2WLFA

Crystallographic analysis of the polysialic acid o-acetyltransferase oatwy
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
210
structure length
210
Chain Sequence
MYSEQGINNTINISTTSLTNATQLTVIGNNNSVYIGNNCKIVSSNIRLKGNNITLFIADDVEIMGLVCSLHSDCSLQIQAKTTMGNGEITIAEKGKISIGKDCMLAHGYEIRNTDMHPIYSLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKEPNCVIAGSPAKIVKENIVWGRKMYHSTMYDDPTLNEFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Kinetic Characterizations of the Polysialic Acid O-Acetyltransferase Oatwy from Neisseria Meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup y
molecule tags Transferase
molecule keywords POLYSIALIC ACID O-ACETYLTRANSFERASE
total genus 76
structure length 210
sequence length 210
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 2wlfA00
1KGQA 4E1KA 3GOSA 5ADXU 5L6VA 4J09A 1G95A 3EEVA 1KK6A 3GVDA 3IXCA 4KNRA 4DCLA 1SSMA 4EA9A 2IU9A 1HV9A 2OI7A 3R5DA 3OTMA 5F42A 2RIJA 1KK4A 4IHHA 3ST8A 4KQLA 2ICXA 1QRLA 4M28A 3VBIA 2GGQA 3FSCA 2OI6A 2TDTA 3MC4A 3MQHA 3OU9A 3TDTA 1FXJA 3HJJA 1QRFA 3R5CA 4M2BA 3MQGA 3R5AA 3FTTA 1KHRA 5E3PA 4EGGA 4HZDA 4EQYA 3JQYA 3F1XA 5AFUU 1THJA 1MR9A 3R2WA 4G87A 4E6UA 3GUEA 3R1WA 4M2AA 4IHFA 5AFUV 4K6RA 3R0SA 2VD4A 1T3DA 1TDTA 1KGTA 3PMOA 1G97A 3P1BA 3BSWA 2OEGA 4KPZA 4N69A 1OCXA 3FSYA 3T57A 2IU8A 4MFGA 5U2KA 1HM9A 2P2OA 2I5KA 4R37A 1KQAA 3DHOA 3R3IA 1SSTA 3FWWA 3D98A 4HZCA 4AA7A 2QIVX 1QRMA 2OEFA 2Q4JA 3NZ2A 2QKXA 3EG4A 3V4EA 4KPXA 1QQ0A 2V0KA 3DJ4A 1HM8A 4R7PA 2WLFA 2VHEA 4KNXA 2W0VA 4N6AA 3SRTA 3D8VA 2V0LA 1YP2A 3R5BA 3VBLA 1KRUA 4J18A 5E3RA 3VBJA 2JF3A 1V3WA 3R8YA 4EA7A 3TK8A 3BFPA 3VNPA 3FS8A 4R36A 1QREA 3VBMA 2OI5A 1XHDA 4G3SA 1SSQA 5E3QA 3P47A 5DEMA 3TIOA 3TWDA 1V67A 1Z90A 4HURA 2WLEA 2W0WA 3VBNA 1QRGA 2JF2A 3CJ8A 3I3AA 4ISXA 1MRLA 2AQ9A 2XATA 1KRVA 3FSXA 3FOQA 2V0JA 3C8VA 2IC7A 3HSQA 4FCEA 4M98A 3BXYA 2WLCA 3FSBA 2V0HA 4HUSA 3I3XA 4E75A 3OW5A 2ICYA 1YP3A 4AAWA 1KRRA 5L6SA 5ADXV 4M99A 3VBKA 2WLGA 3DK5A 3TISA 3SPTA 3BSYA 4N27A 3KWEA 1YP4A 1XATA 4HCQA 1FWYA 3EH0A 3OUPA 3R3RA 4G3QA 2GGOA 2QIAA 3OTZA 2NPOA 2WLDA 1KK5A 3Q1XA 4H7OA 5DG3A 4EAAA 2IUAA 3BSSA 3IGJA 4AC3A 1HM0A 3VBPA 4MYOA 3TV0A 4E6TA 4G3PA 1MR7A 4EABA 4MZUA 4EA8A 1J2ZA 1S80A 4IHGA 2V0IA 3KWCA 4E79A 1LXAA 4M9CA 4N6BA 5DEPA 3ECTA 3BRKX 2FKOA 3KWDA
