2WKWA

Alcaligenes esterase complexed with product analogue
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
315
structure length
315
Chain Sequence
TPAGPLTLSGQGSFFVGGRDVTSETLSLSPKYDAHGTVTVDQMYVRYQIPQRAKRYPITLIHGCCLTGMTWETTPDGRMGWDEYFLRKGYSTYVIDQSGRGRSATDISAINAVKLGKAPASSLPDLFAAGHEAAWAIFRFGPRYPDAFKDTQFPVQAQAELWQQMVPDWLGSMPTPNPTVANLSKLAIKLDGTVLLSHSQSGIYPFQTAAMNPKGITAIVSVEPGECPKPEDVKPLTSIPVLVVFGDHIEEFPRWAPRLKACHAFIDALNAAGGKGQLMSLPALGVHGNSHMMMQDRNNLQVADLILDWIGRNTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Atomic-Resolution Structure of a Novel Bacterial Esterase.
pubmed doi rcsb
source organism Alcaligenes sp.
molecule tags Hydrolase
molecule keywords CARBOXYLESTERASE
total genus 106
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wkwA00
4JYPA 4B81A 3GROA 2GYUA 3FNBA 2W22A 4BC0A 2HU5A 2OQIA 2ES4A 4MJ3A 2JGEA 4B80A 2WIFA 3AUKA 4J03A 4CG3A 3G8YA 5AK4A 3A2MA 1HKHA 3U0VA 2B61A 2DQYA 5FPPA 1JFRA 1QTRA 1H2ZA 2VF2A 4S0XA 1K8QA 4WY8A 4YX9A 1R9NA 1CUGA 1IZ8A 1QTIA 3WI7A 5K3EA 4DIUA 4DYHA 2DHEA 1YAHA 3PFBA 2XMQA 4JNCA 2VAXA 2Z5GA 5IVDA 5CT5A 5FV4A 5HK8A 1AX9A 1UK8A 3H04A 5CT4A 1YB7A 4BYMA 4NMWA 1EDDA 4A16A 4C4ZA 3HYSA 2XMDA 3G9UA 1HLGA 1QFMA 5LKRA 5ESRA 4B83A 2XT0A 1F0NA 2O2HA 3IUMA 3E0XA 2OQVA 3BDVA 4MQMA 2YASA 3ESAA 3YASA 4DLNA 2GBIA 4OU4A 5FKJA 3LIIA 2QXTA 3KWJA 5A71A 4XIIA 3WZMA 4L3WA 1XQWA 4J0IA 3H0CA 1UXOA 4RNCA 2ZJFA 5ALWA 1L7RA 4H7EA 4ARAA 4Q3KA 1XQYA 2I03A 2HU7A 1U2EA 2QJWA 4JYMA 5DTJA 2HA6A 5K3FA 4TPKA 1JU4A 1BE0A 3Q8WA 1XLUA 5AI6A 3CXUA 4WJLA 2AJ8A 3D3NA 4WDQA 1SCIA 5I8PA 2JGMA 1IMJA 3DYIA 4QWWA 1VXOA 4DSZA 5HKAA 1CEXA 4HXGA 1W4LA 4AO8A 3I6YA 3AJAA 2XQGA 1N5RA 3UMJA 1XRLA 1P0IA 1U8EA 2BUCA 4G9EA 4N8SA 1IVYA 1FFDA 2V97A 1XZDA 3C6XA 1EK2A 1YA8A 1HDEA 3FSGA 2XLBA 2OCGA 3E4DA 4DM7A 3R3UA 5IH7A 1TQHA 5A7FA 5HF9A 2YH2A 1MJ5A 1CLEA 2WIKA 1QFSA 1EINA 3VKFA 2VA9A 4QA9A 3V1NA 4DSAA 1XZGA 5ALNA 2VJCA 1CUHA 2ACEA 4OB7A 3GFFA 1VE6A 4DNPA 5T4HA 4MWSA 3M3DA 1C4XA 5AI4A 1Q0RA 1XZJA 1UZAA 2GBCA 1CUWA 5CMLA 2ORYA 2JEYA 4M0FA 1WHSA 5EGNA 2VJAA 4GBGA 3I2JA 4IQ4A 4QDUA 4B85A 2WFZA 3C70A 5HF5A 4L9AA 5BWCA 4ARBA 5JZSA 3H2GA 3TRDA 1LBSA 1M33A 4EY8A 1DT3A 1CUBA 3LP5A 4X94A 4E15A 4P93A 1EB9A 3W06A 2VJBA 3ANTA 5KWJA 1QGED 1MPXA 3QITA 2OGSA 5SYMA 2RHTA 3EBLA 5HF6A 2X5XA 1P0MA 3KSRA 4WCVA 4Q05A 1ZIXA 3O95A 4BRSA 2CMFA 5ALVA 4QE3A 4ZREA 1W6RA 4ZGBA 1JU3A 2CUTA 3R0VA 3UUFA 4E14A 5LP1A 4BB0A 3H2KA 3ICWA 5EHZA 4OPMA 4AO7A 1ORVA 1X70A 2HRRA 1W75A 4FLFA 5HQ3A 2QRUA 2Q0XA 2Y6VA 4IH1A 1XKTA 2XDWA 1TKRA 4D9JA 4WFJA 4B6GA 3UUEA 2X76A 1XLVA 2XE4A 4FFWA 5JALA 2WUFA 4UFOA 2J3QA 3FLEA 3FLAA 4CI9A 5C8VA 5JIBA 5HF8A 2PSEA 2WHQA 5AI5A 3GUUA 2G5TA 1MO2A 3EIOA 4MQLA 4QZVA 5A2GA 1U65A 5EHXA 2K2QB 2X8BA 4AO6A 2C0PA 4ETWA 2QUAA 5FPQA 1CUEA 3JW8A 5LIPA 4P92A 5ALQA 2OAGA 5EIAA 4PF1A 3M81A 4FFVA 1E5TA 1CIJA 4DMCA 2AXEA 4K6KA 4EBBA 1QIJA 3H19A 1G66A 1X2EA 4GEGA 4QWMA 4K6HA 1CUIA 3WL5A 4OD0A 5T4BA 1K4YA 1NU8A 7YASA 5EFZA 2JBWA 3QPAA 4WY5A 4BCCA 4MYSA 2HFKA 2FUKA 3WK4A 2ZSIA 1T2NA 3RK4A 5ALDA 3D59A 1IZ7A 3QPDA 1UKCA 4FBMA 4G5XA 5FDFA 2BAGA 3QYJA 4RGYA 2I3ZA 2WQZA 1XZHA 5A7HA 3WKDA 1WB6A 4X97A 1BCRA 3WKAA 2JGLA 5E4YA 2VATA 4J3JA 1A8SA 5ALMA 4UFNA 3G9ZA 3T52A 2XUIA 5LZ2A 4X7BA 2XUGA 2XQKA 3IURA 1E8NA 1DWPA 2C7BA 2HIHA 3X3HA 4EY4A 3MUNA 2IIVA 1GPKA 3KDAA 3AZOA 4RE5A 2DSNA 3QBJA 2HFJA 4JUIA 2Y2VA 5AOCA 1DWQA 1HPLA 1J06A 5LZ7A 3IA2A 1AKNA 4Y2RA 4BATA 3WWPA 3FVRA 4H0CA 4PSCA 1WOMA 4FTWA 5AICA 2XMGA 5JD5A 1VLQA 2WM2A 4BAZA 3LIPA 1G5FA 5JYCA 5ALOA 2HHAA 4E46A 3VDXA 1UK7A 3WWCA 4W1RA 1CUUA 4FWBA 2VSQA 1GPLA 3ESDA 3Q0TA 1VXRA 4KACA 5KBYA 4UHFA 4LXGA 1FFBA 5ALIA 1C7JA 5AKXA 4HTAA 1N5MA 3P2MA 2WU3A 2PVSA 4G9GA 1WB5A 4IO0A 3STYA 5AKGA 4P08A 3QMWA 5ALEA 3D7RA 2C4HA 4EY5A 3F67A 4PO3X 1CPYA 2WJ4A 2J4FA 3O4HA 3C6BA 2V98A 4BZZA 3DL4A 1DX4A 1G42A 1EI9A 1XZMA 2G4LA 3STVA 5AKIA 4Y2YA 2XQJA 2JEZA 4FKBA 3I2IA 2WFMA 4UBIA 3MVEA 4J0KA 4CIBA 3G0GA 5AI8A 1AZWA 3ICVA 2ZVDA 1YCDA 3FOBA 2UZ0A 4KR0A 2C58A 4KYVA 2XUHA 1QIMA 2RONA 3FVTA 5JZBA 1N1MA 2WFLB 5D3ZA 2QS9A 1XFDA 2XUJA 2ZYRA 1MNQA 2RIPA 3R40A 5CURA 3WK9A 4B9EA 3TJMA 3V1KA 3O9VA 4BE9A 5SYNA 1X2BA 3ILSA 1IUPA 2OXEA 1ZI9A 3A2LA 4QDZA 1XLWA 4U2DA 3G9TA 3AZPA 1YS2X 1WCYA 2Z3WA 4OUKX 4TVKA 4KE8A 1OXMA 2WUGA 1ZD5A 4A5SA 3WL8A 3H1AA 3O0DA 5LZ8A 1EDEA 5FUMA 5D7BA 5CH3A 5ALPA 2Y1KA 1CUFA 2XUQA 1CUZA 5AM0A 3I1IA 1EXWA 3V48A 3E3AA 5JARA 4I4CA 4KRYA 3FSGD 4UHHA 1A8QA 4AMYA 4CG2A 5IVHA 4XJVA 1MX5A 1DQYA 1UOQA 1ZOIA 2B4KA 4YK7A 1H23A 1YS1X 4Q3OA 1E89A 3BL8A 3PE6A 2QJRA 3S8YA 3C8DA 4GLBA 5AKHA 3WL6A 4QDOA 5AK3A 4X91A 3FCXA 5EI5A 3DJYA 1FFCA 3DNMA 5BWBA 3PF9A 1JT2A 2XUFA 4HVTA 1MTZA 2BGNA 1ZD2P 3VJKA 3STXA 4HAIA 4HXEB 2ZJ7A 5ALKA 4UHEA 1Q0ZA 1SC9A 4CIAA 3I2KA 2ECFA 3OURA 1UK9A 5BOVA 2VEOA 4BTLA 4G4JA 1BROA 1LGYA 2BKLA 3HZOA 1GGVA 3TGLA 4X00A 3GELA 1B41A 3U1TA 5AJHA 2XUPA 3R3WA 1VA4A 2FJ0A 4WDRA 5LYYA 2GZRA 1EVEA 1H2YA 1K6EA 3JWEA 2WILA 2OCLA 5IVIA 2C0QA 4H7FA 1BN7A 3KXPA 1R88A 3KWFA 2WTNA 2OCIA 4BDTA 1PV1A 3ZLTA 4BP8A 5C81A 5A7GA 2PU7A 4Y2UA 1P0PA 2XLCA 3C43A 4Y2TA 2CEKA 1XZIA 1XRNA 2HU8A 