2WKPA

Structure of a photoactivatable rac1 containing lov2 wildtype
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
320
structure length
320
Chain Sequence
LATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase, cell adhesion
molecule keywords NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
total genus 108
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2wkpA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wkpA02
3ZVRA 3QUSA 3QENA 4NTZA 5KSYA 1KO7A 3GLFA 4W5WA 1E2FA 4JL6A 5HZHA 4LRXC 2BCGY 1KIMA 1ZNYA 2H8KA 3TNFA 2VH5R 4WF0A 4C0BA 1FMLA 4AKGA 3V00A 2L0WA 4BFXA 2QJ5A 2JAQA 2J0SA 4KFTA 2ZRNA 1E1QD 4QJ3A 2R44A 4URZR 2CK3D 3K3CA 2BCJQ 3WMEA 3CRW1 4URVR 1NJFA 5JI3E 1ZM3A 3OLOA 2QROA 4BFSA 3AVUA 3A6PC 2H28A 2PR5A 1ZUHA 1OTDA 3M0EA 4MYUA 2IL1A 1XXHA 3AKDA 2B21A 4OHYA 1WCV1 4BFWA 1W7AA 5BQ5A 4A36A 1JR3A 4WVFA 2ZRLA 2BJVA 1S3GA 1VECA 1VG0B 2P3SA 4FMBB 1KDRA 4P4SA 1I4TD 2PR6A 1X1SA 3DDCA 1R5NA 4XH9B 1E0KA 1T5LA 5FUYA 1HQCA 3T15A 4IOLA 4M22A 4DCUA 5TB5A 1ANKA 3EZ9A 4RCZA 2KWIA 2XSZD 3SU8A 5FBVB 4PC3A 1XCGB 4I3AA 3BXZA 1MO3A 1II0A 1KY2A 1MRNA 5JSZA 3THYB 1TQ4A 4A8JC 1XX6A 4FI3C 2VP6A 3LQRA 3UK6A 1KK2A 1KDTA 1JAHA 3VOLA 1OT9A 1U99A 3PEUA 4DCSA 4E03A 3KKQA 1QHXA 5TXGA 2IXEA 3RNLA 4JLAA 5EFWA 5FPHA 4TSFD 3SOPA 1JR6A 3F5FA 4L16A 3I3SR 1KSJA 3KTAA 3OESA 4HAWA 3LA6A 4EQ1A 1OLOA 1R0XA 4P31A 1OH6A 2VLGA 3EAQA 3CF6R 2Z6DA 2RCNA 4S35A 3AF1A 4NYJQ 2JN7A 1T1AA 1KYIA 1P61B 4JZKA 3CRRA 4XSGA 5DLQC 4LYJA 2IXFA 2J7PA 1HYQA 3IQXA 3X1XA 3THWA 4RFVA 4BZPA 1F2UA 4NCJA 3KXKA 3OFND 3W8NA 3SE0A 4ZIRA 4LBVA 1UADA 2H5EA 3EXAA 1GKUB 2B02A 4EERA 2E1RA 2ZE7A 2O0HA 2BJWA 3KDSE 4XWOA 2XITA 3LD9A 1G7RA 1TUIA 2YWHA 1N25A 2EYUA 1XZQA 1FTSA 3AVYA 3T5DA 1YRAA 1VPLA 2PX3A 4MUAA 1F5NA 4XIGS 4C30A 2PCJA 1J7KA 3D6TB 4XD7A 3IHLA 3AKCA 4EETB 4RCYA 4EPTA 2QSZA 5E7IA 1N6LA 4KVGA 5F9FA 4KUOA 4TMVA 2YWGA 1P2VA 4Q7MB 3CIOA 3AF0A 2ZS7A 1Z06A 4JL5A 5EXSA 4G5GA 3H82B 1W4CA 2OEPA 5IF9A 2AKYA 5JWRA 2VPPA 4Q5IA 5TDHA 4AG6A 1S96A 1JBKA 4NYMR 4IEIA 3HPRA 4IFBA 4IHQA 4Q02A 2ECKA 2REOA 4HIAA 4KO8A 3WYAA 3BFVA 5AJYA 1NJGA 5FL7D 1FFHA 3FGNA 3Q7PA 3SYNA 3IIJA 2GJAA 5FL7A 4RD1A 4DUGD 2J3EA 3EARA 3IUYA 4RFSA 2OHFA 3CX7A 3IILA 3AV0B 1DAHA 2ZJOA 1XJ4A 1HT1E 1P97A 4M21A 5FBLB 1Z0KA 4TLBA 3LIEA 2ZIAA 4MDFA 1HV8A 2IF0A 3OEED 4U7DA 5HKKD 2QTHA 2ZE6A 4TN1A 5HSQA 3A1UA 3KJEA 4EDHA 2YOGA 5C46F 4BFUA 4RZXA 1Z0IA 1KO1A 3L43A 3U3KA 3U6KA 3SBEA 2PBRA 4QJ5A 2FJUA 3TUZC 1J2JA 5J4HA 4IRUB 2C99A 1NMZA 5L3SA 3CNLA 4LPKA 3EEHA 4DXAA 2BOVA 1LFDB 1FP7A 2CJWA 3H1TA 2PDRA 4IKEA 1TEXA 3SZRA 3DM9B 1OFIA 1U9IC 3K9NA 5GJCA 4FW9A 2PD7A 1YQTA 2QRZA 4YLGA 4MH0R 4PQYA 1YJ5A 2D3WA 3ZQ6A 3QF7A 3HWSA 3MSXA 2Z5FA 3PFIA 2CBZA 2V9PA 3REFA 3DMDA 4KJZA 1OW3B 4PFSA 4BUJA 2ZE5A 1G64A 2LKCA 5DN6D 4OQFA 4KODA 4QOSA 4XVQA 5FL3A 3EX7C 2QGZA 4QXAA 2RGDA 4Q4AA 4ZDJA 2FFQA 5J4VA 1NN5A 1WXQA 4R70A 1N5JA 1Z63A 3FPAA 2ANCA 5HKKA 5EE5B 1W2HA 4XJXA 2R6GA 3RS7A 5DIFA 4V03A 4KXFB 2PYRA 5FUVA 3UMRA 1W0KD 5JWHA 1LY1A 3IPXA 1Z0DA 3A4MA 2WHXA 1NP6A 1F60A 1R6BX 2FF7A 2C77A 3U7HB 3KQLA 5L3QB 3U3JA 4OK5A 2ODBA 4F4JA 2IS4A 4WN5A 5K8UA 1FL9A 2IYZA 1BMFA 6Q21A 2R6DA 3GJ6A 3LRPA 2B7CA 4WXPA 5DH9A 4EKDA 1BMFD 3GJ0A 4IDPA 3TGPA 5SZKB 2CL7X 4Q1DA 4RZ3A 1CRQA 2JIZA 4OQLA 5JSZB 2AD1A 2C78A 3THYA 5DYIA 1EFRD 3RSLA 2QWSA 2FPMA 4A2QA 1D2EA 5H70A 4ZCIA 1OB5A 5KDOA 5DE3A 5J47A 4YMWA 3KXIA 4KSCA 1AZTA 1M34E 4W9MC 1QHGA 3MQOA 1TUEA 3O8DA 5CJ2A 3VR6A 2R65A 3L8ZA 4MUBA 2YWEA 1OYYA 3FMPB 3LV8A 3VHXA 2LKDA 2P5TB 2J0VA 3I61A 3WXMA 2ZRMA 3KUCA 2GESA 3R9IA 2ZEJA 3U7FB 5AVEA 1VDZA 4XTCS 3VX3A 1Z29A 3H0KA 3NHAA 3TW8B 3L0IB 4M0LA 1GM5A 4UJ5A 1GZSA 4NZYA 1VHTA 2ODEA 2VO1A 3GDIA 2GTPA 1DVRA 3O8BA 4GRAA 3O8RA 1SXJB 3WBKA 4NXEA 3FC7A 1RE0A 4D0NA 1N6RA 3GJ4A 4Z1MA 1XMSA 2IYWA 4CT4B 5DKKA 2QMUA 3FWYA 2RH5A 4XD7D 3SJCA 4FCWA 4CGZA 1KSHA 1M8PA 4I1UA 3DL0A 1Z6TA 4YXWA 4D80A 4AKHA 1W4AA 1DARA 2SHKA 3C7KA 3AVVA 1Z2AA 1XCPA 2W2TA 1W47A 1JJVA 3IDQA 3OEEA 2J45A 4G1UC 2D4HA 2INWA 1OT6A 1IY2A 1DAGA 1ZINA 1YZTA 4FMCF 4NXFA 1KKLA 2VLIA 4E04A 1YZGA 4HY8A 1CULC 1GIAA 1Q22A 3UPUA 1Z6GA 1Z0JA 4XWAA 3NOTC 2VBCA 1JB1A 2ZJAA 4NKRA 2D62A 4K08A 3VQTA 4GL2A 2NZJA 4EXOA 3NVAA 3M1IA 3IHWA 3WHLA 1QZXA 4TTQA 2H17A 1AQUA 3MFYA 3NBZC 3AVXA 4EPRA 4AKIA 1U94A 4I1SA 2FG5A 2CVFA 1T1CA 5K8TA 1N9LA 3HU1A 4C0QC 3I73A 2HYDA 2R62A 1E3MA 4DIEA 1E9EA 5J7EA 1SXJE 1NIJA 1TS6A 3EWSA 2DB3A 1FNNA 1DP9A 4R2IA 1ZM7A 3FTQA 1F98A 3PUWA 1CJVC 4AWXA 4FIDA 2NO0A 3CZPA 1G7TA 1KOUA 2DWOA 4PC2A 2P65A 1US8B 4IDOA 2ZYVX 5CLQA 3C14C 3K70D 2ZYWX 4JLNA 5CB6A 2YC4C 2ERXA 3K0EA 1W0KA 3EPLA 4QNMA 5E3HA 3PXGA 1KSFX 1LL8A 4MRVA 5AJWA 1ZIOA 1GSXA 3B1WA 1IHUA 4GOJA 4R9UC 1E6CA 4NYIR 2BKUA 4HSEA 4MQBA 1UEIA 1XF9A 3V4RA 1KK3A 1MT0A 5E7JA 3RS3A 1RPZA 1PV4A 5HWTA 1HTWA 2CE7A 2AD5A 2C9OA 3KB2A 1CJTC 4QL3A 3NOUC 3UMFA 4R6LA 4B33A 5C4MA 1RVDA 4PANA 4GDFA 4DLSA 1Q21A 2BKEA 2W6JA 4GPTA 2ZR0A 2JJ2D 3HJIA 1OYWA 3K09C 1G8PA 4LJ5A 2GJKA 3SN6A 3T1OA 5BW8A 1PVOA 1D2MA 4KLZA 2ZU6A 4KFSA 3TLXA 4PHTA 1OTBA 3M6AA 2Z83A 2WSMA 4A6XA 2IYUA 2RGAA 