFA 2MSEB 1P6XA 3VNUA 1TS6A 1GDDA 3FTQA 4ZCMA 1IM2A 2I1QA 1EW0A 4HAZA 4TLBA 4V02A 2PT7A 4QBIA 1NKSA 4D0NA 5L3QA 3KQKA 3DVLA 2X2EA 2QM7A 4Z1MD 3A36A 3M0EA 3OHMA 2E9SA 1F2UB 4I4LA 2DB3A 2RGXA 3K0SA 2JGNA 3SW1A 2ZRAA 4ZDWA 2HYIC 2KJQA 2FF7A 1ESNA 1F3OA 3QJYA 4NYIQ 2IK8A 2IS2A 3MWLA 2QMHA 4ZPXA 1MH1A 3SU8A 3TR0A 1AZSC 2YKFA 1UDXA 4QJ5A 4UNQA 2ORWA 2R62A 1CU1A 3CPHA 3REFA 4JLDA 1G7RA 1HA3A 4DIDA 4CT5A 1VPLA 1OTBA 2QI9C 2WICA 2FFHA 1P5ZB 4TLEA 2AKAB 3CX7A 2QP3A 4KQDA 4BFSA 1UBCA 1XJQA 5C4GB 3ZVLA 4IEIA 1BMFD 1VKJA 4PSVA 3I5YA 2BMEA 3SYKA 2XB4A 5JS8A 1E2PA 1XD2B 1GWNA 3K0FA 4YMSA 3L82B 3EARA 4WXRA 2IXGA 2KE5A 1LTQA 4NHOA 4QGHA 1D8TA 4LV6A 2YOGA 1P2SA 3GFPA 3IQXA 1RYHA 5JLJA 2BMFA 4PZYA 2CHGA 4KYIB 1MRNA 1Z6AA 2QAGA 3B6EA 3N70A 4H6JA 2OSBA 3B7GA 2JLYA 3ZQ6A 4KXFB 5K8IA 1CRPA 1XB2A 4HOIA 4EPTA 5DKLA 2C04A 1HEIA 1ZD8A 1V43A 1QG2A 4LBWA 3QKRA 4KSCA 3SHFA 3KQLA 2ZQ5A 4ERNA 2ODEA 1T4GA 1UF9A 3B82A 4A8JB 4EERA 4DDTA 4B74A 1TU4A 1Y3AA 3SI7A 3EZFA 5BN4A 5J4VA 4YXWD 1E1QD 1IY0A 4OHZA 1II8A 2JLQA 4R2HA 2KB0A 4OI1A 3DKPA 4TZ0A 1VHTA 2WWXA 1G3IA 3GLHE 3FHTA 2QTFA 4WVFA 5CIWA 3UATA 4UQOA 3K70D 1Z0DA 4HAWA 3THWB 4OI2A 5KUTA 2VF7A 1JR6A 1G5PA 1UKZA 2BIFA 3B1ZA 3BOSA 5J47A 4O3MA 3PUXA 1OIWA 4PC2A 1WCV1 4Q03A 4EDHA 3EPJA 3K0AB 4AKGA 5C18A 5JFGA 4PAOA 1NF3A 3BH7A 2JLVA 4LYFA 1LSVA 4JT2A 3GLHB 2ZYUX 2ZJ8A 1E3MA 3FYHA 4UXIA 2VSOA 3EA0A 3PJRA 4KAXA 2Z4RA 2AK3A 4PQYA 5G4ZA 3BY8A 1KNXA 1R6BX 1S1MA 2FFAA 2N42A 2GF9A 2NMVA 4LHZA 1NBMA 3LI9A 4PANA 3U3KA 4JS0A 3BWDD 5SZJA 1E9RA 1JXMA 3NHAA 1T8UA 4IDPA 1W4RA 4RFSB 2GEDA 4IEEA 3K1JA 4B6EA 4M9XA 2CCGA 4BQSA 3CNLA 4HUQB 4JLJA 4HDQB 1H8HD 3RS0A 4YXWA 3MWJA 1YR7A 4F93B 2B92A 1II0A 2NZJA 3CWZA 4Q7MB 5AUOB 1NNEA 5FI0B 4YWZA 3MSXA 4W5WA 2GZHA 1IXZA 2D7CA 2ZANA 3A37A 1A5TA 3EPHA 2LCFA 4ZCLA 4YC7A 1SKYE 2BVNA 6Q21A 1W4CA 4LRXC 2AK2A 2FPMA 1VMAA 4II7A 2B6HA 4HAVA 5P21A 4TMXA 3MFXA 5FUWA 2OAQ1 3QY0A 1NG1A 1ZM7A 2GXQA 2QRNA 4DLWA 1XJ4A 3CH5A 2LKDA 3WYAA 1Z83A 1KMHA 1WA5A 4NP6A 4ZDJA 4K81B 2BOVA 3PHYA 2RH5A 2YVUA 2ZRBA 4V03A 4ACBA 1L7VC 2C9YA 3KJGA 2IEYA 1XFNA 1OYYA 4LJ4A 4CF7A 1II9A 1XEFA 4GOKA 2J45A 4LV8B 4NYJQ 1BIFA 1IBRA 2WKRA 2WJYA 1SVMA 3I1FA 4FCWA 4Q1FA 3EPKA 4ZO4A 2RHMA 3AVXA 4GZMA 1OT9A 2EVWX 1CR1A 2AX4A 3ZYCA 1E0KA 3JVVA 1SXJB 5FBLB 4DLVA 3VOLA 1M2OB 3FKQA 4TQAA 3THXA 3TK1A 1KI8A 4KHZA 2J7PA 4X8LA 5FOWA 5H8WA 2WWHA 3ZZ0A 1ZCAA 2OXCA 5G3ZA 3LIBA 5CDFA 1PJRA 4G01B 4EPYA 2ZI7A 1OTDA 4A2QA 1RRPA 2W0NA 1J8YF 1FTNA 2WM9B 4C4PA 1XTJA 1T9HA 1C9KA 5JWHA 2F43B 5KDDA 1OFIA 5KNDA 3F8TA 3ADDA 4NTZA 1QHNA 3UB7A 3CX8A 4GS9A 4X8HA 5G3YA 1SXJE 3U4QA 4FW9A 2W83A 4JVLA 1MO5A 1Z28A 3GLGA 2QGZA 1YZLA 3C41J 1KI2A 4KSBA 3AVYA 1UPTA 5B57C 2RGNC 3QOFA 3RRMA 2J0VA 4XWKA 2L1MA 3GDIA 1CKEA 1SXJC 3UMFA 5FPKA 2LWIA 3BORA 4BLOA 1AN0A 4M1SA 1YU9A 2WWGA 4IOMA 4ZKDA 1XMVA 3LAWA 3AEZA 2QN6A 4I3JA 2Q9CA 3KTAB 4UNSA 4P32A 1Q1QA 3UXMA 4CT4B 3GJ5A 2G6BA 3UB6A 1P2VA 2JLSA 2QP4A 1FUKA 1ODFA 1U2RA 2P6NA 2QY9A 2ZJ2A 4IVRA 1XCMA 4CYMA 1QRAA 2KWIA 2Z0MA 3MWKA 5AK0A 3PENA 3UMDA 5HZKA 3HR7A 1IN4A 3W34A 3QG5A 2VHUA 1NVWQ 1UWPX 4B9OA 5FOVA 2GJ8A 1KI1A 3Q5EA 3VE4A 2PYRA 2NO0A 3TMKA 2NO7A 2OHFA 2P5SA 2ZE5A 4GSYA 3S1AB 4BFWA 1ZM2A 3QPWA 5KHOC 2QSZA 1OJ5A 3MFYA 3A1SA 4DSOA 2HT1A 2WKQA 4B32A 3CPJB 3RS4A 4FCVA 4JLAA 5FOUA 3UG7A 2F6RA 4LWZA 1N2CE 4URUR 5HWTA 4HH3A 3U44A 4M4XA 1JJVA 2VQSA 4G0NA 1XXHB 1CR2A 1G7SA 5GADl 4XIGS 5JJIA 2VV8A 1ZNWA 2C95A 4P4TA 5B30A 1XNJA 4YMVA 1JI0A 1N3BA 2EFEB 3OEED 3C2WA 3K3CA 3TIFA 3BGWA 1JEDA 4TSFD 1DBSA 1Z6TA 3QE0A 2YZ2A 1S9HA 4RVCA 2VP2A 4EXOA 2ORVA 2V1BA 3QQ5A 4GMXA 4PO9A 2XTZA 5EUQB 1JALA 5CYPA 3AVOA 3A8TA 3PYPA 4BZXA 2OE2A 2VSXA 3MJQA 4HZIA 4TT3A 5FTNA 5KNBA 5FBWB 5E4FA 4TL8A 4B3CA 4DLTA 1B0UA 1N5LA 1DEKA 2PLFA 2QPOA 4NCHA 4EFMA 3E1SA 4O2LA 2GCOB 1CR0A 2X1VA 5IU1A 4X8MA 3KFVA 4NMMA 4DT1B 3P26A 