2WM2A

Crystal structure of the cofactor-devoid 1-h-3-hydroxy-4- oxoquinaldine 2,4-dioxygenase (hod) from arthrobacter nitroguajacolicus ru61a in complex with chloride
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
274
structure length
274
Chain Sequence
TDTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQELDADFRVIVPNWRGHGLSPSEVPDFGYQEQVKDALEILDQLGVETFLPVSHSHGGWVLVELLEQAGPERAPRGIIMDWLMWAPKPDFAKSLTLLKDPERWREGTHGLFDVWLDGHDEKRVRHHLLEEMADYGYDCWGRSGRVIEDAYGRNGSPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPWFSYAKLGGPTHFPAIDVPDRAAVHIREFATAIRQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-H-3-HYDROXY-4-OXOQUINALDINE 2,4-DIOXYGENASE
publication title Structural Basis for Cofactor-Independent Dioxygenation of N-Heteroaromatic Compounds at the {Alpha}/{Beta}-Hydrolase Fold.
pubmed doi rcsb
source organism Arthrobacter nitroguajacolicus
molecule tags Hydrolase
total genus 97
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.48: 3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase.
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 2wm2A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wm2A01
5D6OA 2OXEA 3R0VA 3N2ZB 4BE4A 3F98A 3DL7A 4OYYA 2PUHA 4X95A 3WKAA 4CG2A 1YR2A 4AN1A 3KWFA 4GHWA 2GBGA 4MQMA 1EB9A 1TAHA 2CUTA 1UFOA 1ZICA 2WIDA 4MXDA 4FHZA 5LKAA 1H2WA 5EFZA 5C81A 2P8SA 5A71A 1XZCA 2XMZA 4WDRA 1WM1A 5DNVA 1XZEA 2JGMA 1EX9A 1GQRA 5YASA 4OU5A 3I1YA 3OTQA 5ALEA 5AOCA 2XMQA 1XZFA 2RIPA 1EDEA 4AZ3A 4A23A 2ROQA 4M0FA 4E11A 4JNCA 5KWIA 1CUAA 1XQWA 2XQKA 4FLMA 3TRDA 5K3DA 4JEIA 4BCBA 4H7JA 4HAIA 1JMYA 4H18A 3R3WA 4GWLA 1MTZA 1QJ4A 1BRTA 4TGLA 4UHCA 4CIBA 2WUEA 2GBCA 4Y2QA 2GYUA 3PFBA 2XUKA 1CUCA 5EHXA 5AM3A 4AMZA 3SX4A 4CCYB 5LZ7A 5LKRA 2WG2A 3O95A 3SK0A 1ETHA 1UK6A 2YYSA 4H7KA 3FLAA 3TJMA 5JAPA 4PSCA 3HABA 1QE3A 1HPLA 4UHBA 4Q3OA 5DLPA 1CUSA 3SC2A 3AFIA 2VT7A 1G5FA 3H18A 1BN7A 5HFNA 1AGYA 2QKYA 2JGKA 4GW3A 1QIIA 1LPNA 1CUYA 3FBWA 3LIPA 1IUNA 3HACA 4X71A 3IVMA 1MNAA 4AXBA 4DIUA 3EIOA 1QIGA 3ANSA 5AIBA 3RK4A 3GROA 5K3EA 3G9ZA 5EHNA 3C6ZA 2XMBA 1JT2A 4KACA 3DD5A 3EBLA 4KAFA 3WK9A 1QO7A 1CVLA 5AM5A 2WUGA 5FXMA 2YH2A 1E8NA 3RKSA 2O2IA 3FLBA 1R50A 1XZBA 3AJAA 4WDQA 3IIIA 1W1IA 2PSHA 4BAGA 1A7UA 1ZI8A 2RONA 4UBJA 4OCZA 3IULA 4WCVA 2AJDA 2B4KA 2XMRA 1DWQA 2W22A 4J0HA 2VJCA 3STVA 1MX1A 1NX9A 4J3JA 3QPDA 2Y6UA 1CUFA 3WK6A 2BAGA 2BKLA 4X85A 4N5IX 5AK3A 3H2HA 3A2LA 1XRLA 1H2YA 3WKEA 4MWSA 2I03A 1P0PA 3WMRA 1EI9A 4CCYA 5T4BA 3PFCA 5HZGA 4G9EA 3G0GA 1ZD4A 3WL6A 3X3HA 3E4DA 4FLFA 4P08A 4B7ZA 3AZQA 1BE0A 2PVSA 7YASA 3V1MA 1Y7IA 2XLCA 2WILA 4W1PA 4ZRDA 5SYMA 2WFMA 1ORVA 2O2HA 3D2AA 5AOBA 5FUMA 4N8SA 4I19A 4U2DA 1W4LA 2ZYRA 4J7AA 4S0XA 3D0KA 3D2BA 3L1JA 3STUA 4ARBA 4B83A 4UBLA 3GZJA 2WG0A 1QO9A 3NOXA 5K3CA 3WL7A 2CMFA 1CPYA 3AIMA 1F0PA 1QGED 5E2IA 3S8YA 4DNPA 4AO6A 3ZLTA 1JMKC 1TCAA 2EDCA 5A7FA 3STXA 4HTAA 1ISPA 5ALSA 3IDAA 3WKCA 5C8ZA 5C8XA 1ZGBA 4IH1A 3B12A 1PJAA 3AIOA 4DTCA 3W9UA 4GLBA 4Q3KA 4L3WA 2OGSA 3W04A 1CUZA 4AQDA 1AQLA 1AURA 1L7AA 1YB6A 4B0OA 4AX4A 3JWEA 2I78A 3WLAA 4X93A 1USWA 