2DFKB 4A0HA 3BB3A 2B7BA 1CJMA 2Z0MA 5EXXA 3QKTA 4R98A 4C0KA 5L3VA 4UNPA 3KFVA 3UXMA 2FN4A 2O8DB 1DAFA 3B1YA 3CPJB 1S2MA 1ZVQA 2CHGA 2QPOA 2A24A 2D74A 2PZGA 2VP2A 3QJYA 4B6EA 5KYKA 2O8CB 3GFTA 2IYLD 4LHYA 5E7MA 2R2AA 3VR2A 3K70C 2UZ3A 5BXQC 4L9FA 2BV3A 1S9DA 4JBWA 1U0JA 1TU3A 4U5XA 1OXSC 1R0ZA 5AJVB 5IK2A 3WRXC 4TZ6A 2OE2A 2JJ1D 4RQ9A 3CX8A 2BBOA 2A30A 4MGIR 4A4DA 821PA 4DUGA 3NBYC 1Q3HA 3DHWC 1WRBA 4HDCA 2BBSA 3F1NA 1G9XA 1KK1A 2WWWA 1XJ3A 2WSSA 4PHHA 4V0NA 4WOPA 2XB4A 3U2QA 4C0JA 1C9KA 5AWFC 1HH4A 1ODVA 1ZJ6A 3TBKA 4FINA 4DCVA 1DAIA 4OHWA 5HR5A 3EA0A 3PUYA 4F92B 2V6JA 4E09A 2H57A 4OQMA 4AK9A 4JKYA 1GILA 2OFOA 1VG1A 5LPNA 4DB4A 2O8EB 2I9VA 1IXRC 2HCBA 3P4YA 4B44A 1FQKA 4R71A 5A5GA 5CITA 2GDJA 4D4LA 4NCNA 4NU0A 4TMXA 4EW7A 2WSSD 1LS6A 4HP9A 1AQYA 2IS6A 5KOYA 4C4PA 4ZV4A 2IA5A 1TS7A 1Z47A 4OK6A 3I4LA 1HE8B 3QKSB 2JLRA 4PQRA 4LX0A 2YZ2A 4PXAA 2I1VB 2DWPA 2PHYA 1UDXA 4DBLC 4TMKA 1T3LA 1F2UB 3R8FA 3C15C 1TPZA 1N0UA 3TE6A 2ASEA 4HEJA 1XJQA 3ZZUA 4WXRA 5SZHB 1SXJC 1II9A 2PX0A 2YKFA 4GNKA 4ASUD 3W6NA 5LD2C 1VIAA 1P0ZA 2BASA 1LF0A 2CLDX 4CZ2A 1S1CA 4HLUA 1UBFA 2F1JA 2FFAA 2D2FA 3EIQA 3LXRA 1Q3TA 1N0WA 4TLAA 1V9ZA 3I62A 4KQDA 1YZNA 3B78A 3EW9A 2ZSAA 4Q48A 2O52A 1NLYA 3F8TA 1C4OA 1RJ9A 421PA 1IY1A 2PL3A 3QXJA 5L3RA 3SEAA 1T1BA 3LW7A 1UBCA 4NXGA 3B9QA 3LH5A 4CYMA 4Q1BA 2ZRHA 1E2DA 5AJXA 3SQWA 3X2SA 2ZAMA 2BEJA 4B3GA 3LW8A 3ZZTA 4DJ2A 1OXVA 4I1VA 2VHQA 4P32A 2X77A 3CRQA 4BWYA 1OH5A 2OFWA 2PZEA 3K0AB 4XTRA 1FOEB 5DN6A 4PZYA 2XEXA 5G40A 4II7A 1YE8A 2ZBBA 3FHOA 2WTUA 1DAKA 3ND8A 3P4XA 5JEDA 1DRMA 2AN9A 1D6JA 3CWZA 1O3YA 5G3YA 4GI7A 5HWVA 1KGDA 4TLDA 4PAQA 3MJHA 2ZU0C 2EYQA 1J70A 3GJ7A 4JT4A 1S1ZA 2QE7D 3W90A 2JDID 2R8RA 3C8UA 1CBUA 2IS2A 2B6HA 2AK2A 1JR3D 3T34A 1YR6A 5F6AA 4WZAE 3R7WB 1CR4A 1UWPX 4K81B 4YMSA 3SJZA 3B33A 2KB0A 2G0NA 1E4VA 3CF0A 1Q20A 2CCGA 5DO9A 2BVNA 2GKSA 1V43A 2CNWA 1GUAA 2I3BA 2CMKA 1LT0A 1KI9A 4M9QA 4BEJA 2XJ4A 3IGFA 4Q4LA 3ZQ5A 1Q1BA 2GZHA 3NDBB 3JZAA 2HT6A 2XZLA 2AX4A 3K9LA 2P0EA 1R0WA 2RAPA 4A0FA 1ODFA 3W5IA 1HUQA 3H7WA 2VP4A 1IQPA 4BLPA 5H68A 2O8DA 3TR5A 2EQBA 1WB9A 1XNJA 3QKUA 2O8FA 4PX9A 2ZTSA 2G9NA 4TYQA 1OKKD 2QMEA 1SULA 1OKKA 1ESMA 2GF9A 3KX2A 4MKGA 1E0JA 3LYXA 1UFQA 1J8MF 2XGJA 4DC9A 2ZJ5A 1TS8A 2OILA 2A5GA 4URUR 1ZW6A 4Q19A 2JLYA 4ZDWA 2G0TA 2WJVA 2F43B 4JLDA 1ZU4A 3DM5A 3GLHA 1XZPA 4AURA 3T50A 4EAQA 4O25A 4R3AA 4B34A 3B13B 2PEZA 5CIWA 1Q57A 4BPBA 4K46A 1X3SA 5DSZA 1UGUA 1K6MA 2PH1A 5FTJA 4CT5A 1D2NA 2GAAA 8OHMA 3GQBA 4NONA 1DTSA 3A37A 5AR1A 1PUIA 4V0OA 5FTKA 3T06B 2ZRDA 3UWKA 2OAP1 4DJTA 4MN6A 3RRMA 4C0LA 3TR0A 1NY6A 4HJ6A 1GNPA 2EU8A 4QGGA 4L8GA 3WMFA 1UWNX 4A6PA 3UMSA 3W3AA 1NN0A 2ZI3A 3GLHB 3OE7A 4P0TA 2AFHE 4Q1EA 1BO6A 5IK2D 3ZVMA 4M1MA 3BOSA 4GCZA 1XCMA 1GKIA 3DPUA 5TBMB 2GZDA 1C1YA 2RB4A 3VNVA 3MJQA 4BZQA 2R6FA 4MYHA 2HJGA 4M9ZA 1N9OA 4O2LA 5FUWA 4IOMA 3IPYA 1OB2A 2MSCB 1OH8A 4ACBA 4H1VA 4IJMA 3WHKA 5GJWC 1ZM2A 1AJEA 3PQCA 1EWQA 3LBNA 2CCKA 3C16C 4MRRA 3U4QB 2O0KA 5EJEA 1E9AA 3G6OA 1E1QA 1M7GA 3Q5EA 2QAGA 2M1CA 2RGCA 5EUMA 2VEDA 3DZ8A 4GZMA 4BLRA 2V1XA 3P20A 2DFNA 3K0SA 3W8RA 1RFLA 2XTMA 4Q7JB 3RANA 2G1KA 4JMPA 2GEVA 3U60B 1O87A 3QXSA 5CYOA 4IEEA 4DT1B 3A1TA 5FTNA 4BE7B 3GLIB 1Z2CA 4C7OA 3V4FA 5J4LA 4NPHA 4V0LA 2FGJA 2JLQA 4IVQA 3RABA 4FN5A 4CDGA 3BE4A 5J4EA 4DLWA 1H65A 2ANBA 5KNDA 2ZVQX 3LBIA 3IQWA 1BYIA 3NJAA 4OHVA 2OCBA 4UNQA 4NYMQ 4PC1A 3T1QA 1G28A 2NPFA 3B2EA 1P3JA 4JYCA 5B30A 1A5TA 1CU1A 1FQJA 1GWNA 2IBMA 4LBZA 1Q44A 1KJYA 2RGGA 5IT5A 2VIIA 2ZS9A 5IDVA 3RWMB 3W5JA 3I1FA 3VTKA 5DHFA 2GHIA 1UEJA 2XZPA 4M9SA 2I1QA 1M7HA 1W5SA 3DVLA 5KIZA 1GVNB 3CRMA 2QTVB 4LJ8A 4I38A 5IHPA 2WWYA 2KBEA 2ZJYA 1D9ZA 5FBRB 2QJ7A 1QRAA 1S1MA 5SZJA 5DJTA 4IW3B 1N9NA 1CS4C 4B3FX 2IYVA 2XNSA 4KUKA 1A4RA 1SQ5A 3HPQA 3RSOA 1WBDA 4TL8A 2Q3FA 4B48A 621PA 1RZ3A 5F3WB 4V0ME 5CM9C 2AK3A 1W1WA 4PZZA 2DY1A 4DSNA 5HDDA 3S1AA 3K0FA 2OCPA 4CW7A 4BFVA 3SFZA 2ZS8A 5DI3A 2F55A 2ZRIA 2C98A 1JNYA 5EXTA 4URWR 4NYJR 3BGWA 1ELOA 4LOAA 4EIWA 1Q0UA 1Q1ZA 3CZQA 1OHHA 4B2PA 2ZJZA 1QBKC 4LWZA 2ZRGA 3ADBA 2Z43A 2OFXA 2HXSA 3CPEA 3P26A 4PC6A 5JBQA 1AIPA 4NBSA 4D26A 3ZGXA 1KDOA 2GA8A 1U81A 1NG1A 3B6EA 2Z4SA 4B3BA 1BH2A 1CIPA 2E9SA 4GMDA 4QFMA 2OAQ1 2IWRA 2YC2C 4YMVA 4LHVA 4B2LA 4YDHB 3C5CA 4ZI3A 4KVAA 2Q3HA 2IHYA 1IOZA 2DFLA 2CEAA 2WWGA 3UE6A 3BD9A 4UNSA 1M7BA 2GXUA 2RGXA 5JZVA 2QM8A 4PO9A 2K5UA 4HAXA 3FKQA 2KX6A 4LV8B 5D3MB 2CVHA 2AHOA 1X86B 4QNRA 4B2IA 1DP8A 1L7VC 2VF7A 4A9AA 1TADA 4PPGA 4L9GA 1JPJA 3BBPA 5JCZA 4DRZA 1FUKA 2F6RA 1E2GA 4UXHA 3MG9A 2GK7A 1XMVA 4KV9A 4PSKA 3B85A 3K3DA 2IYTA 4TLCA 3VE4A 4EQ6B 1LNZA 3U7EB 1YHNA 3KUDA 2IC5A 4ZPXA 4JLVA 1JXMA 1KHTA 1GL7A 1YR9A 2JASA 2RGNA 5J3WA 5F9HA 2WKPA 4HJ3A 1CJKC 1VCMA 3HDTA 4ESHA 4A2PA 1N6IA 1VCNA 4LZZA 1WF3A 1OPXA 4EJSA 2ATVA 1NN1A 2JGNA 2ZVPX 3GLGB 4BFYA 2HT1A 2BMFA 2J9RA 5F69A 2ZJ8A 4NCKA 2XTZA 4AYXA 1AGRA 3RH8B 1QF9A 4M1YA 5JI2E 3TAHA 1ONBA 4ARZA 5KDDA 3TUIC 5FR2A 4CEHB 1KI4A 3QQ5A 1NVWQ 2Q9BA 4JLMA 1BOFA 1ZD1A 1GOTA 3I92A 3FMOB 3F3YA 4R7ZA 3VU9A 1X0OA 3AB3A 5FOXA 4A2WA 4KLNA 1XD2B 4I99A 1U8YA 