2BCGY 3UB8A 3NC0C 2QPTA 1S1CA 3FDIA 4WA7A 1XD9A 3X1YA 2CMKA 4PSKA 4LBYA 1W1WA 2JLWA 1DP8A 4MRRA 3OAAA 3RWOA 3WMFA 4PC1A 5JECA 4YDHB 5KO2A 5EZ5A 2V1XA 3MRSA 2AKYA 4BEJA 4M1YA 4OJQA 2VV6A 5SZIA 3EIQA 2REXB 2YOFA 3LD9A 2YHSA 4LJAA 5HDDA 121PA 1QVRA 3L0PA 1T5IA 3OLOA 2GA8A 3C15C 4G3XA 4E5UA 4HAYA 4Q4HB 2ZYWX 4XD7A 1E2EA 4HZUA 3QXJA 2ZXUA 3B1VA 3GJ6A 1GZSA 3QPVA 2ZVPX 3RS3A 2GVDC 3V4FA 1G9XA 4FMCB 3KJHA 1XJ6A 3BXZA 4JVMA 4LBZA 2QM8A 1DG1G 3AKEA 1Q12A 3I73A 3SJAA 2D2FA 1W5SA 4LHWA 4HY8A 2XEXA 3CF0A 4EFLA 1OXTA 1RKBA 4C0QC 1RC8A 2RGBA 4G5OA 5CM9C 4ON9A 4UXHA 4FIDA 5CK5A 2H28A 2UZIR 2XSZA 4L9EA 1NN5A 3U2QA 4TQ9A 5C46F 4XWOA 2G3YA 2P7JA 2V9PA 3R20A 5LDDC 3SJCA 1P4SA 5GJWC 1WMSA 3QF4B 3NVAA 3CX6A 1GNQA 3SYNA 5HDCA 2C98A 4F92B 1AS0A 1D9ZA 1NN0A 4E03A 1U0LA 2C96A 1JNYA 5KPJA 5J5CA 3K9GA 4Q02A 5F6AA 1AGRA 2OESA 1GG2A 4QKQA 2ZPTX 1TU3A 1X8KA 2NO6A 1E2HA 1KO7A 4JLBA 2AN9A 2PT5A 3FMOB 4JT4A 4N3NA 3CH4B 4QC2A 3CRW1 3V4RA 4N0EA 4Q00A 3TW8B 1NG9A 1BKDR 1U98A 2O8CB 3T5GA 2DYKA 4LDJA 3P20A 2VBCA 5EUMA 4B44A 1W36D 2B02A 5B58C 2ZI4A 2VTKA 2QZ4A 3NXSA 2BKEA 1NBMD 2XGJA 4RZ2A 4MKFA 2QKPA 3OEHD 4QHSA 3QNUA 1Q57A 1LSXA 1OKKD 3D31A 4NE2A 4PPQA 2FE4A 3SDZA 4YQFA 2K5UA 2ZI9A 1ZNYA 3WMEA 1R0XA 2OCPA 1D9XA 3PXGA 4MYHA 2C9CA 1HYQA 3AVWA 2IWRA 4HJ4A 1TQ2A 1ANKA 1Q1EA 2MSDB 5F9HA 3MUFA 4FWIB 2C99A 4C9BA 2OV2A 1FOEB 3AKCA 4IFEA 1R0WA 2ZVQX 2VHCA 3X1ZA 1ZYUA 2ORIA 4G5SA 2O8EA 1BOFA 4MN5A 1W4AA 1ZUIA 1DAHA 3PUWA 2G0NA 1T18A 2QG6A 2WMNB 4H1UA 4JBXA 1ZM4A 3L8ZA 3E5HA 2Q9AA 3KX0X 2PCJA 4URWR 1G3MA 3KXLA 3GLIE 4V0MA 5FPSA 1NY5A 5JEEA 1D5CA 1NWZA 4M9ZA 4PFSA 2PJZA 4PR0A 3A6PC 1DAMA 2VP0A 3CO5A 5KSYA 3DZDA 1G1MA 4M8NE 4A36A 4U02A 3UPUA 3NEJA 2GHIA 2ZAMA 1MO6A 2YNMA 3K09A 2PH1A 2ZJYA 3WRXC 2OO7A 3LNCA 3O47A 5DN6D 4URVR 2XSZD 2IF2A 2ZRGA 3KKOA 3OIVA 1H8HA 5B64A 2L0XA 4POAA 5J40A 4LC0A 2IXEA 1R8SA 2XJ9A 3GEIA 1XJ2A 4Q5IA 1G8YA 2GZAA 2XZOA 1JEEA 4ILEA 4HP4A 4MN6A 4B3FX 3GLIA 2HUPA 1EFRA 3IQWA 5F9FA 2DR3A 4C0HA 5FBRB 4DCTA 3LX5A 4AYXA 2IYZA 1TEVA 2CL7X 3QXHA 3FHOA 3U6KA 5EFWA 4BGDA 2REOA 3D7MA 4BFXA 4OHXA 1NN1A 3TKLA 4Q9IA 4RD4A 2ODWA 1M7GA 2J0SA 1CEEA 1A7JA 2OAP1 1W47A 3H2YA 4L16A 4M1TA 3IEUA 1KJZA 3ICEA 3MJRA 1G5RA 1N6HA 1QZXA 3KQNA 1HE8B 2GBLC 1J7KA 3T1VA 1KO4A 1QF9A 3KJIA 4RQ9A 4DUGD 1T6NA 3AH8A 2QRZA 2FFBA 4Y0VA 3SQXA 1GAJA 2NO9A 1A2BA 1NI3A 4OHWA 3VAAA 5UKDA 1JAHA 2QUZA 2F43A 2I9VA 1CJUC 2QT1A 4YMWA 1QHGA 1UM8A 4MKIA 2IC5A 1EGAA 2WWWA 3C8UA 2PX0A 3DO6A 4QRHA 4AK9A 4BFYA 1E2LA 1DOAA 1SVLA 1QHXA 4QL3A 4F3LA 1ONBA 3B85A 4A2WA 2EQBA 4D4LA 4CEJA 1CJMA 1E9CA 4EJSB 5C1BA 1U90A 2XOKA 1OHHA 2V0UA 3W8NA 4NXFA 3EWKA 3TNFA 1P2TA 2FZLA 1HE1C 4BLTA 3SZRA 1PVOA 3QKTA 1YR6A 3NDBB 4BFTA 1BYIA 4R71A 1F2UA 4PPFA 2HCJB 1FUUA 1GKIA 1TS7A 1OJGA 1T3SA 1X8JA 4PQFA 2ONKA 2PJRA 2A5DA 1MO3A 4JL6A 4GS9B 3Q8XB 1ODVA 1ZNZA 4XVRA 4JIMA 4BUJA 1GOTA 1UKYA 3F1NB 1KYIA 4CRWB 1U9IC 5AVFA 5HCIA 1YZKA 5J3WA 1S4RA 3EASA 2YKHA 4HUTA 3T50A 4PAMA 2IBMA 4MUBA 1Q22A 2F3TA 5EE1A 1OH6A 4NYMR 4LRWA 4C0JA 3IEVA 2W58A 1NMZA 5DE3A 4D81A 2BASA 5FTLA 2VPPA 1FNNA 2A3RA 2WIAA 2GVZC 3SNHA 2C77A 4HQAA 3S1AA 2V4ZA 1OTEA 3UWOA 3LBIA 3IS2A 1P9RA 4IKEA 1X0OA 2VL7A 1XTRA 3TBKA 3SE0A 821PA 1TADA 4MYCA 2FSHA 1FMLA 4IOLA 2QAJA 3THYB 1KTVA 1GSWA 5GJVC 2AFIE 3SBDA 3TQFA 4ZDIA 2QQEA 1J2JA 3CUEF 5EE5B 1E79A 1TUEA 1V9YA 5FH9A 3AVPA 2ZBBA 1U99A 2FX3A 2JASA 2ODBA 2NG1A 4QBFA 4HI0E 5FUYA 2IUTA 4GOJA 4JL5A 3QXSA 3DZ8A 4NKRA 3FVQA 3CPEA 1SVOA 4BFVA 1XBTA 2AR7A 1GSVA 3TH5A 2GDJA 3QXXA 3VHLB 3VNVA 4EFNA 4TQUS 4GP6A 4TL7A 2PLRA 1ZBDA 3ADCA 1XPOA 3GJ4A 4RJLA 2V1AA 1C4OA 2CL6X 1JPJA 5HKKA 3MG9A 1DO0A 2BC9A 4GHIA 1E9AA 4O25A 5CIQA 2IYVA 4LJ6A 4XD7D 1MRSA 3VTKA 1COWD 2V0WA 2FNAA 2ZROA 3FB4A 3FMIA 4G5RA 4Q4JA 3JZMA 3THOA 1JJ7A 1NLYA 4AWXA 5JWRA 4W9MC 5EZ6B 5FR2A 1ZIPA 1D6JA 5FL7A 3MQQA 1EX6A 1XTKA 5LBIA 3MR0A 