5AIBA 1PFQA 5K3CA 2RHWA 4KE9A 4GWLA 1TRHA 1TIBA 1QIIA 1RWQA 4G4GA 1THTA 1KU0A 5A6VA 3HXKA 4Q3LA 5JZ9A 1H2WA 3A6ZA 4IH4A 4Q34A 4QLOA 1LLFA 3H2HA 4U2GA 4X6YA 1GQSA 3HEAA 5K3DA 3DKRA 1W76A 1LPMA 3FYUB 2GYVA 5ALTA 1VZ3A 2B9VA 3OPMA 2WJ3A 2WSLA 4AMZA 2CZQA 4C87A 2OAEA 3OM8A 1A88A 1CUAA 1UKAA 1KEZA 3CCBA 3HJUA 1OILA 1AC5A 3CN7A 3D0KA 4F60A 2J4CA 2AJLI 1SOMA 3QM1A 3DOIA 3B5EA 1TCBA 2O2IA 2HL6A 1J2EA 2OLEA 4G1FA 1CRLA 3LS2A 3ZI7A 5ALYA 1ORWA 4U2BA 1UFOA 1ZGBA 5DNWA 1VZ2A 5DNUA 4RPCA 4N5HX 2C5FA 3G9XA 3IIIA 4YASA 5HK9A 4QEKA 1CUVA 3STWA 1GKKA 4H7DA 3T4UA 2EDAA 2H7XA 3VXKA 2XUDA 4HRXA 4M0MA 3BF8A 4PQEA 4OB8A 5KREA 1YSCA 3WMRA 2XUOA 3RKSA 2QR5A 1ODSA 3MGAA 2ZYHA 4WFKA 1B6GA 4LXIA 3F8SA 5K5EA 4B82A 3H2IA 4Y2XA 5K3BA 1LPOA 2XMSA 1ZICA 1DQZA 3I2GA 1D07A 5KWIA 4EUSA 1E8DA 5DYYA 5FOQA 2PUJA 3EQ9A 4DGQA 4Y2PA 3PICA 4OSEA 1SCQA 1K5PA 4XWGA 3DL7A 5HQ3B 3FLBA 3D2BA 3K9BA 1Y37A 3WA7A 3C5WP 1EVQA 5AKZA 1C7IA 3AZQA 1IUNA 4MEBA 3BXPA 3ANSA 3PF8A 4QDTA 5DTIA 3WK6A 1R9MA 2CBGA 3G0IA 4Y2VA 4AXBA 5E2IA 3BE8A 4UBKA 1DX6A 2WLSA 1XZFA 1Y7IA 2BUBA 4Q82A 3GBSA 3B3QA 4OB6A 1XZCA 1HBJA 2IITA 4EZIA 3VVLA 3DCNA 5ALXA 1XQVA 3ZPXA 4FLMA 1P0QA 3PUHA 2PSJA 5BV7A 1WHTA 4NVRA 3LLCA 3C6ZA 2ZJ6A 3F9CA 2RI6A 4OYLA 1HQDA 3WK8A 3OC0A 4G8CA 1PJAA 2PSHA 4G4IA 4KEAA 4PV7A 1UWCA 1QONA 5CW2A 1NX9A 5AM2A 3FAKA 1E8MA 1ZI8A 3QMMA 3W2TA 1CUYA 4FBLA 4KE6A 2QT9A 1CFJA 5D6OA 4K5QA 4CG1A 1WPRA 4BC1A 4QNNA 4X90A 4ZI5A 2D0DA 4IH9A 4LKOA 4BP9A 3VVMA 3G0DA 1SFRA 4QDXA 4ROTA 2HA4A 3NOXA 4K2AA 2O7RA 3NUZA 1XZEA 3BIXA 1QJ4A 5JANA 3QMVA 4M0EA 4BVJA 1TAHA 3LCRA 2DCMA 4X6UA 3EQ7A 1MX9A 2H1IA 1DWOA 3D2AA 5T4FA 4B0PA 1USWA 4BE4A 5CXXA 1BU8A 3WIBA 2BCEA 4J0JA 1QIDA 1CUCA 1QIFA 1AGYA 4FLEA 2AJBA 4B84A 1AURA 2ZYSA 3FCYA 4N8DA 3JYHA 1QIKA 1XROA 5ALLA 4C89A 2HADA 5AM1A 2WUEA 5FP0A 3SWWA 3ZLVA 5DWDA 1CUSA 4X85A 5LZ9A 3WYNA 3IBTA 1F8UA 4FNGA 1UOOA 1XRQA 4C01A 4F0JA 3O4JA 2JGJA 3O9MA 1WM1A 4ZXFA 3WA6A 5CXUA 4ZV7A 4FNMA 1FSSA 3WK5A 4C6HA 4HXFB 4AN0A 2GYWA 5ALRA 2BJHA 2GZSA 4X95A 1YASA 1FFAA 1XRPA 4N5IX 4CCYA 1O6FA 4E11A 4Y2SA 1DTEA 5CT6A 1G4HA 2VT6A 2DR0A 3RLIA 3MUOA 3EQ8A 1VA5A 3WKBA 3AIOA 4BCBA 1GPNA 3WKEA 1U4NA 2XQIA 4CCYB 4FDMA 1Y7HA 4UBMA 2XMRA 1CQZA 2DFPA 5AKYA 2PKYX 3B12A 5AK5A 4UBNA 3DYVA 2CJPA 1ACJA 1THGA 1W52X 1GT6A 1TCAA 5AKKA 3R3VA 1ACLA 2D5LA 2EDCA 1EDBA 4GW3A 1TCCA 5T4EA 3W05A 2Y2UA 3N2ZB 5HFAA 2JGKA 2DQZA 2PX6A 5ALFA 3E1GA 4BDSA 3WWDA 3DEAA 3WJ1A 2JF0A 4TGLA 3DKKA 1VE7A 2BFNA 3WJ2A 3NGMA 5AI0A 2DHDA 1R50A 3BWXA 5CH8A 1ETHA 4UFPA 1R3DA 2H7YA 1LZLA 5HCUA 1QLWA 2BUAA 4Y9SA 3FBWA 4BVKA 2G63A 4WFIA 1A8UA 2PBLA 4UHDA 3O4GA 5DYTA 3QPCA 5DYWA 4MYDA 1YB6A 3D5EA 3WQHA 4B0OA 2AJDA 4F21A 3WIOA 2ACKA 3WLAA 3HRHA 1Q84A 2G5PA 5IKXA 3A70A 3V9AA 5FRDA 4O08A 4QLAA 2XMCA 1ZJ5A 3O4IA 2WIDA 1QIGA 1L7QA 1W1IA 1JI3A 3W9BA 1UOPA 5AI9A 4ZV9A 4BRZA 5JAPA 2EEPA 4EHBA 4L72A 4IHAA 1DINA 4HZGA 4NS4A 4DNFA 5AO9A 1S8OA 5JADA 1ODTC 1JMKC 4KRXA 3L1JA 6YASA 4DTCA 2WTMA 2RAUA 3F96A 3QH4A 1LPNA 2XI4A 3I2FA 5HKBA 1ZI6A 1IUOA 1VOTA 2CKMA 3R3YA 3HABA 4B9AA 3GA7A 4I3FA 1FJ2A 4UUQA 4UHCA 1JMYA 3WZLA 4Q1VA 1QOZA 1NU6A 1GZ7A 4BVLA 2WHRA 2Y6UA 5AP9A 5YASA 5HZGA 2I3DA 4OU5A 4CFSA 1T4MA 1H2XA 4X93A 5AOAA 3DOHA 4W1QA 5AM5A 5ALGA 2FX5A 1LPSA 4HRYA 1ZD3A 3HI4A 4CCWA 3QVMA 1MT3A 3IULA 3L1HA 1JKMA 1GQRA 4GECA 3F98A 3G02A 1UT6A 3CN9A 4Z49A 2WKWA 1HL7A 1VKHA 4W63A 3RM3A 4GXNA 3IUQA 5CTAA 4X6XA 3I6MA 3V1LA 3WL7A 2Z3ZA 5JAOA 2VAVA 3HACA 4DNQA 3ZLUA 1QE3A 1ZGCA 4EY6A 4EY7A 2WHPA 3FYUA 2QM0A 3DQZA 3SC2A 5JD6A 1A7UA 5DJ5A 5LLSA 2XUAA 1EK1A 5AH0A 2O7VA 3SX4A 1EX9A 1XZKA 3A2NA 5EIHA 4LXHA 4J0DA 1MAAA 5ISMA 4F5ZA 2H7CA 1ZIYA 4W1SA 4BCDA 2QTBA 4ZRDA 5K3AA 4H77A 2Z8ZA 5E4JA 1Q83A 1L7AA 2OGTA 4GDMA 3FYTA 1RYYA 2H9YA 3D4LA 5AIAA 2ROQA 1E66A 5H3HA 5F4ZA 2E3JA 2QZPA 4H35A 1LPPA 3IB3A 1CVLA 5CBKA 1QO7A 4U2EA 4BAUA 4C4YA 3AILA 2RGUA 5JD4A 1MAHA 1R4ZA 2OGZA 2XB6A 4W9RA 2WG0A 1N8SA 2IX9A 5I9IA 1XQXA 4P9NA 4DMHA 2PL5A 1DT5A 3ESCA 4PNZA 5C7YA 1JJBA 4GI1A 3HLKA 2WJ6A 3QZUA 4JH0A 3M83A 4H7JA 2YYSA 3H17A 2OPHA 5JAHA 3CCCA 5FLKA 1LBTA 4DMFA 2WFLA 3WYDA 3WWEA 2WG2A 3BF7A 3DS8A 2HM7A 1F6WA 4PSUA 4K6GA 5LKAA 1JJFA 1CQWA 4H7KA 4AZ0A 2PM8A 2XMZA 4H7HA 3AINA 5LZ5A 1AUOA 1BS9A 3FYUC 1XRMA 1GKLA 3STUA 3OOSA 1LNSA 2GBGA 2GBFA 4AB1A 2R8BA 3IUJA 3EF3A 4UBOA 2VJDA 4GHWA 4EB0A 4J0GA 4U2CA 1XKLA 3L1IA 2VT7A 3C87A 2C5GA 3DD5A 3HC7A 1QZ3A 1KU6A 1EH5A 2J3DA 2O2GA 2ZSHA 2PUHA 4BZWA 2DHCA 1TK3A 2WUDA 2ONCA 5EHNA 1XZLA 1AMNA 5AK6A 1XZBA 5I7UA 3M82A 5A62A 2BGRA 2XQFA 4XX1A 1MN6A 4KE7A 3PFCA 2P8SA 1WB4A 1RP1A 3S2ZA 1EB8A 2FJPA 4RE6A 4BTVA 5CT9A 1MX1A 3R3ZA 2VTVA 3ESBA 1SCKA 3C45A 2JGFA 4INZA 4N8EA 4FHZA 1VJ5A 4FMPA 1ISPA 2OCKA 3I2HA 3IDAA 3V1MA 4C4XA 4G8DA 5CH5A 5C8ZA 5K3FB 5JAUA 2OG1A 4U2FA 1BN6A 4FOLA 5AKJA 2CB9A 1LPAB 4BBZA 4ITVA 4PW0A 5HFNA 3WK7A 3PI6A 4UBLA 2B20A 1OCEA 2V9ZA 1J1IA 1YAJA 5ALJA 3ZV7A 2R11A 2WIGA 3I1YA 5IVKA 2QXUA 4AQDA 2HA2A 2PSFA 1BEZA 1O6GA 3KOOA 4L0CA 2JIDA 1ODCA 1AQLA 1QO9A 2QVBA 5D3KA 3W04A 1F0PA 4AX4A 4G8BA 4OYYA 4W1PA 1XZAA 3K6KA 4Y7DA 4ZWNA 1BCSA 3H2JA 5AKEA 3BDIA 3VISA 4KAJA 4KJXA 3AIMA 2V96A 