2WLAA

Streptococcus pyogenes dpr
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
173
structure length
167
Chain Sequence
NTLVENIYASVTHNSKNEKTKAVLNQAVADLSVAASIVHQVHWYMRGPGFLYLHPKMDELLDSLNANLDEVSERLITIGGAPYSTLAEFSKHSKLDEAKGTYDKTVAQHLARLVEVYLYLSSLYQVGLDITDEEGDAGTNDLFTAAKTEAEKTIWMLQAERGQGPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DPS-LIKE PEROXIDE RESISTANCE PROTEIN
publication title Crystal Structures of Streptococcus Pyogenes Dpr Reveal a Dodecameric Iron-Binding Protein with a Ferroxidase Site.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Oxidoreductase
total genus 76
structure length 167
sequence length 173
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2wlaA00
1RCDA 5JKLG 4ZL6A 3PWFA 2C2JA 5K53A 4MY7A 3Q4QA 4M32A 3Q4OA 4LQJA 2C6RA 4ZKWA 3AJPA 4CVPA 1YV1A 3PVYB 3SHXA 5GU0X 4TOFA 2PYBA 3PZAA 2V2PA 2Y3QA 1OTKA 2FKZA 2V2SA 1JI5A 1B71A 3R2LA 4ZKHA 1BFRA 3R2HA 1H96A 5IX6A 5GN8A 2X170 4Y08A 4RC6A 3FSEA 4II4A 1EUMA 2ZA7A 1R03A 2F7NA 2FL0A 1GWGA 4AM2A 3O7RA 4RC8A 3BT5A 1N1QA 1RCCA 1JTSA 2GYDA 2YW6A 3BVEA 3E1PA 2JD80 2VZBA 2RBDA 1RCIA 1VEIA 1VELA 3H7GA 4DASA 3ISFA 1BCFA 2FG4A 2D5KA 1UMNA 2BKCA 3E1NA 3AK8A 3F34A 4YKHA 5D8YA 3R2OA 1XZ1A 3AJQA 4ISPA 1VEQA 3KA4A 3SIDA 3U90A 2CHPA 3TA8A 3QB9A 3SH6A 5K52A 3PW1A 3AF7X 1L8IA 2FJCA 5ERKA 1JYBA 4MJYA 4RC5A 4CYAA 1RCEA 2CIHA 3ISEA 4A25A 2IY4A 2YW7A 1Z6OM 5GOUA 2C41A 1ZS3A 2C2UA 1RYTA 4TOBA 1NF4A 3KA3A 3PVRB 4RC7B 2XJMA 4OYNA 2CLBA 2CN6A 4ZTTA 3IS7A 4DYUA 2V2OA 3UNOA 3WNWA 1JKUA 2QQYA 3NP0X 3F33A 4ZMCA 5LG8A 2G4HA 2ZG9X 1O9IA 3QHCA 1BG7A 3Q4RA 4TW3A 2V2IA 3PVTA 4XGSA 1YUXA 2BW1A 1JIGA 3OJ5A 3R2RA 3GHQA 3R2KA 4LQHA 4TO9A 5D8OA 4ITWA 3RD0A 2GS4A 4LPJA 1NFVA 4CY9A 1JI4A 4DZ0A 3AF9X 1JREA 4XKUA 4AM4A 4PG0A 5GN8B 4RC6B 4ISMA 3F39A 5J93A 3R2SA 2QF9A 5FFCA 3PWQA 1IERA 1SQ3A 5CZUA 4CVTA 3UOFA 3WVUA 2CN7A 3KWOA 5E2DA 2IB0A 3PVYA 1QGHA 5AXSA 5JKMA 4Z3BA 3BVFA 1TJOA 3VNXA 3F35A 1Z4AA 2CF7A 4QUWA 1DPSA 3BVLA 1J30A 2FZFA 4P18A 2ITBA 4TODA 2V2LA 2BK6A 4M35A 2OC5A 3PW1B 1QYBA 4AM5A 3HL1A 1LKMA 3E1MA 1YUZA 1DATA 2UX1A 5FEJA 2CLUA 3NOZX 2FHAA 4DI0A 5HQOA 4KVRA 3MPSA 4EVEA 3KA8A 3PWQC 4MUDA 2W0OA 3F36A 4CVRA 2OH3A 3EGMA 2WTLA 4ZJKA 2IU2A 5J9VA 1S2ZA 3AF8X 1F30A 5GU2X 1S3QA 1IESA 3O7SA 1FHAA 4TOGA 4LPNA 4TOAA 4XKTA 5LBHA 1NNQA 3KA9A 3EZ0A 3BVIA 2XGWA 1KRQA 4TOHA 2V2RA 4ITTA 1JKVA 5CMQA 2V2MA 3PVTB 3E1OA 3WVWA 2ZURX 2CEIA 1S30A 3AJOA 1NF6A 5D8QA 4ZLWA 1MOJA 1Z6OA 4ERUA 2Z5RA 4ZL5A 4PGIA 4EVCA 1VJXA 2HR5A 5I4JA 4DE6A 4DYZA 3BKNA 2V2NA 3IS8A 2XJNA 3QVDA 1JGCA 4CYBA 3BVKA 3KX9A 1XZ3A 3E6RA 5D8RA 4KVQA 2C2FA 5HJFA 2WLUA 2YJKA 4ZKXA 1TKOA 4II4B 4LQNA 5D8SA 2JD60 4LPMA 2VXXA 4KVSA 5D8PA 5D8XA 2FG8A 3SE1A 5LG2A 4EVDA 1UVHA 2HTNA 3A68A 1LB3A 3E6SA 2ZG8X 5GU1X 4CMYV 5LS9A 2FFXJ 2BJYA 4IWKA 1TKPA 4IXKA 3WVVA 2JD70 2V2JA 3NP2X 5E1UA 2Z5PA 3AK9A 5J8SA 4Z5SA 3A9QA 3QZ3A 3RBCA 3GVYA 4LQVA 2GYQA 5J8WA 