1MX9A 5JADA 1P0IA 2WLSA 4XJVA 4BVJA 1XFDA 2EEPA 2JEYA 3EQ7A 2H7CA 1UKAA 1XZGA 3G02A 1M33A 1R9NA 1G4HA 4DMFA 5JAOA 4LXHA 2BUAA 1QFSA 4UBKA 1DX6A 3WWCA 2ZSIA 1EVQA 4M0MA 3U1TA 1J1IA 1VZ3A 5BWBA 1TKRA 2VA9A 2JGEA 1ODSA 2D0DA 4HXFB 4XIIA 5H3HA 2ACEA 5A2GA 3B5EA 2HFKA 4I3FA 4EY7A 2HU8A 3WK5A 5FOQA 5ALVA 1YCDA 1DQZA 1P0QA 4W9RA 1EDBA 3E1GA 3HRHA 4WFKA 3B3QA 2JGIA 1Y37A 2QRUA 4JYPA 5BV7A 1R4ZA 3EQ8A 4NMWA 1FFCA 3LP5A 4X3CA 1EB8A 1QONA 2HA3A 1O6GA 1A8SA 3BWXA 2PSFA 4QLOA 3I6ZA 3PUHA 3VISA 5IVHA 1QOZA 1YASA 1EVEA 4ZV9A 5LZ4A 2QJWA 1XZLA 3H2KA 3HI4A 3BDVA 5JD5A 2QT9A 1TIBA 3EQ9A 1UOOA 3IUMA 4Y9SA 1ZI6A 4N8DA 5K5EA 6YASA 1C7IA 5DYYA 3A70A 4B81A 2WIGA 1E89A 3H1BA 5CH5A 3DNMA 3H17A 3BDIA 3L1IA 5ALQA 3H04A 3M81A 3AUKA 5CH8A 2VF2A 4QDXA 4DMHA 5A7HA 4HXEB 4UBMA 1CR6A 3STYA 2OLEA 4F21A 3R3XA 2VEOA 2ZSHA 2VJBA 2VAVA 1EH5A 2VT6A 4N8EA 2O2GA 2AJ8A 1QIJA 1LGYA 4GI1A 1UOQA 1AZWA 1XZKA 4J0DA 5HKBA 4QDOA 2WSLA 5T4FA 5JALA 2WIKA 4PW0A 4X00A 4J0KA 1KEZA 2H9YA 3C8HA 4D9JA 1XLWA 2WIFA 3I28A 5IVKA 4U2CA 5LYYA 3FVTA 3Q0TA 4HXGA 1BROA 1XLUA 3BL8A 3ZWQA 1MX5A 2ZYSA 3IB3A 1XRNA 5DYTA 3VJKA 2X5XA 4L0CA 3ED1A 1FFAA 5KWJA 2QTBA 4FBLA 3G9TA 1AKNA 2O7VA 3G0IA 1SC9A 2FUKA 4UHFA 5CT8A 3DKKA 4FNMA 2YASA 1HDEA 3R41A 4W63A 1CLEA 2UZ0A 1CUGA 3A6ZA 1X2BA 4BYMA 5JANA 2QUBA 3DCNA 1QIKA 3G9XA 1TCCA 3M82A 4MQLA 5BWCA 4W1RA 3CCCA 4X92A 3QBJA 1JI3A 1DQYA 5KBYA 3NGMA 2WTNA 3I2HA 3STTA 5FLKA 3FCYA 2YXPX 3FYTA 4NVRA 1YS1X 4U2BA 2R11A 5AH0A 3L1HA 3T4UA 4RE6A 3WA7A 2OAGA 3C87A 2QS9A 4B80A 4WJLA 2W6CX 4FMPA 4KE8A 2EDAA 2QR5A 3HSSA 5FKJA 2PM8A 3QMVA 4ETWA 1VXOA 2ACKA 3OG9A 4C88A 3C43A 2I3DA 3WJ2A 3QM1A 4KE6A 5CXXA 4OB7A 1QIFA 1QFMA 1A8UA 3DEAA 3FOBA 2QXUA 3R3ZA 5ALDA 2JEZA 4QDTA 1HL7A 1EK2A 1WCYA 3MUOA 3F67A 2QUAA 1E8MA 4QDUA 2RHTA 4BZWA 4B85A 4DMKA 5EIAA 3HLKA 5K3FB 1CUJA 1VOTA 5ALGA 2GYWA 5ALTA 2AXEA 4BP9A 3BE8A 1UT6A 2XMSA 4UBNA 2I3ZA 2HA4A 4NZZA 5E4JA 3V9AA 2FX5A 3W9BA 5FPQA 1YB7A 4INZA 4XWGA 5HF9A 1XRPA 1CUHA 2WFZA 5EIHA 4U2FA 5AM4A 4JH0A 2QM0A 3ZLUA 3LCRA 1JJIA 4DM7A 2WJ4A 2XUAA 3WYNA 2QOEA 1MAAA 4H7HA 3S2ZA 1IMJA 1GGVA 4DNQA 1CUEA 4B9EA 2PSJA 1ZD3A 5JD6A 2AJCA 2C58A 4Y2VA 2QZPA 1BCSA 2C0PA 3U0VA 5I7UA 1L7QA 3I2GA 4ZGBA 4FFVA 3BIXA 5D3KA 4LXIA 1FFDA 3D5EA 5LZ5A 5ALZA 3IA2A 1SFRA 4Y2SA 1PV1A 2Z3WA 5CT6A 4ARAA 4UHEA 2XMGA 2HFJA 4CIAA 2B61A 4OU4A 1DINA 3UUFA 1SCKA 5ALJA 2PU7A 1YA8A 3WL8A 1W6RA 3A2MA 2DHEA 4J0IA 2E3JA 5K3FA 1DTEA 3HC7A 4J0CA 1JJBA 4OB6A 2CKMA 3C8DA 5CT4A 4X7BA 5I9IA 5AI4A 2GZSA 3GELA 4IO0A 1XZMA 3OC0A 2PPLA 4EZIA 4Z49A 1ACLA 1LZLA 1C4XA 5ALUA 5FV4A 2RAUA 1EHYA 1ZIYA 3O4JA 1KU0A 5ALWA 5AKEA 1VA5A 5ALFA 2XUJA 2HRRA 1VJ5A 3FCXA 2HA6A 2V97A 1VXRA 5K3BA 4Y7DA 3VKFA 4AZ0A 4UFPA 1A8QA 4QZVA 4RE5A 5AOAA 3SWWA 1QIEA 4I4CA 1XZIA 3R3UA 1QTIA 3WYDA 2HU5A 3WZLA 4TVKA 4P92A 3V1KA 1QIHA 1FFEA 5AIAA 1LZKA 2XUPA 4FNGA 3RARA 1BCRA 3I6MA 5AK5A 2WHRA 5ALRA 3ESBA 1SOMA 4Y2TA 4MEAA 1N8SA 5FRDA 4YX9A 1GZ7A 2PX6A 5AKZA 2GBIA 1ODCA 4IH9A 4QEKA 1WB4A 4DLNA 4C4XA 1XKLA 2R8BA 3WQHA 3AZPA 2H7XA 4H7FA 3K9BA 5E4YA 4EY5A 2Y2UA 3G0DA 5HCUA 5AO9A 1CIJA 4AO8A 3WIOA 1CFJA 2OG1A 