2AR7A 4O3MA 2X8AA 3RS4A 4DDTA 2G1JA 2IF2A 1NF3A 2QT0A 4IXMA 5JLJA 3B9PA 1XJ0A 5DI3B 2W0MA 4CVNA 1S4RA 2V6IA 1UDWA 2WPDD 2ERYA 4HLQB 3I72A 4HZUA 3GJ5A 4WBSA 2ZRPA 3AP3A 1G4AE 1MKYA 2F1HA 3BH0A 3EZ7A 3FFBA 1KZGB 1OF1A 4G5QA 4JL8A 1COWA 5CJPA 3H9WA 4WW0A 4BFZA 2JEOA 3VFDA 4LK2A 1MV5A 4RD3A 5EP3A 2CK3A 4YONB 3R7WA 1S3SA 4XVUA 1MO5A 5EE3A 4GP6A 2W2VA 5BN3A 3A1VA 2LWIA 2C9CA 2R9VA 1NMYA 4A15A 4HP4A 1SVIA 2PZFA 3K9GA 3WNDA 5GVSA 1GAJA 3KTAB 3TVDA 3OIWA 1U90A 1CRPA 1F9IA 4L15A 4B3CA 1KDPA 2X2EA 1TEVA 1XEFA 4JVLA 1UKZA 1KMQA 1XB2A 3X1ZA 1KMHA 2RHDA 2QENA 4KSBA 2NGRA 1CEEA 1H8ED 3FE2A 1I2DA 1HQYE 4DLXA 3T12A 2EFEB 1SGWA 3IEUA 3NTUA 4BLTA 2VTKA 1SKQA 2V8OA 3BERA 1KNXA 3U5ZB 5H1YA 1SVSA 1OTEA 4URYR 4Z54A 4GHIB 2GILA 1XU4A 2V54A 3CB4A 1U98A 2CHQA 3K53A 2FU5C 3DOEA 1E9RA 4PKYG 3KQHA 3K09A 3LBHA 2L0XA 3ADKA 1BS1A 2V9AA 1E2EA 4L5BA 3GEIA 3K0FB 2JIZD 1N6HA 5AVFA 4M53A 2JLVA 1DG3A 3T35A 4PTLA 2EFHB 4D81A 1KJWA 1OH7A 3EG5A 4L9WA 1E79A 5B2ZA 1GP2A 2ZSBA 3KL4A 4MDEA 4EJSB 2VSOA 3AKYA 4Q9HA 2GJ8A 4JSYA 2JLSA 1QHYA 4PAMA 3AF4A 3MGCA 3QOFA 2XNDD 2YHSA 3H82A 1W36D 3H7WB 4TLEA 2PT7A 5AUPB 4JIMA 5FBWB 5TARA 4FWTA 3B82A 2VHTA 1W5TA 2Z6VA 2QSYA 1XMIA 2WMOB 4M1OA 4HB2A 5KDLA 3TVTA 1SXJD 3SJAA 4I5SA 4ESVA 2KI5A 3WY9A 4FWIB 3ICEA 2J7KA 1OFHA 3U7GA 3R8CA 4PPFA 5HE9A 2ZQ5A 5EE0A 2BM1A 3GCGA 3GD7A 5K8LA 2IHBA 4QJ4A 1FZQA 1G3RA 3GEEA 3PEVA 5IS1A 4RFSB 3HR7A 4L4UA 1XJ6A 3VAAA 3NBFA 4Q9KA 3HYTA 5G4YA 2QP9X 4Q01A 4ASUA 4UQOA 1UPTA 1Z5ZA 1QG2A 3GP8A 5HWWA 4Q00A 3SW1A 4HH2A 4UXJA 4DCTA 2OCAA 2GCPA 1KJZA 2QPTA 4EFLA 3E70C 1EXMA 1G5TA 2A9KA 3GJ3A 521PA 1E2LA 3W34A 2QL6A 4XT2B 2AKAB 3HJNA 1KO4A 3ECCA 3KKPA 1S4SA 1S1YA 4HUQB 3R9WA 1E2MA 1RRFA 3IIMA 4LYAA 2QKPA 4NHOA 3ZZ0A 4LJ9A 4NXBA 2F1RA 4JLBA 5EE9A 1NLZA 1XEXA 1Z07A 4EEUA 3DO6A 3UB8A 4B35A 2BC9A 1XD8A 4O0MA 2WJGA 3L8YA 4G5RA 3QG5A 4UKDA 1V9YA 2NQ2C 4RSGA 3IS2B 5AK0A 2GVDC 1IJEA 5C4GB 4IOJA 3OIYA 1OTAA 3KQUA 4D25A 4TWZA 2P6NA 1H8EA 1XD9A 4M2LA 1AS3A 2W6IA 4QGAA 1OT3A 3SFVA 1P9WA 3A58B 3AH8A 1XTQA 3FVQA 2C9YA 2JJ2A 4ON9A 2V1BA 3PIRA 3UATA 4QM6A 1NWZA 3LY5A 5HE8A 1ZIPA 4KFRA 2YKHA 5GJVC 5HCIA 4DLYA 4F91B 4XSHA 3CWFA 2QA5A 4PQFA 2PMKA 1S9HA 1OXXK 2ZR7A 1NVUQ 2CLCX 3NHQA 1E9CA 2QAGC 3WYFA 5DJUA 5A8BA 2IEZA 2WBLC 2PJZA 2KBFA 4TSFA 1EGAA 1YZLA 1KK0A 1RW4A 3EZ6A 3NKVA 1ESNA 5FOWA 1DAMA 1E9BA 5JRZA 4JT2A 1AA9A 4B76A 1CLUA 1L4YA 1DO2A 2WM9B 3K1JA 2QQ0A 3A4NA 3C2WA 2WJJA 2P2LA 3P1JA 3X1DA 2VEAA 4RZUA 3BWLA 1UKVY 1QHHB 4K8OA 2CL6X 1G3IA 3M4YA 1VHLA 2OBMA 2YOFA 4FMDB 3RLFA 4F93B 1US8A 1P73A 3I8SA 2WWHA 3BRWD 2XTNA 4KYIB 3BH7A 3R9XA 4TT3A 1I2MA 3P27A 4HLUC 1BYUA 1E2QA 4C9BA 4WZBE 3SR0A 5DKLA 4NYIQ 4Q47A 4TTPA 1B23P 5F5YA 1E2HA 3NBXX 2NPIA 1BIFA 1XTJA 4YMUA 2PT5A 3H86A 5KPJA 2HV1A 1ZD9A 2ZSFA 3BS4A 3VE3A 4WLAA 2W0NA 3RRYA 1VG8A 4LGMA 2R6AA 4CIDA 4D82A 1W49A 1UBGA 1XPOA 1CR1A 4M1WA 4AG5A 1VMAA 2G83A 4GZLA 3U3MA 2HLDD 1I4DD 2F3TA 1ZCAA 4TTRA 1YU9A 3QE0A 1OXUA 2FZ4A 2PLRA 2ZI4A 4F7WA 1LF5A 1EX6A 2GXQA 1LB1B 1T3SA 4KCGA 4D6PA 3EIHA 1S67L 3TKLA 1OFUX 2ORIA 5E4FA 1LS1A 2BIFA 3D8BA 3PUVA 3GFOA 1R4AA 4Q9IA 4EQ6A 3ETLA 2FEMA 4QHSA 3KXLA 4B47A 2HJVA 2ZE8A 1VKJA 4JLOA 1TNDA 4U00A 1GDDA 1DP6A 2JATA 2ZYUX 1XEWY 3MRSA 2OLKA 1G7CA 4TQ9A 2JJ8A 3QKRB 1G291 1R5BA 3QVUA 2DCUA 3OZXA 4M1SA 4EUNA 2OBNA 4IDHA 4ERNA 3HP1A 2B8TA 1S4QA 3VKHA 1M74A 5B58C 2BM0A 4JGQA 2D06A 4FXPA 4QG7A 1WDTA 4DIDA 3FMFA 2GWHA 2HF9A 2UVQA 4HLDA 4FD2A 1Z83A 4YMTA 4ZDKA 4CEIA 2D02A 1M6NA 3KJHA 2PCLA 2VV6A 4DZZA 3EPJA 4B9OA 4PAOA 2HV8A 4M8NE 1N6PA 4HHDA 3CO5A 3BB1A 5JFGA 2ZRJA 3LNCA 3FHCB 4V02A 2XSZA 5ANRB 1R7RA 1W36C 2NZ8A 2A78A 2GJSA 4B32A 4G0NA 2OWJA 1TQ2A 3C4JA 5F98A 2PMDA 3RVBA 4P4TA 1GG2A 3UMDA 4XT2A 2QEQA 1T5IA 4YWZA 1WE2A 4MYTA 1DE0A 1DG1G 3DKPA 1X8LA 4RZ2A 4DLTA 3QKSA 1GSIA 4I3JA 3BB4A 4LLOB 1P9NA 1UF9A 2AXPA 2F7SA 2GEUA 1OIXA 2J0UB 2QNRA 2WJIA 3EZ2A 3GMTA 1RIFA 1TAGA 4UNNA 1NVVQ 4W7SA 5F68A 4A8JA 1P9RA 4HI4A 3CH4B 1MOZA 3K0AA 1QVRA 4OHXA 2FSFA 2N46A 5DGXA 1FP6A 3MR0A 2IYYA 5FI1B 2J7PD 1EESA 5JCPA 4IDQA 1ZMXA 1LW7A 4LRZE 1NIPA 4X8LA 3PJRA 4WZ6A 4V0KA 3QXXA 1U9IA 1MRSA 1ETUA 4C0AC 1AS2A 2YNMA 4FCVA 721PA 4D4JA 2CL0X 2CMNA 5H8WA 2V0WA 4Q18A 3NH9A 1NSTA 2XX3A 1P6XA 1TTTA 1ZNXA 3BFXA 4D0LB 1E0AA 1HE1C 3DMNA 1JEDA 1W0JA 2C8VA 5CYPA 3AVOA 1ZBDA 1RJ9B 3QPWA 2A24B 1IBRA 1N6OA 3CF2A 3SHFA 2EA9A 4TYYA 1E79D 1X8JA 3HU2A 2OZEA 3L2OB 4U02A 4Q9JA 3NH6A 3OFNA 4M1TA 4QC2A 2CNWD 1R2QA 3C5HA 4BRUA 1VYUA 1P5ZB 5B64A 1OHHD 2QN6A 1CKEA 1ZUNB 3U44B 2J46A 2MSDB 4FMCB 1YZUA 4RJLA 4GFDA 3LVQE 1NL3A 1E2NA 2JDIA 1R10A 2O8FB 2QUZA 1RRCA 3RS0A 1E99A 3LLUA 4P4SB 4QHTA 2C95A 1ZP6A 2IX3A 1G7SA 1RC8A 1S0UA 2DR3A 2FA9A 3I5XA 5FBQB 4OL0A 1FX0A 1OIWA 3E4QA 1F6BA 4Q9LA 5M04A 1KAOA 1JNUA 2OO7A 1ZC4A 2QQEA 4TQAA 3IEVA 1R0YA 1XP8A 2GVZC 3DKVA 1S66L 3LQQA 4S2EA 1YR8A 2ZANA 2ZXUA 2ZRBA 1KI1A 1G3QA 5BWMA 4JBYA 1W4BA 4LJYA 2H16A 2ZOIA 2GJ3A 2P5SA 3E4PA 1KNQA 3QXHA 3SHWA 2E87A 3PR1A 1QHSA 1QG4A 1KTVA 1YVDA 3RWOA 2BHRA 4DEXA 1K5DA 5I5LA 2YWFA 5C18A 2VHCA 1IXSB 4AKEA 1G3UA 1KO8A 4MKIA 3IBRA 5FUXA 3F1NB 3UB9A 1JALA 