5ALSA 1CUDA 5JATA 4J7AA 4MEAA 4H7IA 2PPLA 1CR6A 2XMBA 2QOEA 3WWOA 2HA5A 2W6CX 3WKCA 3GZJA 5ALZA 1DU4A 5EHQA 4Y2QA 3STTA 5J3JA 2QMQA 1EHYA 1J07A 3G7NA 1QIEA 4X71A 3KD2A 1MU0A 1Z68A 4EA6A 5AOBA 4AZ3A 3D2CA 4UPDA 2HA3A 1UK6A 4J0HA 5AM3A 4KAAA 1I6WA 4LYDA 2HA7A 5AHXA 3K2IA 1WPXA 4AN1A 3ED1A 3I28A 1ZJ4A 3AIKA 3W9UA 1CUJA 5CT8A 4DMKA 3I6ZA 1H22A 3AFIA 5AKLA 4H18A 4UBJA 2WG1A 4KAFA 1E3QA 1UKBA 3H18A 5ALHA 3F97A 5AM4A 2WHPB 5DLPA 4XVCA 3C8HA 3R3XA 3BIWA 4X3CA 1JJIA 4NZZA 3TEJA 4X92A 1MNAA 2VQ6A 4UHBA 1ZD4A 5CRIA 1GXSA 4J0CA 4A23A 3VJLA 3H1BA 2WIJA 2LIPA 2ZYIA 2I78A 4MXDA 3PDCA 3FWHA 5LZ4A 4PSDA 3N0TA 4HS9A 1BEEA 4MWTA 1EA5A 2AJCA 3ZWQA 5FXMA 4C88A 2PSDA 3NWOA 4LYEA 4DNOA 1BRTA 2QUBA 4JEIA 3G0CA 3OG9A 1K63A 1R1DA 2NW6A 5EIEA 3G0BA 5E4TA 2PU5A 1YR2A 4B7ZA 3VJMA 1CV2A 3DLTA 1XRRA 1LZKA 3IUNA 2WU4A 3RARA 2JGIA 1LPBB 2QKYA 1CUXA 1QIHA 5JASA 1FFEA 3DDUA 5DNVA 1YA4A 2HRQA 4V2IA 4Y2JA 4OCZA 4YPVA 3BJMA 2HA0A 2XUKA 3HSSA 2HDWA 3PUIA 4BAGA 3C6YA 3SK0A 5ALUA 4I19A 5C8XA 3R41A 4LHEA 2Z8XA 3BJRA 3IVMA 3C5VA 2YXPX 3OTQA 4LIPD
chains in the Genus database with same CATH superfamily
2AOXA 2GZ3A 2WPDD 4ZVVA 3ZHUA 3I39X 3SAJA 3DPUA 5CK5A 1B43A 2E4UA 3FKSD 4D4GA 4R4JA 2XMPA 3M1AA 4OQ4A 3CNBA 4ZCTA 2WMDA 4KIUA 5CB4F 4V0SA 2PCLA 2AG1A 3JSAA 1UUFA 2ES4A 4TLBA 2P6MA 4EMUA 1ECLA 2JGEA 2IY8A 3PPVA 5KYYB 5A0TA 2GJ4A 1Y8AA 3DZBA 3HHEA 3RSLA 3OZEA 4QRIA 4B80A 4YPFA 5BVHA 2MYPA 2ZB2A 5JJ5A 1UFVA 3U3ZA 1PNRA 3G8YA 4UAJA 2J33A 3SNHA 4WKCA 3EIQA 2HDOA 2IDJA 3ENQA 7MDHA 4C08A 2QSZA 3CHYA 4YR9A 3T9DA 5TGDA 3TLMA 5C35A 4IIEA 1P7ZA 2DQYA 4YAWA 3I04M 3WFIA 3X1MA 4EEXA 3SJ7A 3ONDA 4D6XA 2GEKA 3HUEA 2VF2A 4F3NA 4IV5A 3K8YA 1VC2A 1HMYA 4AT1A 4PIMA 1R9NA 1VSUA 4Q6BA 2WWVD 1WZNA 1E96A 1QYCA 1QTIA 3Q6NA 2D6FA 3WI7A 4OUDA 4RY9A 4WOCA 1S9DA 1QE0A 3EVFA 2VJKA 4KQ6A 3ZHCA 3VKGA 4DIUA 2DHEA 1JDVA 2FEKA 3QVWA 1PGJA 4DCUA 2GNPA 4FFPA 4QKQA 1XAGA 3CZPA 1ZEJA 2D8AA 2VAXA 2E55A 3ELWA 3EYAA 1PR9A 2Z5GA 4LY6A 1DS6A 3ETDA 4BWVA 4TMTA 1Y9JA 4BNGA 5LOVA 4C6SA 1QG0A 4DZZA 5B7QA 2MSWA 4XCVA 4Z9BA 3VR1A 3ZZNA 5JSFA 3GLFE 2NAPA 3CW8X 2DPGA 3QLTA 3QF4A 3BJZA 3H9CA 4ZYLA 1L0BA 4E12A 3K9WA 2BI8A 2ZBUA 4YMWA 1P39A 5DWQA 3V7FA 2A0FA 4N0QA 4Q24A 1F6DA 1KI3A 2Z95A 2QX6A 4Z86A 2ZUBA 3R77A 2PGDA 4NDNE 1GQOA 5DM1A 4CXMA 4L28A 2JD0A 4GOOD 1R00A 3P94A 4J1QA 5ESRA 1WF3A 4Q9JA 3JD0A 3RK0A 2WNSA 1D09A 1F0NA 2CVZA 2HBYA 3FMOB 4QTUB 4TMWA 3TUIC 2FZCA 4ZMSA 2FSVA 4TL9A 4TV8B 2JIQA 3ROXA 2NTYC 4XAQA 4UOZA 1RLTA 2JLAA 3D7KA 2JI6A 2Z56A 2C96A 3Q3CA 2XZPA 4RSMA 1N5OX 1XEXA 4MQMA 4U5XA 5HE9A 3ESAA 3RQSA 4INJA 3LXRA 3TIXB 3U39A 3UKDA 3K5HA 1HE5A 2DGDA 3QFHA 4JODA 1MC8A 4H15A 3HN2A 4N0PA 4O5OA 2QR2A 1OBCA 4CKCB 2CDRA 1G2OA 1CNEA 1OIXA 2YVQA 5F1PA 5FB3A 4R1TA 4AU1A 4DQKA 2YHSA 2WWHA 4XIIA 2PMEA 3WZMA 1I4TD 1C3OA 1FYXA 1RYMA 4LC1A 3OF5A 3HU2A 2QP3A 4IM7A 4B6QA 2QSJA 4XTCS 2CSXA 1X80A 1EVKA 3H0CA 3LT4A 1CQPA 4EENA 5JS6A 5I7FA 3SHQA 2Q1TA 3F49S 5AMXA 4ZD6A 4RNCA 3KP1A 2XE7A 1UMKA 1UFQA 1O97D 5I4IA 5ALWA 1GU1A 1P6UA 4KQ1A 2QI9F 5GJCA 4LGMA 3KOUA 3RU7A 2PEZA 3LK7A 4FNAA 5CM2Z 4G07A 5SY9A 5CDFA 5KQGA 4KQJA 2GT1A 3HJCA 3INGA 3UB4A 5CLFA 1Z2OX 3L82B 1GPBA 4UZFA 4JAVC 3WYFA 4NOMA 5E1MA 4Z4CA 3B3FA 4R7TA 4Y9UA 1EZ1A 5DEOA 5I7VA 3M5DA 2X2OA 1VGRA 1AOXA 3QOYA 4E5PA 3M7IA 3SJCA 4Z1OA 1HT2E 4FDAA 3H5NA 1CJUC 1QH8B 3E27A 3PLAE 4JYZA 4GUAA 1JIKA 1UODA 2O3QA 2BI4A 4PFJA 5EXSA 3KJXA 3BB4A 4EA8A 1W2GA 4WJLA 2AJ8A 3D3NA 1G8MA 3FPKA 3GFTA 721PA 4U7GA 1UPBA 1U6JA 3QFCA 2PRIA 5CGQB 1VXOA 1QRUA 2FN7A 2RGNA 4F06A 5L4NA 2CLMB 1LTHR 1QFZA 1TU0A 2X9LA 1YJBA 3EDOA 5DP2A 3NM4A 4RL6A 3U4IA 1RFGE 1PZHA 4DMUB 3FE2A 4C4OA 3BREA 3GN1A 1VCIA 1WP9A 1LF0A 4K28A 3VR6D 4RTMA 2C57A 4L95C 4ZOEA 1LQUA 2CNNA 1X7WB 3N05A 2A8YA 3FOFC 5D3QA 3FLMA 4I2NA 5AVQA 4O1HA 3GK3A 4NHEA 1Z25A 3VRHA 1QF7A 1G17A 4HYTA 1XRLA 1D1TA 3JASA 1TNDA 2EARA 4G9EA 1JBKA 2PX5A 2XT6A 3EG9B 3G0OA 4OHXA 4RFSB 4CTMA 2V59A 2V97A 2A9RA 3SICE 4CT0A 1GA4A 1A97A 2WEKA 4TLCA 5HIIA 1KJNA 1MOQA 1YA8A 4BEVA 4RZXA 4DYVA 2ZTLA 3FSGA 3H5AA 1U0RA 2FMTA 4CTOA 2OENG 5IJ9A 3R3UA 2V74B 2XBUA 2Y92A 1GLGA 1TD9A 2CL7X 3WYBA 1DBVO 4NZMA 2FRXA 3FUXA 3BQMB 1QZZA 1FY2A 2WHYA 4JP3A 3NC1C 1Z5ZA 2EL7A 3ANLA 3GMTA 4KO8A 1FX0A 1KQNA 1MEOA 1JW9B 4WUVA 2FG5A 2H9AA 2HV9A 3WDLA 1LW6E 2VA9A 4ZN6A 3BCHA 3T9AA 3V6MA 5HOEA 3QEBZ 3IUEA 1LC3A 2J9RA 4X65B 1ZP6A 2ECOA 2FEXA 5ALNA 4P38A 2Y0BA 2M6RA 3FGZA 4LFAB 2VJCA 1CUHA 2ACEA 4LHYA 4MVJE 2H1HA 2H4HA 1DV2A 3B1WA 1ZUNA 3M5PA 3MERA 4OB7A 5FTWA 3WFZA 1JLLA 3DM9B 1XNGA 3MMSA 1U2GA 3PHCA 1XTVA 4MV5A 4A8JA 4NZPA 5DW3A 2HWYA 3KL2A 4NU0A 4WT7A 1MW9X 3HB9A 1FVFA 1C4XA 4PO8A 1CY0A 4HDMA 4J0QA 1JA9A 2LIVA 4P3KA 5L3QA 1XZJA 1UZAA 4EIWA 5FI1B 4HV4A 2GBCA 4ZOBA 3U40A 3F1LA 1ES9A 3R7SA 3ZV5A 1JQLB 1P1BA 1WZIA 4YRIA 3JARA 3H1PA 3GNLA 5FA6A 2OCBA 4M7RA 2CV2A 1E61A 1OIWA 2PUWA 221PA 4NEGA 2XAAA 1Y3CE 1UDWA 1PK8A 1IH8A 4QDUA 3HWWA 1S3IA 1YKSA 4XFDA 3AL2A 2NAFA 2WWRA 3JPYA 3Q5EA 4TM8A 1NUHA 5BOSA 3DUFA 1WUIS 1QAMA 2J3HA 4X61A 3OF2A 2PCJA 3D5TA 1SCUB 4MS4A 3TRDA 1LBSA 2CMDA 4DC9A 4EMTA 2J6IA 5CFQA 2BE7A 1CUBA 1NPTO 3KOYA 3LP5A 3LT0A 3PGMA 