3AIKA 4K6HA 3O4HA 1SCIA 1BEEA 4K5QA 1P0MA 1IZ7A 3FYUC 5SYNA 1WHTA 4F5ZA 3H0CA 3Q8WA 1R9MA 3QZUA 4JUIA 4BRSA 2DCMA 5ISMA 1LNSA 4QWWA 1JU3A 4YASA 2RI6A 4C4ZA 4H35A 1F8UA 4MEBA 2XDWA 5AM0A 2OAEA 1ZD2P 3C6YA 5D7BA 4C87A 2XMCA 4M0EA 5EHZA 3M3DA 3P2MA 4BVLA 2OCGA 5CMLA 4X6XA 3DOIA 4G5XA 5J3JA 2RGUA 1HLGA 2O7RA 3D2CA 3QPCA 3IUQA 4B9AA 4HRXA 3BJRA 1ZOIA 1WPRA 4FDMA 4MJ3A 3OOSA 1Q84A 4EY4A 1CV2A 1XKTA 5HK8A 2VAXA 1ACJA 3ZV7A 1E5TA 2WG1A 3YASA 2HA7A 2XT0A 3TEJA 3VDXA 2WUFA 3H19A 1TCBA 5EHQA 3DLTA 3I2KA 2BGRA 2Q0XA 4FBMA 4LKOA 2Z3ZA 1ODTC 1LPAB 5AP9A 4P93A 1ORWA 1GPKA 1CUUA 2WJ3A 4X94A 5CTAA 2G63A 1R1DA 4EBBA 1QIMA 3C6BA 3DL4A 3N0TA 3STWA 2C4HA 5K3AA 3WK4A 1LPSA 4BCDA 3F8SA 4BTVA 4CI9A 3ESAA 4QE3A 3TGLA 5CURA 1QTRA 4H7IA 5AKGA 1AMNA 3WKDA 4W1QA 4Y2XA 5HK9A 5JAHA 1OXMA 2BFNA 4FKBA 5CXUA 2PSEA 5CH3A 3QPAA 3I2FA 4IQ4A 1EDDA 5HF6A 1TK3A 1YAHA 4B84A 1HQDA 2OPHA 5LIPA 1THTA 3VJLA 4H77A 2OQVA 2IX9A 2WM2A 3G9UA 3MUNA 3D4LA 2ZJ6A 1Y7HA 4WY8A 5DNWA 3FLEA 5EI5A 2CEKA 2OQIA 3LS2A 2H1IA 4GDMA 4A5SA 2DHCA 5AICA 4UBIA 3GBSA 1DWPA 4KYVA 1DX4A 5CBKA 1CUXA 3KD2A 2XQFA 3DDUA 2J4FA 4AN0A 1U4NA 4F60A 5D3ZA 2GZRA 4KRXA 2RHWA 1X70A 1ZJ4A 4KJXA 1QZ3A 5EGNA 2HL6A 5DTJA 1VA4A 3WWEA 4Y2PA 2VJDA 3QYJA 2HM7A 1N1MA 2DQYA 4G8CA 5CRIA 4KRYA 5AI9A 1OCEA 3F96A 3FSGA 4BDTA 1XROA 1VZ2A 5JARA 1HBJA 4HVTA 5AI0A 5CT5A 1VLQA 2VSQA 2HU7A 2WHQA 5LLSA 5T4EA 2Z8ZA 3D3NA 4AB1A 4UHDA 5DJ5A 4ZXFA 2G5TA 4G8DA 4AMYA 2DQZA 3MGAA 3JW8A 1XQVA 4RPCA 1B6GA 1ZI9A 4CG3A 1MN6A 1DU4A 3DJYA 5ALLA 4MYDA 3H2GA 2HA5A 4PSDA 5JD4A 5HF8A 1L7RA 2JBWA 1Z68A 5AM2A 4V2IA 1MT3A 2HHAA 3FVRA 1K8QA 1N5RA 1WPXA 5ALNA 5ESRA 1EINA 1Q83A 1T2NA 1UWCA 5DTIA 3K6KA 2AJBA 3BXPA 2ZJFA 1A88A 2BUCA 4ZWNA 2VJAA 2ORYA 1UZAA 2IITA 4RNCA 4U2EA 4OUKX 5AHXA 2QMQA 5HFAA 2J4CA 4PV7A 4FFWA 4L9AA 2CBGA 4J0GA 2Z5GA 4BZZA 5ALMA 4BRZA 4GECA 3ZI7A 5IVDA 3VVMA 1MNQA 4Y2RA 4DMCA 2HADA 1EA5A 2D5LA 3EF3A 1FFBA 3HXKA 2OGZA 1LPPA 4CCWA 3WA6A 5ALXA 4AO7A 5A6VA 3DQZA 5HF5A 2XUIA 4C4YA 4QWMA 3QMWA 1GPNA 4ITVA 4KEAA 2IIVA 2CJPA 1H23A 2WKWA 2B9VA 1YSCA 1WB6A 4F0JA 5AJHA 4LYEA 3O4IA 2HA0A 2JGJA 4C6HA 1MJ5A 4ZI5A 4UUQA 1R3DA 4G9GA 2PUJA 4JYMA 1U2EA 1TRHA 3FYUB 4G1FA 4PNZA 1JU4A 2WQZA 1AC5A 3ESCA 2BCEA 4X91A 4B0PA 1GKLA 5AK6A 4ZV7A 3DYVA 4U2GA 2WHPB 1UK8A 3G0CA 3PDCA 4OSEA 2ECFA 2DR0A 4J0JA 4BDSA 4B6GA 3HJUA 2WFLB 2XUDA 3M83A 4EHBA 1CQZA 3ICWA 3QITA 1BEZA 2FJ0A 3O0DA 1RP1A 3O4GA 4QLAA 1XZHA 2H7YA 3R3VA 1XQYA 5IH7A 1XZAA 5JIBA 3FNBA 5AI5A 1GXSA 4ROTA 4K2AA 3W2TA 1K6EA 2ZYIA 1E8DA 4GXNA 3FSGD 3IUJA 4KAJA 3RLIA 3R3YA 4KE7A 2C7BA 5DNUA 2CZQA 4TPKA 5LP1A 2PSDA 2HA2A 3I6YA 3IUNA 1T4MA 4LIPD 2XQGA 2XUGA 3H2JA 1CEXA 4IHAA 2PU5A 5KREA 4CFSA 1Q0RA 2LIPA 4EY6A 3GFFA 3E0XA 1K4YA 5FDFA 1ZJ5A 3F97A 2VATA 2V9ZA 3UMJA 2WTMA 5ALIA 4EUSA 4X97A 3KDAA 1WHSA 1K63A 1J06A 4P9NA 1VE6A 5JATA 4DSAA 2JGLA 2ZVDA 5LZ2A 5IVIA 1H22A 1EXWA 3WI7A 1CRLA 2XUHA 3FYUA 4C89A 2J3DA 3QH4A 5T4HA 1PFQA 2GYVA 2C5GA 5ALKA 1BN6A 3A2NA 2K2QB 3I1IA 2ZJ7A 3D59A 2WHPA 1CQWA 5AKXA 1BU8A 3AILA 1MAHA 1YS2X 2WFLA 3AINA 5AM1A 5C7YA 1IVYA 1YAJA 3GUUA 2HDWA 4EB0A 2HRQA 3KXPA 