2C5LA 3KKMA 1LSVA 1P62B 2J80A 1JPNA 4LYHA 1E98A 1DOAA 2ORWA 4MKFA 5HCNA 2GBLC 3NXSA 3EWAA 3T5GA 3RC8A 3OF5A 1QVAA 3ONWA 3HJKA 2GCOA 5FOVA 2EFDB 1XFNA 2OOLA 5AJZA 3K0CA 1G1MA 4MRNA 1G8YA 3DEFA 3Q5DA 3KJGA 3CLOA 2HYIC 3OEHD 2ZUBA 4HZIA 3MQQA 5HDSA 3UB7A 1X8KA 4DEYA 4YC7A 1ZAKA 1K8RA 2A5JA 1U2RA 1VCIA 5FOSA 3TH5A 4V0MA 4BQSA 3A4LA 4NH0A 3WP0A 2ORVA 1YKSA 2ZSDA 1P2UA 3QPVA 4H6JA 1EFTA 1NKTA 2OM2A 4HAVA 3PV0A 4US2R 5G3ZA 2VHJA 1NLFA 4AIIA 1XBTA 2QAGB 2D2EA 3QSYA 4LBWA 2JLUA 4DJ3A 3OAAD 4KAXA 2ZETA 3B60A 1TL7C 1S8FA 1E1RA 5LB2A 4Q7KA 4CEHA 5G41A 2DWQA 1CF4A 4G5OA 1NMXA 4QGFA 5J40A 5E95A 2QAJA 2BBTA 2X2FA 3CW2A 1NBMD 2QU8A 4R38A 4GBMA 3QI2A 2IXGA 4IVPA 2FGKA 4CF7A 3PEWA 4LJ7A 4OJQA 3VU9B 3CNNA 4I39A 3THOA 2W00A 4JS0A 2JLZA 2ZUDA 3QF4B 3A0SA 4C0SA 4LHXA 5KO2A 4DB2A 2PYPA 3GJ8A 5FPYA 2G77B 5JWOA 3PITA 4LHWA 5FTLA 2EVWX 3ZJYA 4Y0VA 2O8BB 221PA 4US0R 2WVJA 1HURA 1FNMA 2OG2A 4LDJA 3OHMA 4JVNA 2GK6A 4I81A 2ZROA 4M4SA 3GLFE 1NRJB 1COWD 1EFRA 3N70A 1OV4A 1VG9B 2JHEA 5CLLA 5DYGA 1VIYA 3F0TA 3G5UA 3TSZA 2J1LA 5AUQA 3EA5A 1D8TA 2OESA 1VTKA 3KFXA 1Z3IX 4BLQA 1TF5A 3KJIA 3PVSA 4HB4A 4M1KA 4YQFA 4ZKEA 4QHYA 5EP2A 2QORA 5TVKA 3L0OA 4TZ0A 3B7GA 3LX8A 4US1R 1LSWA 1QHIA 3SBDA 1XPUA 4NP6A 2QY9A 1TU4A 1EG7A 2VV7A 1JQJC 2QZ4A 3VR3A 2WWIA 2YVUA 1BYWA 2J5XA 2N42A 5JS7A 3E4OA 4PR0A 2FEOA 4OKSA 4ZCMA 4M9XA 1UKYA 1FPMA 1FW6A 1OSNA 2EW1A 3CR8A 4H1UA 5FPSA 4P4UA 2FPLA 2WMNB 2IK8A 4PZLA 4DKXA 1P72A 3SS8A 3D72A 4OI0A 1XWIA 1Z28A 5HD3A 1L2TA 2H92A 3QPUA 4LUCA 2QMOA 4OQXA 4C3ZA 2HCJB 3TRFA 2JLXA 1OE0A 3FMIA 2WOJA 5FOUA 4MRPA 2W6JD 3JVVA 5L8VA 1RRPA 1Y28A 1G3MA 1KOFA 1PJRA 1AZSC 2EWWA 2FFBA 2IUTA 3SJBA 3CH5A 3D3QA 1A82A 3CKLA 3IBYA 3LFUA 3NEYA 3TQFA 2VQSA 5DISB 3PHYA 3SC3A 3ZH9B 4LV5B 3FOZA 4MGZR 2HUPA 3QEOA 5EXPA 2ZI6A 3VX4A 4KFUA 1P60A 2GJ9A 4PO8A 5KHOC 2H18A 2F3RA 1T91A 1UM8A 3RYTC 2A7QA 1R8SA 2ZRKA 3K0CC 1DS6A 1OJLA 4WIAA 3NIBA 1G5PA 1E2IA 3TQCA 3ICYA 1XEXB 3LWNA 1U8AA 1G8FA 1WQ1R 5BN5A 1IN8A 3KB1A 4F3LB 1P2SA 1F3OA 1IN5A 5L3SB 2W0SA 2GAOA 2IYQA 3ADCA 3E2IA 5CM8B 2XAUA 1HY3A 3BH6A 4DHEA 3NC1C 5JJIA 1MABA 3OEHA 1A1VA 1RKBA 3EIEA 4Q4JB 1XTIA 2PLFA 4HDQB 1Z22A 2NOAA 1NBMA 5JJKA 1RYHA 1E2JA 2J59A 4GP7A 3CM0A 2V55B 3AUYA 3MWJA 2FSIA 4L9EA 2ZRFA 4QBFA 5C1BA 4C7OB 2OXCA 3DZDA 4A0GA 4HUTA 4N1AA 1GSVA 3RS2A 1DAEA 4UJ3A 1P7CA 3OAAA 4RVCA 5FOTA 4IVRA 2FSHA 4WA7A 3WRYC 4F3LA 1FMJA 5JEEA 3DOFA 2FNAA 4GOXA 5FPTA 3WNBA 1TX4B 2ONJA 4B43A 3QNUA 3QKRA 1H8HD 4LJ4A 4PPNA 4PC7A 3UG6A 1W44A 4B3XA 4HI0E 1Q1EA 1CXZA 3ZIAA 3NOPC 2QT1A 3Q72A 1JQLB 1XFQA 4Q1AA 4ILEA 1B0UA 3MJRA 2VP5A 4NL4H 4HOIA 1Y3AA 1KI3A 3JZMA 3F1PB 4CEIB 2WV9A 3VMFA 3ZD6A 1ZM4A 1YR7A 3FKSA 4HZUB 2VSXA 1DPFA 4MGYR 4PPQA 2ZOHA 1KI6A 3UKDA 2JCSA 4N3NA 2FZLA 2W27A 3SYKA 3I5YA 1N6NA 1KAGA 3AGPA 1G4UR 4ZIRB 5JHGB 2ZI7A 4B71A 3H4MA 1ZRHA 1QDEA 3REGA 1XRJA 1IXZA 2G6BA 1P4SA 4FCTA 2WOOA 4L9SA 4NMMA 4DSTA 2CLSA 3V9PA 3A0VA 1UBEA 1G16A 4MGKR 2ODNA 2DYKA 1EX7A 2H1LA 4PHGA 5TMPA 1N3BA 3AF2A 1XFAA 5JS8A 1G17A 3ADDA 2EWVA 3Q85A 1AKYA 5EZ5A 4D0GA 2ATXA 3NC0C 1G6OA 1HT2E 4KU4A 4MN5A 4TL6A 3TAUA 5HZKA 1JI0A 1SVMA 3MUFA 3U44A 3Q7QA 1DEKA 1E9DA 4XVRA 4AYTA 3RS5A 1G41A 2V7QA 1W0JD 1NVXQ 1T9HA 3EC2A 1IJFA 1JAIA 4BBUA 3CX6A 1F2TA 1UKEA 4DLZA 3BIFA 3VNUA 3MWKA 1N5KA 3NEJA 2ZITA 2RKOA 4Z8XA 1TS0A 3NG1A 2ZYTX 1N0VC 3MWLA 2O5VA 4ABYA 1NNEA 3GJXC 2QE7A 4J0QA 1SHKA 4BBVA 5FR1A 2BMJA 3ZLJA 4JLJA 3PUXA 4QM7A 3VR1A 1TF2A 2HEIA 2DHRA 5D3QA 1U0LA 2QMHA 2MMCA 1KI2A 3LLMA 5CDFA 1ZD8A 3A36A 4DVGA 4B73A 4DWJA 2V4ZA 2XXAB 2GEDA 4JVMA 4HB3A 3WNCA 4RKFA 4JVSB 3GPLA 3I32A 4ZI2A 5HD5A 3RC3A 2QBYB 1E2PA 4EPVA 5IU1A 5AUOB 2NG1A 2RGBA 1W36B 2N1BA 3LIAA 2A2ZA 4TT3D 5EP4A 1NKSA 3SDZA 4BBTA 4DT1A 3GLIA 3W6OA 3HR8A 2FE4A 4A1FA 2GNOA 2XJ9A 2RGNC 1OFTA 1Y63A 1MO4A 2W83A 4RD4A 4Z1MD 5HTKA 3EPHA 3AUXA 4ZKDA 4AY2A 2ZPTX 4DLUA 2VV8A 1JXOA 3G82C 3PEYA 5JJLA 3ZVLA 5CDFE 1U8ZA 2K7SA 5KPDA 1EFHA 3L0PA 4CRWB 1II8A 2UZIR 3WYGA 1XPRA 1T4GA 2IW3A 3ASZA 3MLEA 5LB4A 2GXAA 4CEJB 4FMDF 4QBGB 3TK1A 1CP2A 3J81k 3GLGE 4A8JB 1MZUA 1XD2A 2D7DA 3B1XA 1E32A 2QGNA 1PUJA 3ZD7A 1VCOA 3NHBA 5JMTA 3TUJC 1KSGA 1GSWA 1G21E 2F1IA 1BKDR 3BFKA 1E69A 1DADA 3QEJA 4LJ6A 5EP1A 2KE5A 2BEKA 3BC1A 4GT1A 4HUQA 4HAUA 2FFHA 2IT1A 4TMTA 3OIUA 1JEEA 4JBXA 1XJCA 1L8QA 4KITB 3C8CA 1G5RA 3LICA 1ZUIA 3WBJA 1AM4D 1MO6A 5DI9A 2R78A 4BLOA 1J8YF 2IUSA 3AP1A 4B6FA 1VYVA 1W46A 2GF0A 1CTQA 3U3OA 2P67A 3RHFA 4ZDIA 3FHTA 4M4XA 3MWYW 3ZIAD 2GRJA 1ZNWA 2ONKA 4QRHA 4EFNA 4ITRC 4UNRA 4EPYA 3KQNA 4B3DA 1Z6XA 3IS2A 2I4IA 2ZJ2A 5KTYA 1TQ6A 2DPXA 2KDKA 3ZQJA 4MYCA 3CNOA 2XZOA 1XDBA 4LI0A 3H2YA 3BY9A 5J5CA 3U3RA 1AK2A 3P7NA 2Q6TA 2QTFA 1YZQA 2IUUA 5KU1A 3ZVNA 4HYYA 2TMKA 1D7EA 2FDCA 2IYRA 2WKRA 1QHNA 1XTSA 2NO9A 2WZQA 2YYZA 4IXNA 3A1WA 3F1PA 5G53C 1M1YE 5A0FA 5LDDC 2NTYC 2W58A 4NCIA 4XOIA 3SYLA 3HU3A 3VKWA 1SXJA 4MKHA 4OHZA 2L4RA 1KI6B 2WPDA 2PD8A 2ZR9A 3OIVA 4DCNA 1E96A 5TV2A 3D7MA 2BWJA 1J99A 3FKSD 3ULFA 4GHIA 3AVQA 2CXXA 3CR7A 2HLDA 1SVWA 2VRWA 2XOKD 1OJGA 3LUQA 3AP2A 4MA4A 4YDSA 3BAFA 4OQNA 1WA9A 3ND9A 4G01B 5D3MA 4MRSA 4PSAA 