4M33A 2Z5QA 3HIUA 3FVBA 4LYXA 3RE7A 3KA6A 2ZG7X 3PW8A 4RC5B 2Z90A 4LYUA 3E1LA 2CHIA 4DYXA 1L8HA 3QD8A 1ZUJA 3GE4A 3F38A 4M34A 4U3GA 5CMRA 3RAVA 5JKLA 1DVBA 4E6KA 5FFBA 5ERJA 3R2MA 2Z6MA 3QHBA 1O9RA 1TK6A 1F33A 1LKOA 4REUA 2XKQA 2XJOA 2ZA6A 3E1JA 3KXUA 1VLGA 5FFDA 5FFAA 5FFEA 3F32A 4CVSA 2VXIA 1RCGA 3E2CA 3PW8C 4XKSA 4EVBA 5JKMG 4ML5A 3RGDA 1LKPA 3ES3A 5HJHA 4CMYA 3OGHA 3T9JA 3F37A 1MFRA 2WLAA 3PVRA 4TOCA 1HRSA 3E1QA 3FI6A 3IQ1A 4MN9A 3ERZA 4RC7A 5JACA 3Q4NA 4IWJA 5GU3X 4MKUA 4PGKA 4PG1A 3EZUA 4DYYA 2ZA8A 4ETRA 1SOFA 5C6FA 4R42A 2V15A 3UOIA 1AEWA 4TOEA 2YJJA
chains in the Genus database with same CATH superfamily
1RCDA 5JKLG 4ZL6A 3PWFA 2C2JA 5K53A 4MY7A 3Q4QA 4M32A 3Q4OA 4LQJA 2C6RA 4ZKWA 3AJPA 4CVPA 1YV1A 3PVYB 3SHXA 5GU0X 4TOFA 2PYBA 3PZAA 2V2PA 2Y3QA 4W4KB 1OTKA 2FKZA 2V2SA 1JI5A 1B71A 3R2LA 4ZKHA 5JDOB 1BFRA 3L0MA 3R2HA 1H96A 5IX6A 5GN8A 2X170 4Y08A 4RC6A 3FSEA 4II4A 1EUMA 2ZA7A 1R03A 2F7NA 3V3KB 2FL0A 1GWGA 4AM2A 3O7RA 4RC8A 3BT5A 1N1QA 1RCCA 1JTSA 2GYDA 2YW6A 3BVEA 3E1PA 2JD80 2VZBA 2RBDA 1RCIA 1VEIA 1VELA 3H7GA 4DASA 3ISFA 1BCFA 2FG4A 2D5KA 1UMNA 2BKCA 3E1NA 4YXMA 3AK8A 2V8TA 3F34A 4YKHA 5D8YA 3R2OA 1XZ1A 3AJQA 4ISPA 1VEQA 3KA4A 3SIDA 3U90A 2CHPA 3TA8A 3QB9A 3SH6A 5K52A 3PW1A 3AF7X 1L8IA 2FJCA 5ERKA 4YXJA 1JYBA 4MJYA 4RC5A 4CYAA 1RCEA 2CIHA 3ISEA 2WWXB 4A25A 3C21A 3C1YA 2IY4A 2YW7A 1Z6OM 5GOUA 2C41A 1ZS3A 2C2UA 1RYTA 4TOBA 1NF4A 3KA3A 3PVRB 4RC7B 2XJMA 4OYNA 2N02A 2CLBA 2CN6A 4ZTTA 3IS7A 3W54A 4DYUA 2V2OA 3UNOA 3WNWA 1JKUA 2QQYA 3NP0X 3F33A 4ZMCA 5LG8A 2G4HA 2ZG9X 1O9IA 3QHCA 1BG7A 3M6JA 3Q4RA 4TW3A 2V2IA 3VV9A 3C1ZA 3PVTA 3UFBA 4XGSA 1YUXA 2BW1A 1JIGA 3R2RA 3OJ5A 2AR0A 3GHQA 3R2KA 3N6OA 4LQHA 4TO9A 5D8OA 4ITWA 3RD0A 2GS4A 4LPJA 1NFVA 4CY9A 1JI4A 4DZ0A 3AF9X 1JREA 4XKUA 4AM4A 4PG0A 3LKDA 5GN8B 4E40A 4RC6B 4KXRB 4ISMA 3F39A 5J93A 3R2SA 3C23A 2QF9A 5FFCA 3PWQA 4YVZA 1IERA 1SQ3A 5CZUA 3VVAA 4CVTA 3UOFA 3WVUA 2CN7A 3KWOA 5E2DA 2IB0A 3PVYA 1QGHA 5AXSA 5JKMA 4Z3BA 3BVFA 1TJOA 3VNXA 3F35A 1Z4AA 2CF7A 4QUWA 1DPSA 3BVLA 1J30A 2FZFA 4P18A 2ITBA 4TODA 2V2LA 2BK6A 4M35A 2OC5A 3PW1B 1QYBA 4AM5A 3HL1A 1LKMA 3E1MA 1YUZA 1DATA 2UX1A 5FEJA 2CLUA 3NOZX 2FHAA 2MGYA 4DI0A 5HQOA 4KVRA 3MPSA 4EVEA 3KA8A 3PWQC 4MUDA 2W0OA 3F36A 4CVRA 2OKCA 2OH3A 3EGMA 2WTLA 4ZJKA 2IU2A 5J9VA 3FRRA 1S2ZA 3AF8X 1F30A 5GU2X 1S3QA 1IESA 3O7SA 1FHAA 4TOGA 4LPNA 4TOAA 4XKTA 5LBHA 1NNQA 3KA9A 3EZ0A 3BVIA 2XGWA 1KRQA 4TOHA 2V2RA 4ITTA 1JKVA 5CMQA 2V2MA 3PVTB 3E1OA 3WVWA 2ZURX 2CEIA 1S30A 3AJOA 1NF6A 5D8QA 4ZLWA 4W4LB 4X0JA 1MOJA 3JZ9A 1Z6OA 4ERUA 2Z5RA 4ZL5A 4PGIA 3FRSA 4EVCA 1VJXA 2HR5A 5I4JA 4DE6A 4DYZA 3BKNA 2V2NA 3IS8A 2XJNA 3GGYA 3QVDA 1JGCA 4CYBA 5HU6D 3BVKA 3KX9A 1XZ3A 3E6RA 5D8RA 4KVQA 2C2FA 5HJFA 2WLUA 3KHKA 2YJKA 4ZKXA 1TKOA 4II4B 4LQNA 5D8SA 2JD60 4LPMA 2VXXA 4KVSA 4WJG4 5D8PA 5D8XA 2FG8A 3SE1A 5LG2A 4EVDA 1UVHA 2HTNA 3A68A 1LB3A 3E6SA 2ZG8X 5GU1X 4CMYV 