4MQBA 1Z06A 1X6VA 2P5TB 3KKPA 4DZZA 3IDQA 4FMCF 3OE7A 3TSZA 3E4PA 2X19A 2AXPA 5JCPA 3SN6A 1FMJA 3IIMA 4B33A 1YVDA 4AD8A 1PV4A 4R9UC 3EWSA 1LW7A 4AYWA 3DM5A 4A4DA 1Z0FA 2EYUA 1H65A 2Q0HA 2QE7D 3IPYA 3MJHA 4MRNA 3DHWC 2HEIA 2O8CA 4D2IA 1AGPA 1E4YA 3CB4A 1Q1ZA 1GSXA 1D2NA 3NHQA 3ULFA 2F1IA 3Q85A 1GRQA 3AKYA 4V0KA 2P67A 2XTMA 4OK6A 2QBYA 3MAAC 3AP2A 2CVFA 1XJ0A 3TRFA 2ZU0C 4OKSA 1KIMA 5G4YA 4RY2A 3I3SR 4Q9LA 2A5JA 2FOLA 3HU3A 1G7CA 4IDQA 4H9GA 4KFSA 4WF0A 4GMDA 4MYTA 3AF1A 1Q20A 3TAHA 4UNPA 1ZUNB 3A1UA 4B2IA 1NLZA 1EK0A 3AF2A 3WNCA 4A82A 2YKGA 1EX7A 2D74A 4OI4A 1AA9A 4US0R 4US1R 4JLMA 2BDTA 2IXFA 3BH6A 3WYGA 1GVNB 2GK7A 4PO8A 1CS4C 2O8BB 1PUJA 3E4QA 2VF8A 2NPFA 3BY9A 2ZRCA 3ZGXA 2GEVA 4F91B 1IOZA 2BBOA 2XITA 3A4NA 4M9SA 1N6LA 3DMDA 4QXAA 3WY9A 1DAFA 2FU5C 2WPDD 2W0MA 3AVUA 3LX8A 4I1SA 4UNRA 2DFLA 2CLDX 4KBFA 5H70A 3E2IA 1W7AA 3I92A 1G8PA 1SVSA 3CWQA 2FWRA 3QIAA 2PZEA 2GAAA 1L4YA 5E7IA 4BBVA 1NLFA 4IOKA 3TUIC 5JHGB 1XEXA 1VDZA 4KLNA 1LT0A 1E1RA 1E2JA 1UAAA 2R2AA 3IHWA 2AXNA 2ANBA 2VRWA 4TTPA 2C78A 3AF4A 3VX3A 5F98A 1Q44A 2E1RA 4NYMQ 1XZPA 4QGGA 3I72A 4CEJB 2W6JD 5HWWA 5FPYA 4V0NA 3SBEA 1QHHB 3LIAA 2WV9A 4M4SA 2N1BA 3TVDA 2ZU6A 1KK2A 1UKVY 2F9LA 1PLLA 5FI1B 1OXUA 5TARA 3O8DA 1UEIA 3CNNA 1JBKA 4DDUA 3CIOA 4D26A 1NRJB 4QHYA 1TS0A 5DLQC 4BWYA 2GJ9A 2YINC 1WE2A 3GMTA 4BLPA 4W5HA 1MZUA 4LHXA 4NCNA 3EEHA 3I61A 1LB1B 2FSGA 5DHAA 4BZQA 2GXUA 5FTKA 1OTAA 4KUOA 3H7WB 4EESA 4KJZA 3J81k 1FFHA 4EUNA 1CRQA 4HHDA 3JVUA 4TN1A 4IJMA 4MGKR 1WA9A 1AS3A 4YMUA 1CJTC 4C2UA 1YE8A 2OEPA 2JAQA 2C9OA 3HYTA 4Q18A 4YDSA 4TYQA 4A0RA 2ZS8A 5CB8A 2W0SA 1ESMA 5A4JA 5JI2E 4Q9JA 4DSUA 1PZNA 4I3AA 1JR3A 5DI3A 5BYJA 3GQBA 2QEQA 1SKQA 2A5YB 4XJXA 4DCVA 4FMBB 2GCPA 2ZE8A 1YRAA 4I1VA 1Z6YA 3BJIC 3U7EB 2CJWB 3ZZUA 5D3MA 4Q4AB 1KDPA 2F1JA 3RANA 1DS6A 3QI2A 2HYDA 3VFDA 3WBKA 3NH6A 1TMKA 3AGPA 3P27A 3LXXA 1AJEA 3W3ZB 2D06A 2GJKA 2RAPA 4ESVA 4H1VA 3EWAA 2F55A 4HLQB 4NL4H 2CCJA 2OOLA 2A2ZA 2G83A 4PO1A 3KZ1E 4KYUA 3PUVA 3B9PA 3SJBA 4ABYA 2OLKA 4Q66C 5JWOA 3L0IB 2OT3B 4HAUA 1T1BA 1FNMA 1NKTA 4KU4A 4M1KA 1LF0A 4U00A 4KLZA 4ESHA 1G291 1DAKA 1XEXB 1EFUA 1GL7A 3K09C 5KPDA 2ZRMA 4IRUB 2ZJOA 2XNDD 1LS6A 3EIHA 1NP6A 5CYOA 2HV1A 4LGMA 4EKDA 3CR7A 4HYYA 3I4LA 1P72A 2W00A 1IN6A 4NXGA 1YZGA 1XTSA 3U7GA 1QHHA 2QT0A 2IS4A 1E2IA 3WMGA 1GNPA 4MKGA 1X1SA 3R9IA 1EFTA 4C2TA 5TBMB 2ZS9A 3AQ4A 1ZNXA 2JLXA 1ZAKA 1V9ZA 3VX4A 1OF1A 2GWHA 4L9FA 3X2SA 1DE0A 2PEYA 1HV8A 2AD5A 3M1IA 4YONB 2BEKA 3BE4A 3ZJYA 2QL6A 4FMDF 3IUYA 3NG1A 2NTYC 3WRYC 1Z0AA 3LVRE 4A6XA 2W2XA 1IY2A 4PC7A 1KSGA 1G8GA 2BM1A 4GP7A 1F9IA 1X3SA 3L8YA 1KI6A 2WSSD 4LJ7A 3ZD6A 1DO2A 4MDFA 2W6ID 3EXAA 4OJKA 4XVQA 2J59A 3RAPR 1XZQA 2EFGA 2RGNA 5KU1A 1M7HA 3THYA 2NGRA 4ZIRA 1G64A 5FBVB 1J70A 2HT6A 1R8QA 4AG5A 2V3CC 3Q7PA 4GL2A 1L8QA 1MO4A 1OH5A 4DRZA 3H82B 3EZ2A 4F4CA 4OQMA 1XXHA 2J7PD 4M9QA 1G20E 2WAYA 2QMOA 1ZCBA 4GZLA 1NVXQ 3U6BA 2FEOA 1ZINA 3Q7QA 2CVHA 2INWA 1G7TA 3HYRA 4Q21A 4NXEA 2CNWA 2JLRA 2RB4A 1Q3HA 1R2QA 4LLOB 3X1DA 3LI8A 4JVSB 4L5BA 2J46A 2Z4SA 2UVQA 1FP7A 4S2EA 4L8GA 2IWHA 2R78A 1DVRA 1DARA 5A0FA 2QBYB 2KX6A 2ZR9A 5IDVA 3EPLA 4ITRC 4IDHA 2QWSA 4GOXA 1MABB 5D3QA 1KMQA 1KI9A 2ZYTX 2DWOA 3ZVNA 3WHKA 1OFHA 3I32A 3QKUA 1OXXK 2O8DB 4XTRA 4TYPA 4KI0A 4PHFA 3LA6A 4O2RA 4TL6A 4EEPA 4O0MA 2ZS7A 1YKSA 3HU2A 2Y8EA 1XEWX 4R3AA 1G6HA 2IYYA 2PDRA 1GUAA 1JR3D 2QJ7A 1E2DA 1IXSB 1Y63A 1OH8A 2XXAA 2FJUA 4QM7A 2ZOHA 5L8VA 3FKSA 1Z6GA 4BRWA 1G19A 1DPFA 4DSNA 2FGKA 4I5SA 4NXBA 1GIAA 5EXSA 1WQ1R 1M7BA 2JN7A 1NVVR 4NZYA 1QBKC 2J0UB 1W5TA 3CZQA 2QNRA 4F38A 4JVNA 4HUQA 1N6NA 1EFHA 4LSGA 5LD2B 3GECA 1QVAA 1Z63A 5GVSA 4CEIB 5JCZA 1HUQA 2VHQA 4TMVA 3X1XA 2IUUA 1KGDA 4WAUA 4DCNA 4OHYA 1FQJA 1CULC 3UMSA 3QEJA 4AY2A 4KODA 3FGNA 1RRFA 1GNRA 1K5DA 2H8KA 1G8HA 1K8RA 5EP2A 1SVWA 3OFND 3AVQA 3KKQA 3QKSB 1E0JA 5JSZA 1GRRA 3V00A 