5FH9A 1T3HA 5G4ZA 4GW9A 1AS0A 2NIPA 3UANA 2X1VA 3S1AB 3IIKA 3MD0A 3CLVA 2O8BA 4OBEA 3NDPA 3QG1A 3LI9A 4Q03A 4IDNA 3ICQB 3D31A 4DLVA 4ZO4A 1KI7A 2BMEA 2QP3A 4DLRA 1ZM9A 1EWRA 1Q12A 2OBLA 4BECA 4JJZA 2V1UA 2RGEA 5K8IA 5HPYB 5EE1A 2FX3A 3TSWA 2O8CA 4D4KA 1JECA 4PSVA 5ELXA 4HNBA 1F2TB 3CUEF 1Z0AA 1EFUA 3IBGA 3PUZA 4QGHA 3LVRE 1HEIA 1T19A 1AN0A 2D7CA 2DFTA 2NO7A 4RKEA 2CDNA 2VP9A 3FFAA 3AM1A 5KSZA 1SVOA 1TF7A 3T61A 1Z08A 1X6VA 2AXNA 1E2KA 4WL9A 1A2KC 3MFXA 3FDIA 3LX5A 4Z51A 3SNHA 2OCYC 1G20E 1D06A 5BN4A 1D5CA 1SKYB 2VSFA 4Z8YA 4R2HA 3NWJA 3CPHA 3QXCA 3O8CA 2IWHA 5EUQB 2VF8A 2VHUA 1RYFA 5JHHB 4GS9A 2Z6CA 2XXAA 1W4RA 4HH3A 1L4UA 1QHHA 1NI3A 4OI1A 4D4MA 2EFGA 1GTVA 3PCRB 5P21A 4I4LA 4Q4HB 3UIEA 2J41A 4LC1A 4GMXA 3UB6A 5C2JB 5DHAA 4LY6A 5B57C 4HATA 4RD0A 1IN7A 2OLJA 3ZDQA 3QVVA 1IY0A 3CWQA 4JGRA 3AGQA 2FSGA 4X8OA 4EPWA 1NBME 2C96A 2X19A 2ZSEA 4HQAA 1ZNZA 2YINC 3TSOA 3GLGA 1N2CE 3AQ4A 4ACAA 5J4YA 1Q1QA 4AYWA 1FTNA 1SVLA 3UG7A 3AVPA 4C2UA 2QRNA 3HYRA 1U0HC 3ZYCA 4JGPA 5FFMA 1UAAA 4YXWD 2GETA 1T6NA 3QBTA 1AKEA 2O0JA 4A92A 3MXQA 2W6ID 2ZAOA 3K70B 1IM2A 2IS1A 2YJTD 2C04A 2BDTA 3UWOA 1T0JB 1CJUC 4E22A 1SKYE 4EJSC 3LIFA 2OUKA 1T0HB 1PLLA 3AEZA 1TMKA 5CK4A 4A0RA 3LIBA 1DO0A 2GBLA 1SHZA 3Q8XB 5AUNB 5KUTA 1AGPA 4Q4JA 1GNQA 2WIAA 5TY0A 2Q21A 1JR3E 3EWKA 1DELA 2NO1A 1SVKA 3A8TA 3FB4A 1GRNA 3U4QA 1WP9A 4MITA 3ZS9A 3GECA 1WA5A 3KQKA 2AWNA 2BBWA 4KYUA 1LSXA 4EFMA 1E1RD 1OXTA 2WIBA 1YRBA 2A5YB 4KI0A 1W2GA 3B8HA 2CJWB 4P33A 3THXA 3KZ1E 4JLKA 1GKYA 4POAA 2Q0HA 2W2XA 2AFIE 4TYWA 3EPKA 2XB2A 4I1OA 3L0SA 4LC0A 2A5DA 2XOKA 3K8YA 3MAAC 5BYKA 4H9GA 5LD2B 2ZM5A 5GJBA 3SQXA 4Q66C 2NMVA 2P7JA 4F38A 1GL9B 2EFCB 3LDAA 2YKGA 2JJ1A 3BORA 4GSYA 5JECA 2AL7A 1ZU5A 2ZI9A 3T1VA 2AWOA 1NVVR 4LSGA 1RRGA 2CCJA 4DDWA 3L82B 4G3XA 4EPXA 1N5LA 3RRNA 3I8XA 2VYFA 1KO5A 4BRWA 4A82A 1FUUA 1T8TA 2C2HA 3CRVA 2MMGA 2FV8A 3W9YA 3H84A 4BLSA 3EZFA 2A5FA 1XEWX 2FWRA 2ZREA 5LBIA 1VYTA 4HAZA 3MMPA 5L3QA 3SI7A 5KSPA 3LO5A 3X1WA 4BZXA 4KBGA 4TL9A 2DBYA 5IRCD 5CB8A 4DDVA 2P6UA 1E4YA 3ASYA 4W5JA 1ZC3A 3LAWA 1GRQA 4Q21A 2CE2X 2XNDA 1G8GA 1IN4A 1G18A 3X1YA 2C03A 1R5OA 2G3YA 4X8HA 3BJIC 3VR4A 2ZJBA 4TYNA 2HDNB 4TYPA 3W6PA 2J87A 1DBSA 4QBIA 2OXRA 1KKMA 4Q1CA 3B1ZA 4W5HA 4GS9B 3TJZA 5GADl 2Q9AA 2L1MA 2F9LA 2Q9CA 5CK5A 2WWXA 1K5GA 4BFTA 4LYFA 3BY8A 2V1AA 4LPSA 1MR3F 2OSBA 2V0UA 4PKYA 4I3IA 4DSOA 1MH1A 1PZNA 4PO1A 2QPAA 4Y0AA 1XTKA 3IKJA 4OYHA 1II8B 5JRJA 4KHZA 2VP0A 3VHLB 3KX0X 2A3RA 3WMGA 2Y8EA 4BEBA 2QI9C 2GZAA 2GCOB 1LV7A 2ZI5A 4BASA 4URXR 1TQDA 2HXYA 3UMEA 4LPZA 4QKQA 1G8HA 1M2OB 3RDPA 4Q4HA 3K9HA 5KSOA 4AI6A 2WKQA 2FPKA 4HLCA 5SZIA 4ARZB 4LBYA 4Q4AB 1E9FA 1MABB 2QBYA 4N0EA 4TQUS 3T1TA 3Q3JB 4LHZA 3F1OB 2WICA 2JA1A 4PHFA 4X8MA 1W48A 3THXB 4RD6A 3CONA 2GCNA 1A7JA 3PENA 2V3CC 2WJYA 2F9MA 3U6BA 2KSQA 3KKOA 2H7VA 2QHKA 4P3YA 3VKGA 1E94E 4TMZA 3WP1B 4TL7A 1P75A 3GLIE 1Z6AA 2YV5A 5KNCA 2J0QA 4LCBA 1GRRA 4KBFA 3A1SA 4QBHA 1IN6A 1EW0A 3LI8A 3CBQA 2WJHA 4O2RA 2ZRCA 4B74A 4C2TA 4NDZA 5FI0B 3GFPA 5FTMA 3W3ZB 3IO5A 4HJ4A 1JJ7A 4OI2A 1ZCBA 4RY2A 3N2EA 1NSFA 1EK0A 3TMKA 4C0HA 4OK3A 1CR0A 3IO3A 3AKEA 3N5CA 3RRZA 3KKNA 3G0HA 4WUJA 2GXSA 2OT3B 3FG8A 1E0SA 4AC9A 3TW4A 1X1RA 1VB6A 2PJRA 4UXIA 3BK7A 4BGDA 1IAQA 3N2IA 1T8UA 4DSUA 4HB0A 1SZPA 3GLHE 3ZS8A 4OI4A 1KMHB 1Z0FA 3MCAA 1J90A 3FYHA 2D01A 4LJAA 4WAUA 3QIAA 4LRYC 2WWFA 4B75A 1KI8A 4RD2A 1E9SA 2MSEB 2FOLA 1GFIA 1OIVA 3AF3A 2FH5B 1PLJA 2UKDA 3O47A 4IFEA 4N0DA 4XWKA 4TMWA 4JYBA 4LV6A 1OTIA 5HDCA 2ODWA 4D2IA 1H8HA 1XXHB 3LIDA 1CR2A 3R20A 2P6RA 2ZRAA 1YZKA 2WAYA 1T18A 4G5SA 5TBMA 4HDOB 5EZ6B 4F4CA 2IYXA 1FX0B 4DDUA 3QF4A 3E5HA 1N5IA 2REXB 3P32A 2V7QD 2KJQA 4JSTA 3OE7D 1XJ2A 2RHMA 2QG6A 5J4KA 1UJ2A 1IONA 4IOKA 5FPKA 3QBVA 1D9XA 3QY0A 1XMJA 2O8EA 2ZUCA 1N6KA 3E1SA 4LRWA 2Z4RA 1Z6YA 4HAYA 1ZYUA 3LXXA 1R8QA 3VR5A 1A2BA 3C41J 2QM7A 5KNBA 1F48A 2OV2A 2B8WA 4JKIA 5GVRA 3RAPR 3PG5A 3EASA 5CIQA 1LVGA 2F43A 2WAXA 4F4IA 3AVTA 1I4LD 4E07A 3RTYA 4E5UA 4NE2A 3GEHA 2CHVA 4AD8A 1WMSA 3B1VA 1WBBA 4GOKA 1GNRA 2VA8A 4NCHA 2QP4A 1G6HA 4OJKA 4EEPA 1V5WA 1G19A 3AVWA 4JGOA 2IYSA 2NO6A 3JVUA 1NG9A 1HA3A 4Q1FA 2JLWA 2Q3MA 5EQTA 4ZCLA 1KZ7B 5BYJA 1OJ5A 2RMKA 1PLKA 2OWHA 1GITA 2VL7A 3Q9LA 3GLFB 3U61B 3BWDD 1KY3A 2R6CA 1P2TA 2J0UA 3EC1A 1XXHE 1EFCA 4EESA 2YOHA 5A4JA 3THWB 3CAXA 3PYPA 2HF8A 4JJKA 1LTQA 2REBA 5DNYB 5F2EA 1NY5A 4H6JB 2FMXA 3A0RA 2G88A 3TIFA 2BMDA 2IEYA 2PEYA 4JLPA 2LCFA 1GL6A 1Z8FA 2B92A 3B5JA 1NN3A 5UKDA 4Q7LA 1XTRA 3F1OA 121PA 4CEJA
chains in the Genus database with same CATH superfamily