5LS9A 2FFXJ 2CWLA 2BJYA 4IWKA 3KDQA 1TKPA 4IXKA 3WVVA 2JD70 2V2JA 3NP2X 5E1UA 2Z5PA 3AK9A 5J8SA 4Z5SA 3A9QA 5JDOA 3QZ3A 3RBCA 3GVYA 4LQVA 2GYQA 5J8WA 4M33A 2Z5QA 3HIUA 3FVBA 4MXPA 4LYXA 3RE7A 3KA6A 2V8UA 2ZG7X 3PW8A 4RC5B 2Z90A 4LYUA 3E1LA 2CHIA 2G38B 4DYXA 1L8HA 3QD8A 1ZUJA 3GE4A 3F38A 4M34A 4U3GA 5CMRA 3RAVA 5JKLA 1DVBA 4E6KA 5FFBA 3JZAB 5ERJA 3R2MA 2Z6MA 3QHBA 1O9RA 1TK6A 1F33A 1LKOA 4REUA 2XKQA 2XJOA 2ZA6A 3E1JA 3KXUA 1VLGA 5FFDA 5FFAA 3GGZA 5FFEA 3D19A 3F32A 4CVSA 2VXIA 1RCGA 3E2CA 3PW8C 4XKSA 4EVBA 5JKMG 4ML5A 3RGDA 1LKPA 3ES3A 5HJHA 4CMYA 3OGHA 3T9JA 3F37A 1MFRA 3DBYA 2WLAA 3PVRA 4TOCA 1HRSA 3E1QA 3FI6A 3IQ1A 4MN9A 3ERZA 4RC7A 5JACA 3Q4NA 4IWJA 5GU3X 4MKUA 4PGKA 4PG1A 3EZUA 4DYYA 2ZA8A 4ETRA 1SOFA 5C6FA 4R42A 2V15A 2Y44A 3UOIA 1AEWA 4TOEA 2YJJA
chains in the Genus database with same CATH topology
1RCDA 5JKLG 4ZL6A 3PWFA 2C2JA 5K53A 4MY7A 3Q4QA 4M32A 3Q4OA 4LQJA 2C6RA 4ZKWA 3AJPA 4CVPA 1YV1A 3PVYB 3SHXA 5GU0X 4TOFA 2PYBA 3PZAA 2V2PA 2Y3QA 4W4KB 1OTKA 2FKZA 2V2SA 1JI5A 1B71A 3R2LA 4ZKHA 5JDOB 1BFRA 3L0MA 3R2HA 1H96A 5IX6A 5GN8A 2X170 4Y08A 4RC6A 3FSEA 4II4A 1EUMA 2ZA7A 1R03A 2F7NA 3V3KB 2FL0A 1GWGA 4AM2A 3O7RA 4RC8A 3BT5A 1N1QA 1RCCA 1JTSA 2GYDA 2YW6A 3BVEA 3E1PA 2JD80 2VZBA 2RBDA 1RCIA 1VEIA 1VELA 3H7GA 4DASA 3ISFA 1BCFA 2FG4A 2D5KA 1UMNA 2BKCA 3E1NA 4YXMA 3AK8A 2V8TA 3F34A 4YKHA 5D8YA 3R2OA 1XZ1A 3AJQA 4ISPA 1VEQA 3KA4A 3SIDA 3U90A 2CHPA 3TA8A 3QB9A 3SH6A 5K52A 3PW1A 3AF7X 1L8IA 2FJCA 5ERKA 4YXJA 1JYBA 4MJYA 4RC5A 4CYAA 1RCEA 2CIHA 3ISEA 2WWXB 4A25A 3C21A 3C1YA 2IY4A 2YW7A 1Z6OM 5GOUA 2C41A 1ZS3A 2C2UA 1RYTA 4TOBA 1NF4A 3KA3A 3PVRB 4RC7B 2XJMA 4OYNA 2N02A 2CLBA 2CN6A 4ZTTA 3IS7A 3W54A 4DYUA 2V2OA 3UNOA 3WNWA 1JKUA 2QQYA 3NP0X 3F33A 4ZMCA 5LG8A 2G4HA 2ZG9X 1O9IA 3QHCA 1BG7A 3M6JA 3Q4RA 4TW3A 2V2IA 3VV9A 3C1ZA 3PVTA 3UFBA 4XGSA 1YUXA 2BW1A 1JIGA 3R2RA 3OJ5A 2AR0A 3GHQA 3R2KA 3N6OA 4LQHA 4TO9A 5D8OA 4ITWA 3RD0A 2GS4A 4LPJA 1NFVA 4CY9A 1JI4A 4DZ0A 3AF9X 1JREA 4XKUA 4AM4A 4PG0A 3LKDA 5GN8B 4E40A 4RC6B 4KXRB 4ISMA 3F39A 5J93A 3R2SA 3C23A 2QF9A 5FFCA 3PWQA 4YVZA 1IERA 1SQ3A 5CZUA 3VVAA 4CVTA 3UOFA 3WVUA 2CN7A 3KWOA 5E2DA 2IB0A 3PVYA 1QGHA 5AXSA 5JKMA 4Z3BA 3BVFA 1TJOA 3VNXA 3F35A 1Z4AA 2CF7A 4QUWA 1DPSA 3BVLA 1J30A 2FZFA 4P18A 2ITBA 4TODA 2V2LA 2BK6A 4M35A 2OC5A 3PW1B 1QYBA 4AM5A 3HL1A 1LKMA 3E1MA 1YUZA 1DATA 2UX1A 5FEJA 2CLUA 3NOZX 2FHAA 2MGYA 4DI0A 5HQOA 4KVRA 3MPSA 4EVEA 3KA8A 3PWQC 4MUDA 2W0OA 3F36A 4CVRA 2OKCA 2OH3A 3EGMA 2WTLA 4ZJKA 2IU2A 5J9VA 3FRRA 1S2ZA 3AF8X 1F30A 5GU2X 1S3QA 1IESA 3O7SA 1FHAA 4TOGA 4LPNA 4TOAA 4XKTA 5LBHA 1NNQA 3KA9A 3EZ0A 3BVIA 2XGWA 1KRQA 4TOHA 2V2RA 4ITTA 1JKVA 5CMQA 2V2MA 3PVTB 3E1OA 3WVWA 2ZURX 2CEIA 1S30A 3AJOA 1NF6A 5D8QA 4ZLWA 4W4LB 4X0JA 1MOJA 3JZ9A 1Z6OA 4ERUA 2Z5RA 4ZL5A 4PGIA 3FRSA 4EVCA 1VJXA 2HR5A 5I4JA 4DE6A 4DYZA 3BKNA 2V2NA 3IS8A 2XJNA 3GGYA 3QVDA 1JGCA 4CYBA 5HU6D 3BVKA 3KX9A 