3H1AA 3G7NA 1IUOA 3T52A 4X6UA 1GPLA 3DOHA 1ZGCA 4BP8A 2BUBA 5BOVA 1IUPA 1U8EA 3FWHA 2C0QA 4L72A 2C5FA 4Q1VA 5AKKA 2XMDA 1UK7A 4GEGA 1X2EA 2OCIA 2BJHA 1EK1A 4G4IA 4QDZA 3BJMA 4O08A 2WUDA 4YPVA 1G66A 1XQXA 3G8YA 2V98A 3ANTA 4Y2UA 5AKHA 3WL5A 1W75A 1H2XA 2PKYX 3AZOA 2NW6A 4FWBA 1U65A 5JYCA 3BF8A 2Y6VA 1LBTA 4OPMA 1K5PA 3UUEA 1KU6A 1LPBB 4LHEA 2QVBA 1DT5A 5E4TA 1VE7A 4UPDA 5I8PA 1UKBA 3OM8A 4E15A 5ALPA 1QLWA 4WFJA 5A7GA 3KOOA 3HEAA 1WOMA 4BATA 4BCCA 1NU8A 3PICA 3WZMA 2Y1KA 4B82A 2AJLI 2CB9A 4Q3LA 3BF7A 4E46A 5LZ9A 1XZJA 4DNOA 4H7DA 2WU4A 3HYSA 3WIBA 2XB6A 1GQSA 2JIDA 3C6XA 3PE6A 4Q05A 4K6GA 3ILSA 4C01A 3JYHA 5EIEA 1I6WA 4Y2YA 2ZYHA 3WK8A 5F4ZA 3LIIA 4Y2JA 2WU3A 4Q82A 2Y2VA 2PBLA 4A16A 4YK7A 4KE9A 1E66A 2XUOA 4H7EA 5AKLA 3V1NA 2FJPA 5A62A 2OCLA 4GBGA 1UOPA 4MYSA 3V48A 2X8BA 3C5WP 1J07A 3RM3A 2VTVA 3IBTA 3I2IA 3QMMA 3F9CA 1THGA 3H2IA 1UKCA 5FPPA 3D7RA 1N5MA 4XX1A 2G5PA 1G42A 1GT6A 4XVCA 5ALHA 3PF8A 3NWOA 1CUDA 1FSSA 2XI4A 4UBOA 2ONCA 1O6FA 1Q0ZA 4BAUA 1LBSA 1WB5A 3DS8A 3WKBA 5JZBA 1RYYA 4PSUA 2GBFA 3G0BA 2XQIA 1XRQA 2G4LA 1TQHA 3QVMA 1GKKA 5AKIA 3WWDA 1C7JA 4NS4A 4HZGA 2XLBA 3V1LA 3FAKA 2JF0A 1VKHA 4G4GA 1UK9A 4G8BA 5AK4A 2PL5A 4BC1A 3PUIA 4BVKA 5FP0A 4UFNA 3KWJA 1F6WA 4IH4A 4PF1A 1AX9A 1XLVA 2QJRA 4OD0A 4H0CA 3ZPXA 2QXTA 2B20A 1D07A 3WWOA 4OYLA 1ZD5A 3BIWA 4KAAA 1IZ8A 1CUIA 3CN7A 5JZSA 4CG1A 1CUVA 3OURA 5C8VA 4J03A 1DT3A 5CW2A 4PQEA 4G4JA 2DHDA 3I2JA 3K2IA 5HQ3B 1R88A 5HKAA 1BS9A 1MPXA 3PF9A 2X76A 4BTLA 5LZ8A 2DFPA 4PO3X 3W06A 1JJFA 4DSZA 3NUZA 4KR0A 3WJ1A 4BBZA 4DNFA 4EY8A 4N5HX 2BGNA 1LPMA 3E3AA 5JZ9A 4FTWA 1SCQA 1CUBA 3KSRA 1JFRA 2XE4A 1F0NA 4HS9A 1LLFA 2V96A 1JKMA 1W76A 4X6YA 1XRMA 4RGYA 5AKYA 1XRRA 3ESDA 3W05A 5AKJA 2XQJA 4ZREA 2ES4A 4LXGA 4X90A 4DGQA 3O9VA 3WK7A 1HKHA 5CT9A 3O9MA 4FOLA 1XZDA 5AI6A 4BAZA 3ZLVA 2OGTA 1ZIXA 3CCBA 1CUWA 4HRYA 3VXKA 1FJ2A 3R40A 1E3QA 3ICVA 3DYIA 4E14A 1YA4A 4W1SA 3C70A 2XUFA 4UHHA 1RWQA 1UXOA 1J2EA 3VJMA 5DWDA 2DSNA 4FLEA 4BB0A 5ALOA 4BC0A 1LPOA 3HZOA 2Z8XA 4UFOA 2OCKA 3CN9A 3MVEA 4QA9A 1H2ZA 2HIHA 1QIDA 4OB8A 1DWOA 3VVLA 3C45A 2JGFA 3CXUA 4LYDA 3WWPA 3IURA 5DYWA 5AI8A 2WJ6A 1AUOA 5IKXA 3LLCA 3C5VA 1W52X 3PI6A 3OPMA 2XUQA 4WFIA 1S8OA 4Q34A 2VQ6A 1MU0A 5HQ3A 3GA7A 1MO2A 4BE9A 4K6KA 2J3QA 3DKRA 4WY5A 4DYHA 4QNNA 5JASA 5ALYA 2WIJA 5JAUA 4MWTA 1B41A 1OILA 1NU6A 4EA6A
chains in the Genus database with same CATH superfamily
4BRUA 4BKRA 1P17A 3LF2A 3LVBA 3MA0A 3N2ZB 2OUKA 5EUQB 4TYQA 1J90A 1I30A 3F98A 5T3YA 3IUSA 5BVHB 4JP1A 1ZR4A 4HHEA 4GC9A 4AJEA 1DIOB 1UTGA 1GPH1 1DUIA 1QCYA 2G06A 3DF7A 4MW0A 4X95A 4L9SA 4CG2A 2P2CA 5IZ4A 3AESA 2CNWD 4NBRA 5U4XA 4AN1A 4GHWA 4EGCB 4KSCA 5FADA 3HWX1 4NHOA 3RHTA 2NIPA 3Q3EA 1X94A 3FFWA 4GKAA 4GM0A 4V38A 3KOMA 2OFOA 1SIBE 4M0UA 1TAHA 4REOA 4UUBA 1YB2A 2QD2A 1EGAA 1FOEB 3MYYA 2PLFA 3GCDA 2ALJA 2AYYA 3U4QA 2BDEA 5KJEA 3SHTA 4JEMA 1TA4A 1T9BA 1Y7LA 3AU9A 3O26A 1EUQA 3OQJA 1YE3A 4FHZA 1ODIA 5LKAA 3FJOA 5I48A 4MA0A 1ILWA 1I10A 3ZTWA 1EPUA 3DE1X 5EWMB 3KFLA 1DPGA 3N07A 1ETUA 1T1GA 2QNIA 1SQFA 4L8WB 1T3HA 5IH3A 2ZS9A 5LM3A 3UAWA 3I0MA 1LI5A 1VRCA 2IHJA 