1IJFA 1KO8A 3TLXA 2GCOA 2BMJA 4I38A 1W0JA 2WKPA 1Z0IA 2OFOA 3B1WA 3NKVA 4A8JA 2JLUA 2EYQA 3VR1A 2W6IA 1SXJA 2Z5FA 4RZXA 4HI4A 1X1RA 2Q3HA 4OBEA 4UXJA 4ARZB 1ZU4A 2I1VB 2RMKA 5DJUA 3VR3A 3OEHA 3H82A 2RHDA 2YV5A 4MGYR 4KUKA 4HSEA 4DLZA 4H6JB 3OFNA 4FCTA 4JLPA 4BEBA 4TMTA 1F5NA 1AKYA 2HJGA 4RCZA 1E9FA 4DC9A 1S9DA 2ZSAA 4KVGA 2JIZA 2DWPA 4Q1BA 2J1LA 4G5GA 1TTTA 2ZSFA 1MKYA 2HLDD 4EPXA 3FFAA 2ZSBA 4B73A 4D6PA 2ZIAA 5FUVA 2BBSA 2QU8A 3UMRA 5F5YA 4HATA 2OUKA 3C8CA 3QXCA 2Q3MA 4XSGA 1OIVA 1GFIA 2WOOA 1AM4D 4BZPA 3K0CC 3QG1A 1R7RA 3PEUA 8OHMA 1E2GA 2W2VA 2V55B 1GP2A 2QAGB 2DHRA 4JLOA 4N0DA 4DB2A 4JJKA 2E87A 4KO8A 2GESA 1GL9B 4OYHA 3B9QA 2J87A 2ZITA 1CTQA 3GFTA 2O0JA 1I4TD 3GLFE 3ZQJA 4B47A 1JXOA 3LBHA 3TQCA 3K0EA 5ANRB 1W44A 5FOTA 4JBWA 2IYUA 3SOPA 1WP9A 2IF0A 4D4JA 3RS2A 4WUJA 2ZOIA 1PLKA 5KOYA 5AUQA 5EXPA 4P31A 5BXQC 4DJ3A 5AR1A 3ECCA 1DAIA 2CHQA 4HB4A 1EXMA 4LJ5A 5LB2A 3ZDQA 1CLUA 4TLAA 1KKLA 2FH5B 4TSFA 1EFCA 4DUGA 1W2HA 4Q4HA 3GLFB 4HJ3A 1KZ7B 3WYFA 4KBGA 2IA5A 1KK3A 1D7EA 3A4LA 3U7FB 1OH7A 2MMGA 1VCNA 5BN5A 3REGA 2JLZA 1OXSC 1FTSA 1XP8A 3WP0A 1BYUA 1US8A 3BRWD 1P9NA 3BD9A 3KKMA 1S96A 2C8VA 1GL6A 2V7QD 1XU4A 1I4DD 2H16A 4NU0A 1R5BA 3PEVA 2ZRDA 1ZUHA 5EE0A 1IQPA 5FL3A 1LSWA 2A5FA 3WP1B 5A5GA 2WWFA 3C16C 3E4OA 221PA 1MABA 4DDVA 3M4YA 1RE0A 5J4EA 4BFZA 4CZ2A 1VECA 1KMHB 3TR5A 1GKYA 3HDTA 2XZPA 4ACAA 4C3ZA 4DT1A 4AI6A 1T3HA 1KSHA 2XB2A 2PEZA 3UG6A 4WOPA 3B1YA 2ZR0A 3EAQA 4E04A 3THXB 1XDBA 1P73A 2G88A 3UB9A 3BFVA 5DKKA 3LH5A 1QDEA 1E9SA 2R9VA 1XCGB 2ZE7A 1P75A 1HT2E 3RRYA 3TE6A 4HLUA 4LYHA 2BHRA 2Q3FA 2QTHA 2EFDB 2ZRIA 5TMPA 4A2PA 3ETLA 5E3HA 1N0UA 1A4RA 3GJ8A 1FPMA 2VEAA 2IHBA 2KBFA 3PIRA 4Q4LA 3VR4A 1E32A 4V0OA 1NJGA 3DDCA 4A0GA 4Q47A 1P61B 1CF4A 1M74A 5TDHA 5K8UA 1CJKC 3ZIAA 4L9SA 2QAGC 2QMUA 1GM5A 2GAOA 4BPBA 2CE7A 2ZRNA 3SQWA 1BO6A 3EZ7A 4WZBE 4Z51A 4CEIA 1ELOA 2IYLD 2V6JA 3KJEA 3IBRA 1XF9A 3LBNA 4G1UC 2F3RA 4KV9A 5IT5A 3GLGE 2J0QA 2OZEA 3FMFA 5FL7D 1F6BA 3KQUA 4NCKA 4QNMA 2XXAB 2D02A 3CF6R 4LCBA 3KB1A 1W48A 3HU1A 4LX0A 2WWYA 3NWJA 4EEUA 3L43A 2AWNA 4QNRA 1I2MA 3OIUA 4JGRA 1VG9B 3H9WA 3FC7A 2WBLC 3AP3A 4OI0A 3HR8A 1LY1A 3RABA 1XFAA 3DPUA 1VG1A 2CBZA 1DAGA 3D6TB 4K46A 5AJXA 3D8BA 1VHLA 4OQLA 1ZM9A 2SHKA 2X2FA 3HJIA 4Q7KA 2O8DA 3T15A 5IF9A 2ZUCA 1U94A 1W0KA 4RZUA 5DYGA 1G5TA 3BBPA 1Z29A 2CE2X 4B3DA 2O8FB 1IHUA 3R8FA 2AL7A 3ZS8A 4UKDA 1OIXA 5TV2A 2FA9A 1JAIA 1T3LA 2F7SA 1D2MA 1GSIA 2FSFA 4LOAA 4DHEA 1W36C 2EU8A 1LL8A 1N6RA 2FN4A 2GXSA 2H1LA 1QHSA 1IJEA 4GFDA 3CRVA 3MGCA 4PKYA 4FI3C 1OT3A 1S4SA 2QORA 1KOUA 3GLGB 1OFUX 1CXZA 5DISB 2B8TA 5KDLA 2L0WA 1RPZA 1M1YE 2GJAA 3KB2A 3LRPA 2VO1A 1E9DA 3AUXA 3GFOA 3RHFA 3UWKA 4L9GA 1MT0A 5FPTA 3ZZTA 4IDOA 3LQRA 1KI6B 1WBDA 3I8SA 4Q48A 1HY3A 2ZSEA 1VG8A 3PCRB 2REBA 2HJVA 3QKRB 4B71A 5IHPA 1B23P 4ARZA 2FGJA 3HJNA 4KFRA 5DI9A 1YR8A 4DCUA 2RGGA 4ZDKA 3LYXA 1E79D 2FZ4A 5M04A 3ZLJA 1KK0A 2R6AA 2ANCA 3NC1C 1N9LA 5E7MA 2EW1A 2ATXA 2G0TA 2PBRA 2ZETA 3ADKA 4RD2A 2WJJA 3W6OA 1G3RA 5IK2D 2IYXA 2J3EA 2QENA 1OLOA 3CM0A 3HP1A 4LRZE 2VYFA 2ZI6A 3QKSA 4HB2A 4D82A 1KY3A 1U0JA 2FDCA 1E2FA 1VB6A 1XMIA 3T12A 5F69A 4AKHA 3VQTA 2IUSA 4EQ1A 2ZAOA 4QGAA 3EC1A 4Q01A 2WSSA 4QGFA 2JATA 1YRBA 1Z8FA 2WHXA 4B2LA 2NO1A 3SJZA 4HZUB 5JBQA 4HJ6A 3N2IA 2EA9A 2H92A 2GKSA 2ZJAA 3ASYA 3W3AA 1UKEA 2ECKA 1G17A 2PL3A 1IN7A 1IY1A 1TQ6A 3H4MA 5J4KA 1HH4A 3NTUA 1KZGB 1TQDA 3RDPA 2A30A 4DLRA 3N2EA 2OXRA 4U7DA 4LZZA 4A6PA 3HWSA 1W46A
chains in the Genus database with same CATH superfamily