chains in the Genus database with same CATH superfamily
1KGQA 4E1KA 3GOSA 5ADXU 5L6VA 4J09A 1G95A 3EEVA 1KK6A 3GVDA 3IXCA 4KNRA 4DCLA 1SSMA 1EWWA 4EA9A 2IU9A 1HV9A 2OI7A 3R5DA 3OTMA 5F42A 2RIJA 1KK4A 4IHHA 3ST8A 4KQLA 2ICXA 1QRLA 4M28A 3VBIA 2GGQA 3FSCA 2OI6A 2TDTA 3MC4A 3MQHA 3OU9A 3TDTA 1FXJA 3HJJA 1QRFA 3R5CA 4M2BA 3OGZA 3GQ9A 3MQGA 3R5AA 3FTTA 1KHRA 5E3PA 4EGGA 4HZDA 4EQYA 3JQYA 3F1XA 5AFUU 1THJA 1MR9A 3R2WA 4G87A 4E6UA 3GUEA 3R1WA 4M2AA 4IHFA 5AFUV 4K6RA 3R0SA 2VD4A 1T3DA 1TDTA 1KGTA 3PMOA 1G97A 3P1BA 3BSWA 2OEGA 4KPZA 4N69A 1OCXA 3FSYA 3T57A 2IU8A 4MFGA 5U2KA 1HM9A 2P2OA 3V4EA 2I5KA 4R37A 1KQAA 3DHOA 3R3IA 1SSTA 3FWWA 3OH2A 3D98A 4HZCA 4AA7A 2QIVX 1QRMA 2OEFA 2Q4JA 3NZ2A 2QKXA 3EG4A 3OH0A 4KPXA 1QQ0A 2V0KA 3DJ4A 1HM8A 4R7PA 2WLFA 2VHEA 4KNXA 2W0VA 4N6AA 3SRTA 3D8VA 2V0LA 1YP2A 3R5BA 3VBLA 1KRUA 4J18A 5E3RA 3VBJA 2JF3A 1V3WA 1Z2FA 3R8YA 4EA7A 3TK8A 3BFPA 3VNPA 3FS8A 4R36A 1QREA 3VBMA 2OI5A 1XHDA 4G3SA 1SSQA 5E3QA 1N4IA 3P47A 5DEMA 3TIOA 3TWDA 1V67A 1Z90A 4HURA 2WLEA 2W0WA 3VBNA 1QRGA 2JF2A 3CJ8A 3I3AA 4ISXA 3GQAA 1MRLA 2AQ9A 2XATA 1KRVA 3FSXA 3FOQA 2V0JA 3C8VA 2IC7A 3HSQA 4FCEA 4M98A 3BXYA 2WLCA 3FSBA 2V0HA 4HUSA 3I3XA 3OH4A 3SUCA 1L0SA 4E75A 3OW5A 2ICYA 1YP3A 4AAWA 1KRRA 5L6SA 5ADXV 4M99A 3VBKA 2WLGA 3DK5A 3TISA 3OH1A 3BSYA 4N27A 3SPTA 3KWEA 1YP4A 1XATA 4HCQA 1FWYA 3EH0A 3OUPA 3R3RA 4G3QA 1M8NA 2GGOA 2QIAA 3OTZA 2NPOA 2WLDA 1KK5A 3Q1XA 4H7OA 5DG3A 4EAAA 2IUAA 3BSSA 3IGJA 4AC3A 1HM0A 3VBPA 4MYOA 3TV0A 4E6TA 4G3PA 1MR7A 4EABA 3GQ7A 4MZUA 4EA8A 1J2ZA 1S80A 4IHGA 2V0IA 3KWCA 4E79A 1LXAA 3GQ8A 4M9CA 4N6BA 5DEPA 3ECTA 3BRKX 2FKOA 3KWDA 3OH3A
chains in the Genus database with same CATH topology