2ATCA 4RCZA 1FU4A 4S12A 5L7YA 4FB4A 4ZIRB 1EXNA 1E6EA 2OZVA 3KV1A 4UDOA 1O97D 2HYDA 2LP4Y 5E1BA 1WETA 4NBWA 3I1YA 3QE9Y 5JSHA 4GL2A 1CYDA 2DF8A 2W2OA 3HB0A 1R2QA 3SJCA 5IJWA 1ISRA 1QQ6A 1D1SA 1K8ZB 2XVYA 4AWXA 4QELA 1XPRA 1XZFA 2EJVA 3COPA 3GY0A 2EKPA 4OHWA 1EDEA 1KP3A 4P2BA 4AZ3A 5B4UA 4A23A 1C1HA 3R0QA 4M0FA 1G8AA 3CW2A 3JATB 4LHZA 5TEWA 5IXJA 5KJFA 2X0JA 5DIFA 4UCXA 5L7WA 1KMHB 1QH8B 2NO7A 4H7JA 4BMOB 1USGA 2H06A 2ZJ5A 3KJFA 5FBHA 2C57A 2QG6A 1YJAA 1I3KA 4INAA 4YJ2B 1SVLA 5I9LA 3IT1A 1DRWA 2AR9A 2JIBA 3R3WA 1FFWA 5F5NA 5FBVB 3TQHA 8ADHA 3DOEA 4CQNA 3CMMA 1K7CA 1ZA1A 1US8A 4P3OA 4FYIA 3PCTA 4R1QA 3HK2A 1JHZA 4MYRA 4S04A 5KC8A 1CP3A 4XJSA 3CLHA 3DEHA 4QYIA 4UHCA 3ZUPA 2CWDA 5BW4A 4CIBA 3EVEA 2GBCA 3RFTA 3BL6A 1HEUA 3DE3X 3C3XA 3L6UA 1E1YA 2PS3A 4JIMA 2WWVD 3ZDQA 2GYUA 3PFBA 3GAFA 1PDWA 5JS6A 2H1CA 1IATA 1K6IA 1KARA 1TIKA 1B2RA 2RARA 3FB1A 5AM3A 1THMA 2DUNA 1SUAA 4NYMR 2FMFA 1DKLA 2BGKA 3SX4A 3QQPA 3LNCA 5TS3A 4CCYB 1PQPA 1M1NB 3CVJA 1MEEA 1WMBA 1U1EA 3X0DA 5C35A 5KCZA 4ZOLA 5L6MB 1XMPA 1COWD 4J2OA 2EC5A 3P96A 1L0BA 4IHJA 2YZNA 3OQBA 4MW2A 1SEVA 3H65A 2X8AA 2BZ0A 3HV0A 1BX0A 2WU8A 4BB5A 4DCMA 5CB8A 4TKUB 3TPZA 3IKTA 1S8FA 3GCWA 1X7YB 4JSYA 5JU6A 3PUJA 1U0JA 2YYSA 3TJMA 1XTJA 1K6MA 3NIWA 2J59A 1UIRA 1YV9A 5G4LA 5H68A 3H4MA 2DKOA 2CBZA 4Q3OA 3GLUA 2QE7D 1CDEA 1WABA 1KDPA 1SIUA 1N33B 2IWRA 1E99A 2F7SA 2FW7A 3JQ6A 3R8FA 3T15A 4K6MA 2XNSA 4OQXA 5ETJA 3IJRA 2W6MA 4C9BA 2EQAA 1Z07A 1ZCAA 4KQEA 1UMBB 4RVUA 4U0JA 2GAOA 1N6PA 3THYA 2I55A 3A4LA 3PDUA 2H5IA 2JGKA 3B1XA 3ZE7A 4EABA 1RJWA 3GVIA 1AE1A 1KRHA 1LD3A 3HXLA 3RO7A 1I9CA 2EZTA 4KGVA 1CUYA 3KVVA 5AW2A 1SHTX 1K9VF 5CA1B 1NF9A 3LIPA 4J90A 1PGOA 5BSTA 3L4JA 3PXXA 4M6WB 4DEVA 1EFVA 1FVOA 2WYUA 2YWRA 3MT8A 4H0NA 4XE5A 1L6IA 4JLAA 3N2GB 4JMLA 3V7YA 3VDNB 4DBZA 2D5IA 2DGDA 3FPBA 5PGMA 4JGGA 4ED9A 4DIUA 3VNSA 5KNBH 2NMVA 1QIGA 5AIBA 3MILA 5MDHA 1QV7A 3KDPA 4HD8A 5KKNB 2DJIA 1HDXA 2JAXA 3RK4A 1A2BA 4B5KA 2NU7B 3TZCA 2B94A 1Z0AA 2GARA 1XXLA 2XTZA 3C6ZA 2IU6A 3G9ZA 5IW8A 4J3NA 5IXSA 2XKAA 4KACA 1MX3A 5FD8A 5DCLA 3ZD7A 3C98A 4JP3A 4RD6A 3EBLA 4KQJA 5AD1A 2VUTA 2V4UA 4MP6A 4IW3B 2G4VA 3HYRA 3C7KA 2YH2A 3QJYA 1T35A 1XK7A 4P82A 2RKOA 1N6NA 3DV0A 4I2VA 2O14A 2P4UA 4L0DA 5CLHA 3E8SA 1IU9A 1E3DA 1XZBA 2FUG1 3MTEA 3IIIA 2PS1A 1W1IA 2PFSA 1X8XA 3FYDA 3K32A 3LHFA 3P5BA 4QXMA 3X1XA 1A7UA 4MJLA 3ZHTA 2GCGA 3VHLB 4EG0A 3C48A 4KV7A 1J8YF 3W2GA 1I5RA 2B4KA 2WHXA 1N34B 2QTVA 1SZCA 1DWQA 3ZY3A 4EYEA 2HLHA 2PUVA 2W22A 1R37A 2QM8A 3TI9A 1ZC3A 1E2HA 2VPWA 1AUVA 4MRSA 4MVWA 4G0YA 2D0OB 1MX1A 2VK2A 3VDMA 1T5IA 1NX9A 2EZ9A 2CLOB 3PI7A 1PUIA 1UBMS 1KI6B 4JOSA 4J3JA 3U3RA 4B6SA 4QTYA 1F9EA 4HNUA 3UG6A 4PX3A 1NONA 4WK4B 1IM8A 3AJDA 3VJLA 1I7SB 1KO5A 5FL3A 3QELA 5J5AA 5F1KA 3LDAA 3CO0S 2VPZA 3HDYA 2LPMA 4AYWA 4MQBA 4UD6A 2W2LA 4WLVA 3PLRA 4LJ8A 1VLLA 2J9RA 4LYFA 1XV5A 5IAKA 2NV0A 4M7OA 3WHKA 5DNYB 2NZUG 3NIDB 5DXAA 5ANRB 5AK3A 2FPOA 4BQQA 3BXGA 1CULC 2D7JA 4DQLA 4BWVA 4ZVLA 3FW1A 4HDMB 4ZVUA 5FTKA 2GN4A 2Y0EA 1P0PA 3JQGA 1JE0A 4IIJF 1N0UA 3OZTA 4P32A 4CW7A 5HZGA 3EH1A 3OMLA 5M34A 4Z86A 1D2MA 