2WLVB

Structure of the n-terminal capsid domain of hiv-2
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
144
structure length
144
Chain Sequence
PVQHVGGTYTHIPLSPRTLNAWVKLVQQKKFGAEVVPGFQALSEGCTPYDINQMLNCVGDHQAAMQIIREIINEEAAEWDVQHPIPGPLPAGQLREPRGSDIAGTTSTVEEQIQWMFRPQNPVPVGNIYRRWIQIGLQKCVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Site Remodelling Switches HIV Specificity of Antiretroviral Trimcyp
pubmed doi rcsb
molecule keywords GAG POLYPROTEIN
molecule tags Viral protein
source organism Human immunodeficiency virus type 2 (isolate d194)
total genus 53
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2009-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2wlvB00
3BP9A 4E91A 1AFVA 2X2DD 1G03A 1P7NA 1M9FC 2M8LA 4XRQA 5HGMA 2PXRC 1QRJA 4U0CA 4DGAC 2Y4ZA 5JPAA 1GWPA 4U0BA 4PH3A 4B4NA 4WYMA 5HGNA 1D1DA 4PH2A 4U0EA 2X83A 1M9EC 2V4XA 4J93A 4INBA 2WLVA 4NX4C 2EIAA 4HTWA 1M9CC 4LQWC 5HGKA 1U7KA 1EM9A 4QNBA 2PWOA 2XGYA 4DGEC 3H4EA 4U0FA 2PWMA 2JPRA 3MGEA 2WLVB 1AK4C 3H47A 4U0AA 5HGOA 2X82A 1M9YC 4U0DA 2M8PA 1E6JP 1L6NA 4PH0A 3NTEA 2KGFA 1EIAA 5HGLA 1M9DC 4XFYA 3P05A 4XFXA 2GONA 2XGUA 2XDEA 4E92A 2M8NA 2LF4A 2XGVA 4XROA 1M9XC 2GOLB 4XFZA
chains in the Genus database with same CATH superfamily
3BP9A 4E91A 1AFVA 2X2DD 1G03A 1P7NA 1M9FC 2M8LA 4XRQA 5HGMA 2PXRC 1QRJA 4U0CA 4DGAC 2Y4ZA 5JPAA 1GWPA 4U0BA 4PH3A 4B4NA 4WYMA 5HGNA 1D1DA 4PH2A 4U0EA 2X83A 1M9EC 2V4XA 4J93A 4INBA 2WLVA 4NX4C 2EIAA 4HTWA 1M9CC 4LQWC 5HGKA 1U7KA 1EM9A 4QNBA 2PWOA 2XGYA 4DGEC 3H4EA 4U0FA 2PWMA 2JPRA 3MGEA 2WLVB 1AK4C 3H47A 4U0AA 5HGOA 2X82A 1M9YC 4U0DA 2M8PA 1E6JP 1L6NA 4PH0A 3NTEA 2KGFA 1EIAA 5HGLA 1M9DC 4XFYA 3P05A 4XFXA 2GONA 2XGUA 2XDEA 4E92A 2M8NA 2LF4A 2XGVA 4XROA 1M9XC 2GOLB 4XFZA
chains in the Genus database with same CATH topology
3BP9A 4E91A 1AFVA 2X2DD 1G03A 1P7NA 1M9FC 2M8LA 4XRQA 5HGMA 2PXRC 1QRJA 4U0CA 4DGAC 2Y4ZA 5JPAA 1GWPA 4U0BA 4PH3A 4B4NA 4WYMA 5HGNA 1D1DA 4PH2A 4U0EA 2X83A 1M9EC 2V4XA 4J93A 4INBA 2WLVA 4NX4C 2EIAA 4HTWA 1M9CC 4LQWC 5HGKA 1U7KA 1EM9A 4QNBA 2PWOA 2XGYA 4DGEC 3H4EA 4U0FA 2PWMA 2JPRA 3MGEA 2WLVB 1AK4C 3H47A 4U0AA 5HGOA 2X82A 1M9YC 4U0DA 2M8PA 1E6JP 1L6NA 4PH0A 3NTEA 2KGFA 1EIAA 5HGLA 1M9DC 4XFYA 3P05A 4XFXA 2GONA 2XGUA 2XDEA 4E92A 2M8NA 2LF4A 2XGVA 4XROA 1M9XC 2GOLB 4XFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP9 A;  