1KGQA 4E1KA 3GOSA 5ADXU 5L6VA 4J09A 1G95A 3EEVA 1KK6A 3GVDA 3IXCA 4KNRA 4DCLA 1SSMA 4EA9A 2IU9A 1HV9A 2OI7A 3R5DA 3OTMA 5F42A 2RIJA 1KK4A 4IHHA 3ST8A 4KQLA 2ICXA 1QRLA 4M28A 3VBIA 2GGQA 3FSCA 2OI6A 2TDTA 3MC4A 3MQHA 3OU9A 3TDTA 1FXJA 3HJJA 1QRFA 3R5CA 4M2BA 3MQGA 3R5AA 3FTTA 1KHRA 5E3PA 4EGGA 4HZDA 4EQYA 3JQYA 3F1XA 5AFUU 1THJA 1MR9A 3R2WA 4G87A 4E6UA 3GUEA 3R1WA 4M2AA 4IHFA 5AFUV 4K6RA 3R0SA 2VD4A 1T3DA 1TDTA 1KGTA 3PMOA 1G97A 3P1BA 3BSWA 2OEGA 4KPZA 4N69A 1OCXA 3FSYA 3T57A 2IU8A 4MFGA 5U2KA 1HM9A 2P2OA 2I5KA 4R37A 1KQAA 3DHOA 3R3IA 1SSTA 3FWWA 3D98A 4HZCA 4AA7A 2QIVX 1QRMA 2OEFA 2Q4JA 3NZ2A 2QKXA 3EG4A 3V4EA 4KPXA 1QQ0A 2V0KA 3DJ4A 1HM8A 4R7PA 2WLFA 2VHEA 4KNXA 2W0VA 4N6AA 3SRTA 3D8VA 2V0LA 1YP2A 3R5BA 3VBLA 1KRUA 4J18A 5E3RA 3VBJA 2JF3A 1V3WA 3R8YA 4EA7A 3TK8A 3BFPA 3VNPA 3FS8A 4R36A 1QREA 3VBMA 2OI5A 1XHDA 4G3SA 1SSQA 5E3QA 3P47A 5DEMA 3TIOA 3TWDA 1V67A 1Z90A 4HURA 2WLEA 2W0WA 3VBNA 1QRGA 2JF2A 3CJ8A 3I3AA 4ISXA 1MRLA 2AQ9A 2XATA 1KRVA 3FSXA 3FOQA 2V0JA 3C8VA 2IC7A 3HSQA 4FCEA 4M98A 3BXYA 2WLCA 3FSBA 2V0HA 4HUSA 3I3XA 4E75A 3OW5A 2ICYA 1YP3A 4AAWA 1KRRA 5L6SA 5ADXV 4M99A 3VBKA 2WLGA 3DK5A 3TISA 3SPTA 3BSYA 4N27A 3KWEA 1YP4A 1XATA 4HCQA 1FWYA 3EH0A 3OUPA 3R3RA 4G3QA 2GGOA 2QIAA 3OTZA 2NPOA 2WLDA 1KK5A 3Q1XA 4H7OA 5DG3A 4EAAA 2IUAA 3BSSA 3IGJA 4AC3A 1HM0A 3VBPA 4MYOA 3TV0A 4E6TA 4G3PA 1MR7A 4EABA 4MZUA 4EA8A 1J2ZA 1S80A 4IHGA 2V0IA 3KWCA 4E79A 1LXAA 4M9CA 4N6BA 5DEPA 3ECTA 3BRKX 2FKOA 3KWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KGQ A;  4E1K A;  3GOS A;  5ADX U;  5L6V A;  4J09 A;  1G95 A;  3EEV A;  1KK6 A;  3GVD A;  3IXC A;  4KNR A;  4DCL A;  1SSM A;  4EA9 A;  2IU9 A;  1HV9 A;  2OI7 A;  3R5D A;  3OTM A;  5F42 A;  2RIJ A;  1KK4 A;  4IHH A;  3ST8 A;  4KQL A;  2ICX A;  1QRL A;  4M28 A;  3VBI A;  2GGQ A;  3FSC A;  2OI6 A;  2TDT A;  3MC4 A;  3MQH A;  3OU9 A;  3TDT A;  1FXJ A;  3HJJ A;  1QRF A;  3R5C A;  4M2B A;  3MQG A;  3R5A A;  3FTT A;  1KHR A;  5E3P A;  4EGG A;  4HZD A;  4EQY A;  3JQY A;  3F1X A;  5AFU U;  1THJ A;  1MR9 A;  3R2W A;  4G87 A;  4E6U A;  3GUE A;  3R1W A;  4M2A A;  4IHF A;  5AFU V;  4K6R A;  3R0S A;  2VD4 A;  1T3D A;  1TDT A;  1KGT A;  3PMO A;  1G97 A;  3P1B A;  3BSW A;  2OEG A;  4KPZ A;  4N69 A;  