1LW6E 2X9VA 3X3HA 1X19A 2V6IA 2PK3A 3P2YA 4ECEA 4LDAA 3V4LA 5DASA 2C8LA 4P35A 4LMRA 5FBKA 4MV5A 3U1VA 3C3PA 4FWIB 3DEKA 2QHXA 5JXJA 1EQAA 3HCCA 3JYPA 1C1XB 2IPNA 2BEWA 1BE0A 1N7HA 1CJCA 4KXMA 2I2BA 1IXZA 2P4HX 2YWEA 2ZUUA 2DWPA 4HQNA 3I4FA 4TMWA 1Z34A 1LLUA 5HW0A 2J9XB 3KXLA 2JBAA 3QJGA 1UFKA 1C1YA 2A5YB 3V1MA 4ZFNA 5DW3A 4HUJA 3RG8A 1QB7A 1JG6A 3AY3A 2XLCA 2JAQA 4DUGD 2BLNA 1OLSB 1V9LA 2WQ7A 4OL9A 1M34B 5JXWA 1LBQA 2R4QA 1SCNE 4ZRDA 3EPHA 5SYMA 4DA6A 1CK4A 1W1WA 2ZQZA 3GT0A 1YB4A 2OB2A 1E1LA 2O2HA 4OGLA 5CEFA 3D2AA 5AOBA 3FOFC 1A98A 3BTVA 2XODA 4Q9IA 3ER9A 5TB5A 3G7UA 3WLKX 3R9KA 3AL3A 3NAQA 4MO9A 1W4LA 4A2WA 3ZW8A 5F7ZA 3NM4A 2ZYRA 2R7LA 3VAZA 5IDWA 2BH2A 4S0XA 4ADSG 3D2BA 4UDNA 1NR7A 5IS2A 2VNAA 4UBLA 4URXR 3BULA 3GZJA 4M2LA 2WG0A 3UB2A 3NOXA 2W6JA 4RFLA 2OXFA 3A0UA 4KQGA 1L2TA 4CMCA 2E4YA 3B13B 5TPWA 4ENUA 2G9ZA 4F6RB 5A9SB 3VO2A 5LWHA 1SRQA 1AMUA 2ZYUX 1F7UA 2N47A 1RAHA 2ONYA 1AHIA 1XJCA 2IRWA 4MGIR 3NS7A 4DC9A 4ZI7A 4EGSA 1YZUA 1GTZA 2VDUE 2XJ9A 5FAXA 1TCAA 4D4JA 6ADHA 3UATA 3V1UA 2AGVA 1O95C 2EDCA 3IDOA 4FOTA 3FMGA 2O5EA 3OU7A 4LI0A 4HTAA 4RDHA 5H4HA 5CB4A 3P0IA 4ZCQA 2WRZA 1W0CA 1Y6GA 1FF9A 3WKCA 1XX6A 5C8ZA 3EPLA 5ILGA 2ODPA 4TKVA 3HKDB 3LUDA 1T5TA 3KZ1E 3CGGA 3ON5A 3SE7A 3B12A 4LOAA 5G0UA 3K9FC 4BMZA 5HP4A 1AMOA 4QL3A 2RGBA 3BTOA 1ZOSA 4MUKA 3OD5A 3PWTA 4I9FA 1NOKA 5KSYA 1RCTE 4DTCA 3W9UA 4IVPA 3C4JA 1CJUC 2V9CA 3M6XA 4Q3KA 5BWNA 1Q0UA 3ACDA 2OGSA 1HE2A 2E89A 3PC3A 4PAMA 1CUZA 4JT9A 2E7ZA 5ICEA 1AQLA 4IGIA 3ZOKA 4MR8A 1AURA 2PL3A 1L7AA 1PO7A 1YB6A 1I2AA 2EFGA 3L6DA 4KX5A 5IKMA 4L1KA 5DTEA 3LLUA 1FP1D 1CJBA 1M7HA 1RJEA 4KH0A 1U2QA 2A67A 3WP1B 3H6KA 1G5RA 4AX4A 1RJ9B 3JWEA 1JAHA 3DMNA 4P33A 4X93A 1USWA 4MQEA 1ORTA 1MX9A 5JADA 3KUXA 3RBXA 4ZTBA 1QOPB 1YC2A 2HMYB 2WLSA 3E6AA 3LP8A 3IB6A 2H7CA 2G8NA 1U7ZA 1VBMA 1O8BA 2VJOA 3SDBA 4Y2HA 7REQA 5CM2Z 1J97A 2PCLA 3HP4A 4GOOD 4KCGA 4KV9A 4MUAA 3AHJA 4FX2A 3QF4A 3U9LA 2HK9A 4Q39A 5CGZA 4JJKA 1U1IA 2J9YB 1RHJA 1OFGA 4AUKA 5IAOA 5B36A 1KQOA 1FXWA 2XYQA 4LXHA 5JAOA 4ZXPA 2XSZA 1XBTA 4UBKA 5BR7A 1O95D 3MGCA 1DX9A 3WWCA 3ZCSA 1E18A 3IIMA 4YAUA 3UANA 3I6IA 4WXPA 2QAGA 3F71A 4I50F 2G3YA 4KN9S 3U1BA 4IUDS 3LQFA 3EIFA 1PQYA 1J1IA 2WPNA 1PDVA 1ORHA 1UBEA 5BWBA 9MHTA 2I66A 1C30B 1HSZA 4O5OA 3N5KA 2JAWA 1BYUA 3KPYA 1O2DA 3I9V6 3H1EA 5F4BA 1H1LA 1BQEA 1B8NA 1R5BA 2AW3A 3OY2A 2G08A 1JXOA 2P9CA 3B5EA 3CPHA 3DW1X 1Y5LA 2VHYA 1T6ZA 4FS8A 4MVJE 4I3FA 4X44A 3V4ZA 3QLUC 4S1PA 2MYTA 4FMCF 3ROGA 2J7PD 1OZ0A 2PWAA 2EAUA 4QNMA 1YCDA 2IBSA 4D6YA 2YHIA 3EIEA 1DQZA 1K88A 2GB4A 4CM9A 1ZNXA 4C6SA 1OFIA 1UF9A 1Z0IA 1VE9A 5CAEB 1Y9EA 2BW0A 3IESA 1L7BA 2W11A 5INTA 1SUEA 2Q4OA 3HRHA 5F77A 1HV8A 4UOEA 2ZATA 2P78A 1E9RA 3B3QA 4JQCA 2H2IA 3F90A 5EXTA 3RB8A 4D3YA 4DQDA 2P3SA 3SY8A 2H0AA 3I9JA 2CNBA 4L9WA 3TTWA 3VAYA 4YUAA 1PJZA 4JYPA 1V0JA 5C8YF 1DKRA 5CLIA 4FYHA 4MCAA 1JLMA 1R4ZA 3HCNA 1Q14A 1IE3A 4N12A 3HUTA 4DVJA 4IV8A 4F92B 1MOQA 2GF0A 3PA6A 4TSKA 4HL6A 2VP6A 3OBIA 1N6LA 1XD2A 4HLUA 2A7QA 4YMWA 3OQMA 3ZUGA 2B1RA 2VRCD 3BQNB 5F7OA 4BLRA 1GQQA 3E3MA 4GPD1 4QUKA 2DBYA 2QLBA 3DDOA 2M6LA 