3QP2A 3WK4A 2P6RA 3DZJA 1LVHA 4JC5A 4P6ZM 3S7PA 2H4HA 2PD4A 4JUDX 3W9UA 5C2JB 3OOVA 1K4EA 2ZB4A 3SMQA 3FKVA 4D4KA 4PZEA 2JVKA 3MIIA 1GQFA 3AGQA 1HTWA 2PMWB 3P2KA 1U0TA 2VAVA 1LPPA 2M7UA 1U4SA 4DKXA 3PEWA 1EI5A 2BEVA 3FLEA 3GNSA 1SC6A 2XNSA 1CUBA 2F8LA 1DB3A 2HF7A 4KVAA 3SS3A 421PA 4EK9A 3G5MA 2O3SA 3HV0A 1PK7A 3RAFC 4AJ9A 1ECJA 4CBVA 4FOFA 3GJ0A 4HS9A 3K8ZA 4WN9A 3EGXA 1NOIA 3VZBA 4YUWA 1RWOA 3ABSB 3BFGA 3VO2A 3RUCA 3GFFA 4N49A 2QVBA 3OVMA 3UHOA 3OSUA 1A95A 2RHJA 2AHRA 2VQDA 2XQIA 5B1YA 3VDMA 1O7EA 3AFNA 1ZC3A 1YFZA 2X77A 5IC6A 2ZI3A 3HHEA 4KITB 3AG6A 1D6SA 1DELA 2OM2A 2Q8NA 3ACBA 3BQ9A 4PWZA 3VGJA 4YK7A 3W9YA 5SYAA 5IT4A 3DCJA 4IDFA 4WKPA 2ZRJA 4X1YB 4IYRA 1DQSA 3O0TA 3EZ6A 3WGGA 3KE8A 3F9RA 1BS1A 2Q2VA 3NV7A 3PR1A 4M7OA 5KYNA 4B3SB 1JFLA 1UBGA 4BCCA 1J2TA 1QIKA 5FAQA 1VYTA 3GARA 2X4DA 3MT8A 1B0AA 1QCZA 3UE0A 1JF8A 1PZFA 1UADA 3I2HA 3G5TA 2Y2VA 4PSCA 3PUIA 1F12A 1RQLA 5EXXA 1PJ2A 4F06A 2ZRPA 1QCYA 5LQUA 1RZRD 1E7SA 4O7DA 3IUMA 1GGVA 3FRIA 4E5SA 3C8HA 1EHYA 1V6AA 2XD5A 3CRRA 4IVQA 3D6HA 4TS4A 3ZHSA 2J0UA 4HCJA 2O2DA 4CTOA 4F7WA 4DZZA 2VH1A 1YKDA 4S2NA 2CXUA 2ZJBA 4U8GA 5FD8A 4QOFA 1J25A 2BFPA 5ICCA 2DLNA 1MCZA 1PE0A 5AWFC 1FCNA 3M6AA 5FOSA 2WTUA 3NBUA 1VEUA 1V35A 4I2NA 4A1FA 5BN3A 1M34E 3T9BA 4UC0A 5AKHA 4U2BA 1FS5A 2ECQA 2AYZA 5GZ6A 3I5UA 1Q7CA 3AB3A 1OILA 1JDNA 3KUDA 2ZPUA 1KDOA 3ROKA 2PAVP 1V11B 1C1YA 2EXXA 4IFTA 2GD0A 4JJFA 4GVLA 4A23A 5I8WA 1OT6A 1I7SB 2UV8A 1Y5IA 1QQAA 3T4SA 1U6KA 3D0OA 5FOXA 3IO5A 1CBUA 2OP0A 3IQDB 5CERA 2QJFA 1DUVG 1SBYA 4B2YA 3EZNA 4HFMA 1ZMXA 1IUOA 3CVOA 5F76A 5GONA 3H1FA 1OYWA 3F5QA 2EIHA 1AXBA 3PJGA 4KO2S 5CB0A 4AF8A 2V97A 3B13B 1DP9A 1DCMA 3T99A 1BVYF 3OZEA 3RIMA 3RR2A 1ZD2P 2C5WB 1TTQB 2DY0A 2HLNA 2DULA 2BISA 2GYYA 4BO7A 5AVVA 3Q6MA 3FOFC 4KR6A 2QHXA 3ZTYA 4E33A 5FRDA 2JEOA 1N6KA 2AEMA 3MF4A 4EB0A 5I5LA 2IOQA 2FEMA 3WWCA 4G0VA 1NVEA 4P0QB 7MDHA 3UK1A 3ZBPA 4X6UA 3RYFB 3FSGA 1OPRA 3A1DA 3ZNPA 1VE6A 2VZ0A 2VHJA 5EJMA 1XTZA 4JDUA 3VFFA 1KPHA 4P35A 2OA0A 5FJJA 1KI3A 1M0WA 2PU5A 5FKJA 4BNMA 1X7WB 2VG8A 4C29A 3CN7A 3KPVA 1IWPB 1QORA 2GD2A 2O19A 3JZFA 2HRZA 2X5NA 1A96A 4Y2HA 5J59A 3WNDA 1NRIA 1NL3A 5LQSA 1FX0A 3AVVA 2EFJA 1S2OA 3ITNA 5AKZA 1WD5A 1E3WA 1I3OA 1PL8A 2Q5JA 3RXWA 1AKRA 4OHMA 4CW7A 1MJFA 1DV2A 1NXYA 1X86B 2JIMA 2WFAA 4GCZA 1XQYA 3L7MA 1NASA 4NCIA 1QBGA 5ILQA 3W4KA 2G5PA 2ODNA 4B43A 3TD6A 2JJMA 5F1FA 4OPQA 1RRGA 4JA0A 1BGXT 4PV7A 3TBFA 5CXQA 2Z6CA 1GFZA 1TMYA 1A8QA 4U39A 4TYWA 1DZ3A 1LJLA 3BWMA 1XZEA 3IO3A 3CMZA 4FQ7A 5FQKA 4HVCA 3VZCA 5IM4A 4L9AA 4JT9A 3T4PA 2ZUBA 3G79A 1DIBA 1N9NA 3L6BA 3UF0A 1YDFA 4B7ZA 4O5OA 3AUYA 3U4DA 1N33B 1ZRHA 3VOZA 5IYZB 3T34A 1V1RB 2H8GA 2ZIUB 3DLHA 1KMMA 1VJTA 5EFZA 1YLTA 4CQNA 2R86A 3WBJA 3GOQA 2H2WA 4Z8YA 1B3BA 3U31A 3UGQA 3WQRA 3WWDA 4C1NA 5JH7B 4EKIA 1IL0A 3C1OA 4M21A 4M8SA 3GUVA 1XPUA 4L51A 2WIFA 4GOGA 1J09A 3O31A 4BX3A 5FQJA 1PFUA 2RBGA 2RGCA 3KQWA 3N0XA 2OWJA 3RM3A 5D5QA 3JALA 3DDOA 5CYGA 4PZCA 4R51A 5AW4A 3N3BC 1XXMA 3PNYA 2QZZA 4H3SA 5DYNA 2QXUA 1T2DA 2H1RA 2YJGA 2G77B 2IKQA 3CF4A 2BV3A 4ZYYA 3E2PA 4IIXA 4TXNA 5MF6A 3H13A 1N6IA 2MSWA 4MR7B 3I2GA 3ZIAD 3ANMA 1ORWA 4NQZA 1SXPA 3M89A 4KJXA 4TTQA 1BHQ1 5IDQA 5DULA 2O8EB 1V1MA 4J16C 1OKKA 3BM5A 4UEQA 2VNHA 3QOYA 3RRZA 2AC4A 3QVVA 4FDAA 2I78A 3G6WA 1T91A 3RAEC 2IE8A 3PE4A 5L8MA 3ZWCA 4MZDA 5M29A 2RHRA 4UHBA 4MDEA 2R6GA 4KIFA 3M82A 2E5FA 1OC2A 2H5EA 4RKWA 5TEVA 4CKZA 5KTKA 4Q1AA 2A78A 3KOXA 5KKAA 1FUEA 3IS2B 1TUIA 3U7HB 2B30A 3NECA 2H0RA 3Q11A 2X02A 4DOMA 3R8CA 4MV5A 4LRYC 1UEJA 2IGTA 2WKHA 3FKWA 3FBGA 3KE9A 4NHEA 5A0TA 2HIAA 3LW8A 1TS8A 1VM6A 3BX1A 5L7WA 3OQNA 1R4MB 2PL5A 3T1TA 1Z62A 1DTSA 4BWFB 1Y1TA 1ZJ6A 2PM8A 1Y3HA 2HA2A 4HHEA 3VVMA 1DC7A 2FSIA 3ISTA 4ZGWA 1Z47A 3P2OA 2R8BA 3MQ0A 3BRSA 3CKLA 3H5OA 2X5XA 2MSCB 2WP0A 1YOVB 1EQ2A 1JEQA 1K55C 1BE0A 4L6AA 5C4MA 5LZ9A 4NG2A 1JMYA 4I39A 1P33A 2DR0A 2QMYA 2WU1A 1TE2A 3C24A 4KQ2A 5DYIA 1V3UA 1I9GA 3CJRA 4IMJB 2YASA 1Q7GA 3G9QA 2PUFA 5K0JA 1Z5VA 5EQDA 4AKEA 1I1OA 1E2MA 1UR5A 3A28A 3WR5A 3U3MA 1OYOA 1B6TA 1R0RE 1XAGA 3JQBC 4TV9B 3U37A 3UPTA 1HNXB 5GOZA 1D3AA 1V4NA 2DWCA 1W4ZA 4P0MA 4RSMA 4EG7A 4C7OA 1NYYA 1H2EA 3CLHA 4NBTA 4EI2A 1QZZA 3CPTA 5FTJA 