1KZ6A 4P93A 3SXUA 5BYBA 3AEQB 2NU7A 4FWIB 1HLDA 3KOXA 1RLIA 3LOUA 4MRRA 5JJBA 2VJBA 1MHTA 2GBPA 4X7MA 3VA7A 3RYFB 4MRMA 4E5NA 3OUTA 3ZNPA 2QT0A 1QS0B 2VG8A 1DAFA 1QGED 4CN8A 1EXMA 1H0HA 1MPXA 3HYLA 4PBSA 3LBYA 2UVDA 3M6AA 2OGSA 4ZYWA 4BFYA 2ANBA 2QHXA 3EBLA 1PN3A 2YQZA 3BGVA 3EXEB 4YRFA 3QHQA 3DP7A 4BGUA 2VPPA 4DMGA 3KSRA 3DPIA 5HUHA 1YD7A 3GWGA 1QV7A 2OXRA 4J6FA 3HA2A 4FFSA 4WHMA 3RFUA 3RS4A 2CNWA 1EJ2A 3VSCA 4Q05A 3QG5A 1L5VA 3V33A 2E5FA 1KO4A 4BN4A 3IJ5A 1CSEE 2ZJYA 3DDCA 1WXHA 2YL2A 3PDIA 5I8ZA 5CDUA 2WA1A 4L9WA 2VHXA 2CVPA 2XGSA 5C5EA 4MS1B 4XM1A 5EJIA 2VQDA 4WESB 5JSKA 3WQSB 2YR0A 3ILYA 4TYPA 5DGCA 1AKTA 4O2AB 4F2DA 1FXSA 1NI4A 5G0TA 1JU3A 2VKTA 2XD4A 3PEYA 3AVWA 4JT8A 3GFRA 3UT6A 1JSCA 1T5HX 1U5CA 2B5OA 4G1UC 3DWIA 1DQRA 4DEXA 2ORIA 2ZBRA 3CPEA 1F5SA 4KRFA 3VU3A 1XP8A 2HRRA 3DEHA 4QGHA 5H81A 1QHXA 1GN8A 3ZQKA 1E7QA 4MS1A 3PUVA 2ET6A 2Q0XA 4BFTA 1Z4OA 2CJWB 3OLCX 3SIWA 1G7CA 4CM7A 3E9ZA 4M9RA 2R6R1 4XSGA 1SKAA 3OEYA 1CLUA 4HTFA 4I3GA 4E13A 4V1CI 2NSDA 3WBKA 5IKMA 5JSZB 1VPEA 4G0PA 5TMEA 3AHEA 3KOMA 3I1FA 5CNMA 3GDGA 5JC1A 3EIHA 2VT2A 1ADFA 1PEAA 2X76A 4RMHA 2XE4A 3IUPA 3IQGX 3QYFA 5BV1A 1R8JA 2I7TA 2PIAA 2J3QA 3AEXA 4DADA 4OMUA 4J0EA 2VS1A 4W5QA 4A0GA 1OC4A 1PSDA 2C31A 2ZUSA 3FW1A 5HF8A 1T8SA 3T0FA 4TKVA 2PS0A 3V7YA 1Z13A 2PSEA 3E15A 1MGOA 4JR0A 2WYHA 3DZDA 2BH9A 1MO2A 1CR0A 2J85A 3C3KA 4UHJA 3R7BA 3EIOA 1PIWA 5K0ZA 3HUTA 1E2PA 1FU8A 1FRFS 3KPWA 3NVDA 4M9CA 4QZVA 5EQJB 4V1CA 3BGDA 4ALNA 2X8BA 4AO6A 2NSYA 2C0PA 1RPTA 2J6CA 3FHCB 5B55A 2QUAA 2PY6A 2YXLA 4MW2A 3HZRA 1KYVA 4WMLA 2QY9A 3BL6A 3CUVA 5LIPA 4MVJD 3LVFO 1XT6A 1MPTA 4D4KA 2QG6A 3B6KA 1T6YA 2YW2A 1AHHA 1P9LA 5AUPB 4YJGA 5IM5A 1O03A 3C3EA 3FROA 2PWBA 2JANA 4RMIA 4GI2A 2ZUUA 5GV7A 4KPEC 1CIJA 4J75A 1Q14A 4J90A 2YKGA 4DMCA 4BLSA 1Y5IA 4KXNA 1DJMA 3L0SA 1Z22A 1QGUB 3B2QA 1YZHA 4RIFA 1QIJA 3IMKA 4WD3A 3OQBA 1IEWA 1VM6A 3D8HA 3TLGA 2VP0A 4AZSA 3VBEA 2QR3A 4JLOA 4P36A 2XCTB 4I5GA 4IUYA 2IJGX 5LP6B 3BKXA 3GBVA 1SXHA 5KNCA 3K6JA 1SH7A 5KNDD 1NDQA 3AL3A 3BERA 2R1VA 3BBPA 4TTVA 1CQIA 1MB4A 2AN9A 5K3SA 2W2XA 3EVDA 2IXDA 4DLSA 3TXYA 2P90A 4WOJA 5C34B 2V3VA 3M4XA 1DOZA 1RYNA 2B8NA 4EJ0A 4L5JA 1NG1A 4B4WA 5KOJB 2HFKA 3AVXA 1V16A 2GPSA 2FUKA 2YNMC 3BRWD 4MV9A 4CMKA 1AHPA 3UAGA 1OASA 4B7UA 1C9KA 3WK4A 4H08A 1JVNA 3UB2A 3RK4A 1Y6RA 4MKHA 5FWYB 3UGTA 3FOAA 1YI8A 4ZEMA 2AR0A 2DPHA 4YA6A 2PMCA 4Q9HA 4GNRA 5CX1A 4G5XA 1TEHA 5FWAA 3MUEA 4C7OB 3CLRC 4P2GA 3TOZA 4RGYA 3C16C 2A78A 3B7WA 1NBIA 2JRLA 1N5DA 2AQHA 5B7PA 4ZEWA 3R9XA 2CVQA 1FW6A 1NV8A 2EFDB 4LHVA 5E4YA 1ESMA 4J3JA 4HDAA 1AN0A 1AB5A 3KD3A 1W4BA 5I5GA 4Y30A 1G2IA 3O91A 1T9ZA 4OHMA 2BMJA 3DLCA 3ND7A 4YWHA 1KZHA 3FIJA 1IONA 3B8HA 4B8WA 4H59A 3IURA 1Z0ZA 2PXAA 5HMLA 2O8EB 4M60A 4V3BA 4U00A 3RSOA 4AUEA 2W83A 3ASUA 2IV7A 2YJNA 4OHCA 1D2EA 2WYIA 1JSZA 1EE2A 1I2DA 2HIHA 2VPIA 3X3HA 3MUNA 1D8AA 2E49A 4MRNA 2PJDA 1GPKA 2AYYA 5C52B 1SC4A 3DW1X 1DXHA 3O8RA 3N6XA 1LDMA 3A37A 2RHCA 4X1YB 2J32A 2QZJA 2IOFA 3DHNA 3AXSA 3UJ7A 3GLGB 4OK5A 1H2FA 1A4UA 3LT5A 2A1TR 1KFCB 2PX4A 4IXDA 5GV8A 4B73A 4FDLA 9LDTA 4NMMA 2WJZB 3W5UA 3QVJA 1XMXA 3HY4A 3N2LA 1KOFA 3O1HB 1BZYA 3L0CA 1CDOA 4Y0NA 3UJ3X 5MFZA 1BDHA 3U4GA 3RWBA 3W4IA 1JWAB 2ALJA 3HKEA 2C9OA 3KFVA 5JZVA 5KTRA 3C39A 1MT0A 4RDHA 3FVRA 2V6BA 2HNAA 3SFZA 1B93A 2WP8J 3L02A 3BMOB 3KVYA 4LW8A 4OATA 3TX2A 4NFSA 2N46A 3N39C 4H9GA 4WKNA 5JD5A 1GD1O 3JWIA 1DELA 4P98A 1M34B 3DM5A 3H3XA 4F2PA 2PD6A 4JY7A 1QG4A 1ZGGA 3A4VA 2CEAA 4M1KA 3LIPA 2IW3A 4KV9A 1V9SA 4FMDB 4XYMA 1SHKA 3QF4B 2J5BA 3RS9A 5JYCA 3R8FA 1EP2B 3ONFA 4URYR 4BUCA 5C0OE 5JXHA 1XLTC 3GFVA 4RVHA 5ALOA 1YKFA 3PEFA 1X74A 3DOJA 3FX2A 5GVSA 1DIHA 4BFCA 3UK0A 3ZUPA 4JP1A 1XWWA 3VDXA 1ZIDA 3QW4B 3ZZ1A 2B25A 4P8RA 3I32A 4RK6A 2I6SA 4AWBA 1GPLA 8OHMA 5E8JA 4KUHA 2QRHA 3ESZA 3VC1A 3U49A 2ZZKA 3DWEX 3PA8A 2YJ3A 4L0MA 4L8FA 2HR1A 1C7JA 1QCZA 1XZNA 1XVTA 2JIZA 2W8BA 3I42A 4QJBA 5ECDA 3SBOA 5C7IO 1N5MA 3PNVA 1WIWA 4YXFA 1HY3A 1QK5A 3R75A 2XODA 2AJTA 2X14A 1JJAA 4IO0A 1N6PA 1G8SA 3CE6A 3TEFA 3GEHA 3LWBA 2BD0A 5HRUA 1X0VA 1TGYA 1E3EA 1FSFA 1S3SA 5IYZA 4ZZIA 2WDZA 4EY5A 2O8DA 3JAKA 2YDYA 1CPYA 3P19A 4PO3X 4JFAA 3KQHA 1I3OA 3O4HA 1VPTA 3M0EA 3U48A 3QIVA 1IVNA 2IXEA 4LNHA 4JVNA 1JWLA 2IBTA 3CEPB 4N5LA 1T6XA 2VAWA 3BRSA 3EAFA 3ESYA 3FNIA 3IT0A 2ZBEA 3MJEA 5E9AA 4EYSA 2I4OA 1EJ0A 3TPCA 3KT8A 4AP6A 1NR5A 3COZA 3ZVLA 1T3GA 4Q7QA 2BMDA 3HWSA 3CRW1 2ZRCA 4JVLA 4KH0A 1OB2A 1TYAE 1JHVA 5SYAA 1HLPA 2XA9A 2YC4C 4CMEC 1UPCA 3I2IA 3Q87B 4URZR 2CNWD 1V0JA 2EKPA 3D3JA 3LH5A 4B3JA 2UV8A 2H48A 3W3AA 1CBUA 2D59A 1ZY2A 2PXXA 3T3PB 4DUPA 5B2ZA 5CHEA 4NENB 3CPJB 4MW5A 1OXBB 2E6UX 4YMLA 3VYWA 7ADHA 3L4KA 3NI2A 2I2FA 3HDTA 1W49A 4I9FA 1ZL0A 1J2TA 2ZAMA 4BXOA 3D6FA 3B13B 4PHTA 1V5FA 3FOBA 3UAWA 4GP9A 4Y6LA 4YLGA 1UBCA 2QLFA 1QIMA 2ZRLA 2OBMA 1HSOA 2RKOA 2VPWA 4DKJA 2QRZA 4RPKA 4HQNA 1N1MA 5H68A 3AF4A 3RB8A 3LD9A 4DVJA 1UM9B 3MGKA 1QC5A 1DJPA 1HQKA 2MMGA 3NCTA 4KCGA 4ZIRB 3LVBA 4LZOA 1JPJA 1CZUA 3HRKA 4PZPA 4NWIA 2YHAA 2BGTA 1Q1AA 2EZ9A 2GD1O 1M6HA 2O1WA 2EFHB 3A6EA 3SE7A 4D3ZA 3ZLBA 2PANA 2V0GA 2NSJA 2QMEA 2AR7A 4FR2A 2IUUA 