5LA6A 1IXRC 1XZNA 1ZP6A 2AYZA 2HX1A 3ORYA 4XSVA 4AY3A 4BXOB 1VLZA 4DMLA 5C5DA 2JH9A 3EEBA 5D3QA 3EXG2 3H3JA 1W0KA 3CIOA 2ZSUA 5BN1A 2NSHA 3GU3A 1BHQ1 2BEKA 4QLOA 2OGWA 1Z5PA 5CNJA 4EG7A 5MN5A 3T3HA 1IEXA 1SVUA 1JKXA 1ESCA 3UGTA 3V7UA 2BGMA 5KUTA 5GPBA 1SC6A 2W6ZA 3ORSA 4WZAB 1QOZA 1Q21A 2JFPA 4M0CA 1YASA 4F84A 2PYDA 1YTUA 3DMTC 3H2KA 4H60A 1KJIA 3HNOA 1L4BA 3BDVA 3HI4A 3QFRA 5BMVB 4MX8A 1TIBA 2V1XA 1RI4A 1YWGO 3IUMA 1JAYA 3I0ZA 4JOCA 2XXBA 1ZSYA 4HWTA 4M9ZA 1FDTA 4N8DA 3V1YA 3WGNA 3CU5A 1OKKD 3QPBA 3P5SA 4IL5A 4HATA 4DA8A 4C2UA 5K0ZA 6YASA 4HNVA 3K9QO 1V71A 4LWPA 3OAAD 4MZXA 5KNCH 2JK1A 4D4KA 3E61A 3DZKA 1Z6AA 1QG0A 2JFZA 3BH0A 4HEA6 4XDYA 1E2BA 1Q95A 4IXTA 3EZ2A 2W6IA 2ATXA 4BMPB 3L1IA 5ALQA 1RBYA 4M9SA 3VR2D 3WR5A 3QQ5A 1MB9A 1YCHA 1EJBA 4DZTA 3SIRA 4PXAA 4QNRA 2R8RA 3AUKA 3AY7A 1RYBA 3VNVA 4QDXA 2Q6VA 3LYHA 4U4AA 2LW7A 1TGYA 4F2HA 3K8YA 4YT8A 2AWOA 5DN6D 5KZMB 4YRTA 4R7TA 5ECYA 3COSA 4G4SO 4Q24A 3BD6A 4F4DA 3LCMA 3DUFB 2E85A 1USKA 2IJGX 4M8KA 1EFPA 5BT9A 5IT5A 2J3HA 5GONF 3ROPA 4C76A 4Q4JA 3LDHA 3QV1A 4M76B 3SM9A 4B2LA 4DDHA 4DDKA 3G79A 1E9BA 5FOUA 1DIHA 2GEVA 2O7NA 2RG1A 4KQ1A 4J2TA 3ENWA 3G2OA 1EMDA 1FPMA 4PGMA 4EGJA 3ABIA 3FUCA 1RABA 1XGKA 2IH2A 5CJPA 4N8EA 3NBKA 4NQZA 1U28C 2O2GA 5F9MA 1QIJA 2H1HA 4GI1A 1GUDA 5AXDA 4DDTA 4QOSA 4RV9A 3ZGXA 4J0DA 2M32A 5CEJA 4YACA 2RSLA 4E30A 4QDOA 3RADC 4G41A 1VL0A 3QUSA 5LDGA 4XWTA 4ZZ0A 4HRVA 4HGNA 2BFBA 4QFMA 5EIBC 1J39A 4ZK6A 3EMBA 2BHLA 4IIEA 1RQ2A 1XCMA 3BRWD 4NJMB 4BFUA 4HNAA 4CM8B 3NOOA 3KR0A 1XVLA 4IJWA 2HZBA 1YH3A 2WMYA 1PDOA 4RCYA 2BMAA 2MYNA 3EPKA 1OA1A 1Z88A 1ZK2A 2V6BA 1QPGA 3DULA 4HYEA 2EZ4A 3LGSA 4QD3A 1IBMB 2AEFA 2BKEA 2MDTA 4TTQA 4DRYA 1GRNA 3DOCA 4YCMA 2I67A 3C8HA 4HRAA 4LF7B 1ZCFA 1T25A 2DBZA 1Y3HA 4KYTA 1ZOOA 4GL4A 1ADFA 2WIFA 3I28A 5JJIA 3IAM6 1PBNA 4ZAVA 3GLIB 5IVKA 1RKBA 2IUEA 3NP9A 3DMFA 4FDTA 3REFA 2Y67A 2RJOA 3Q0TA 2DR3A 3NP7A 1M1YE 2EBWA 3IE0A 4FMDF 4R1MA 5TY0A 3T7CA 4CQMB 1WS6A 4G5OA 4OX9B 2F1KA 4MJ7A 3S28A 3THWB 1BROA 1XLUA 1I4DD 3ZWQA 4EZBA 1PG0A 4U6SA 2Y0DA 3KP1A 5AOVA 1FFGA 5TMPA 5FJIA 3UTCA 3X2EA 4Y3UA 1XRNA 4XR9A 1UMCA 2QGFA 2B5WA 4XARA 1KDRA 2C2GA 2BM9A 3K96A 1P39A 5GV7A 4L0CA 4BEWA 1BWRA 5CBPA 1RYEA 1I80A 3T5TA 1XA3A 4BJHB 4RFSA 4X9XA 1IDN1 2F3PA 4MPPA 3WKEA 1L4GA 2XZLA 2OXIA 5K9ZA 1YQXA 4WKNA 1ECLA 1V1RB 2EU8A 2IOHA 4R8LA 3G0IA 4CN9A 5JFTA 3WVNA 2NTJA 1H6BA 1I24A 2BLLA 4REMA 4BN0A 1ZSVA 2ZRIA 3FZEA 4AZWA 4CV1A 3W04A 3RNLA 1ODFA 3O2NA 1ZQ1A 5BN5B 1QG4A 2XADA 3DKKA 3SLRA 1T5LA 4NOMA 4DT1B 3UMSA 1DXYA 3EUFA 3LWZA 3NIFB 5EIBD 1PCXA 5FHRA 4DV6B 3ZCRA 3C8MA 4JLVA 4I5DA 5K2MA 5KI6A 2MJLA 5K45A 1G1AA 1PZHA 4GQAA 4CFYA 1CUGA 2XA2A 3CBGA 2JCYA 1G5QA 3FLMA 3RQIA 3W4JA 1GSAA 4DKXA 1ZR2A 2CCGA 3FCSB 2V7TA 2PQ6A 2OBYA 3FIJA 3WAGA 1QIKA 3S8MA 3V8RA 3OQNA 4OH7A 3A04A 1TCCA 5K4GA 4MQLA 3SZUA 1V47A 3NHWA 2C54A 3DBHA 2QLJA 3FKJA 2C04A 1TVMA 5KOIA 1I7NA 4X92A 2Q1YA 4OG2A 2BP7A 3QBJA 1NKVA 4KBGA 3DYBA 5JECA 4P86A 1W85A 5KBYA 2GNOA 3S5UA 4PYIA 5J4VA 1W581 1RYHA 5KVVA 3H05A 2ISCA 1P1BA 5TEVA 4NVRA 1TTPB 3RC7A 2HO4A 2OBLA 3WDSA 3DBOB 4MP8A 1Y5IA 3HV2A 