1OCX A;  3FSY A;  3T57 A;  2IU8 A;  4MFG A;  5U2K A;  1HM9 A;  2P2O A;  2I5K A;  4R37 A;  1KQA A;  3DHO A;  3R3I A;  1SST A;  3FWW A;  3D98 A;  4HZC A;  4AA7 A;  2QIV X;  1QRM A;  2OEF A;  2Q4J A;  3NZ2 A;  2QKX A;  3EG4 A;  3V4E A;  4KPX A;  1QQ0 A;  2V0K A;  3DJ4 A;  1HM8 A;  4R7P A;  2WLF A;  2VHE A;  4KNX A;  2W0V A;  4N6A A;  3SRT A;  3D8V A;  2V0L A;  1YP2 A;  3R5B A;  3VBL A;  1KRU A;  4J18 A;  5E3R A;  3VBJ A;  2JF3 A;  1V3W A;  3R8Y A;  4EA7 A;  3TK8 A;  3BFP A;  3VNP A;  3FS8 A;  4R36 A;  1QRE A;  3VBM A;  2OI5 A;  1XHD A;  4G3S A;  1SSQ A;  5E3Q A;  3P47 A;  5DEM A;  3TIO A;  3TWD A;  1V67 A;  1Z90 A;  4HUR A;  2WLE A;  2W0W A;  3VBN A;  1QRG A;  2JF2 A;  3CJ8 A;  3I3A A;  4ISX A;  1MRL A;  2AQ9 A;  2XAT A;  1KRV A;  3FSX A;  3FOQ A;  2V0J A;  3C8V A;  2IC7 A;  3HSQ A;  4FCE A;  4M98 A;  3BXY A;  2WLC A;  3FSB A;  2V0H A;  4HUS A;  3I3X A;  4E75 A;  3OW5 A;  2ICY A;  1YP3 A;  4AAW A;  1KRR A;  5L6S A;  5ADX V;  4M99 A;  3VBK A;  2WLG A;  3DK5 A;  3TIS A;  3SPT A;  3BSY A;  4N27 A;  3KWE A;  1YP4 A;  1XAT A;  4HCQ A;  1FWY A;  3EH0 A;  3OUP A;  3R3R A;  4G3Q A;  2GGO A;  2QIA A;  3OTZ A;  2NPO A;  2WLD A;  1KK5 A;  3Q1X A;  4H7O A;  5DG3 A;  4EAA A;  2IUA A;  3BSS A;  3IGJ A;  4AC3 A;  1HM0 A;  3VBP A;  4MYO A;  3TV0 A;  4E6T A;  4G3P A;  1MR7 A;  4EAB A;  4MZU A;  4EA8 A;  1J2Z A;  1S80 A;  4IHG A;  2V0I A;  3KWC A;  4E79 A;  1LXA A;  4M9C A;  4N6B A;  5DEP A;  3ECT A;  3BRK X;  2FKO A;  3KWD A; 
#chains in the Genus database with same CATH topology
 1KGQ A;  4E1K A;  3GOS A;  5ADX U;  5L6V A;  4J09 A;  1G95 A;  3EEV A;  1KK6 A;  3GVD A;  3IXC A;  4KNR A;  4DCL A;  1SSM A;  1EWW A;  4EA9 A;  2IU9 A;  1HV9 A;  2OI7 A;  3R5D A;  3OTM A;  5F42 A;  2RIJ A;  1KK4 A;  4IHH A;  3ST8 A;  4KQL A;  2ICX A;  1QRL A;  4M28 A;  3VBI A;  2GGQ A;  3FSC A;  2OI6 A;  2TDT A;  3MC4 A;  3MQH A;  3OU9 A;  3TDT A;  1FXJ A;  3HJJ A;  1QRF A;  3R5C A;  4M2B A;  3OGZ A;  3GQ9 A;  3MQG A;  3R5A A;  3FTT A;  1KHR A;  5E3P A;  4EGG A;  4HZD A;  4EQY A;  3JQY A;  3F1X A;  5AFU