1XZ3A 3E6RA 5D8RA 4KVQA 2C2FA 5HJFA 2WLUA 3KHKA 2YJKA 4ZKXA 1TKOA 4II4B 4LQNA 5D8SA 2JD60 4LPMA 2VXXA 4KVSA 4WJG4 5D8PA 5D8XA 2FG8A 3SE1A 5LG2A 4EVDA 1UVHA 2HTNA 3A68A 1LB3A 3E6SA 2ZG8X 5GU1X 4CMYV 5LS9A 2FFXJ 2CWLA 2BJYA 4IWKA 3KDQA 1TKPA 4IXKA 3WVVA 2JD70 2V2JA 3NP2X 5E1UA 2Z5PA 3AK9A 5J8SA 4Z5SA 3A9QA 5JDOA 3QZ3A 3RBCA 3GVYA 4LQVA 2GYQA 5J8WA 4M33A 2Z5QA 3HIUA 3FVBA 4MXPA 4LYXA 3RE7A 3KA6A 2V8UA 2ZG7X 3PW8A 4RC5B 2Z90A 4LYUA 3E1LA 2CHIA 2G38B 4DYXA 1L8HA 3QD8A 1ZUJA 3GE4A 3F38A 4M34A 4U3GA 5CMRA 3RAVA 5JKLA 1DVBA 4E6KA 5FFBA 3JZAB 5ERJA 3R2MA 2Z6MA 3QHBA 1O9RA 1TK6A 1F33A 1LKOA 4REUA 2XKQA 2XJOA 2ZA6A 3E1JA 3KXUA 1VLGA 5FFDA 5FFAA 3GGZA 5FFEA 3D19A 3F32A 4CVSA 2VXIA 1RCGA 3E2CA 3PW8C 4XKSA 4EVBA 5JKMG 4ML5A 3RGDA 1LKPA 3ES3A 5HJHA 4CMYA 3OGHA 3T9JA 3F37A 1MFRA 3DBYA 2WLAA 3PVRA 4TOCA 1HRSA 3E1QA 3FI6A 3IQ1A 4MN9A 3ERZA 4RC7A 5JACA 3Q4NA 4IWJA 5GU3X 4MKUA 4PGKA 4PG1A 3EZUA 4DYYA 2ZA8A 4ETRA 1SOFA 5C6FA 4R42A 2V15A 2Y44A 3UOIA 1AEWA 4TOEA 2YJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RCD A;  5JKL G;  4ZL6 A;  3PWF A;  2C2J A;  5K53 A;  4MY7 A;  3Q4Q A;  4M32 A;  3Q4O A;  4LQJ A;  2C6R A;  4ZKW A;  3AJP A;  4CVP A;  1YV1 A;  3PVY B;  3SHX A;  5GU0 X;  4TOF A;  2PYB A;  3PZA A;  2V2P A;  2Y3Q A;  1OTK A;  2FKZ A;  2V2S A;  1JI5 A;  1B71 A;  3R2L A;  4ZKH A;  1BFR A;  3R2H A;  1H96 A;  5IX6 A;  5GN8 A;  2X17 0;  4Y08 A;  4RC6 A;  3FSE A;  4II4 A;  1EUM A;  2ZA7 A;  1R03 A;  2F7N A;  2FL0 A;  1GWG A;  4AM2 A;  3O7R A;  4RC8 A;  3BT5 A;  1N1Q A;  1RCC A;  1JTS A;  2GYD A;  2YW6 A;  3BVE A;  3E1P A;  2JD8 0;  2VZB A;  2RBD A;  1RCI A;  1VEI A;  1VEL A;  3H7G A;  4DAS A;  3ISF A;  1BCF A;  2FG4 A;  2D5K A;  1UMN A;  2BKC A;  3E1N A;  3AK8 A;  3F34 A;  4YKH A;  5D8Y A;  3R2O A;  1XZ1 A;  3AJQ A;  4ISP A;  1VEQ A;  3KA4 A;  3SID A;  3U90 A;  2CHP A;  3TA8 A;  3QB9 A;  3SH6 A;  5K52 A;  3PW1 A;  3AF7 X;  1L8I A;  2FJC A;  5ERK A;  1JYB A;  4MJY A;  4RC5 A;  4CYA A;  1RCE A;  2CIH A;  3ISE A;  4A25 A;  2IY4 A;  2YW7 A;  1Z6O M;  5GOU A;  2C41 A;  1ZS3 A;  2C2U A;  1RYT A;  4TOB A;  1NF4 A;  3KA3 A;  3PVR B;  4RC7 B;  2XJM A;  4OYN A;  2CLB A;  2CN6 A;  4ZTT A;  3IS7 A;  4DYU A;  2V2O A;  3UNO A;  3WNW A;  1JKU A;  2QQY A;  3NP0 X;  3F33 A;  4ZMC A;  5LG8 A;  2G4H A;  2ZG9 X;  1O9I A;  3QHC A;  1BG7 A;  3Q4R A;  4TW3 A;  2V2I A;  3PVT A;  4XGS A;  1YUX A;  2BW1 A;  1JIG A;  3OJ5 A;  3R2R A;  3GHQ A;  3R2K A;  4LQH A;  4TO9 A;  5D8O A;  4ITW A;  3RD0 A;  2GS4 A;  4LPJ A;  1NFV A;  4CY9 A;  1JI4 A;  4DZ0 A;  3AF9 X;  1JRE A;  4XKU A;  4AM4 A;  4PG0 A;  5GN8 B;  4RC6 B;  4ISM A;  3F39 A;  5J93 A;  3R2S A;  2QF9 A;  5FFC A;  3PWQ A;  1IER A;  1SQ3 A;  5CZU A;  4CVT A;  3UOF A;  3WVU A;  2CN7 A;  3KWO A;  5E2D A;  2IB0 A;  3PVY A;  1QGH A;  5AXS A;  5JKM A;  4Z3B A;  3BVF A;  1TJO A;  3VNX A;  3F35 A;  1Z4A A;  2CF7 A;  4QUW A;  1DPS