3W9BA 2G2WA 1LRLA 4N9QA 2XCLA 3V3SA 2WUVA 2GBIA 3NDRA 4FDLA 3S44A 4AJHA 3LDGA 4CXMA 3MAGA 1PSZA 1L4UA 3L0OA 4KL8S 1ZG3A 2P62A 1TL7C 3QEOA 2IW1A 3TQRA 5BNTA 5LR6A 1N34B 4F3LB 4W1SA 1HI9A 5ER6A 1PEDA 2J3KA 1V7QA 3C8DA 3GEEA 5IXYA 5KINB 4JJGA 4HH4A 2Q5IA 4L28A 2DWQA 3JWEA 1S3SA 1U9YA 5E4YA 3FCEA 3TTTA 1CSEE 5BSEA 5FAPA 3RC1A 2C8LA 1JHAA 1VSUA 3K1YA 4QPCA 4XH9B 3ND8A 4ISCA 3R5KA 4M1MA 1I0ZA 3J7TA 1EE2A 2JJYA 2CHUA 4C3VA 1GT6A 3QBTA 1T36B 5F3RA 1XG5A 1YZFA 4LN1A 1EUCB 1Z37A 3E05A 1O3YA 2H2DA 1DIGA 3MJEA 4OHBA 1LKZA 1E25A 3KEGA 4MAMA 5CJPA 4BN5A 4EJSA 5CB4A 5JRJA 1ES3A 4R7ZA 1VYVA 3CISA 5SY6A 1KK1A 1MQ9A 3OU6A 5HSQA 1KYYA 5KTYA 1WHTA 4XB2A 1FILA 5DBIA 5BSUA 2PRJA 2ZI5A 3HCEA 4G8CA 4I50B 1XNRB 4EABA 3UDIA 1XEWY 2C7RA 1J9ZA 3U4AA 3ZCSA 2BHSA 5KWEA 1J7JA 4X8OA 4MWZA 1Y7IA 3LFVA 1ZX1A 1U8ZA 3HJGA 2NOAA 2NUTC 3GCDA 3LSTA 3N8DA 3R0VA 3WNQA 2RCNA 1ZOOA 3I83A 3SOIA 4JKYA 3T3PB 2WM2A 2OK7A 2R7KA 3PFWO 4BO9A 2C9MA 4FK8A 4KYTA 3G0DA 1RRCA 1ULTA 2CLIB 3OPYA 1J2EA 2R8PA 3HPRA 2YS7A 1SKMA 2J9OA 1ONPA 2QD2A 3FPHA 4LPKA 3NHBA 5E2AA 3TQTA 3ZV4A 3ZLUA 4MUGA 3V8BA 1WSAA 1L8LA 1CZNA 3EC2A 3M6WA 2O8NA 1PHRA 4LY6A 1BJRE 1V45E 5C7OO 1OB2A 2I4RA 4JFAA 2QMIA 4Y6OA 1LBIA 5AQBA 3JZAA 3PC6A 3VNQA 1FR1A 1O9HA 7REQB 2PMCA 2DQKA 2VBFA 3DAPA 2PQ2A 4U0XA 4P82A 4INOA 4R70A 3AFHA 5EKUA 3CZCA 4P54A 3SIPA 2HDUA 1FDOA 4B48A 3ZWVA 2YYZA 2GLUA 3DLCA 2P2DA 3A0VA 3B60A 5CVVA 1F8UA 1LNZA 1NLUA 2G80A 1JR3E 3N5CA 4WN9B 3WLIA 1KRWA 5J4LA 4GBJA 5F1PA 4EA7A 4FN4A 2FRDA 2JKTI 1SFRA 1ZESA 3SH8A 1M1NB 4HP9A 1DP4A 1L7BA 2GLXA 1KFKB 2PMBA 4P38A 1VB5A 4EG0A 3TLGB 2XUDA 3KV1A 2W6QA 2OBMA 4HNQA 4QQ8A 3PFBA 4JR1A 4IHJF 5TNXA 3RIHA 1KJ8A 5HARA 5ENZA 9ATCA 4JI3B 1SKUA 5HRUA 4KNYA 2QX9A 1TX4B 2IUFA 2CLCX 4FFVA 4HQ6A 4AG6A 4E7PA 1DRJA 1WB4A 3I34X 2JEZA 4KKXB 4NDZA 1UODA 2JJ2A 4I3FA 4JCOA 1YCDA 3VPDA 1NUQA 1EX9A 2YV3A 3HGMA 4DLSA 4LSWA 1A2KC 3CBGA 4I1IA 4DQXA 2EP7A 5EMHA 3GOHA 3LUAA 1V41E 1IXRC 3IUBA 3A3EA 1YZYA 3ELBA 3LYHA 3IWIA 3QFTA 4P4SB 2AOUA 3HYCA 4W8OA 1KKMA 2Y6VA 4O6VA 2JDIA 3DTKA 4QJGA 1GZ3A 2PPVA 3N5KA 4X44A 5A9RA 5BUZA 5J4HA 5JNLA 2E4VA 2VUIB 3KJXA 4Q7LA 4U0KA 5CTNA 1EA5A 2VR1A 4V3BA 5KSPA 5BWOA 5KTNA 2NUAB 2VRCD 3QYPA 4LNAA 1M5UA 1E1NA 1GQOA 4J9UE 1Z34A 1P45A 2P65A 2QZJA 4V0LA 4WZAE 4DCGA 5C52B 4L7VA 4GI2A 1X9GA 4HMQA 4OJTA 2J3JA 1PSWA 1R66A 3OT1A 4HN9A 3I52A 3AKZA 4CR8A 4XRGA 4BQFA 3UJNA 3B6IA 3MBIA 3NJ8A 4R41A 4Z7NB 5CFMA 4DB4A 2GBGA 1L5YA 5HKBA 3QLJA 3JAWA 3C38A 4RS3A 3TR6A 4P80A 5EZQA 3IH8A 1SGWA 3IXQA 4M87A 1KO1A 3OF5A 1NSFA 4U9HS 5E1MA 1UZNA 2VOJA 2WSLA 3T06B 4D74A 1V6CA 4DE3A 2J5QA 1PR9A 2EC5A 3DAVA 4BBUA 3L93A 3LF1A 4GHIB 3AP1A 3FFXA 3L0SA 4WXHA 1IPEA 2IE0A 3TSAA 4CNQA 5AVTA 1R6AA 3ZVTA 4DRYA 2PTGA 4Z49A 1I5OA 3C6MA 4ASUD 4RTLA 3CWFA 4I81A 3T3NA 1RW4A 4WYYA 4PXAA 1DCFA 3BVPA 3W2IA 1NOJA 1PU2A 1CFJA 2ZREA 1Z5ZA 3EG5A 3E8SA 3H9UA 4EG8A 5JDCC 2R0QC 1ZK1A 2RAVA 5C1OA 3GRFA 3M6UA 3HO1A 2IHTA 4MBFA 3VE3A 1HZJA 2HEGA 4DLPA 1A71A 2HSEA 4ER5A 2PKWA 2CVQA 3HYLA 4BTVA 1V1RA 4UAGA 1BWSA 4YLGA 3ELWA 1C81A 4RY0A 5A5FA 4BNGA 1MENA 4EHKA 3F1OA 2V65A 4FGSA 2IP2A 4QYXA 3UJPA 5BPHA 1PR0A 2YHAA 3AY3A 3DP7A 1P4HA 4G5XA 5JMPA 5TPWA 1T5SA 5IAAA 2QMEA 1T0BA 3BRQA 2WD7B 3GZNB 1GYRA 2V8OA 4EPWA 4MW6A 4QPZA 3NEPX 4B87A 2FLVA 1F8GA 5CK4A 4C2TA 1MDFA 3RYFA 1SNYA 2R1VB 1T5LA 5HNKA 3NQ41 1PUIA 4D2OA 4M6WB 3E3AA 2F3UA 2R11A 3G2LA 3WHLA 2PMFA 3RTYA 2VP9A 1UMDB 2HBRA 2FWJA 2JFYA 1CZHA 2JIZD 3MA0A 3NBFA 4Z0TA 4B3XA 4BLUA 1FX0B 3GPLA 1O0SA 1VIAA 3Q7VA 3G7UA 3RASA 3Q8KA 1S1YA 3FDFA 2IPXA 4DDWA 4NK3A 2G1JA 3IX3A 1E9EA 1Z3IX 1N57A 1SN7A 2H6EA 2Z30A 3HEMA 3KT8A 5AM0A 4JU9A 4HYQA 5DLYA 3RV3A 2FSVC 4OPYA 5K6TA 3EUEA 4KQWA 5FPHA 3S1YA 2EJBA 3NV9A 5K8TA 3NO4A 2BKUA 2QW1A 1SRRA 3AY0A 4GUAA 3A9SA 5B1IA 3U1VA 1K5HA 3WNBA 2PD8A 2VT7A 2CDAA 4BKUA 1JVJA 2C2HA 1NBWB 2KPOA 4M8KA 1VG0B 