2ESRA 1FTSA 2PQ6A 1DX9A 2C4UA 2OCDA 2PGLA 3DXZA 4KG7A 4MGKR 2VOJA 4D41A 3BN3A 5C3MA 3KR0A 3R40A 2JB9A 3NIFB 1KSGA 5KZMB 1V5EA 2JGRA 5CURA 3WK9A 1YU6A 3GB9A 4F84A 5IPFA 3LCMA 2C03A 5C5CA 1C9NA 3B85A 3IBGA 4MLPA 3ME5A 4NONA 3MJDA 1C1XA 3OQHA 4PC7A 4KQ9A 2QZ9A 2PJRA 3WY9A 1G5PA 8ATCA 3OQMA 4P0TA 3G9TA 4RHYA 3AZPA 2P8JA 4FQ5A 5BN4A 1WCYA 2VXCA 1E2FA 3KVVA 4U7DA 4JI0B 1FMCA 3DE5X 2ONKA 3OQ1A 5F35A 4XSHA 1E20A 4OUKX 2WUGA 5LD2C 4FE7A 2XYQA 4DRZA 3BIFA 4DDWA 2ZSUA 2QAJA 1SKMA 4NRDA 1XVVA 4EVQA 2ZZMA 2RH9B 1SCJA 4WNAB 4FU0A 2O8CB 3CNQS 5CJ2A 1RKVA 1PP4A 2GERA 3BFXA 5LZ8A 4OQYA 2XNKA 5DN9A 5FUMA 3KO8A 2GAOA 6PFKA 1QDLB 1S4QA 4J2HA 2Q5OA 5KJEA 4CU2A 1RRCA 5HGJA 3JQQA 2OB2A 4R1UA 4GNKA 1CUFA 2HAEA 2YFYA 1CD5A 3P2KA 1QK4A 5J2TB 2GLTA 2A59A 2JGNA 3I1IA 3L4BC 3ZC3A 3ZWOA 1E63A 1EXWA 3EVGA 2HPVA 2WI8A 4BJ1A 2O20A 4G0YA 3CZQA 5FJJA 4D6YA 5JARA 5ITVA 3IXMA 1A8QA 4UHHA 2A92A 3R8XA 4AMYA 1KQOA 4HYEA 4EW6A 5JOQA 4XJVA 1U0SY 4O59O 4WKGA 3TL3A 4XJXA 1EVZA 1RAIA 1XDBA 5CVDA 4BY9E 4HT3B 3MHTA 1OYOA 1XDZA 2B4KA 5B53A 1WUJS 1FQOA 4W6QA 2NZWA 1T4CB 1VMIA 2GN0A 3OWOA 4RESA 5KYUA 3X0DA 3KT6A 1E89A 2RC6A 2B0JA 3BL8A 4KVZA 3ZY5A 4I1SA 4OLJA 4R1PA 1L5HB 2CK3A 3MB5A 3MT9A 5F5NA 4BNYA 3T7KA 3D4NA 3K9FC 2XCQA 4G24A 2QJRA 5IT9A 3GMIA 3IRUA 4JLBA 3W90A 4ZOLB 2G04A 5AWFC 1NTOA 1H0RA 4QDOA 1ZFNA 4HCJA 4DNXA 3TZCA 5L45A 5FX2A 1X80B 1KOLA 2ZR8A 4S35A 5FNVF 3SKVA 1M0EA 2WD8A 3QQPA 4X91A 3P5SA 2I76A 5HZKA 1A50B 4JQOA 2HIGA 4MWBA 4DE5A 3B9RA 5EZQA 3S2UA 3W2FA 3ZGNA 3DJYA 3DNMA 4CF4A 2O54A 4Q93A 5TVGA 2FB9A 2QUKA 3PF9A 4ZC1A 3QEOA 3WGJA 4PLHA 2DUMA 4KAXA 3KEGA 2A0UA 1ZH6A 3K94A 4B8YA 2YWDA 3LFTA 2OC9A 1MTZA 3A10A 1M34A 4NCBA 1EAMA 1X1CA 3FVVA 1PUIA 3R74A 3O26A 1PT7A 2BSAA 3HUFA 3L6RA 5IULC 4UEQA 1GAXA 3BL5A 4D80A 3OJEA 3BGOS 4ML3A 1IY9A 2V3WA 4IKPA 4UHEA 3WL3A 4CV1A 3T1VA 1SC9A 4CIAA 4F6LA 2QLBA 1U7PA 5CA1A 5CVJA 4RVDA 1CS4C 2FFHA 3LKDA 3S1AB 3IQXA 2I22A 3MWKA 2OD7A 3N8NA 1KJZA 2VEOA 1X7WA 1BROA 1LGYA 2HCJB 3IMEA 3IPCA 4ZJZA 2BKLA 2ZUTA 3UFXA 3RRJA 2AW3A 3QJGA 4TWJA 2OCXA 1T1SA 1XCPA 5D86A 3VAZA 4DCVA 5F7XA 4BZXA 1WCV1 1NN0A 2VUSA 3CUTA 1DBIA 1PDVA 4I1PA 3HB1A 3T95A 1D5WA 4C6TB 4LJ5A 3AEKB 4O2BB 3E5MA 3TW8A 4WDRA 3U3MA 4Q02A 4HB3A 2DT5A 2GZRA 4WUTA 1IBLB 2A3NA 4OXYA 2JAOA 4PYLA 3JWEA 2RJOA 4YV7A 1A4IA 2C9MA 3F78A 1Z26A 3NYRA 1IEVA 1LQTA 4IIXA 2GZ2A 4DKXA 1XTUA 2D74A 2DWQA 5KWSA 1UWKA 4PQGA 4H7FA 1I6MA 1BN7A 5A3VA 4ZGGA 3E22B 5K99A 1IB6A 2LKCA 3ND8A 2YW9A 5ARDA 2DUUA 3EVZA 3AI7A 3I73A 3KJHA 3T9FA 3DZKA 4DLZA 3NGLA 4A0RA 4D56A 4HAUA 4GS5A 3MJ4A 2OCIA 1CTQA 1PV1A 1E1DA 2JHPA 2V03A 5HJ7A 2WJPA 2VYCA 2YWXA 4O4IB 5JWOA 4Y2UA 1P0PA 3A04A 5EP3A 3B9QA 4RHCA 4RVOA 1OZAA 2PV7A 2A9VA 4JL8A 2FQXA 3QF7A 4Y2TA 2GBLA 5CXQA 1Q0LA 3D8NA 3B2NA 2ZSEA 1QDEA 2TMGA 2IXBA 3KE9A 4IJVA 1JBQA 3KQVA 2ZAGA 1PFQA 1U0TA 1XTPA 3GL9A 1NW5A 2RHWA 4MGIR 5K3CA 3X2SA 4UVGA 4HNRA 1UBNA 3K15A 4G4SO 1JVSA 2ZI9A 3HJBA 1TIBA 5CNJA 3DGFC 1OPRA 4D46A 1W5EA 1NY5A 4MNTA 1OXVA 1THTA 2XR1A 1FTNA 4OIMA 1HSZA 1U28C 1NN1A 1T26A 4MYTA 4EJSC 3GHHA 2R6ZA 3A6ZA 1JQDA 3H2YA 3RC3A 2D4AA 2GX6A 4ENTA 1I4OA 5HTKA 4W99A 3C3YA 2HK6A 2W8ZA 2BEUA 3RRBA 3RV4A 1CR1A 1GQSA 4H1VA 4X6YA 2I9KA 2ID9A 4GUDA 4PC3A 5A05A 5KOYA 4A2WA 1UZUA 4EDHA 3IHKA 3K9LA 1SAYA 3FYUB 4LWPA 3LF2A 3NM6B 2JVJA 2ATCA 2GYVA 5DNWA 3M49A 3OPMA 2LCQA 4CTKA 4DG8A 3GPIA 3IUSA 2J5QA 1A2BA 2W42A 2WSLA 3UK2A 4RTJA 3G8DA 3H75A 2WWIA 3HLYA 4R1LA 1YOVB 5EE5B 3EH1A 4M2LA 4MV7A 3B52X 2CE2X 2G8NA 5FO0A 2XVAA 1C14A 1PCXA 4H60A 3IQDB 4MA0A 4RZHA 1KDZA 5JS1A 3CN7A 1Z33A 2WSSD 3D0KA 3MM4A 4CM9A 1WDLA 3VH2A 3O21A 1LRJA 1JKFA 2XDAA 3A14A 3P0JA 4NCXA 4WZBE 4Z54A 1SOMA 2C2ZA 5KDOA 4G0UA 1GWNA 1SXGA 4MWGA 4ZYTA 1TMKA 4CMBA 1RJ9A 2FW8A 3A6DA 3B5EA 4HH1A 2G9QA 1XMJA 1HDOA 4BV3A 4I6EA 4WEQA 1Z0JA 3CF2A 1XG5A 5KAPA 2O2IA 2HLDD 4F2HA 1T36B 1JHUA 1GTMA 2WJAA 3MTQA 1KJWA 4KKXB 1TJ5A 1EVYA 4YS6A 1NE7A 1ADGA 3ZI7A 5ALYA 2PFSA 4FFRA 3ZY6A 1AGNA 4RK4A 3SM3A 3L8EA 1RP7A 5HUQA 4IZIA 3J80A 1K6JA 3IVGA 1VZ2A 3LHSA 1HFKA 3I9LA 4LI0A 2CNBA 3B9PA 3KTAA 2NM0A 4MP6A 3N2GB 3ICEA 2I5PO 5KDLA 1O95D 1Q77A 1NVWQ 3A8TA 1AZSC 1O89A 4PLVA 2HCBA 1QRTA 4XGIA 4NOLA 3ZWVA 1Q1GA 1T9CA 4BPBA 4DWOA 3SJZA 2Q6KA 5KDDA 3KHKA 2CFOA 3VXKA 2XUDA 4AVYA 3RVPA 4B40A 5JU6A 3QLEA 2TRSB 4QNMA 3SZGA 3BKWA 4OB8A 1XU7A 4Z0TA 3VX4A 3M9LA 3MWYW 4R2MA 4RUKA 1L1RA 2GM3A 3VU9A 3A7DA 1KSHA 2C97A 4KUEA 1E3DA 2Q4OA 3KV3O 3WYCA 3VSEA 1HNNA 4WFKA 3WMWA 4B4UA 5DSXA 4AMVA 4PONA 5JSQA 5FL7D 4HF7A 4EA9A 2HPAA 1NBEA 4FDVA 1K68A 3PZRA 3R7LA 2B83A 3L79A 1CDEA 5K3BA 3V8PA 2L19A 3I9KA 1JPNA 1H6BA 3HYNA 1YC2A 3T12A 1ZICA 4Q6WA 1MO3A 1DQZA 3OPQA 1G6KA 3CF6R 1N77A 4NQRA 4TTAA 3UA4A 4NR0A 2UUOA 3TIVA 3ZNNA 5E2BA 4XUCA 1Y5RA 2PL9A 1E3IA 2Q1YA 1E8DA 3MIIA 4PBTA 1IQPA 1N25A 4OJYA 1NQWA 4OQQA 5DB4A 3RTBA 4DLLA 3HP1A 2HUPA 2Y9MB 1NWHA 1MOSA 4X3PA 3PICA 2Z30A 4F6RA 2R8ZA 3RUIA 1JQEA 3ID6C 2H1LA 2GF9A 2QF7A 2X13A 5HQ3B 1QYDA 1G21E 3GRRA 1CERA 3ABOB 4BFVA 4DXAA 2BP7B 4EF4A 4OJKA 1SZPA 3K9HA 4QQFA 3D2BA 3PVSA 2VLBA 4HDSB 3AX6A 1B0PA 3WA7A 1E4EB 4BEJA 1YZUA 2Q0SA 3DFMA 4J4BA 3QU2A 1C7IA 5AKZA 3MFQA 