A;  3BVL A;  1J30 A;  2FZF A;  4P18 A;  2ITB A;  4TOD A;  2V2L A;  2BK6 A;  4M35 A;  2OC5 A;  3PW1 B;  1QYB A;  4AM5 A;  3HL1 A;  1LKM A;  3E1M A;  1YUZ A;  1DAT A;  2UX1 A;  5FEJ A;  2CLU A;  3NOZ X;  2FHA A;  4DI0 A;  5HQO A;  4KVR A;  3MPS A;  4EVE A;  3KA8 A;  3PWQ C;  4MUD A;  2W0O A;  3F36 A;  4CVR A;  2OH3 A;  3EGM A;  2WTL A;  4ZJK A;  2IU2 A;  5J9V A;  1S2Z A;  3AF8 X;  1F30 A;  5GU2 X;  1S3Q A;  1IES A;  3O7S A;  1FHA A;  4TOG A;  4LPN A;  4TOA A;  4XKT A;  5LBH A;  1NNQ A;  3KA9 A;  3EZ0 A;  3BVI A;  2XGW A;  1KRQ A;  4TOH A;  2V2R A;  4ITT A;  1JKV A;  5CMQ A;  2V2M A;  3PVT B;  3E1O A;  3WVW A;  2ZUR X;  2CEI A;  1S30 A;  3AJO A;  1NF6 A;  5D8Q A;  4ZLW A;  1MOJ A;  1Z6O A;  4ERU A;  2Z5R A;  4ZL5 A;  4PGI A;  4EVC A;  1VJX A;  2HR5 A;  5I4J A;  4DE6 A;  4DYZ A;  3BKN A;  2V2N A;  3IS8 A;  2XJN A;  3QVD A;  1JGC A;  4CYB A;  3BVK A;  3KX9 A;  1XZ3 A;  3E6R A;  5D8R A;  4KVQ A;  2C2F A;  5HJF A;  2WLU A;  2YJK A;  4ZKX A;  1TKO A;  4II4 B;  4LQN A;  5D8S A;  2JD6 0;  4LPM A;  2VXX A;  4KVS A;  5D8P A;  5D8X A;  2FG8 A;  3SE1 A;  5LG2 A;  4EVD A;  1UVH A;  2HTN A;  3A68 A;  1LB3 A;  3E6S A;  2ZG8 X;  5GU1 X;  4CMY V;  5LS9 A;  2FFX J;  2BJY A;  4IWK A;  1TKP A;  4IXK A;  3WVV A;  2JD7 0;  2V2J A;  3NP2 X;  5E1U A;  2Z5P A;  3AK9 A;  5J8S A;  4Z5S A;  3A9Q A;  3QZ3 A;  3RBC A;  3GVY A;  4LQV A;  2GYQ A;  5J8W A;  4M33 A;  2Z5Q A;  3HIU A;  3FVB A;  4LYX A;  3RE7 A;  3KA6 A;  2ZG7 X;  3PW8 A;  4RC5 B;  2Z90 A;  4LYU A;  3E1L A;  2CHI A;  4DYX A;  1L8H A;  3QD8 A;  1ZUJ A;  3GE4 A;  3F38 A;  4M34 A;  4U3G A;  5CMR A;  3RAV A;  5JKL A;  1DVB A;  4E6K A;  5FFB A;  5ERJ A;  3R2M A;  2Z6M A;  3QHB A;  1O9R A;  1TK6 A;  1F33 A;  1LKO A;  4REU A;  2XKQ A;  2XJO A;  2ZA6 A;  3E1J A;  3KXU A;  1VLG A;  5FFD A;  5FFA A;  5FFE A;  3F32 A;  4CVS A;  2VXI A;  1RCG A;  3E2C A;  3PW8 C;  4XKS A;  4EVB A;  5JKM G;  4ML5 A;  3RGD A;  1LKP A;  3ES3 A;  5HJH A;  4CMY A;  3OGH A;  3T9J A;  3F37 A;  1MFR A;  2WLA A;  3PVR A;  4TOC A;  1HRS A;  3E1Q A;  3FI6 A;  3IQ1 A;  4MN9 A;  3ERZ A;  4RC7 A;  5JAC A;  3Q4N A;  4IWJ A;  5GU3 X;  4MKU A;  4PGK A;  4PG1 A;  3EZU A;  4DYY A;  2ZA8 A;  4ETR A;  1SOF A;  5C6F A;  4R42 A;  2V15 A;  3UOI A;  1AEW A;  4TOE A;  2YJJ A; 
#chains in the Genus database with same CATH topology
 1RCD A;  5JKL G;  4ZL6 A;  3PWF A;  2C2J A;  5K53 A;  4MY7 A;  3Q4Q A;  4M32 A;  3Q4O A;  4LQJ A;  2C6R A;  4ZKW A;  3AJP A;  4CVP A;  1YV1 A;  3PVY B;  3SHX A;  5GU0 X;  4TOF A;  2PYB A;  3PZA A;  2V2P A;  2Y3Q A;  4W4K B;  1OTK A;  2FKZ A;  2V2S A;  1JI5 A;  1B71 A;  3R2L A;  4ZKH A;  5JDO B;  1BFR A;  3L0M A;  3R2H A;  1H96 A;  5IX6 A;  5GN8 A;  2X17 0;  4Y08 A;  4RC6 A;  3FSE A;  4II4 A;  1EUM A;  2ZA7 A;  1R03 A;  2F7N A;  3V3K B;  2FL0 A;  1GWG A;  4AM2 A;  3O7R A;  4RC8 A;  3BT5 A;  1N1Q A;  1RCC A;  1JTS A;  2GYD