5LBTA 1MENA 3NM5A 3ZVRA 3A6LA 1W85B 2H1RA 2ZSKA 1GTSA 4XQCA 1DT5A 2W1TB 2BY4A 5HZHA 1R4ZA 2EF0A 2REQA 4MMNA 1JSCA 1KIMA 1RPAA 1JG7A 5HMLA 1YRYE 4IBXA 2UVDA 3HADA 4C14A 3V00A 4G65A 3NGMA 3KQMA 2QJ5A 2GO1A 3SSOA 2J0SA 3PUHA 1RPNA 1Y8QA 1YMUA 4QJ3A 4URZR 4EA9A 4YT8A 3K3CA 5CMLA 2R6R1 5FO1A 3T9DA 1GFZA 5M2QA 1MO2A 4OFWA 5DLPA 1PYGA 4BAZA 1ZM3A 4I14A 4F8JA 5KOJB 1NX9A 2H28A 1BXKA 3M0EA 4MYUA 2QJRA 3W4PA 5GONB 2B21A 2CVQA 5CYFA 4OHYA 2AOWA 1WCV1 4DMFA 4K9NA 1P44A 1VE1A 5A4MS 1K55C 1ZD3A 1N1EA 5ICCA 2ZM2A 1RAEA 3JY6A 1XHEA 3VYTB 1AUQA 2QVZX 4QVKA 4XPIA 4CKBA 1YFZA 1OI7A 4K6FA 1UT8A 3WGQA 4CGYA 1DAPA 3RT7A 1FU7A 3E84A 5IYZF 4FMBB 3V7UA 3FCAA 1SC3A 4A7PA 3SXUB 4IQFA 1NSYA 3RTDA 4AY4A 1TJ3A 3O94A 1E7MA 4XH9B 3NUQA 1LLUA 1BE0A 1KQPA 1WVMA 2XDWA 4FJ0A 4H7IA 4WESA 1VSUA 4Y13A 3NV7A 4BBPA 3T15A 3N0VA 3X2FA 3GZJA 3KSZO 4ZD6A 4DCUA 4FFRA 4YIHA 4RCZA 1PGQA 4Y9SA 2QL7A 3SU8A 4B84A 1W76A 1VPWA 1ZJZA 5FAKA 3VR4D 1IOWA 2PU7A 1PO7A 1KY2A 1MRNA 2V58A 2Z9CA 3V7YA 5JSZA 2P8JA 4N5NA 4EI9A 3THYB 5JCJD 5I9NA 4A8JC 1QH0A 3T3NA 1EFVA 4HJRA 4E2ZA 4D42A 1KK2A 4ZU3A 3QBJA 2AUNA 5CXWA 2VDVE 1OT9A 1U99A 4I4TF 2AEMA 3KT3A 4BJHB 3SIWA 4EG5A 2IXEA 4N9KA 4OB7A 2C1XA 1ENPA 4CM5A 2QLTA 1FXUA 2Z8YA 4TSFD 3SOPA 7ADHA 3O91A 3PPIA 1VGQA 1FP2A 1KSJA 2AZ4A 2DT5A 2JFZA 1IMOA 1EI9A 2Q27A 2ZIVB 1AURA 2P9VB 1EUCB 1P1RA 3F6SA 4P31A 1RXVA 1OH6A 4Z53A 3EAQA 2XB6A 3CF6R 2B5VA 2Y79A 2DQZA 2Q50A 2RCNA 2XW6A 3AF1A 2BFAA 4NYJQ 2JN7A 2OVFA 2Z5VA 1H8ZA 4JZKA 5F1PA 5A3JA 1CUAA 2J7PA 3IQXA 3X1XA 4CMEA 2RAVA 5K0ZA 1TJ5A 1AVTA 1KGFA 2DCFA 4COKA 4YX9A 2H7YA 2P11A 4UCWA 3WADA 5HUHA 1UADA 3LEZA 2TS1A 3EXAA 5HAIA 2B02A 1GKUB 2E1RA 3NHWA 1O6FA 1PL6A 3FTPA 3MTBA 2VUSA 3VV3A 4XWOA 1N78A 2XITA 3QMPA 1G7RA 1PWHA 2HAEA 2SCUB 2Q8NA 3S81A 3OH8A 2PX2A 4UUQA 2BTQA 5C32A 4IR7A 4JHLA 1UR5A 2ZAIA 5BN5B 4NS4A 1YLYA 2GN0A 2V7WA 2C4NA 2CXSA 1I14A 3I64A 4MUAA 5I9TA 1VFPA 1V0JA 3EODA 4P3NA 4C30A 1KH3A 3DOHA 4XFKA 4CMAA 1VE9A 1T8WA 4XD7A 3IHLA 5AK6A 3KS9A 1JSXA 4RCYA 2QSZA 2Y99A 4EPTA 1GCEA 3AEKA 5E7IA 2WF6A 2ID4A 1ORIA 3ZGNA 4Q7MB 5KX5A 4DV3B 1E3UD 1ES5A 1Y8RB 4G5GA 2VZLA 4EY3A 5AVUA 4Q5IA 5IH7A 3WHIA 3JD3A 1JBKA 3R5JA 4MUEA 5A3SA 5JAZA 2WF7A 1BAPA 4R83A 3ANYB 2R79A 3JZDA 1P8JA 4JQYA 4D98A 3ZWVA 4CQMD 4Q0HA 1CLEA 2PXAA 4IFBA 4M0EA 5KI6A 5C5KA 1QGUA 3WYAA 1C29B 1NJGA 2VJLA 5FL7D 2DFVA 3P71T 2XUOA 3D0QA 3Q7PA 4CL8A 4Z7NB 3RYCA 3I6IA 1PVVA 3CX7A 1ULTA 3FDFA 1XA4A 1RYYA 3AWDA 3OEWA 3U1TA 5BORA 1PW7A 1HT1E 2ZJOA 1P97A 5FBLB 1CUFA 2BGMA 2ZIAA 4MDFA 5JRDS 1HV8A 2IF0A 3OEED 5IUNC 3NDBB 3EYAA 2GM4A 1MOPA 1QOZA 2VNJA 2QR3A 1PWGA 3EF3A 1QG6A 1Z0IA 4G81A 4RZXA 5BO5A 3H1FA 4QFCA 2Q5HA 1MT3A 4AUNA 1ENOA 1T1EA 3F9RA 1QV9A 2FJUA 1VLMA 3FAKA 4BV9A 2B0CA 5J4HA 3TUZC 5JW6A 5A9TA 5HP4A 3H1TA 3U40A 4MWCA 1AN9A 3DBHB 4QJIA 3HCNA 3DM9B 3ISVA 1UWKA 2OCIA 4FW9A 3VRHA 4PCAA 3VPCA 1YL6A 2O2EA 3FMGA 3LK7A 4YLGA 5KYUB 2D3WA 3DF7A 3QF7A 3ZQ6A 5MN6A 3HWSA 3FW1A 3VJKA 3NT5A 1Q7TA 1T1JA 1SKFA 3ED5A 3PFIA 3V4OA 2V9PA 3REFA 2ASVA 3DMDA 1CIJA 2R8ZA 2ZE5A 1G64A 4CG3A 2XYVA 4EB8A 1H6DA 2LKCA 4XVQA 4FB5A 3R5KA 4INPA 1Y4OA 1KDWA 1BLPA 1SO8A 1ZHHA 4ES6A 2D2XA 1MORA 4QXAA 4ZDJA 1ZBQA 1FE8A 5G1PA 4CLOA 2GDZA 4S2LA 3CW8X 1CDDA 2AFHB 4R70A 5J4VA 3CVUA 1Z63A 9ABPA 5JCOC 1ID8A 1Q16A 1RYDA 4BDTA 1JV2B 5HKKA 1W2HA 1JVSA 3HEMA 1TTQB 4EUVA 3RS7A 3OBIA 3GIDA 3QTTA 3PGMA 3PBTA 2MYUA 3I04M 4BL2A 4R2WA 4ZQBA 2W71A 3CI6A 1R6BX 5B7QA 1B15A 3MJ4A 4CF4A 1GQFA 2X7HA 3F3SA 3JASA 4I5DA 3U3ZA 5MGNA 1PT6A 1NWHA 2O8NA 3FKJA 4K1XA 3UHPA 5L3QB 5LQRA 4LF4B 2CSUA 2ODBA 3K7EA 4O08A 2IS4A 3ZTTA 4E3KA 1UC9A 2IYZA 1R5JA 3FTFA 4X56A 4JKTA 3ORRA 3PYLA 4YJ3F 1KEWA 1YV9A 1ODIA 4MBKA 4CG0A 2CL7X 4Q1DA 1Z37A 2EGUA 1PNOA 1FRZA 3PNPA 2XCQA 3C3AA 3ZJUA 5DYIA 1EFRD 2R85A 2QWSA 2IIPA 4EF4A 3ERCA 2WWVD 1P0CA 3U3XA 2PRFA 2Y05A 4RY0A 4YMWA 1TB4A 2GX5A 4DUYB 3L84A 1SXPA 3VR3D 3TDNA 1FFYA 1Y8AA 3MQOA 2JFPA 3ULKA 4PCUA 3GA5A 4MUBA 3OZVA 3PGJA 4ZQEA 2EATA 2P5TB 2Q4EA 2JC3A 4UEWA 4F60A 5JDIA 2Q3LA 2J0VA 3AI3A 1XFDA 1RLMA 3JWHA 4G0ZA 3WXMA 2MWMA 3FPGA 4BVAA 5E2AA 4QZVA 1FA9A 2VAPA 5DYNA 3R9IA 4EW1A 2YN0A 1VDZA 1Q14A 2QRUA 4RGVA 4XTCS 3VX3A 5ERYA 3H0KA 3ZNOA 4XDYA 1JFSA 3COPA 3QYPA 1VHTA 3O8RA 3PGXA 2NVUB 1DVRA 3VBCA 1X1AA 5CB4F 3W78A 1KMMA 2FW8A 2DZDA 1B6RA 2R68A 1QZ3A 5AKIA 2B1RA 4EI2A 3D6FA 2FZWA 4CL0A 1KZ6A 3A11A 1H4VB 1RYEA 3KXPA 2YVAA 4PLWA 4Y2QA 2CHFA 5CYGA 5JY1A 1Y8CA 1ADBA 3F67A 3BILA 5C7LO 5AK4A 5I9SA 1P4RA 1M8PA 4KOAA 2FCRA 3NU1A 3HCYA 2F8MA 3SICE 1HL3A 3UGKA 3OPRA 3AVVA 2BEWA 2Z2IA 1W47A 1Z4OA 2Q1TA 1AQ6A 2V5UA 1HDCA 3EOZA 3OEEA 3S5JA 4H3VA 3S2YA 1GZ3A 5FLYA 2AYYA 4ZGGA 5FQOA 3NM4A 9LDTA 4EA8A 3K9WA 4D46A 2Q0SA 3MQ2A 2P62A 4CCAA 1CFZA 4FWBA 4OKPA 3CCCA 1YZGA 4E5SA 2E3JA 5JD3A 4QOIA 4RIFA 1TMYA 3QNCA 1F6DA 3UPUA 4AZTA 4D9HA 3PGA1 2W3DA 2ZJAA 1JB1A 2FCAA 4F3RA 4D57A 3U7IA 1XXLA 1UQRA 2NW6A 3PC8C 2XF3A 3RE1A 3IHWA 3WHLA 1CVLA 4U2FA 1QYIA 1AQUA 3MFYA 5LXTA 3U7HB 2WLTA 3HEAA 4AKIA 1HTTA 1YULA 3OECA 3SS4A 1N9LA 5JO9A 4ZICA 1A88A 1XXMA 4ETZA 3I73A 2R62A 3DMPA 1MKMA 5LP1A 4DIEA 1V3UA 1O57A 1OAAA 1R4NB 1SCQA 3C7CB 4DHWA 3EWSA 1QFJA 1YLTA 4R81A 1CUHA 1GRCA 3W8DA 3AERA 4R40A 1M2JA 1DIRA 5F51A 2WSYB 2HKIA 3ADPA 3HR4A 2D5CA 4MV8A 1KOUA 5GP1A 1BD4A 2VXCA 4ZARA 4OLHA 4HJXA 5LVAA 4H6XA 2ZYWX 4K8RB 2GPSA 4O63O 3OZCA 1PCXA 5DFAA 2JVIA 4EI7A 4Y3IA 3PXGA 1KSFX 4RPIA 3ZIDA 4IUHA 3C3YA 1V1MA 1EVZA 4IV5A 5AVZA 1CDZA 1NVFA 4R8MA 1H6AA 3AB8A 1KK3A 5E7JA 3AY7A 2O4CA 5A62A 2CE7A 3KB2A 4QL3A 1CJTC 1DCKA 3DTKA 3NOUC 5EGSA 3RHSA 2RHRA 8ATCA 1B42A 1QCCA 4NNPA 4DLSA 1NNLA 2R7NA 4LJ5A 4O2AA 4RWEA 3S2ZA 3UV7A 