1YDWA 2A0KA 5KNCH 1WX1A 1OX4B 3HXTA 3PQ3A 4LXUA 5IJ9B 2B98A 1NVBA 1XTKA 4WCFC 2H63A 4GLFA 4WA8A 5DTIA 2X8LA 4DA9A 1JT9A 3A06A 5K09A 4EKDA 2DH6A 3EGDA 2RHLA 2EG5A 3PFFA 3GZNB 4FGSA 3A3KA 1KARA 2WLSA 1I0ZA 4TWAA 2BHLA 1XZFA 1Y7IA 1N8KA 1WCIA 4H4CA 4ZQHA 3U3DA 4R3NA 1BKYA 1NW6A 1XDGA 3HVKA 3HCRA 3OTHA 5IKOA 4HWOA 2VRCA 4GP6A 4N9QA 4TLDA 4L1KA 2IITA 3BTUA 4C04A 4EZIA 4HB0A 3PV0A 1XQVA 4FLMA 3R3HA 3QFFA 3JQ7A 3KZVA 2WU8A 4DHWA 4PHGA 3UW3A 5BV7A 1DC8A 4PG4A 4YMTA 1QX3A 2G9ZA 3ZG6A 1NR7A 1ZM4A 3HL4A 3LFHA 3G59A 6REQB 1YZ3A 1C9MA 1CE8A 4OYLA 4R1NA 4I81A 3DEKA 1GL7A 3ENZA 5IBQA 4G8CA 4A0HA 3ORSA 5AW5A 2N42A 2BKUA 5G0WA 3EZ7A 4KEAA 3UMFA 1YL7A 5IBCA 3F2VA 3K30A 5C31A 1GNLA 3GLIA 5EQFA 1QONA 1NUAA 3CSSA 3O1JC 1PE0A 5JAMA 5E1DA 1T1GA 3Q9NA 1M2VB 3OTIA 4WVLA 1PX0A 4JLVA 4RTQA 1U5BB 1EAYA 1NMQA 2JIBA 3IERA 3IHLA 3ZE8A 5ENVA 5JAZA 1NBME 2BFPA 1XK6A 3CUEF 3JYPA 4ZDJA 5CLIA 5KJFA 4L8LA 4CG1A 3ZZ0A 2C2YA 2QM8A 5I7SA 1WPRA 4BC1A 7ABPA 2UZ1A 4X90A 2DWCA 3DMPA 1OFUX 2BJWA 1FLDA 4KL8S 1BC5A 2MTBA 4LKOA 2EZTA 5BSWA 3I9MA 1U1IA 3I5YA 1DHTA 3VDMA 3VVMA 2TMDA 3C1TA 2JD2A 3SNKA 1R0CA 2YV5A 1PDWA 1SFRA 2I80A 1K3FA 1K8YB 1ZX1A 2NO9A 3FWPA 2IZ7A 2VSFA 4K6OA 1VYTA 5C9ZA 3PEEA 4I6GA 2OEPA 1NW4A 3HB7A 5IXYA 4DR3B 1E1LA 1ML3A 4TL7A 1CDDA 1T5OA 4FGJA 1A98A 1QJ4A 2Q5HA 3H5VA 3R6GA 4IZ6A 3QMVA 4Z0HO 4O2BF 2NO1A 4UDXX 5JD3A 4Q4CA 1ZA1A 3CO5A 3IQHX 4GXTA 4LJ7A 2I34A 3P2YA 3CEHA 4BVJA 3KUUA 1TO6A 1AXRA 3INYA 4IQ8A 2OZLA 4B3IA 2D1YA 4AECA 3HB0A 3N74A 1DWUA 3AQIA 2NWQA 3EQ7A 1MX9A 1YQUA 1YQGA 4JXJA 5C4MA 4EUKA 1Z29A 5DCYA 1GJRA 4F04A 4N7MA 4DQVA 1WSWA 2XZDA 3TKLA 2YCLA 3T41A 1E98A 1BU8A 2AN4A 2P3LA 3A1UA 3RJ9A 3NPMA 1VL0A 4A03A 3SC2B 4FUQA 1VLVA 5L3SB 3NALA 2QN8A 3MBIA 1QIDA 1CUCA 2TECE 1F38A 1AGYA 3V8BA 1Z5OA 5LYJB 4N8DA 5I9MA 3JQBC 4GL4A 2VVTA 3SXUB 4EVIA 4Z0NA 4B3DA 2F7SA 2K6GA 2WJYA 5ALLA 3LUDA 4MUHA 3S2IA 1QVZA 4O4LA 1PTKA 2HADA 2IXFA 2GEJA 3QPUA 1BOFA 2XYPA 1VBKA 3Q85A 2A9QA 4Q01A 3GO4A 2EBUA 5FP0A 1RJ9B 2ID4A 2DBRA 3ZBQA 2FEPA 3SHFA 1P1RA 3K1AA 4AP5A 4DBLE 1P19A 4BMYA 4S05A 1MORA 4I50B 2C4NA 1ZBQA 4NNOA 4O4HA 2JDIA 1I2CA 3EUFA 3PC4A 4URHA 1Z2PX 4X85A 3NKLA 3RK1A 5EJ7A 1TUBA 4CIDA 3L7NA 2XCOA 4BJHB 1WMFA 4CLOB 2QTZA 6ADHA 2C4TA 1Z62A 4B47A 3BB1A 2QPTA 1XTZA 4A8JC 2DECA 1U2GC 1WXFA 3D4OA 3FKQA 3KTAB 4CKEA 4D5EA 1I2MA 1KDPA 1Y98A 3O4JA 4KR2A 1CT9A 2LCFA 2R8XA 4IDCA 2GPNA 1D7AA 3EZXA 3WA6A 1Y1TA 2CY0A 2WHEA 3NIBA 1Z5PA 1Q6YA 4HAZA 1T2FA 2ERXA 1M72A 3L6BA 4FEGA 4C6HA 1PJ4A 4CG0A 5CITA 1GVNB 1KBQA 4AN0A 2WSSA 3WJAA 4CM9D 2GYWA 5IW8A 2O3UA 1DG1G 4HJXA 4M46A 2BJHA 2GZSA 2IYNA 3UAZA 1V7QA 1HDZA 4JI7B 2MSKA 3DMNA 3E82A 1CR4A 1A9TA 4V0KA 5C8YB 3OT5A 5KNBD 2H16A 1SA0A 1PT6A 4CDGA 3S8MA 3H2SA 3E8SA 1SBZA 2O6LA 3OZWA 2GKGA 3P26A 1BU5A 1DAEA 1Z6ZA 1Z8DA 4G5FA 3MLAA 2XEXA 4DQ0A 4YXWD 3DONA 3HU3A 4WECA 2ZE8A 3A9RA 1O6FA 2ECQA 1UP7A 4PPGA 1P2UA 4ETIA 5DI9A 2OGUA 2II6A 1KORA 1QQ7A 1G1MA 1EBFA 5CT6A 4BX0A 5CLHA 3OCVA 5GPBA 1M6VB 3T7TA 2ZRPA 3NH9A 4ZZ1A 5KVCA 5IK2A 1YHZA 3C8ZA 2AGVA 2G6BA 2C07A 3W4KA 3AIOA 1Q1BA 1NXVA 3UN1A 4BCBA 1GPNA 4COKA 2GQ0A 2QK4A 3JWJA 3F90A 3N3BC 2K4MA 3F4LA 2EW1A 3HBLA 4A36A 4KU4A 5KUTA 1N2JA 1N0VC 1Y7HA 2PT6A 2I91A 1L9XA 5HX7A 1ELOA 5HDBB 1K9SA 4A6DA 1ZH8A 3L9WA 1ZJWA 2O3RA 3EOAI 5B58T 3GV0A 5LBIA 4KXQA 4WZBA 3N3AC 2ZSAA 3I30X 2AC4A 4LEIA 4U7PB 1GZVA 3BVPA 4XTRA 5EJMA 3NBYC 2O19A 4G26A 4HQFA 1I3CA 4Q9IA 2ZKLA 1C80A 2RHHA 4YFVA 2ZIFA 4D0RA 2I6XA 1J0XO 1Q0QA 2A6PA 2AF3C 4UVDA 1KEVA 3FYCA 3WIDA 4DY6A 1XGKA 2ZXUA 5TV2A 5GVRA 2D5IA 2OOKA 4J9VA 2FN9A 3JQ6A 4WBXC 16PKA 3TAUA 3KEQA 5C7OO 1DFHA 3LWDA 2OY0A 4IF4A 4BQFA 5CFNA 1A9ZA 2QVYX 2V0CA 4FJ1A 1M34E 3ZDEA 3PEWA 2OA0A 2EBHX 1KYWA 1LEHA 3M6VA 3FI9A 3PQ8A 2XOXA 4GQIA 4NOKA 3SHTA 4CEJA 4GW3A 5T4EA 2N3ZA 3ODPA 4TKZA 2WJHA 1F8XA 1R9GA 1SKYB 2G3YA 3DXFA 5FT9A 4CFZA 3E35A 1Z7WA 2JGKA 4BQNA 4DCOA 1XYVA 1Y5LA 4LJLA 1XDSA 4FCVA 4C3OB 4WQMA 4AZ3B 4A8HA 2Q0QA 3OT1B 2PAAA 3VR3D 2V4ZA 2VJMA 4DV1B 3W78A 1V71A 3D7SA 3OHMA 3H9EO 3D0QA 1IBCA 3E5NA 3DEAA 4RJIA 3W04A 1AA6A 3R7NA 5I3ZA 1D3AA 3ONNA 1NJSA 5JJCA 4G2NA 1E6MA 2Q1SA 2XA1A 4GYWA 2OZLB 2HF7A 3DMDA 2HK8A 3DKKA 3FJOA 4D9IA 4L9RA 4DG9A 1MTOA 4II7A 5LOVB 4S04A 1VE7A 3R5FA 1NPDA 5A9RA 3UT5B 3OE7A 1MW8X 2JJ2D 4AJIA 1PYDA 1RS0A 1AD2A 4XGRA 5A4AA 1XF1A 3TMAA 2F1RA 3D6AA 5CH8A 2UXBB 3MBKA 2YOHA 1FBNA 1U1GA 2H1RA 3KLMX 1E32A 1N2CB 1S89A 4MJXA 2H7YA 3OZSA 3LUGA 4IOLA 1AMUA 4BVBA 2ZIGA 3UFBA 4ZMBA 4FHEA 4NU6A 3ZDXB 5JCOC 1ZG3A 4NSNA 4Y9SA 3VYVA 5HG0A 1Y3FE 4PTLA 1AKEA 2G76A 4RJ2A 3P71T 4JI5B 3W8RA 1EFHA 1ULTA 1ZNZA 4RL4A 4YONB 4BVKA 2QI9C 1XI2A 3L1VA 5H70A 3PIDA 4O0LA 1JQBA 2C92A 2IHVA 1GTJ1 4N6OA 1TM1E 1ZD1A 1A8UA 1ZOPA 3O4GA 5DYGA 4ABTA 3H16A 5L3RA 4JJAA 4P4UA 2ZE7A 3ZBUA 2BSQA 1FDIA 4NS1A 5KSYA 1YB6A 2VDUE 3QUBA 3QUTA 1DAOA 3N7AA 4L4UA 4AY3A 2CXXA 3JZIA 3WIOA 1KEEA 2EAUA 5ICMA 1NYTA 3MTBA 3OOYA 7AT1A 3HRHA 3RUCA 1J8VA 1Q84A 3PA6A 1SD5A 4LDNA 3GLKA 1CNMA 2FEOA 3E18A 3EVBA 2H2DA 2PZMA 3TFWA 4YRGA 1SPBS 5FRDA 1ZXLA 2XMCA 4N3CA 2PZAA 2FPGB 2ZT7A 4GR5A 5THKA 3O4IA 4HX5A 2PVPA 2NVUB 1YR9A 2WIDA 1XOIA 2FHPA 5LWQA 1M2JA 