A;  2YW6 A;  3BVE A;  3E1P A;  2JD8 0;  2VZB A;  2RBD A;  1RCI A;  1VEI A;  1VEL A;  3H7G A;  4DAS A;  3ISF A;  1BCF A;  2FG4 A;  2D5K A;  1UMN A;  2BKC A;  3E1N A;  4YXM A;  3AK8 A;  2V8T A;  3F34 A;  4YKH A;  5D8Y A;  3R2O A;  1XZ1 A;  3AJQ A;  4ISP A;  1VEQ A;  3KA4 A;  3SID A;  3U90 A;  2CHP A;  3TA8 A;  3QB9 A;  3SH6 A;  5K52 A;  3PW1 A;  3AF7 X;  1L8I A;  2FJC A;  5ERK A;  4YXJ A;  1JYB A;  4MJY A;  4RC5 A;  4CYA A;  1RCE A;  2CIH A;  3ISE A;  2WWX B;  4A25 A;  3C21 A;  3C1Y A;  2IY4 A;  2YW7 A;  1Z6O M;  5GOU A;  2C41 A;  1ZS3 A;  2C2U A;  1RYT A;  4TOB A;  1NF4 A;  3KA3 A;  3PVR B;  4RC7 B;  2XJM A;  4OYN A;  2N02 A;  2CLB A;  2CN6 A;  4ZTT A;  3IS7 A;  3W54 A;  4DYU A;  2V2O A;  3UNO A;  3WNW A;  1JKU A;  2QQY A;  3NP0 X;  3F33 A;  4ZMC A;  5LG8 A;  2G4H A;  2ZG9 X;  1O9I A;  3QHC A;  1BG7 A;  3M6J A;  3Q4R A;  4TW3 A;  2V2I A;  3VV9 A;  3C1Z A;  3PVT A;  3UFB A;  4XGS A;  1YUX A;  2BW1 A;  1JIG A;  3R2R A;  3OJ5 A;  2AR0 A;  3GHQ A;  3R2K A;  3N6O A;  4LQH A;  4TO9 A;  5D8O A;  4ITW A;  3RD0 A;  2GS4 A;  4LPJ A;  1NFV A;  4CY9 A;  1JI4 A;  4DZ0 A;  3AF9 X;  1JRE A;  4XKU A;  4AM4 A;  4PG0 A;  3LKD A;  5GN8 B;  4E40 A;  4RC6 B;  4KXR B;  4ISM A;  3F39 A;  5J93 A;  3R2S A;  3C23 A;  2QF9 A;  5FFC A;  3PWQ A;  4YVZ A;  1IER A;  1SQ3 A;  5CZU A;  3VVA A;  4CVT A;  3UOF A;  3WVU A;  2CN7 A;  3KWO A;  5E2D A;  2IB0 A;  3PVY A;  1QGH A;  5AXS A;  5JKM A;  4Z3B A;  3BVF A;  1TJO A;  3VNX A;  3F35 A;  1Z4A A;  2CF7 A;  4QUW A;  1DPS A;  3BVL A;  1J30 A;  2FZF A;  4P18 A;  2ITB A;  4TOD A;  2V2L A;  2BK6 A;  4M35 A;  2OC5 A;  3PW1 B;  1QYB A;  4AM5 A;  3HL1 A;  1LKM A;  3E1M A;  1YUZ A;  1DAT A;  2UX1 A;  5FEJ A;  2CLU A;  3NOZ X;  2FHA A;  2MGY A;  4DI0 A;  5HQO A;  4KVR A;  3MPS A;  4EVE A;  3KA8 A;  3PWQ C;  4MUD A;  2W0O A;  3F36 A;  4CVR A;  2OKC A;  2OH3 A;  3EGM A;  2WTL A;  4ZJK A;  2IU2 A;  5J9V A;  3FRR A;  1S2Z A;  3AF8 X;  1F30 A;  5GU2 X;  1S3Q A;  1IES A;  3O7S A;  1FHA A;  4TOG A;  4LPN A;  4TOA A;  4XKT A;  5LBH A;  1NNQ A;  3KA9 A;  3EZ0 A;  3BVI A;  2XGW A;  1KRQ A;  4TOH A;  2V2R A;  4ITT A;  1JKV A;  5CMQ A;  2V2M A;  3PVT B;  3E1O A;  3WVW A;  2ZUR X;  2CEI A;  1S30 A;  3AJO A;  1NF6 A;  5D8Q A;  4ZLW A;  4W4L B;  4X0J A;  1MOJ A;  3JZ9 A;  1Z6O A;  4ERU A;  2Z5R A;  4ZL5 A;  4PGI A;  3FRS A;  4EVC A;  1VJX A;  2HR5 A;  5I4J A;  4DE6 A;  4DYZ A;  3BKN A;  2V2N A;  3IS8 A;  2XJN A;  3GGY A;  3QVD A;  1JGC A;  4CYB A;  5HU6 D;  3BVK A;  3KX9 A;  1XZ3 A;  3E6R A;  5D8R A;  4KVQ A;  2C2F A;  5HJF A;  2WLU A;  3KHK A;  2YJK A;  4ZKX A;  1TKO A;  4II4 B;  4LQN A;  5D8S A;  2JD6 0;  4LPM A;  2VXX A;  4KVS A;  4WJG 4;  5D8P A;  5D8X A;  2FG8 A;  3SE1 A;  5LG2 A;  4EVD A;  1UVH A;  2HTN A;  3A68 A;  1LB3 A;  3E6S A;  2ZG8 X;  5GU1 X;  4CMY V;  5LS9 A;  2FFX J;  2CWL A;  2BJY A;  4IWK A;  3KDQ A;  1TKP A;  4IXK A;  