U;  1THJ A;  1MR9 A;  3R2W A;  4G87 A;  4E6U A;  3GUE A;  3R1W A;  4M2A A;  4IHF A;  5AFU V;  4K6R A;  3R0S A;  2VD4 A;  1T3D A;  1TDT A;  1KGT A;  3PMO A;  1G97 A;  3P1B A;  3BSW A;  2OEG A;  4KPZ A;  4N69 A;  1OCX A;  3FSY A;  3T57 A;  2IU8 A;  4MFG A;  5U2K A;  1HM9 A;  2P2O A;  3V4E A;  2I5K A;  4R37 A;  1KQA A;  3DHO A;  3R3I A;  1SST A;  3FWW A;  3OH2 A;  3D98 A;  4HZC A;  4AA7 A;  2QIV X;  1QRM A;  2OEF A;  2Q4J A;  3NZ2 A;  2QKX A;  3EG4 A;  3OH0 A;  4KPX A;  1QQ0 A;  2V0K A;  3DJ4 A;  1HM8 A;  4R7P A;  2WLF A;  2VHE A;  4KNX A;  2W0V A;  4N6A A;  3SRT A;  3D8V A;  2V0L A;  1YP2 A;  3R5B A;  3VBL A;  1KRU A;  4J18 A;  5E3R A;  3VBJ A;  2JF3 A;  1V3W A;  1Z2F A;  3R8Y A;  4EA7 A;  3TK8 A;  3BFP A;  3VNP A;  3FS8 A;  4R36 A;  1QRE A;  3VBM A;  2OI5 A;  1XHD A;  4G3S A;  1SSQ A;  5E3Q A;  1N4I A;  3P47 A;  5DEM A;  3TIO A;  3TWD A;  1V67 A;  1Z90 A;  4HUR A;  2WLE A;  2W0W A;  3VBN A;  1QRG A;  2JF2 A;  3CJ8 A;  3I3A A;  4ISX A;  3GQA A;  1MRL A;  2AQ9 A;  2XAT A;  1KRV A;  3FSX A;  3FOQ A;  2V0J A;  3C8V A;  2IC7 A;  3HSQ A;  4FCE A;  4M98 A;  3BXY A;  2WLC A;  3FSB A;  2V0H A;  4HUS A;  3I3X A;  3OH4 A;  3SUC A;  1L0S A;  4E75 A;  3OW5 A;  2ICY A;  1YP3 A;  4AAW A;  1KRR A;  5L6S A;  5ADX V;  4M99 A;  3VBK A;  2WLG A;  3DK5 A;  3TIS A;  3OH1 A;  3BSY A;  4N27 A;  3SPT A;  3KWE A;  1YP4 A;  1XAT A;  4HCQ A;  1FWY A;  3EH0 A;  3OUP A;  3R3R A;  4G3Q A;  1M8N A;  2GGO A;  2QIA A;  3OTZ A;  2NPO A;  2WLD A;  1KK5 A;  3Q1X A;  4H7O A;  5DG3 A;  4EAA A;  2IUA A;  3BSS A;  3IGJ A;  4AC3 A;  1HM0 A;  3VBP A;  4MYO A;  3TV0 A;  4E6T A;  4G3P A;  1MR7 A;  4EAB A;  3GQ7 A;  4MZU A;  4EA8 A;  1J2Z A;  1S80 A;  4IHG A;  2V0I A;  3KWC A;  4E79 A;  1LXA A;  3GQ8 A;  4M9C A;  4N6B A;  5DEP A;  3ECT A;  3BRK X;  2FKO A;  3KWD A;  3OH3 A; 
#chains in the Genus database with same CATH homology
