2WLVB

Structure of the n-terminal capsid domain of hiv-2
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
144
structure length
144
Chain Sequence
PVQHVGGTYTHIPLSPRTLNAWVKLVQQKKFGAEVVPGFQALSEGCTPYDINQMLNCVGDHQAAMQIIREIINEEAAEWDVQHPIPGPLPAGQLREPRGSDIAGTTSTVEEQIQWMFRPQNPVPVGNIYRRWIQIGLQKCVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN
publication title Active Site Remodelling Switches HIV Specificity of Antiretroviral Trimcyp
pubmed doi rcsb
source organism Human immunodeficiency virus type 2 (isolate d194)
molecule tags Viral protein
total genus 53
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2009-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2wlvB00
2X2DD 2XGYA 1QRJA 4NX4C 1M9XC 4DGAC 2Y4ZA 2GOLB 4U0FA 2WLVA 1D1DA 1L6NA 3P05A 2M8LA 4XFXA 1AFVA 5JPAA 2V4XA 1E6JP 4XFZA 5HGKA 1M9EC 4U0EA 2X82A 1G03A 1M9CC 4J93A 4HTWA 2PXRC 4E92A 1P7NA 2LF4A 2XGVA 4U0CA 5HGMA 5HGNA 4XFYA 1EM9A 1M9FC 2XGUA 3NTEA 1M9DC 4U0DA 4U0BA 2WLVB 3MGEA 5HGLA 4DGEC 1U7KA 4INBA 2KGFA 4WYMA 2EIAA 2PWOA 1AK4C 4LQWC 5HGOA 4XROA 1GWPA 4PH0A 4PH3A 1EIAA 2M8PA 4PH2A 4XRQA 3H4EA 2PWMA 2GONA 1M9YC 3H47A 4QNBA 4B4NA 4U0AA 2M8NA 2X83A 4E91A 2JPRA 2XDEA 3BP9A
chains in the Genus database with same CATH superfamily
2X2DD 2XGYA 1QRJA 4NX4C 1M9XC 4DGAC 2Y4ZA 2GOLB 4U0FA 2WLVA 1D1DA 1L6NA 3P05A 2M8LA 4XFXA 1AFVA 5JPAA 2V4XA 1E6JP 4XFZA 5HGKA 1M9EC 4U0EA 2X82A 1G03A 1M9CC 4J93A 4HTWA 2PXRC 4E92A 1P7NA 2LF4A 2XGVA 4U0CA 5HGMA 5HGNA 4XFYA 1EM9A 1M9FC 2XGUA 3NTEA 1M9DC 4U0DA 4U0BA 2WLVB 3MGEA 5HGLA 4DGEC 1U7KA 4INBA 2KGFA 4WYMA 2EIAA 2PWOA 1AK4C 4LQWC 5HGOA 4XROA 1GWPA 4PH0A 4PH3A 1EIAA 2M8PA 4PH2A 4XRQA 3H4EA 2PWMA 2GONA 1M9YC 3H47A 4QNBA 4B4NA 4U0AA 2M8NA 2X83A 4E91A 2JPRA 2XDEA 3BP9A
chains in the Genus database with same CATH topology
2X2DD 2XGYA 1QRJA 4NX4C 1M9XC 4DGAC 2Y4ZA 2GOLB 4U0FA 2WLVA 1D1DA 1L6NA 3P05A 2M8LA 4XFXA 1AFVA 5JPAA 2V4XA 1E6JP 4XFZA 5HGKA 1M9EC 4U0EA 2X82A 1G03A 1M9CC 4J93A 4HTWA 2PXRC 4E92A 1P7NA 2LF4A 2XGVA 4U0CA 5HGMA 5HGNA 4XFYA 1EM9A 1M9FC 2XGUA 3NTEA 1M9DC 4U0DA 4U0BA 2WLVB 3MGEA 5HGLA 4DGEC 1U7KA 4INBA 2KGFA 4WYMA 2EIAA 2PWOA 1AK4C 4LQWC 5HGOA 4XROA 1GWPA 4PH0A 4PH3A 1EIAA 2M8PA 4PH2A 4XRQA 3H4EA 2PWMA 2GONA 1M9YC 3H47A 4QNBA 4B4NA 4U0AA 2M8NA 2X83A 4E91A 2JPRA 2XDEA 3BP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X2D D;  2XGY