3WVV A;  2JD7 0;  2V2J A;  3NP2 X;  5E1U A;  2Z5P A;  3AK9 A;  5J8S A;  4Z5S A;  3A9Q A;  5JDO A;  3QZ3 A;  3RBC A;  3GVY A;  4LQV A;  2GYQ A;  5J8W A;  4M33 A;  2Z5Q A;  3HIU A;  3FVB A;  4MXP A;  4LYX A;  3RE7 A;  3KA6 A;  2V8U A;  2ZG7 X;  3PW8 A;  4RC5 B;  2Z90 A;  4LYU A;  3E1L A;  2CHI A;  2G38 B;  4DYX A;  1L8H A;  3QD8 A;  1ZUJ A;  3GE4 A;  3F38 A;  4M34 A;  4U3G A;  5CMR A;  3RAV A;  5JKL A;  1DVB A;  4E6K A;  5FFB A;  3JZA B;  5ERJ A;  3R2M A;  2Z6M A;  3QHB A;  1O9R A;  1TK6 A;  1F33 A;  1LKO A;  4REU A;  2XKQ A;  2XJO A;  2ZA6 A;  3E1J A;  3KXU A;  1VLG A;  5FFD A;  5FFA A;  3GGZ A;  5FFE A;  3D19 A;  3F32 A;  4CVS A;  2VXI A;  1RCG A;  3E2C A;  3PW8 C;  4XKS A;  4EVB A;  5JKM G;  4ML5 A;  3RGD A;  1LKP A;  3ES3 A;  5HJH A;  4CMY A;  3OGH A;  3T9J A;  3F37 A;  1MFR A;  3DBY A;  2WLA A;  3PVR A;  4TOC A;  1HRS A;  3E1Q A;  3FI6 A;  3IQ1 A;  4MN9 A;  3ERZ A;  4RC7 A;  5JAC A;  3Q4N A;  4IWJ A;  5GU3 X;  4MKU A;  4PGK A;  4PG1 A;  3EZU A;  4DYY A;  2ZA8 A;  4ETR A;  1SOF A;  5C6F A;  4R42 A;  2V15 A;  2Y44 A;  3UOI A;  1AEW A;  4TOE A;  2YJJ A; 
#chains in the Genus database with same CATH homology
 1RCD A;  5JKL G;  4ZL6 A;  3PWF A;  2C2J A;  5K53 A;  4MY7 A;  3Q4Q A;  4M32 A;  3Q4O A;  4LQJ A;  2C6R A;  4ZKW A;  3AJP A;  4CVP A;  1YV1 A;  3PVY B;  3SHX A;  5GU0 X;  4TOF A;  2PYB A;  3PZA A;  2V2P A;  2Y3Q A;  4W4K B;  1OTK A;  2FKZ A;  2V2S A;  1JI5 A;  1B71 A;  3R2L A;  4ZKH A;  5JDO B;  1BFR A;  3L0M A;  3R2H A;  1H96 A;  5IX6 A;  5GN8 A;  2X17 0;  4Y08 A;  4RC6 A;  3FSE A;  4II4 A;  1EUM A;  2ZA7 A;  1R03 A;  2F7N A;  3V3K B;  2FL0 A;  1GWG A;  4AM2 A;  3O7R A;  4RC8 A;  3BT5 A;  1N1Q A;  1RCC A;  1JTS A;  2GYD A;  2YW6 A;  3BVE A;  3E1P A;  2JD8 0;  2VZB A;  2RBD A;  1RCI A;  1VEI A;  1VEL A;  3H7G A;  4DAS A;  3ISF A;  1BCF A;  2FG4 A;  2D5K A;  1UMN A;  2BKC A;  3E1N A;  4YXM A;  3AK8 A;  2V8T A;  3F34 A;  4YKH A;  5D8Y A;  3R2O A;  1XZ1 A;  3AJQ A;  4ISP A;  1VEQ A;  3KA4 A;  3SID A;  3U90 A;  2CHP A;  3TA8 A;  3QB9 A;  3SH6 A;  5K52 A;  3PW1 A;  3AF7 X;  1L8I A;  2FJC A;  5ERK A;  4YXJ A;  1JYB A;  4MJY A;  4RC5 A;  4CYA A;  1RCE A;  2CIH A;  3ISE A;  2WWX B;  4A25 A;  3C21 A;  3C1Y A;  2IY4 A;  2YW7 A;  1Z6O M;  5GOU A;  2C41 A;  1ZS3 A;  2C2U A;  1RYT A;  4TOB A;  1NF4 A;  3KA3 A;  3PVR B;  4RC7 B;  2XJM A;  4OYN A;  2N02 A;  2CLB A;  2CN6 A;  4ZTT A;  3IS7 A;  3W54 A;  4DYU A;  2V2O A;  3UNO A;  3WNW A;  1JKU A;  2QQY A;  3NP0 X;  3F33 A;  4ZMC A;  5LG8 A;  2G4H A;  2ZG9 X;  1O9I A;  3QHC A;  1BG7 A;  3M6J A;  3Q4R A;  4TW3 A;  2V2I A;  3VV9 A;  3C1Z A;  3PVT A;  3UFB A;  4XGS A;  1YUX A;  2BW1 A;  1JIG A;  3R2R A;  3OJ5 A;  2AR0 A;  3GHQ A;  3R2K A;  3N6O A;  4LQH A;  4TO9 A;  5D8O A;  4ITW A;  3RD0 A;  2GS4 A;  4LPJ A;  1NFV A;  4CY9 A;  1JI4 A;  4DZ0 A;  3AF9 X;  1JRE A;  4XKU A;  4AM4 A;  4PG0 A;  