 1KGQ A;  4E1K A;  3GOS A;  5ADX U;  5L6V A;  4J09 A;  1G95 A;  3EEV A;  1KK6 A;  3GVD A;  3IXC A;  4KNR A;  4DCL A;  1SSM A;  4EA9 A;  2IU9 A;  1HV9 A;  2OI7 A;  3R5D A;  3OTM A;  5F42 A;  2RIJ A;  1KK4 A;  4IHH A;  3ST8 A;  4KQL A;  2ICX A;  1QRL A;  4M28 A;  3VBI A;  2GGQ A;  3FSC A;  2OI6 A;  2TDT A;  3MC4 A;  3MQH A;  3OU9 A;  3TDT A;  1FXJ A;  3HJJ A;  1QRF A;  3R5C A;  4M2B A;  3MQG A;  3R5A A;  3FTT A;  1KHR A;  5E3P A;  4EGG A;  4HZD A;  4EQY A;  3JQY A;  3F1X A;  5AFU U;  1THJ A;  1MR9 A;  3R2W A;  4G87 A;  4E6U A;  3GUE A;  3R1W A;  4M2A A;  4IHF A;  5AFU V;  4K6R A;  3R0S A;  2VD4 A;  1T3D A;  1TDT A;  1KGT A;  3PMO A;  1G97 A;  3P1B A;  3BSW A;  2OEG A;  4KPZ A;  4N69 A;  1OCX A;  3FSY A;  3T57 A;  2IU8 A;  4MFG A;  5U2K A;  1HM9 A;  2P2O A;  2I5K A;  4R37 A;  1KQA A;  3DHO A;  3R3I A;  1SST A;  3FWW A;  3D98 A;  4HZC A;  4AA7 A;  2QIV X;  1QRM A;  2OEF A;  2Q4J A;  3NZ2 A;  2QKX A;  3EG4 A;  3V4E A;  4KPX A;  1QQ0 A;  2V0K A;  3DJ4 A;  1HM8 A;  4R7P A;  2WLF A;  2VHE A;  4KNX A;  2W0V A;  4N6A A;  3SRT A;  3D8V A;  2V0L A;  1YP2 A;  3R5B A;  3VBL A;  1KRU A;  4J18 A;  5E3R A;  3VBJ A;  2JF3 A;  1V3W A;  3R8Y A;  4EA7 A;  3TK8 A;  3BFP A;  3VNP A;  3FS8 A;  4R36 A;  1QRE A;  3VBM A;  2OI5 A;  1XHD A;  4G3S A;  1SSQ A;  5E3Q A;  3P47 A;  5DEM A;  3TIO A;  3TWD A;  1V67 A;  1Z90 A;  4HUR A;  2WLE A;  2W0W A;  3VBN A;  1QRG A;  2JF2 A;  3CJ8 A;  3I3A A;  4ISX A;  1MRL A;  2AQ9 A;  2XAT A;  1KRV A;  3FSX A;  3FOQ A;  2V0J A;  3C8V A;  2IC7 A;  3HSQ A;  4FCE A;  4M98 A;  3BXY A;  2WLC A;  3FSB A;  2V0H A;  4HUS A;  3I3X A;  4E75 A;  3OW5 A;  2ICY A;  1YP3 A;  4AAW A;  1KRR A;  5L6S A;  5ADX V;  4M99 A;  3VBK A;  2WLG A;  3DK5 A;  3TIS A;  3SPT A;  3BSY A;  4N27 A;  3KWE A;  1YP4 A;  1XAT A;  4HCQ A;  1FWY A;  3EH0 A;  3OUP A;  3R3R A;  4G3Q A;  2GGO A;  2QIA A;  3OTZ A;  2NPO A;  2WLD A;  1KK5 A;  3Q1X A;  4H7O A;  5DG3 A;  4EAA A;  2IUA A;  3BSS A;  3IGJ A;  4AC3 A;  1HM0 A;  3VBP A;  4MYO A;  3TV0 A;  4E6T A;  4G3P A;  1MR7 A;  4EAB A;  4MZU A;  4EA8 A;  1J2Z A;  1S80 A;  4IHG A;  2V0I A;  3KWC A;  4E79 A;  1LXA A;  4M9C A;  4N6B A;  5DEP A;  3ECT A;  3BRK X;  2FKO A;  3KWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...