5J2TF 2X0KA 2QVXX 1RHUA 2V7UA 2H57A 4OI1A 1BJTA 3GLTA 1TFUA 8GPBA 1JI3A 3P9RA 4BLUA 4QBFA 5ITSA 1M7GA 2CXSA 3G8BA 3DWFA 2O2XA 5AI9A 2NPOA 1M1NB 1NP3A 3RAPR 2PXHA 4ROSA 4BNTA 3EZ6A 3LQRA 1VP3A 4OLFA 1P8JA 4BRZA 3TQHA 4C20A 5KYTA 3QU4A 1RAAA 1NVFA 3GXBA 1XHFA 3IAS6 2F1JA 4OI4A 1I13A 3AERA 2Y0PA 5I7AA 4RIHA 1RXIA 4WGGA 3COSA 4QBGB 1DIAA 4C7VA 1RAEA 1SY7A 1K2WA 2WJWA 4RWEA 5AO9A 3R5TA 1O5IA 1YL6A 3BD8A 4KPFC 3GPDG 1UIRA 1EXDA 4QQRA 2BR3A 5JSHA 3DT6A 3HCPA 2JFUA 1LDYA 4JKYA 4MV8A 3HEBA 3ISTA 1YI1A 4DABA 1Y5NA 3STHA 3QBDA 4BQIA 3RNLA 1VQ1A 3IV6A 4WZAE 1ZKDA 4OI0A 2PMKA 2ZPAA 3TZBA 2QPOA 1L4KA 1P3DA 2OOSA 4GZLA 4MCIA 2QXYA 4KX5A 1QV6A 2JLWA 3BMCA 1IUOA 2VH1A 2E21A 1AXEA 3KQWA 1E6CA 2CKMA 3NKFA 4PYIA 3T34A 3GQBA 3GDHA 3M5WA 3R3YA 3AKYA 1CS0A 3DBLA 3HABA 1PYOA 4IRUB 4AZVA 4D3YA 4DC0A 2YMLA 3GA7A 1GUZA 3G49A 1JB9A 1OLUB 5KPDA 1BDBA 4UUQA 1LRKA 2J9FB 5JYBA 1IM8A 1C0KA 3WZLA 1G55A 5JISA 1Q7BA 4Q1VA 2DF8A 2E4YA 2W4QA 3UV6A 3WYGA 3FNQA 3GUHA 5REQB 4RJJA 2YS7A 1R74A 1RQPA 2KE5A 2XGMA 4HNQA 3K0AB 5LJIA 2WQ6A 2BKXA 5EXDA 1UBSB 4DT1A 5AESA 1KTIA 5AHOA 1FP2A 1MXHA 4XWKA 3Q8XB 2Y6UA 5YASA 2BW0A 1FRZA 3MRSA 4B2YA 5B1SA 5HZGA 3RT7A 1LXCA 3EF1A 3CNHA 3Q1LA 3QE4A 3AJDA 1IDOA 2PWZA 2X19A 1JHYA 2VDQB 1T4MA 4KHZA 4I7EA 1H2XA 1JEDA 5SV2A 4KFRA 2JFYA 4EYOA 3V4RA 3JQAD 4W1QA 2OWDA 3D54D 4JUDX 421PA 5ALGA 4C0LA 2ZTUA 4TN1A 5BYKA 4L2IA 2FX5A 2WM8A 3VU0A 3WDMA 1LPSA 2QG4A 3WLFA 2MINA 3DXYA 1RXWA 3HI4A 2I1WA 3ANXA 1U2TA 4TT8A 4JJ6A 5FOXA 5GJBA 3FPAA 1MT3A 4UQOA 5F76A 4V1CB 4TTJA 5LP6C 3OQIB 4ZU3A 4BVGA 3K0FA 2BEKA 1KPGA 3TG2A 1OTHA 1L7BA 4PQFA 3UH1A 2Y1EA 3PL1A 4L78A 3TE6A 3G02A 1UT6A 3CN9A 2F9MA 4TTIA 1S2LA 1G9XA 1NF8A 5KNBH 1Y1QA 2PGIA 3D8BA 4ZRMA 5U4XA 3T3DA 4BASA 1JEYB 3EGIA 2VL7A 2G80A 1T4BA 2GSWA 4GKAA 2Q5QA 4R2HA 2VRBA 4RKEA 2WNIA 4B3SB 3IRVA 2G71A 1GADO 5BO5A 3V1LA 1XWFA 3WL7A 1HT0A 4K9QA 3WL4A 4TXJA 5IUJC 3L4SO 3ZQ4A 1NIJA 3K16A 4B6OA 1NDHA 1JNYA 2Z2KA 3SQLA 3X1JA 4AZ0B 1REQB 2ZCUA 3O83A 4EMSA 4HYYA 1QE3A 3P4YA 4OOEA 2HHHB 1W44A 3A4TA 3K96A 4QVKA 1SQSA 1ODLA 4F1KA 3QEAZ 2AXQA 4QL3A 3ZDAA 3IPRA 4M1QA 2QM0A 2ZB8A 4FDTA 1DO0A 4G0NA 2AVNA 2XB8A 2MYNA 3K1YA 3PVZA 1U8FO 1Q6ZA 1RIIA 1P7WA 3H9JA 4ZA2A 4EJ2A 1QGAA 3AW9A 1IIBA 3DUFB 2Q3FA 5G2OA 5JD6A 3GLUA 2ZQYA 2DSTA 1T24A 1X8XA 4M76B 1PFGA 2R8RA 3I64A 2ZBQA 4TWBA 4CMEA 1TD1A 4Y9DA 4URXR 4QVIA 1Z5WA 4MI1A 5G41A 2OSBA 1YIDA 1U0LA 2XUAA 4RKQA 3EXIB 1GZ3A 2CDCA 3RU3A 2Y76A 3AHGA 3MMNA 4MEJA 5FBWB 1EK1A 3NVMB 1I9GA 1E7YA 3PC8C 4DV7B 2KBFA 2O7VA 3PR2B 3QY9A 4ZOLA 3SX4A 1P44A 2J41A 4RK1A 1P7PA 2A88A 4N3AA 3UJNA 1SXJB 1XZKA 4CF3A 3IL2A 4Q4DA 2CJWA 3DNPA 2ZJAA 4EP1A 4ZCLA 3MQ2A 4NCKA 2J09A 1CDZA 2IELA 1GITA 1HYHA 3G8AA 3IAAA 3KX2A 4IXWA 3DEFA 3NBZC 1SZJG 4ZQEA 3FWYA 5EKUA 1QBGA 1FJXA 4W1SA 2HSDA 2QTBA 2QAIA 4RD0A 1JA1A 3T3IA 1C4OA 1HRDA 2JL1A 4L27A 3CCFA 4R9UC 3VHXB 4YV0A 1RWXA 3OZAA 1NW7A 1TVMA 1B8NA 2I67A 4RSRA 4O4LF 5I9SA 4BBJA 4B5LA 2QAGB 1E5DA 2C1EA 1FOEB 1KTVA 1QRRA 1UJMA 1XWIA 2I2BA 3LDFA 4H77A 1BHQ1 1TQ8A 1Q83A 2OGTA 1XD2B 4UPVA 3QU5A 1L7OA 2HD4A 4RM2A 2DERA 1R6BX 1TOAA 3BWDD 4MQ4A 1N6KA 2FAXA 3GF4A 3I2YX 5JFOA 1R7RA 1HX7A 2HCTA 2ON6A 3A7EA 5E1BA 1U7TA 2ZB7A 5L7YA 1KIMA 1NR1A 1IHOA 1USGA 1L5KA 5JXJA 4JOBA 3MWDA 1JIXA 2ZUEA 1BVUA 1XD9A 3A6FA 1G4AE 4L51A 4DQUA 5ETJA 4PSVA 1NBMA 3ITNA 4OFWA 1NF9A 1P5HA 1VCHA 1VHTA 2MR6A 1JP7A 2PGAA 3IB3A 3NJ4A 4EKEA 3N5CA 5A9SA 4AY2A 5T8KA 5CBKA 1R5NA 1FFXA 3HDVA 2B2XA 4B3XA 2RCYA 4HDCA 1G2QA 2IUSA 3N2NA 4B7CA 4BAUA 4C4YA 1FB5A 3BMOA 3BBLA 3FDXA 4GVPA 5CG2A 3FCUB 1K75A 4CLHA 1R4ZA 2HQRA 1OMOA 2XB6A 3BD6A 4NICA 3SJUA 3VPDA 1L5OA 1AGPA 4W9RA 1NVXQ 2EZ8A 2WG0A 3ETNA 2IX9A 1SBTA 1TYBE 2XIJA 4YUXA 3VU1A 1KFJB 2ID8A 3I76A 1XQXA 3ND5A 1LLUA 2F8MA 2IHKA 3T9CA 3AEUA 1RAGA 2YMQA 3EC2A 2QROA 5T3UA 5JYDA 1MO6A 4C76A 4RPGA 3UO8B 1MENA 2BM0A 2FP4B 3ZW9A 1DT5A 4O63O 4M8IA 4MI6A 3KKKA 4OIFA 5EMJA 1KE2A 4DLBA 5JROA 4Q7MB 3GLGE 1SKUA 4HFNA 4LOLA 3I01A 1FTWA 2OKGA 3AR7A 1JJBA 1UKZA 4UCXA 1JQAA 4RF2A 3FWKA 2HRDA 1MHPA 3PYLA 4GI1A 1A77A 3CC8A 1VIVA 4PZLA 3HLKA 4PC2A 3QZUA 3RFXA 4JH0A 5DLQC 3M83A 4H7JA 2D5CA 2YYSA 3FNGA 3G88A 2KSQA 3H17A 3EIXA 5L3QB 5B1YA 3HCWA 1YIOA 1BXZA 3KFLA 4S0ZA 3NHUA 2QM7A 3C7AA 3CCCA 2OPHA 2OXCA 5JAHA 3KTOA 5BV2P 1OBOA 7GPBA 1Y3HA 5TT0A 1Y6FA 3RC8A 2GFQA 2XTAA 5K8JB 5TGZA 2C0CA 3DBOB 5D3MA 3BCUA 2WG2A 1KJIA 3KPJA 4Z4EA 2QRNA 4ND4A 1V9LA 4GE3A 5EJ9A 1DCMA 3REOA 1B8PA 1N7HA 3AR5A 2H2AA 4K6GA 5E7JA 4GSLA 3IELA 3R7DA 4AZ0A 2I1QA 2VNIA 4F1JA 3PQFA 4H7HA 1BMDA 5M5BA 2VZ9A 4PN7A 1H85A 3AINA 4ENVA 3KG2A 2BFEA 3KXLA 4RJKA 5LZ5A 1BS9A 4QBHA 2E1RA 1XA4A 3PJDA 1VHLA 2PUTA 2O1SA 2ZI5A 3EDMA 3FPJA 3T5PA 1GCAA 4G5RA 1GCOA 3WBFA 4QBTA 2VNSA 3S1SA 1GKLA 4C2AA 3DE0X 2DG2A 3CX6A 1RMYA 3OIYA 4WN3A 1JHQA 1Q44A 4A0SA 1YF3A 3R5HA 1G5TA 1RWPA 3DAFA 5CCDA 1NOKA 4MPDA 3RYIA 3IUJA 4EPXA 3E2MA 1O0SA 2MINB 4B2IA 1B73A 3W0LB 1AA9A 1B1CA 3M4YA 4PYQA 1E1CB 3X1DA 1HE3A 4EB0A 2IF0A 3WG9A 4KXLA 5BW5A 2V6IA 4YJHB 5IXSA 1FDUA 4QEZA 4ALIA 3U7FB 4OHFA 1GTSA 4ND8B 4DA4A 3ENVA 5AW9A 3GJ5A 2JI7A 3DD5A 3FB1A 2ZDQA 4KC0A 4C0HA 2Z6AA 5IT5A 1EH5A 2VSXA 3B2EA 