3LKD A;  5GN8 B;  4E40 A;  4RC6 B;  4KXR B;  4ISM A;  3F39 A;  5J93 A;  3R2S A;  3C23 A;  2QF9 A;  5FFC A;  3PWQ A;  4YVZ A;  1IER A;  1SQ3 A;  5CZU A;  3VVA A;  4CVT A;  3UOF A;  3WVU A;  2CN7 A;  3KWO A;  5E2D A;  2IB0 A;  3PVY A;  1QGH A;  5AXS A;  5JKM A;  4Z3B A;  3BVF A;  1TJO A;  3VNX A;  3F35 A;  1Z4A A;  2CF7 A;  4QUW A;  1DPS A;  3BVL A;  1J30 A;  2FZF A;  4P18 A;  2ITB A;  4TOD A;  2V2L A;  2BK6 A;  4M35 A;  2OC5 A;  3PW1 B;  1QYB A;  4AM5 A;  3HL1 A;  1LKM A;  3E1M A;  1YUZ A;  1DAT A;  2UX1 A;  5FEJ A;  2CLU A;  3NOZ X;  2FHA A;  2MGY A;  4DI0 A;  5HQO A;  4KVR A;  3MPS A;  4EVE A;  3KA8 A;  3PWQ C;  4MUD A;  2W0O A;  3F36 A;  4CVR A;  2OKC A;  2OH3 A;  3EGM A;  2WTL A;  4ZJK A;  2IU2 A;  5J9V A;  3FRR A;  1S2Z A;  3AF8 X;  1F30 A;  5GU2 X;  1S3Q A;  1IES A;  3O7S A;  1FHA A;  4TOG A;  4LPN A;  4TOA A;  4XKT A;  5LBH A;  1NNQ A;  3KA9 A;  3EZ0 A;  3BVI A;  2XGW A;  1KRQ A;  4TOH A;  2V2R A;  4ITT A;  1JKV A;  5CMQ A;  2V2M A;  3PVT B;  3E1O A;  3WVW A;  2ZUR X;  2CEI A;  1S30 A;  3AJO A;  1NF6 A;  5D8Q A;  4ZLW A;  4W4L B;  4X0J A;  1MOJ A;  3JZ9 A;  1Z6O A;  4ERU A;  2Z5R A;  4ZL5 A;  4PGI A;  3FRS A;  4EVC A;  1VJX A;  2HR5 A;  5I4J A;  4DE6 A;  4DYZ A;  3BKN A;  2V2N A;  3IS8 A;  2XJN A;  3GGY A;  3QVD A;  1JGC A;  4CYB A;  5HU6 D;  3BVK A;  3KX9 A;  1XZ3 A;  3E6R A;  5D8R A;  4KVQ A;  2C2F A;  5HJF A;  2WLU A;  3KHK A;  2YJK A;  4ZKX A;  1TKO A;  4II4 B;  4LQN A;  5D8S A;  2JD6 0;  4LPM A;  2VXX A;  4KVS A;  4WJG 4;  5D8P A;  5D8X A;  2FG8 A;  3SE1 A;  5LG2 A;  4EVD A;  1UVH A;  2HTN A;  3A68 A;  1LB3 A;  3E6S A;  2ZG8 X;  5GU1 X;  4CMY V;  5LS9 A;  2FFX J;  2CWL A;  2BJY A;  4IWK A;  3KDQ A;  1TKP A;  4IXK A;  3WVV A;  2JD7 0;  2V2J A;  3NP2 X;  5E1U A;  2Z5P A;  3AK9 A;  5J8S A;  4Z5S A;  3A9Q A;  5JDO A;  3QZ3 A;  3RBC A;  3GVY A;  4LQV A;  2GYQ A;  5J8W A;  4M33 A;  2Z5Q A;  3HIU A;  3FVB A;  4MXP A;  4LYX A;  3RE7 A;  3KA6 A;  2V8U A;  2ZG7 X;  3PW8 A;  4RC5 B;  2Z90 A;  4LYU A;  3E1L A;  2CHI A;  2G38 B;  4DYX A;  1L8H A;  3QD8 A;  1ZUJ A;  3GE4 A;  3F38 A;  4M34 A;  4U3G A;  5CMR A;  3RAV A;  5JKL A;  1DVB A;  4E6K A;  5FFB A;  3JZA B;  5ERJ A;  3R2M A;  2Z6M A;  3QHB A;  1O9R A;  1TK6 A;  1F33 A;  1LKO A;  4REU A;  2XKQ A;  2XJO A;  2ZA6 A;  3E1J A;  3KXU A;  1VLG A;  5FFD A;  5FFA A;  3GGZ A;  5FFE A;  3D19 A;  3F32 A;  4CVS A;  2VXI A;  1RCG A;  3E2C A;  3PW8 C;  4XKS A;  4EVB A;  5JKM G;  4ML5 A;  3RGD A;  1LKP A;  3ES3 A;  5HJH A;  4CMY A;  3OGH A;  3T9J A;  3F37 A;  1MFR A;  3DBY A;  2WLA A;  3PVR A;  4TOC A;  1HRS A;  3E1Q A;  3FI6 A;  3IQ1 A;  4MN9 A;  3ERZ A;  4RC7 A;  5JAC A;  3Q4N A;  4IWJ A;  5GU3 X;  4MKU A;  4PGK A;  4PG1 A;  3EZU A;  4DYY A;  2ZA8 A;  4ETR A;  1SOF A;  5C6F A;  4R42 A;  2V15 A;  2Y44 A;  3UOI A;  1AEW A;  4TOE A;  2YJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...