3JQPA 1NDQA 2I80A 4TMYA 5SYMA 2CEAA 4UE2A 5KKNB 4XAQA 2IUEA 3KFXA 3E18A 4DIOA 4CQHA 2J3MA 3NBYC 3VPGA 2QRVA 2ZBDA 1Q0RA 1Z08A 4G0ZA 1N2IA 1P0QA 4R8SA 2R6FA 3W90A 4GOMD 1IBKB 3WIOA 3WTBA 5IJZA 1NJ8A 2DXIA 2GERA 1AV7A 3R5HA 1EVQA 3NGMA 2X8JB 1TYAE 1EG7A 4TWRA 5DIFA 3MTQA 3ZHYA 4D4IA 4EEXA 5KSOA 4LWOA 5BWMA 4HIAA 3H84A 1Q17A 2KYRA 2WIJA 3OZIA 4RHTA 1NM5A 3QEMB 2FQ1A 3TMAA 2QDXA 1NSTA 1WXHA 2GR9A 4PLZA 3AIKA 1NR7A 4R54A 5DNUA 1KZYC 3HFJA 4JAVC 4B75A 3SS4A 3ROTA 1JYSA 1YTUA 3ZD7A 1QRDA 2JJ8A 3AONB 3CU5A 3LPAA 4E2FA 1LLBA 2L17A 5H68A 5B2ZA 1BN7A 3IXGA 1KZ1A 2PT9A 1E5QA 1ZL2A 2HGSA 4R5MA 2AT1A 4EY4A 2X9GA 2KSQA 4JYMA 1OFTA 3ZD8A 2BI4A 1OVGA 2Y1GA 3GEBA 1T5HX 3HCCA 5EXDA 3RS8A 4XQ9A 4D45A 1PTJC 2GEKA 4B3MB 5IM5A 1CUDA 2X71A 4RMGA 1MJNA 2OYSA 2NVUA 1S2LA 1WPXA 2QSYA 3AV3A 3N28A 3R7NA 2RG1A 5KTTA 2YWGA 3QJ5A 2IYQA 3QIVA 1UC8A 1BTLA 5JS7A 5E38A 1IG0A 2XODA 2NT4A 2C2KA 2HHLA 3WS5A 1CRWG 2B18A 3ZNOA 5JRZA 3PITA 1U8AA 1X0VA 2PRFA 2CMNA 2VDUE 1TO2E 3OCZA 4YJKA 1YCGA 4MYUA 2QV0A 4PIPA 1U0GA 4P4GA 1QVWA 2R7AA 2C5GA 4NU8X 3IUSA 4EPRA 3OPLA 1T19A 3EMDA 5GV8A 3ZHTA 2J9GA 2B2NA 3L40A 1O03A 2PR5A 1M6NA 1Q6YA 2ZYVX 4IBOA 4LJYA 3VU9B 4CGZA 4Y0AA 1C4XA 3IUPA 3S2ZA 5JROA 1Q77A 1W79A 4A73A 4GWGA 3T94A 5KCZA 3ZVMA 1E2BA 3X43A 4ZFNA 5ALWA 5FQIA 3KIPA 1F0KA 3A9TA 4X61A 2BH2A 2UKDA 4HEJA 3AB8A 4HVTA 1IN8A 3S2IA 3C85A 3WS4A 4BEVA 4TYNA 3KU4A 4EZIA 3QX3A 1SM4A 2BGNA 3UUFA 5LKAA 5KYKA 4JZKA 2TS1A 3CINA 2DSNA 1P0ZA 3TZHA 1DADA 2I4LA 4BIMA 4CI9A 4R5HA 1GTSA 4KRFA 5CNKA 2I54A 2OBBA 1BD4A 2GEUA 4GBMA 3JATA 3KTAA 4RYEA 5A8BA 1Z09A 2GJSA 2HC9A 3ONWA 1UFKA 2VEDA 3QKIA 1GA4A 1V8BA 3FDJA 4JHXA 4LRYA 3ZBTA 1GEEA 1QG6A 5E7JA 4C20A 3IE2A 4C14A 3NEYA 5KJFA 1K57A 2GJ3A 1XA0A 1XO1A 1P5HA 4TRRA 4EW1A 3EYAA 1O8CA 4ENSA 2D2EA 2P4SA 4HQLA 2FR1A 3LDAA 2GM4A 4XGNA 1Z4OA 1C9DB 3E22A 4LPSA 2A9KA 3SQLA 1UPUA 5JD3A 4TTAA 5JO9A 4A8JC 1TUBB 3AEQB 4MYDA 5KAPA 1CQIA 4XDGA 4D41A 1U0HC 1V5WA 3EGOA 1RAIA 3QH4A 1KOFA 5I9TA 1T3TA 1JA1A 3K96A 4Y2GA 4E22A 3IUNA 3T4QA 3LQQA 3SZMA 4BTEA 5CLIA 3JPYA 1SB8A 1R6TA 4XPIA 4XI9A 1DTWB 4E3LA 1T0HB 3DEKA 4QG7A 3K0AA 4ZC1A 3F3YA 3OCUA 4X65B 4ZYZA 5EN4A 2A9RA 1MC4A 1E3WB 1ZD9A 2B9VA 2O05A 1Q21A 3G9UA 3L05A 3NM5A 1G4AE 3HN7A 2AI3A 5AHXA 4DXAA 5F9MA 2ZC4B 1YMQA 4CE6A 5IM4F 3HCYA 1B16A 4KK4A 4NOJA 1Y28A 5JFTA 2Z2ZA 5EQTA 1IOWA 4DCMA 4C0KA 3IBJA 4DKIA 2IEBA 3KS9A 3K1AB 4INJA 1E89A 3RH8B 3KBOA 4NE7A 3D4LA 5MGBA 1OB5A 1NTOA 3WO0A 4ER0A 1QOPB 4IUYA 1AHPA 2FXIA 1TCVA 3K4QA 1KDRA 1SQ5A 3SIXA 1ZNQO 4HF7A 5ARBA 3GH3A 4KQIA 2HWXA 1S8FA 1UT8A 2B78A 3UPOA 1UMCB 2GH1A 3TJZA 4LDAA 1DBRA 4HGZA 4ZOLF 1P62B 2W2TA 4AP5A 2YWEA 3VHQA 4RTQA 3EEAA 4L57A 1SQFA 1ENYA 3ZCTA 5FAKA 2PA3A 1KYXA 1X94A 4HY3A 1G55A 4RIEA 5HIAA 2Q5OA 4YRIA 4LOJA 2BD0A 1X19A 2XI4A 5A4DA 4X63A 5ER9A 2OCBA 2QM0A 2R9WA 1AUXA 1JLHA 2D2IA 5JH7F 3ZDBA 3HDQA 4HG2A 1RJ9A 3IV7A 3I2YX 4W7SA 3NW9A 3ZTTA 2OUIA 2PZBA 1PCXA 2V7QA 3K1ZA 1QAQA 5FA5A 4BASA 2X22A 4DNQA 2VC2B 3IHAA 4NPAA 3GP3A 4X84A 1D7OA 1QH0A 3WFIA 4B2PA 5LU9A 4PGGA 4TKVB 2VP4A 1C3LA 3HUEA 3D8SA 3M2TA 3LHFA 5FNZA 4CL8A 1QH1A 3GBPA 1FU8A 2G4VA 3OLZA 4FEGA 4WK2B 1ZMRA 4ZQCB 5EJIA 3CUTA 1Q2UA 4H27A 5DXJA 4AT1A 1ONNA 2YMQA 2ZRLA 4HP8A 3I7JA 1PJZA 1XFDA 2EWWA 1RLMA 2Z3VA 3CS3A 1L5OA 1Q2XA 2A7QA 4E30A 1TEZA 1VZ2A 3JQAB 1Y1PA 3CGGA 5I8PA 1H0SA 3GLFA 3WS2A 4KXNA 4MOWA 4RSRA 4B6FA 1I7QB 2ARKA 1OW3B 4P4SA 1WB9A 3NUGA 3IP5A 3RVBA 5L9AA 2I3BA 4OLDA 4D99A 4IEDA 1P4RA 4X64B 3EIEA 3ICWA 3CLOA 3O1LA 4ZHQF 1J5EB 5DF9A 4QPJC 1TUBA 5E4JA 4I8DA 4O4HF 1KJWA 1YRHA 4DARA 3W5BA 3PX2A 4Z9BA 4A7PA 4MR8B 5K2OA 1CG6A 1D1TA 1TF7A 3OA2A 4M0LA 3RRNA 2PH3A 4DABA 3UPNA 3RSLA 2HF9A 1X14A 2AN1A 1TYDE 3AINA 2PS0A 5EINA 2CK3A 2YUIA 4CPKA 2V1ZA 4TSRA 1A5ZA 4EW7A 1W49A 2RL3A 2X14A 4FE3A 2VP5A 4WCDA 3DLTA 4XT2A 3ABRB 4DLUA 4IGAA 1ZZEA 1J1IA 1W6UA 4K6CA 5LA6B 