4E91 A;  1AFV A;  2X2D D;  1G03 A;  1P7N A;  1M9F C;  2M8L A;  4XRQ A;  5HGM A;  2PXR C;  1QRJ A;  4U0C A;  4DGA C;  2Y4Z A;  5JPA A;  1GWP A;  4U0B A;  4PH3 A;  4B4N A;  4WYM A;  5HGN A;  1D1D A;  4PH2 A;  4U0E A;  2X83 A;  1M9E C;  2V4X A;  4J93 A;  4INB A;  2WLV A;  4NX4 C;  2EIA A;  4HTW A;  1M9C C;  4LQW C;  5HGK A;  1U7K A;  1EM9 A;  4QNB A;  2PWO A;  2XGY A;  4DGE C;  3H4E A;  4U0F A;  2PWM A;  2JPR A;  3MGE A;  2WLV B;  1AK4 C;  3H47 A;  4U0A A;  5HGO A;  2X82 A;  1M9Y C;  4U0D A;  2M8P A;  1E6J P;  1L6N A;  4PH0 A;  3NTE A;  2KGF A;  1EIA A;  5HGL A;  1M9D C;  4XFY A;  3P05 A;  4XFX A;  2GON A;  2XGU A;  2XDE A;  4E92 A;  2M8N A;  2LF4 A;  2XGV A;  4XRO A;  1M9X C;  2GOL B;  4XFZ A; 
#chains in the Genus database with same CATH topology
 3BP9 A;  4E91 A;  1AFV A;  2X2D D;  1G03 A;  1P7N A;  1M9F C;  2M8L A;  4XRQ A;  5HGM A;  2PXR C;  1QRJ A;  4U0C A;  4DGA C;  2Y4Z A;  5JPA A;  1GWP A;  4U0B A;  4PH3 A;  4B4N A;  4WYM A;  5HGN A;  1D1D A;  4PH2 A;  4U0E A;  2X83 A;  1M9E C;  2V4X A;  4J93 A;  4INB A;  2WLV A;  4NX4 C;  2EIA A;  4HTW A;  1M9C C;  4LQW C;  5HGK A;  1U7K A;  1EM9 A;  4QNB A;  2PWO A;  2XGY A;  4DGE C;  3H4E A;  4U0F A;  2PWM A;  2JPR A;  3MGE A;  2WLV B;  1AK4 C;  3H47 A;  4U0A A;  5HGO A;  2X82 A;  1M9Y C;  4U0D A;  2M8P A;  1E6J P;  1L6N A;  4PH0 A;  3NTE A;  2KGF A;  1EIA A;  5HGL A;  1M9D C;  4XFY A;  3P05 A;  4XFX A;  2GON A;  2XGU A;  2XDE A;  4E92 A;  2M8N A;  2LF4 A;  2XGV A;  4XRO A;  1M9X C;  2GOL B;  4XFZ A; 
#chains in the Genus database with same CATH homology
 3BP9 A;  4E91 A;  1AFV A;  2X2D D;  1G03 A;  1P7N A;  1M9F C;  2M8L A;  4XRQ A;  5HGM A;  2PXR C;  1QRJ A;  4U0C A;  4DGA C;  2Y4Z A;  5JPA A;  1GWP A;  4U0B A;  4PH3 A;  4B4N A;  4WYM A;  5HGN A;  1D1D A;  4PH2 A;  4U0E A;  2X83 A;  1M9E C;  2V4X A;  4J93 A;  4INB A;  2WLV A;  4NX4 C;  2EIA A;  4HTW A;  1M9C C;  4LQW C;  5HGK A;  1U7K A;  1EM9 A;  4QNB A;  2PWO A;  2XGY A;  4DGE C;  3H4E A;  4U0F A;  2PWM A;  2JPR A;  3MGE A;  2WLV B;  1AK4 C;  3H47 A;  4U0A A;  5HGO A;  2X82 A;  1M9Y C;  4U0D A;  2M8P A;  1E6J P;  1L6N A;  4PH0 A;  3NTE A;  2KGF A;  1EIA A;  5HGL A;  1M9D C;  4XFY A;  3P05 A;  4XFX A;  2GON A;  2XGU A;  2XDE A;  4E92 A;  2M8N A;  2LF4 A;  2XGV A;  4XRO A;  1M9X C;  2GOL B;  4XFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...