4CM9A 1UC4B 5L53A 4I50A 2VGJA 3V8VA 5BW8A 1ZL2A 3SIPA 2B35A 4LNUA 3TLXA 2OECA 4W5RA 3L7BA 1H0SA 2Z08A 3D6MA 4PHTA 4XXRA 1QTNA 2HIHA 5JO0A 2IYUA 2J9ZB 1ZGGA 1LPNA 3VZQA 2YX1A 1CJMA 2NM0A 1XA0A 2QYTA 2WSIA 1IUKA 3QKTA 1U0GA 5A7HA 2JI6A 5K3CA 3IOBA 1G5UA 4O4HB 1SB9A 1W73A 4UNPA 4C0KA 5L3VA 3CPJB 1LQTA 1X87A 3W2GA 1S2MA 1ZVQA 1VL1A 4R1SA 3T0GA 5K5BA 5KYKA 2QSJA 1JMVA 3ZWPA 3K0BA 1MOSA 3OC6A 3JQGA 2R2AA 3BTUA 3L1IA 2UZ3A 3VR2A 3K70C 3VC2A 2BV3A 3SC2B 3IFSA 1U0JA 1TU3A 2G63A 1OXSC 1YB1A 1AK1A 4TRRA 5K8CA 3JARA 4RQ9A 1KU0A 3E27A 1G2QA 1YRQA 2RJNA 4PFKA 5FKJA 1G6AA 3FPVA 1Z26A 4DL9A 4I3HA 5T4HA 3CINA 3BWBA 3T5BA 3AFHA 1WRBA 4F8YA 1OFVA 1KVMA 1K68A 1G9XA 1KK1A 3UO9A 2WWWA 3AK4A 1N57A 3IDSA 1NAHA 4V0NA 4G63A 4J1NA 4WOPA 4L8YA 4UVDA 2QJFA 1T1GA 4V3CA 4EBLA 1ODVA 1HH4A 3G5AA 3RVJA 1S4MA 4DCVA 3KSIA 1DAIA 1L0FA 2I5PO 1SN7A 1X94A 4D0SA 4RTJA 3RD5A 1LSJA 4F5ZA 2ZKLA 5LPNA 2O8EB 5CGXA 1VG1A 1L7BA 4JP2A 3IXHA 3A0RB 3S2SA 3C1AA 3AF6A 4TXLA 4DB4A 3ABIA 3P4YA 4B44A 3VPHA 5A5GA 1P2BA 4NCNA 2QMZA 2XQJA 1LS6A 5F1GA 4HP9A 1AQYA 1PJLA 1YMQA 3IA2A 1I5RA 4C08A 3Q9NA 4C4PA 1K08A 4ZV4A 5G0SA 1B4DA 4OK6A 5KSWB 3W5CA 1MGOA 1RBMA 2QRLA 4QUIA 1S2NA 3P0IA 1DIAA 3QKSB 1TW3A 4Q0JA 2AMJA 4BP8A 2REQB 3ZGOA 2DTXA 4LX0A 4PXAA 1VMIA 1YS4A 1OAOA 1CI8A 4KW7A 4TMKA 2HU2A 4LEIA 3OHSX 5HIAA 1GGKA 1T3LA 2ZT6A 2Y71A 1NRFA 3C15C 1TPZA 3TE6A 1XTPA 1U5BA 3HTXA 3WB9A 4HEJA 1TJYA 5JPCA 4B3TB 1NXSA 4DQ0A 4RUKA 2ODQA 2NVBA 1U2TA 3EXEA 2CF5A 1L5MA 2PX0A 1YIDA 2PIDA 3CE6A 3MINB 3CQ9A 4WECA 2AYZA 3TZKA 1P0ZA 2RBEA 1CQWA 2OXIA 4CZ2A 5G4LA 3K1AB 2WHEA 1ZGZA 3AEUA 3O03A 4M1QA 3W5HA 5JTTA 2Z8ZA 1FP4A 1UBFA 2F1JA 3KZXA 3LXRA 3T9EA 1KWKA 4P93A 5CH8A 1N0WA 4DWOA 1V9ZA 1GG9A 1Z9BA 4KQDA 3JQ6A 2WIKA 1UPUA 1ZR2A 2M6KA 3WB1A 4WLNA 5AQ1A 1V95A 1WDWB 2ZSAA 4DRXA 2XGSA 4YP7A 1NLYA 1C4OA 3QIVA 4EENA 5JC8A 1ICIA 3E2KA 1IY1A 2R1VB 4WK0B 4R9NA 5L3RA 5I7RA 1U3DA 1EVJA 1R4NA 1IL0A 3HLFA 4ZZ3A 5DM70 3RADC 1H2HA 3D3JA 3ZDRA 1L0BA 1SURA 1ZJ5A 5AJXA 2ZAMA 2EX9A 2BEJA 4BB9A 3ER8A 1RQNA 2HF7A 3LW8A 3AJEA 5ICMA 3R3JA 4Y3UA 4P32A 3BDAA 2GYWA 4DE0A 3N53A 3MS7A 1NZJA 4OY3A 4XTRA 2CLEB 2WDPA 4MGEA 2I9PA 2IOFA 4KXXA 4Y2SA 5CXSA 3KTFA 1DAKA 1CEYA 2DPHA 3CWZA 4PBRA 5HWVA 5AQAA 1KGDA 1VKOA 3S7ZA 1TDJA 1ZIXA 3GJTA 1PEKE 1OZFA 5FQNA 3V4VB 3G3EA 3RVPA 1ORRA 1Q7EA 2HFKA 3IUPA 4Z5XA 1VI2A 4YXFA 1NC1A 1H93A 3HV0A 4A1OA 2JDID 2R8RA 1JYEA 3C8UA 1JFVA 4AZWA 1CBUA 4EUKA 3I9JA 1WW3A 3IAM6 1I3OA 5DNVA 2RHCA 1O0CA 5F6AA 3BVPA 4RBNA 1UWPX 1BKSB 4BYGA 3SJZA 3B33A 1WW8A 2KB0A 1EVEA 1E4VA 1T6YA 2OOSA 1C9DB 2CCGA 2BVNA 4FX2A 4MAFA 1V43A 3VHQA 4EG8A 4RWZA 3BIOA 5CW2A 2NTJA 3IAS6 3CUEC 1DXOA 1VBFA 2GSDA 2XJ4A 3HHEA 3UAWA 4Q4LA 3VMMA 1Q1BA 2RK3A 3GYBA 1L1RA 4WY2A 3VDMA 1TO1E 3X1JA 4BKRA 2IYNA 1Y6ZA 4X94A 1TKAA 2ZBUA 3BIXA 3K9LA 1QTRA 2YIJA 4KO1S 5AIAA 4A0FA 5CRFA 3LVBA 1HUQA 1ZGCA 3W5IA 1B2RA 4M1ZA 1GPNA 3AETA 2BUAA 2DQ4A 1RGZA 2BTQB 1NJ1A 1BXRA 4BMDA 5CFNA 2IX9A 2WA1A 4EZEA 4F45A 1BRMA 2OKGA 2LNDA 1ZRSA 2OLEA 5EA2A 2ZTSA 1C8KA 1Z7YA 1KR2A 4LNHA 1SULA 2PANA 3G2MA 4QREA 4RENA 3HJBA 3KYIB 1ESMA 1RJWA 2GF9A 4CCWA 3HUUA 4DZRA 3TXXA 2BTFP 3ICWA 2JHAA 4QEDA 4DC9A 4WM9A 1TU0A 2PQ6A 5ED0A 3QPDA 4AKTA 4IJ6A 2GWRA 1JPVA 3VC7A 3MERA 2I91A 1BE6A 3R5FA 4TRNA 2GD6A 4WINA 1ZU4A 3DM5A 3GLHA 1XZPA 5F77A 3ZCUA 4BATA 1RWOA 2J85A 2VK8A 4AURA 1S3IA 5DOVA 4TM8A 3I6YA 3DDHA 5JSYA 1MJ5A 4QPDA 1XYGA 3B13B 2PEZA 2GZ3A 3FSGA 4R84A 2EKLA 4TV9B 1M0EA 2X9NA 4LCJA 5GZ3A 5FTJA 5DNCA 4YY3B 1D2NA 2C2MA 1Q6YA 3GQBA 5FTKA 5K3AA 2VPYA 4KKXB 4A27A 3UWKA 2OAP1 1WULS 2C4WA 3RRMA 2WGVA 1NONA 3JATA 3KQTA 2B2XA 5T4BA 4QGGA 5FDFA 1D4OA 3GMWA 2WD8A 4MB2A 3RIMA 2GB4A 3KPUA 3KJNA 3W3AA 3AEQB 2CLKB 2ZI3A 2H11A 2VZ8A 4JJ4A 4Q15A 1OBVA 1BO6A 1VL2A 1IZZA 2PKRA 3DBOB 5C31A 5IK2D 2BFPA 1Y1PA 1W5AA 1XCMA 3DPUA 4N9WA 4C3OB 2DTEA 2I33A 2GZDA 3MBZA 5ALYA 1CYDA 5J59A 3ZR4B 3MJQA 3IE2A 1D2GA 2X5JO 2FI1A 4MYHA 3WFIA 2XKKA 4M9ZA 3ZCRA 2HHJA 3BRSA 4GEGA 1LJLA 2BHLA 3GRFA 1SU6A 5DCYA 1W8QA 1OB2A 3QFSA 5DX8A 4GD3Q 3G2NA 3UXYA 1OH8A 1KQFA 1R4MA 2XADA 4J6EA 4IUYA 1NV8A 3PQCA 1T5HX 3QHAA 2CCKA 3EDCA 1EWQA 1OC4A 1UXJA 1IELA 4QSHA 1A8QA 1YR1A 1Z74A 4BQRA 1HWYA 4WOCA 2VQFB 1B8UA 1WKBA 2M1CA 2VEDA 1BJKA 2DY0A 5BOSB 1RFLA 1ZMOA 2VS1A 1WIWA 4NNOA 5K0SA 1K54C 3DMGA 3MF0A 2GN8A 4RO0A 5DHUA 4IYJA 1UQTA 2G1KA 7REQB 1SIWA 5KTOA 3GGPA 1W52X 1NTOA 3WR5A 3S27A 5IKXA 1QPBA 4G0UA 3Q9UA 3OP1A 2I71A 3II6X 2C0CA 5MHTA 4ZMBA 2NUAA 4NPHA 5JANA 3WZMA 4AO8A 4IVQA 3H5LA 4FN5A 2GZ2A 4HGPA 4ID3A 3RABA 4BWGA 5J4EA 3PZRA 2NTNA 4CDGA 1OZHA 3WMRA 2WQ7A 3W05A 1XR3A 5C34B 3LBIA 3P96A 3ANSA 4P0MA 5CX4A 3O73A 1BYIA 1I5EA 3JQFC 5DASA 4ZJUA 3K16A 4EJMA 4B6SA 3B2EA 3ZLUA 1D0VA 3ZCSA 1O94A 3U0BA 3HB9A 2P40A 1T4BA 3GUHA 5B30A 1KYQA 1CU1A 2BJHA 3CV3A 5BSKA 1BS2A 1Q44A 5ARBA 3LE8A 4L6IA 4ETXA 2WILA 4Z2AA 3K0HA 5DW0A 3ZY6A 4DM3A 3OPMA 4Q4CA 2OFFA 3AOEA 3EEFA 2XZPA 3ESZA 4MR7B 3U48A 1WZUA 4MQFA 3QLJA 4FH4A 1KAMA 1W5SA 2QR2A 3BZUA 5KIZA 3CRMA 3FPJA 3KD3A 4K86A 5G4KB 4AIRA 4X1LA 4LVNA 1P0MA 4I19A 3WVNA 1D9ZA 1M1YA 4I1YA 2QJ7A 2NAFA 3LKVA 3VDQA 3GLKA 