1IYOA 2C4VA 3EIOA 1OV6A 1JWBB 2E3JA 1RP5A 2YXPX 3FPEA 4TMFA 1IN1A 2GSWA 1Z15A 3R3HA 1K08A 1ZI6A 3CEJA 3LEQA 3IV6A 3WDMA 5EM0A 1XL0A 4B88A 1N2EA 2NT3A 4K08A 1MR3F 2VIIA 3E7FA 4U2DA 2ZM5A 3RC3A 3WLAA 5HFAA 4CIDA 4ZVPA 1KHTA 4ILKA 2WUEA 1KAHA 3D7LA 4EF6A 5FEMA 3NGLA 3JR7A 3TSYA 5DNAA 3NRJA 1HNWB 3R5FA 1G3UA 3QX8A 4IMIB 5AVSA 4C4AA 1B2LA 1TM4E 3WRYA 2V1UA 5LXTA 1OWMA 2D0OB 4D8YA 3PFFA 3TGPA 4MMNA 2GFIA 4H7HA 1SVNA 1FLNA 4FMPA 3DWKA 1R37A 1RVDA 4TKMA 2AWOA 2FHSA 1TEXA 4JWKA 2ZIXA 1PK8A 1UGUA 1EVJA 5BSRA 2D5CA 5JZVA 2NWQA 2LB9A 1A1VA 1JDVA 2YXNA 4CVNA 4G5QA 4I1UA 4CTJA 3DWFA 3R3VA 3IURA 2ZRKA 1NY6A 4DCJA 2FETA 3B6MA 4LRTB 1KQGA 1R0YA 2WNSA 3AOEA 3K9HA 3WISA 3NIBA 3O3MB 4RKEA 1YHNA 1C0LA 3EZ9A 3DOFA 1I1HA 1L6RA 1NATA 2QRUA 4B3IA 1GPKA 5L3SB 3D2BA 4N1AA 5HPIA 3SS8A 1RCJA 4R4SA 1DDIA 5PGMA 1S2GA 4BBTA 3LHKA 4PWYA 3I2KA 4JMPA 3LVFO 4F84A 3BFKA 4GQIA 4MV6A 2AXEA 3IBCA 4JBIA 1U1GA 1EW0A 1UL1X 1E64A 2GLTA 1YSQA 1V8PA 1NKSA 2V7GA 1DJAA 2HPZA 3DW3X 3K5IA 3PHGA 1U4NA 5TEWA 4I1PA 4P34A 1EINA 1WM1A 1SCBA 4OXXA 2X2EA 3THRA 1FIUA 4F8YA 3HLTA 3A36A 3M0EA 2DERA 3S8MA 4NCAA 2V4MA 3HSKA 3IR6A 2BGKA 5AM2A 3LUPA 2PTHA 4L0QA 1F3OA 5FQMA 5JARA 4FWBA 3VO9A 4OGFA 4QJBA 1B00A 3GCZA 5CA0F 1CF9A 3JQ7A 1UDXA 1QV6A 2YQ4A 3FFTA 2JKRM 3BW6A 3HXMA 2M6SA 3O88A 4B4UA 2WKEA 1U8EA 2F8MA 2WUGA 2AZ4A 1N92A 4CT5A 2GZRA 2HJHA 1SKFA 2WICA 4JQSA 3FF1A 4TLEA 3MJDA 1M34A 1M2VB 2WJ4A 4WLUA 4EJ2A 3ZVLA 5EEGA 1VCHA 4IEIA 1GA9A 5KJ1A 3PGXA 3TSCA 4EM6A 4CM1A 1U2PA 4FEYA 2XB4A 5BVGA 3K0FA 4GYKA 1R6UA 3RYIA 4AFIA 4WXRA 4ICIA 1TVMA 2PH5A 4OKNA 4PG7A 3RRJA 1UPFA 5A3QA 1LTQA 3PYMA 1CUYA 3T3GA 4B9EA 5AKEA 3O9ZA 4UE6A 3F9IA 4KQGA 2NACA 3PQ2A 2JFFA 3DLPX 5KCMA 3G8BA 4Z9XA 4KXUA 3IQXA 3R2JA 2OQ2A 3DV0A 3X44A 2BMFA 4MAFA 5K01A 2CHGA 1SXHA 5IXJA 2HA0A 1Q0ZA 4PYRA 2W37A 3B6EA 4PYJA 4Y2QA 2CSXA 4WELA 4K1XA 5B1DA 3HABA 4KXFB 3ZQ6A 1L7AA 3IALA 1CRPA 2OB1A 3DBLA 3EXEB 4BEWA 4RDXA 3AUTA 4CIVA 3L02A 1WSWA 1V43A 2DHCA 3OI7A 4BNHA 4DDTA 4EI7A 3V7UA 3LLSA 4A8JB 1CEYA 1HKHA 1RI1A 4N5IX 4OHPA 3SI7A 2BZ1A 3P9ZA 3IVGA 4UTOA 2H29A 4YXWD 1E1CA 5FNVA 3GXBA 3N75A 3H3JA 1HMPA 1OD6A 3PLRA 4ZEXA 4ALIA 4BMDA 2DAPA 4RNCA 4J0FA 1R0LA 3D4OA 1VHTA 1WXWA 1FDRA 3FHTA 1LJUA 2QTFA 4WVFA 3WGOA 5BQOA 2EF1A 4J1TC 5CDTA 5JUWA 4CCYB 1CEEA 5D51S 1KFEB 3ECSA 4KQFA 1GNSA 1QYWA 1WMDA 2BIFA 2XNKA 3L7NA 4Y9DA 1BW9A 5HOEA 3LF2A 2HDWA 4HGQA 2O8VA 3K0AB 2QL9A 3AM5A 4UE3S 5JFGA 4PAOA 1U5CA 2CKMA 4HXEB 4ENRA 3GNTA 1LSVA 2IIPA 3IT0A 3MBOA 2ZJ8A 3R6LA 4JT2A 4MV9A 2Y1CA 3SMVA 1SEPA 4XYBA 4Q39A 2EBWA 1AKTA 3VR5H 2ISSD 1YR1A 5FQNA 2VCYA 3KYZA 2Z4RA 3C3WA 3M34A 3OJCA 1NGSA 4G1VA 4I7EA 5G4ZA 4REMA 5DM0A 2N42A 3RRBA 1S3IA 2JKYA 1U63A 5BT9A 3W4PA 2AX3A 3FOAA 4LHZA 1UFRA 3G35A 4MQ5A 4Y15A 3CZAA 3GAMA 4KQOA 5DSXA 1Z12A 3G0GA 4JS0A 4RJKA 2QRQA 4LW8A 1K0KA 4JQCA 2V8BA 4NQRA 4RFSB 1SEVA 4JYZA 3LX4A 4RSHA 2QZ9A 1S6RA 5ES3A 3GNQA 1M5TA 1MB2A 2E4WA 3L0DA 4W6QA 1CZKA 1I0LA 1DQZA 3G0OA 2I2BA 4LQLA 2X2OA 3AI1A 4FKZA 4HUQB 5DM60 4HDQB 4EY6A 1MXOA 2OCKA 2HD4A 3N6IA 2CNOA 3GDOA 4QD3A 4EH1A 3MWJA 1MUUA 2WHPA 2B92A 1M66A 5A6VA 3E2LA 1II0A 2ZR8A 3KO6A 3LR4A 3CWZA 4XXRA 3IP1A 3L7BA 4YWZA 1X15A 3Q1KA 4O4LB 4Q3DA 1GGNA 4WLFA 1OLXB 4W5WA 1GGJA 3FAZA 2I0FA 1CK3A 4UOEA 4YUYA 3EPHA 2LCFA 5JAHA 2VJBA 4PM9A 4ZCLA 4CF3A 3WYFA 2R5WA 3F5MA 3C6QA 3EQ7A 2AK2A 2FPMA 1LEHA 1YS7A 4GKBA 1V7CA 5ICMA 2B6HA 4N3BA 4OG2A 2NUPC 5GQSA 4BDSA 5I7OA 2ZB8A 3ESZA 3FCCA 1QGAA 4JX9A 3E4CA 3FRJA 4GF5A 1ZM7A 2GXQA 1S5PA 2REQB 4DLWA 4XEUA 1XJ4A 1JQDA 2XWJI 2LKDA 3BJMA 3CH5A 2ID8A 3T5CA 4QUEA 3BYZA 4UDYX 3WK7A 1KMHA 2WYIA 3N6VA 4PNZA 4OCZA 4NP6A 4K81B 1V4VA 3OWHA 1LD3A 2IYPA 2YVUA 1X1TA 3QNMA 2C7VA 2QLNA 1RAFA 4ACBA 3G2IA 1NF9A 4X1YA 2HRDA 4RQTA 2QRKA 3BCHA 2CUTA 1II9A 3L8FA 2XYVA 2DUWA 3F8WA 2WJYA 2AEEA 2WKRA 1CJBA 2R00A 3EC7A 4FE7A 3P0HA 4IZ6A 3EPKA 2ZC5B