4FJ0A 1LWNA 2VQEB 5ELLA 2ZSHA 4PS1A 1HYQA 4LDRA 2FDRA 4BZWA 1D1SA 5B57C 4YAFA 4WOPA 4D9MA 4Q1AA 3D1LA 2AOWA 4XIYA 1F8YA 3TCXB 3D7MA 5CFPA 3ZS9A 1IHUA 1TK3A 3RYIB 4YC7A 2VBCA 3EIEA 4PSAA 1T0HB 4PYOA 5IMBA 4B6SA 4KGDA 5L3VA 3EF0A 1JTVA 4Q3EA 2ETXA 1L8AA 4DB4A 1XZLA 2YVLA 3HVHA 3LNCA 3NATA 5JXGA 1VRWA 2G17A 5AK6A 5I7UA 2NOAA 4MI3A 4JBNA 2XQFA 1ZKMA 2HEGA 2WJIA 4Z4IA 1Z2DA 2IYOA 4QPNA 4E51A 1XD8A 4KE7A 3PFCA 4IPTA 2Q62A 4D0LB 3K20A 2BF4A 2I9PA 3O7WA 4D43A 4CRWB 1SURA 1WXXA 3EFBA 2HSGA 3THXB 1OFHA 4BTVA 5BWMA 3HFJA 5CT9A 2AKAB 2LW7A 2PBZA 3COVA 4LBWA 3MWDB 4JUFA 1FP6A 1Q17A 3G1WA 4LDJA 2IQIA 1Z28A 4MPJA 1QRSA 3ZU5A 2NXJA 3ESBA 3E4CA 3QY0A 5KINB 1C8LA 3C45A 5IBPA 1JQ5A 4Q47A 1BQ3A 2Y1OA 1JHAA 1U3WA 3FF4A 2Y67A 1VJ5A 2GJ8A 2PNFA 3D8TA 3OZCA 4JBGA 4WLNA 3RVRA 1ISPA 3I2HA 4H4EA 3IDAA 1YS6A 1U1FA 1K7EB 3GJ0A 3INNA 3IUYA 2TYSB 4FMCB 1Z37A 2Y1DA 1D2NA 3N7TA 3V4VB 3WLPA 3QXJA 4G0MA 3X1WA 4TM7A 2ZJOA 2JFFA 4CBVA 3PC7A 4UM7A 3SQDA 3ZWAA 4KI7A 5JAUA 3IESA 1WLYA 1QTQA 1ZITA 4MUBA 3AVQA 4UCFA 4HMOA 2OHXA 2P2CA 3TW6A 3N7UA 1UBUS 3KCNA 1X77A 2Q3JA 4FOLA 3TM5A 1FMFA 1GNPA 3THOA 1VB5A 3DBRA 4BVEA 3I8XA 1YBAA 1K92A 1LPAB 1M8FA 1SRQA 1QH1B 1WBJB 2FP4A 1TC1A 2GVZC 2HTFA 2QN6A 4DJEC 4EGQA 5HWSA 5ICGA 2XVYA 5HJ2A 4I55A 3TCNA 4YRSA 1SQ5A 1SG6A 5HFNA 3WK7A 1XDWA 4R7ZA 5FTJA 3S81A 5DASA 4MVXA 3S2FA 4UBLA 2V9ZA 1Y3DE 4ZOLF 1J1IA 2IPLA 5ALJA 3H0EA 1XCBA 4X6LA 1B7GO 3SOPA 3ITEA 3NRJA 5CEFA 1MJFA 5EWJA 3SI7A 2BMAA 3GA0A 3ICPA 3NZEA 2I3AA 2Q50A 2WM9B 4G5QA 2QTCA 4HB2A 1K3TA 1BOOA 1U28A 1S2DA 1BEZA 2GJKA 4M9QA 4O2BA 5FQNA 1RU3A 5CB4A 1O58A 1Z08A 4I9NA 4I46A 2PRYA 5A1JA 4BFLA 2IK8A 3UXMA 1YH3A 3GLHA 2I29A 2UU9B 3W5IA 4S1PA 3T7JA 3R0ZA 2C2HA 3GY0A 3OTGA 5EP1A 1N4DA 3I01M 1S02A 1N2XA 2JLSA 3RTEA 2V55B 1IATA 4NMLA 3PHIA 4G8BA 2EYUA 5B3JA 3SYTA 1W88B 4JUBA 3VDNB 1X8KA 3O73A 1QF9A 3ABQB 1AQUA 3BZWA 1X6VA 2PGJA 3W79A 1SQ0A 4WXMA 3IJRA 1XTBA 1BCSA 1DEOA 2EP7A 2VDJA 4UEKA 4BFXA 5A03A 4K0RA 1BHSA 1QHYA 1VSBA 2AT1A 2XTMA 3AIMA 2XGGA 3WGTA 5IWCA 1VJ1A 3DDHA 1QGOA 3DH0A 3LBIA 1X1BA 2C3PA 3UH0A 3KUCA 3EGWA 4S3MA 3OC6A 4RTPA 3KWMA 3AY7A 4ZOAA 3FPGA 2BDTA 4J7AA 1YOBA 5DBHX 5KHOC 1EFPB 4A82A 13PKA 2P7HA 2QX9A 2VYND 1AS0A 3U09A 2XMBA 4BNWA 4EG4A 1BIFA 2O4UX 2QOEA 2YDXA 3Q7EA 4D4HA 3BHNA 4QFBA 3CZMA 3GEGA 2D2FA 2CFCA 3ESQA 3BILA 2GDJA 3HCCA 5IX8A 1M0TA 5E7IA 4JJGA 3CQ9A 4R9SA 3FNRA 4WINA 2A5YB 3SZRA 5GADl 4EUNA 5EHQA 3DBHB 1K7XB 4B8ZA 5HQJA 2QD1A 4EL5A 3GZNA 4KMMA 1F14A 4FW9A 5IT0A 1XCLA 4ZP1A 1TPYA 3NM5A 1V7ZA 5IC4A 2IHUA 3K0CA 1QIEA 1L7DA 3MCUA 2PEYA 4F4UA 1TQDA 3I6QA 4MKGA 3G2KA 2H1OA 4DLAA 1ECCA 4L08A 2XCRB 4DLTA 3U81A 3GCDA 1J0CA 5CUQA 4ALLA 3IA7A 5AVRA 4YUWA 5DCUA 1Z68A 3JWPA 2MHCA 1ZUIA 2V1XA 3SIPA 1G63A 3IAXA 2B37A 4UAGA 4FR0A 5BQ3A 1XUOA 4ZO7A 1EVLA 3Q3JB 2EW2A 4XJTA 3R2JA 3LKBA 3OX4A 2IP4A 3EN0A 1I6WA 1I7LA 2ZT8A 4M4SA 1JDNA 2HA7A 2HI0A 2GKOA 3K2IA 5LQKA 1RABA 3OVMA 1AV6A 2I6TA 3U3JA 2J9FA 3MS7A 4C22A 1US8A 3ED1A 3U2QA 4HDRA 1JHRA 3ACDA 1G64A 4NPCA 3W9UA 1YR8A 1LY1A 1ADYA 3MTJA 3PKIA 5IUKC 5CT8A 4Q37A 3RNOA 1GSOA 5F4BA 4DMKA 1YUBA 3AFIA 4NABA 4WN9A 1ABFA 1XJWA 1YRLA 1WE2A 2IGTA 4MA5A 4C4PA 4UBJA 3EXFB 2QZSA 2ZWOA 4MZDA 1JJVA 4IJUA 5MFPA 3FZNA 4EHHA 5C8DA 4N3NA 1Y34E 4DJAA 4OQXA 4AROA 4OYHA 1NJ6A 1W9MA 2AOTB 3H18A 1EUDB 3F97A 2WHPB 3DQQA 3JY6A 4GOLD 4MRMB 5KJCA 3AV0B 4R8LA 4RV5A 4C7BA 3BIWA 2ASEA 3V2GA 2C29D 4NBTA 1KSFX 2Q1WA 4X3CA 4IBOA 3WWZA 1C9JA 4MUJA 2VPXA 4OQEA 2DUNA 1U81A 5C1DA 4LTDA 2BFWA 1C7EA 4WACA 1ZMTA 1MNAA 4YY3B 3GJYA 4FYWA 4E31A 1YNSA 4IG9A 2VF5X 3I83A 2XJ9A 5CRIA 4C0XA 4KQ2A 3T94A 4Y3UA 3S29A 3FCOA 3HCFA 4YRAA 4GKJB 1DO2A 4CHGA 3GVIA 2W2QA 4QBKA 3LCUA 2WM3A 2ZYIA 4U2KA 4MMXB 4E3WA 1DIOB 4LRTB 4MXDA 2XHZA 4QGFA 2RAVA 2PR2A 5J2UA 3PKZA 1IE3A 1L4NA 2ZETA 3P9ZA 3IR7A 4LHZA 1SVWA 3FKSA 4HS9A 4IEEA 1EA5A 4E4TA 2E9SA 3CF4G 2OV1A 4A27A 2QNIA 4MH0R 5BVGB 4LE0A 4C88A 1V4VA 3DAGA 1VKZA 1Z4QA 5JQGB 1X14A 4H1UA 2G5GX 3KZ1E 2W8BB 1DAPA 3CR7A 3NWOA 4I08A 5KQLA 4G0VA 4YCMA 5JHHB 2QUBA 4GXRA 1HM5A 3BXHA 3GJ8A 1Y8RA 3HLTA 1RE0A 3JZDA 1PZGA 3QXSA 4F71A 1J24A 4WRRA 4JEIA 1JIQA 3G0CA 3V3KA 3WB9A 1GEGA 2QL7A 1K63A 4KPUA 1YVEI 4MDHA 5FO1A 2WAMA 2VHTA 1T2VA 4XXHA 5AM2A 4P4LA 1ZU4A 2JS7A 2QNBA 4E88A 1N6NA 3OZRA 4LJ9A 5KMGA 3MXOA 1FDRA 3PCRB 1IOZA 3UJCA 1UPAA 2WKQA 3ICCA 2PA0A 1N57A 2EC5A 2RI0A 3FMGA 4AQ7A 2GAFA 1XC7A 4TV8A 4PIVA 5E4TA 1KZ7B 2VRCD 2XW6A 5MN5A 2CFSA 2NZVG 1PJLA 3B8EA 2PU5A 1KVRA 2OYSA 2RHJA 5AW8A 2AL7A 4JGIA 4P53A 2ATEA 2MSLA 3CEMA 5A6SA 4YAEA 3OQOA 3JYOA 3MFYA 1QORA 3INTA 4HDNB 5LVAA 1AKRA 3GRZA 1ZNQO 1KJ8A 2C94A 3B6EA 1OXKB 2J5KA 1X9HA 2PZGA 3IUNA 3KR9A 3OEWA 3PSAA 4TV9B 4HUJA 5DTEA 5BNTA 1OA0A 4BP3A 2WU4A 3SDSA 2ANCA 3T1HB 5E3JA 3RARA 3AERB 4ZCPA 5KCMA 3IAFA 1JB1A 1LPBB 2CC2A 5EIOA 3C15C 3RVOA 1COWA 3U7GA 2ZJ5A 4MMYB 4F91B 4AIIA 1G59A 2C99A 5JASA 4FI3C 4IMIB 4HDKA 2H5LA 2JZOA 2A5FA 1FFEA 2A33A 2A9OA 3N2KA 1PR6A 2LZ0A 3JQAA 3ZBPA 2B1GA 3CWQA 2WWYA 1GILA 3KSAC 5ILOA 2WAOA 1ZCJA 1WDMA 3HFGA 4QGAA 3QK7A 1N6LA 4LVCA 1OXTA 4V2IA 1JZTA 2GETA 2NIPA 3I05A 3IUBA 4NZNA 3ZXUB 5CYFA 4IDQA 4WLOA 1NVEA 4LAFA