2CXRA 4FS8A 4MMZB 2PR2A 1N9NA 2X0NA 4X6XA 4TS9A 3UF0A 3B5EA 1UOEA 2XNSA 1HDIA 5JFTA 2QMIA 1A4RA 2CFSA 4TLMB 3NMUF 3FUTA 4TS4A 5AFSA 1T6XA 1ZICA 1UBHS 1WBDA 4CLCC 2I1LA 2YVLA 2J3IA 4M98A 4TL8A 5P8WA 3USES 621PA 1RZ3A 5ALWA 4YJKA 3B5IA 5F3WB 3NT2A 1KH1A 1Y3IA 5DWQA 1W1WA 4PZZA 2AOTA 3BCHA 2H1FA 4U6SA 4HX9A 4J0EA 3JWPA 3CX3A 3C30A 4Q0MA 1PZHA 5KBYA 5H16A 4EMSA 3OJ0A 3MT7A 4NYJR 1BXGB 3OZHA 1PJTA 2DAPA 5JAQA 4EVIA 2YFYA 5KMGB 3AZPA 1Q1ZA 3CZQA 4DBVO 5ES4B 2NSLA 1OHHA 1VKNA 5IDXA 1QBKC 3T4EA 2ZRGA 3ZVWA 4PC6A 1AIPA 4OPMA 3PX7A 3CVXA 1KDOA 3IALA 1GKKA 2UZ1B 1BH2A 3O2SB 2E9SA 4GMDA 3KYZA 2PXXA 3C5CA 4D6XA 2BDEA 3I05A 2Q3HA 2IHYA 5JXHA 3F8WA 1IOZA 2JGLA 2WTXA 1FDRA 3FZYA 3PBNA 1HVBA 3PWSA 1M7BA 2GXUA 2RGXA 3IUNA 2QNIA 4ILEA 4Y1RA 4HAXA 4EKIA 3W8KA 1EXWA 4EFKA 4A16A 2WKSA 3IP6A 4UD6A 4OOEA 3C6MA 2CVHA 3QVKA 4QODA 2X22A 1K57C 1LLCA 1DP8A 4DWVA 3FSEA 1PZMA 4A9AA 3TLMA 2G28A 5JCZA 4FBLA 2ZIXB 4EVRA 4F5DA 4CF5A 2WM3A 3KB6A 4JGIA 2XOXA 2WB4A 4PSKA 4X45A 2E4YA 2IYTA 2JAXA 4EQ6B 3EVCA 2AC7A 1DTWB 3U2AA 3VSCA 4JUBA 4QFBA 4R4SA 1U7OA 3AR3A 3MNFA 2G67A 5KYYB 4KFCA 5EWMB 1KHTA 2BP7A 2PGLA 3BL8A 3SJ7A 3QH4A 2ZAGA 1D2HA 3F49S 4F12A 4HJ3A 1CJKC 1VCMA 4J1QA 1FTGA 3HDTA 1IBMB 1PS0A 5DOZA 4LQCA 2H1WA 2RIPA 4KPGA 4RKQA 4WELA 1N6IA 3RCBA 1K7YA 4AN4A 1VCNA 3PQ4A 1U8TA 4YUXA 2IA2A 5B6JA 2EL9A 3FB1A 5K03A 2YS7A 3BQNB 3B6IA 1L5KA 3QEAZ 1JDTA 4OBBA 4BFYA 1QRSA 4NCKA 5F69A 3UH1A 4IFIA 2H65A 3BLMA 3BMQB 2N3ZA 1ONBA 4PX3A 3ZE8A 1LBHA 2J3TC 3EMBA 3NYRA 3CCBA 4ZO7A 3GD5A 3SE7A 3TUIC 3VOSA 3WK6A 3L06A 4BBZA 1KI4A 4ESOA 4R3UC 4F84A 1BRTA 1W5FA 1JP7A 1KYXA 1MFPA 1RHKA 2VJOA 1UAGA 3QQ5A 1TD5A 5F5NA 4QGBA 4DXBA 1BOFA 2PX5A 1G5QA 4QTUB 1YMSA 3W8FA 4ARUA 4BE4A 3I92A 2CBGA 2IU6A 3TSYA 2PZLA 3ELDA 3WB0A 3WWEA 4HGNA 1HQDA 4I9NA 4Z7JA 1X19A 3G30A 4PAUA 1IUNA 1WTCA 1T8PA 4D3YA 4ZK6A 4XDZA 4BFCA 1L7QA 4YAKA 3P4UA 8MHTA 3EOBI 3RS4A 1NJ5A 2G1JA 1X7YA 1NF3A 2IF2A 4IXMA 4RA9A 1IEXA 4CL3A 5JLJA 5JMTA 1QKJA 1CQIB 2VDWB 3G49A 3H2ZA 5CVVA 2H1CA 3UJ6A 4IDGA 2ERYA 3DMRA 3I72A 4YBZA 3GJ5A 1V7PC 1JXQA 4WBSA 3LY4A 3EXHC 2A86A 3NBKA 1P7YA 3FFBA 4JL8A 4G5QA 3Q40A 1B6SA 3VPBA 2ZK7A 3H9WA 3NC4A 3ZE0B 1SCNE 2JEOA 4YH1A 2JZOA 5GWXA 3VFDA 1MV5A 3HRHA 5GIPE 1GCGA 1VMEA 1S3SA 5KNCD 4L4SA 1MO5A 4XVUA 5BSFA 1IZ9A 1CW2B 2OY0A 1EEHA 3UENA 1NM5A 2C9CA 3SLGA 5K6RA 4KENB 1N8SA 2R9VA 1E61A 1NMYA 3H5VA 3L0YA 3WX0A 1M1YB 1Q6ZA 3FV7A 1GAJA 4MKXA 2M6SA 4JBHA 5E6SB 1U90A 4WY5A 2EFUA 4L15A 4EY6A 1CRPA 3MWGA 3BE5A 1OVMA 3FZNA 4H7KA 3AB7A 2QENA 2VKQA 2NGRA 1PJ3A 4GP9A 4HL6A 5JYOA 3E53A 3MS6A 3OLXA 4BQQA 3NTUA 4ZVOA 1FC0A 2Y2QA 4G4SO 1Q0HA 4BFLA 2V8OA 5JQGF 3RYFB 3IWQA 3ONNA 4URYR 4V3BA 5FLXA 3D8TA 4M6WB 1ZK2A 3SAJA 1NR5A 4GHIB 5KSCA 1XU4A 2V54A 3SXUA 1U5AA 5CX1B 1VEUA 3O38A 3I53A 1WR8A 4ND8B 2WAAA 3Q6MA 2P6MA 4X1MA 1E9RA 3EC7A 4WZBA 2JCGA 4RTSA 3I42A 1DKQA 1LI4A 4ZOLB 3ZJ5A 3NIGB 1E2EA 2E89A 2HDHA 4L5BA 2I67A 4LDQA 5HK9A 3QA3E 4WT7A 4Y0UA 3QE9Y 1DG3A 2DTDA 3ZDDA 2HJHA 2VR1A 3G0GA 3GQVA 1UMKA 3EG5A 3K8ZA 2I7XA 3GRUA 4YRTA 2ZSBA 1HD8A 4MDEA 3G5MA 3N07A 3W77A 3I9MA 3LKDA 4GR4A 3S3TA 1C30A 1QHYA 2JLSA 4AL4A 2I4LA 3M82A 1B43A 2R751 3HKDA 2PUJA 3JQ9A 4PRLA 3TQQA 3HFGA 5HW0A 1RACA 2XNDD 4CFSA 5DSTA 1UODA 1I6MA 1H3FA 2JVJA 1QLHA 5AUPB 1AU9A 2BFBA 3DUFB 1K0KA 3B82A 4J2TA 1W5TA 2Z6VA 4M1OA 2WMOB 2Z57A 1CC1S 1IZ7A 1MC4A 2FSVA 1OI2A 2X1HA 2XB9A 2SKDA 3S4YA 1YSQA 3SJAA 3WGVA 3HB5X 1DC3A 4ESVA 2HRRA 2KI5A 3RIYA 4C6TB 1M1NB 1OFHA 1UK9A 3HQ4O 1H9BA 3R8CA 3WG9A 3ZJTA 1TZJA 4HQNA 3UQZA 2KYRA 1U28C 2FUG6 5DF7A 3KOOA 2C7QA 2MYPA 3BFDA 5K8LA 2IHBA 4MJ3A 3OD5A 5TGFA 5DBEX 1RABA 4ZYTA 3JYIA 1X7ZB 3I2IA 4BZZA 1SXQA 3VAAA 3AR8A 5EUBA 1LUAA 2AOXA 4Q9KA 3Q81A 1DEAA 1U1EA 5IC4A 3QSGA 3K20A 3GVIA 4L2IB 1QH8B 4ZAWA 3PNMA 4ZQFA 1P0IA 2Y67A 3QOYA 2FZCA 4JC4A 3SW1A 4X9XA 5EMHA 4BP9A 1HZZA 2OCAA 1XDUA 3GGSA 3ZE9A 5JD6A 1N34B 4JYAB 2XA7S 2WYIA 2CNDA 4HWPA 2M6RA 1RTKA 3KPJA 3TIIA 4HFNA 3W9BA 1VLZA 1BGWA 2O2CA 3A1NA 5GHXA 521PA 1K88A 4XYBA 3UK0A 1B2LA 3W34A 4KR7A 2QL6A 2AKAB 3T0IA 5LQCA 1HZZC 3ECCA 1TI7A 1A9TA 1AXGA 1N5OX 1S4SA 3AHJA 1S1YA 5FWYB 1RYMA 5BSRA 4CPDA 2KHZA 2FJ0A 2WZBA 4NZNA 5FPPA 1YLWA 5DTQA 2AEEA 1RPTA 2VOJA 1MX9A 4DJJA 5LMUB 3WYBA 1AB6A 3U4CA 5HF8A 2P41A 2QM0A 3A04A 3UB8A 4O0MA 5KOHB 5C1IA 1BD3A 3HL0A 3P01A 3SLKA 1NZDA 4RSGA 3IS2B 1Y5MA 2IEDA 1V37A 4MNTA 3K4QA 3TL2A 1I2SA 4O4IA 5C4GB 3OIYA 5EESA 4YR9A 1CB7A 4OD0A 4D25A 3GUYA 3QNBA 2P6NA 2PGIA 1QFXA 1WL8A 3JQPA 2CZCA 1PWXA 4UE2A 1BCSB 5HFJA 3TRDA 1AS3A 4G1MB 3P0RA 2ZIFA 3DV0A 2D13A 1NZFA 3AETB 1HE2A 4MCIA 4QGAA 3VAZA 2X14A 3ZU4A 3KQQA 1V6AA 3A58B 3AH8A 3KEFA 4N6GA 4PZ0A 4TWRA 5DB4A 2V1BA 3OLZA 3UATA 2H0YA 1UBOS 1SQGA 5CHEA 3RGGA 4EF6A 5LOVF 3LY5A 3C1TA 1F20A 4WHMA 1V48A 3ZDZB 2C54A 1FJ2A 2OCDA 2ZJ9A 4EJFA 3CWFA 4N1HA 5M29A 4PQFA 3DEJA 1W5EA 3RJZA 1L4EA 1OXXK 1Q0LA 3RSSA 1UBLS 4YINA 2CLCX 2F90A 3AJ8A 3G89A 5CB0A 1UZNA 4WDQA 5LL6P 2IQIA 4EDFA 4G4IA 3H9GA 1G68A 1JR4A 3BQMB 1YZLA 2PGDA 4IJVA 4LXQA 4U2KA 4MEAA 1YASA 3ICPA 4ZV7A 5HUJA 3FJOA 4YV0A 2BI7A 2NVOA 1ESNA 1KEZA 2QN1A 3DLPX 3DLAA