A;  1QRJ A;  4NX4 C;  1M9X C;  4DGA C;  2Y4Z A;  2GOL B;  4U0F A;  2WLV A;  1D1D A;  1L6N A;  3P05 A;  2M8L A;  4XFX A;  1AFV A;  5JPA A;  2V4X A;  1E6J P;  4XFZ A;  5HGK A;  1M9E C;  4U0E A;  2X82 A;  1G03 A;  1M9C C;  4J93 A;  4HTW A;  2PXR C;  4E92 A;  1P7N A;  2LF4 A;  2XGV A;  4U0C A;  5HGM A;  5HGN A;  4XFY A;  1EM9 A;  1M9F C;  2XGU A;  3NTE A;  1M9D C;  4U0D A;  4U0B A;  2WLV B;  3MGE A;  5HGL A;  4DGE C;  1U7K A;  4INB A;  2KGF A;  4WYM A;  2EIA A;  2PWO A;  1AK4 C;  4LQW C;  5HGO A;  4XRO A;  1GWP A;  4PH0 A;  4PH3 A;  1EIA A;  2M8P A;  4PH2 A;  4XRQ A;  3H4E A;  2PWM A;  2GON A;  1M9Y C;  3H47 A;  4QNB A;  4B4N A;  4U0A A;  2M8N A;  2X83 A;  4E91 A;  2JPR A;  2XDE A;  3BP9 A; 
#chains in the Genus database with same CATH topology
 2X2D D;  2XGY A;  1QRJ A;  4NX4 C;  1M9X C;  4DGA C;  2Y4Z A;  2GOL B;  4U0F A;  2WLV A;  1D1D A;  1L6N A;  3P05 A;  2M8L A;  4XFX A;  1AFV A;  5JPA A;  2V4X A;  1E6J P;  4XFZ A;  5HGK A;  1M9E C;  4U0E A;  2X82 A;  1G03 A;  1M9C C;  4J93 A;  4HTW A;  2PXR C;  4E92 A;  1P7N A;  2LF4 A;  2XGV A;  4U0C A;  5HGM A;  5HGN A;  4XFY A;  1EM9 A;  1M9F C;  2XGU A;  3NTE A;  1M9D C;  4U0D A;  4U0B A;  2WLV B;  3MGE A;  5HGL A;  4DGE C;  1U7K A;  4INB A;  2KGF A;  4WYM A;  2EIA A;  2PWO A;  1AK4 C;  4LQW C;  5HGO A;  4XRO A;  1GWP A;  4PH0 A;  4PH3 A;  1EIA A;  2M8P A;  4PH2 A;  4XRQ A;  3H4E A;  2PWM A;  2GON A;  1M9Y C;  3H47 A;  4QNB A;  4B4N A;  4U0A A;  2M8N A;  2X83 A;  4E91 A;  2JPR A;  2XDE A;  3BP9 A; 
#chains in the Genus database with same CATH homology
 2X2D D;  2XGY A;  1QRJ A;  4NX4 C;  1M9X C;  4DGA C;  2Y4Z A;  2GOL B;  4U0F A;  2WLV A;  1D1D A;  1L6N A;  3P05 A;  2M8L A;  4XFX A;  1AFV A;  5JPA A;  2V4X A;  1E6J P;  4XFZ A;  5HGK A;  1M9E C;  4U0E A;  2X82 A;  1G03 A;  1M9C C;  4J93 A;  4HTW A;  2PXR C;  4E92 A;  1P7N A;  2LF4 A;  2XGV A;  4U0C A;  5HGM A;  5HGN A;  4XFY A;  1EM9 A;  1M9F C;  2XGU A;  3NTE A;  1M9D C;  4U0D A;  4U0B A;  2WLV B;  3MGE A;  5HGL A;  4DGE C;  1U7K A;  4INB A;  2KGF A;  4WYM A;  2EIA A;  2PWO A;  1AK4 C;  4LQW C;  5HGO A;  4XRO A;  1GWP A;  4PH0 A;  4PH3 A;  1EIA A;  2M8P A;  4PH2 A;  4XRQ A;  3H4E A;  2PWM A;  2GON A;  1M9Y C;  3H47 A;  4QNB A;  4B4N A;  4U0A A;  2M8N A;  2X83 A;  4E91 A;  2JPR A;  2XDE A;  3BP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...