2AOXA 1PGNA 2QUIA 3GCGA 1X8JA 3HO8A 1TM1E 1PFYA 5FL7A 1XO1A 2J33A 4WJLA 1XRSB 1WSDA 2WF8A 3GJ3A 3HN2A 3VKUA 1V25A 1J8QA 1RXIA 3ODPA 3T61A 3UJ9A 4B4VA 1DGQA 3T1QA 4FT4A 1YRBA 4I36A 3SBOA 1EUCB 5FKJA 3QMVA 4ETWA 1YBMA 2ADMA 1VXOA 3OG9A 2EEZA 2PZFA 4LAFA 4EBFA 4Z4CA 1JG4A 3RRNA 4MV4A 3PWSA 4LMBA 1BGXT 3HBNA 4BJ3A 2YWDA 4PSAA 1HFEL 1QIFA 4PZEA 3BS4A 4G4SP 3Q2KA 1RZRA 3W8FA 3LGXA 2OUIA 3TUZC 3FOBA 1E7QA 2QVGA 3HY3A 3LUJA 1ZXBA 3R4VA 2QXUA 3KKMA 4GMKA 4S35A 1X1DA 5ALDA 1Q1NA 1ZU5A 2O9JA 3MUEA 1OQAA 1Y4SA 4LA4A 1PUXA 1ZKMA 1YOVB 3I4LA 4P4SA 1P19A 1WCYA 3AUSA 3MUOA 1X1AA 4IQ8A 4X45A 3OP1A 3QW2A 3WLPA 2A4KA 5HCIA 4EECA 4FD3A 4MDEA 3S8EA 3S29A 4C3ZA 1KC3A 4GMHA 2RHTA 5F3DA 2QYOA 1L3BA 4B85A 1EEXB 4DMKA 3RBAA 3ZDAA 3RC8A 1WXEA 4KRFA 5AVYA 4NJOA 3AETA 1VOTA 1G5HA 2JC3A 1K4KA 5F21A 6REQA 3CNNA 3QTLA 1DO2A 1PN3A 4FFNA 5D5PA 4HH1A 1ITZA 1BX1A 2QQFA 2PKXA 2QUJA 2SKDA 5ALTA 4C5AA 2DERA 5EJIA 1C3LA 1G5IA 4QRIA 3BE8A 1UT6A 2O2JA 2PWBA 2QW0X 2RGNC 1U7DA 3O93A 4WSOA 1KL7A 4GP6A 4MYHA 3L0BA 5E4JA 4BLQA 1JFTA 4ZODA 2BL4A 2G4CA 3NEJA 1OXKB 2D74A 3D4NA 5I7VA 1PR1A 5H8WA 1TKAA 1U0EA 3KSUA 3RFFA 2KI5A 1AQJA 1CRPA 4DG5A 4XWGA 1FS6A 1XRPA 2QRVB 3WIUA 4CEJB 3N6XA 4MPRA 1CUHA 3GC6A 2P6NA 3I9NA 2FA9A 4P98A 3FY4A 4S1VA 4ZT2A 4Q4HA 2GVZC 1Y4ZA 2OOKA 4ZT5A 1YMUA 4PGHA 2JLBA 1HYEA 3AM4A 4JVOA 1IY0A 1ZUWA 1PZNA 3CH5A 2P9YA 1CX9B 2B7CA 4PNPA 1U0RA 3AQIA 5FOXA 3TL6A 3QVVA 4DM7A 1J8FA 3F3YA 5AVSA 2HCRA 4PR3A 3AC0A 4NMMA 4Q9AA 4J6EA 3KETA 4AZ0B 1E58A 2YJNA 4L0MA 1MAAA 2VUHB 2E5LB 1LY1A 1M6VB 2FLWA 3FDZA 3X43A 5LU9A 2ZI6A 3OU6A 3ED5A 1GGVA 3HFSA 1P33A 3CLSC 5EKXA 1TFUA 1F3OA 2R00A 1R15A 4XVQA 1K7SN 3KJIA 3RRXA 3SQDA 1MD9A 3MXOA 4NK5A 2C00A 2P27A 4HH3C 4K9KA 4RL4A 1WVIA 3L05A 3TNDA 3T7JA 3AUUA 2I7VA 3I1FA 3UW1A 3ZV4A 4DBVO 1WAMA 2K7FA 1RRVA 2WJYA 2IGBA 2IZZA 2WPDD 2X1HA 1PR4A 1L4FA 1GA6A 3L8FA 1C9JA 1QCDA 1RI2A 3IAXA 3KTOA 4M8SA 2IH4A 1A3CA 5FTWA 2PIAA 4MRMA 4Y2VA 2CXQA 3EJWA 3OCUA 5IT4A 2I76A 1RC0A 2Y1CA 4JBLA 3HYLA 4KK3A 1W4AA 3G8AA 2Z2ZA 1AQYA 3CRVA 3L4EA 4RLQA 4DF3A 5BVHA 1IFXA 3SCZA 1SCAA 1L7QA 1JIKA 2FW0A 4QT0A 2REQA 2BE7A 3F6CA 2X3YA 4M1QA 1LW7A 1YQ9A 1WCIA 2RK4A 4I7EA 4XZ3A 3TLXA 4FFVA 3BIXA 2O3SA 3KYCA 4L5AA 1QHXA 1HTTA 2ZI3A 4OJYA 4UEOA 4Y6RA 1FFDA 3D5EA 5LZ5A 2GXAA 4LGVA 4DRZA 4LN1A 1OAOA 2LRHA 4OXIA 4WN3A 3FMOB 4AF7A 1V11A 4TTAA 5K6RA 1W87A 3QRWA 1DJQA 5AVJA 1AA6A 1CE8B 1T3ZA 4H1UA 4CKYA 2BBWA 2FMTA 3EH2A 1OYWA 1PV1A 5CT6A 4ARAA 2XMGA 3REGA 1EVZA 5F5XA 3V8BA 1VKOA 5WRFA 4YV7A 4CIAA 1ZCZA 2WJWA 3DD1A 1G8YA 1DJMA 1RJFA 3JU3A 4QYSA 1KHTA 5ALJA 1M8PA 1XTQA 4MH0R 2A78A 4D26A 1ZXXA 1VHLA 1P4HA 2PU7A 4O4JA 1O89A 4JJ4A 2Q2QA 4NCNA 5CEEA 1ADCA 2PANA 1GZ4A 3VOSA 5CHYA 1REQA 3UKOA 4EUHA 3B3JA 1AD2A 4MSUA 3HNPA 3OFNA 4N0DA 3TI7A 4D8WA 1DAPA 3G3EA 2I33A 3VU8A 4J0CA 2ZWVA 3DB1A 4MRPA 4XJXA 1K8XB 4MYCA 2PJZA 2AA3A 2V4ZA 3EA4A 4WCFB 2CKMA 2XF8A 3U4AA 5BR8B 3SXUB 1SHZA 1UKZA 4QXRA 2L2QA 4IGAA 5DHQA 3OO1A 4U7FA 4OQZA 5F1OA 3UYKA 4UTXA 9ABPA 5BNZA 3GFVA 2FZKA 4J4BA 1ZMBA 2VYVA 3N2NA 3GELA 2EERA 2YV5A 1M3SA 2I54A 4C4AA 4RA6B 3TN7A 3E1KA 3OC0A 1BFDA 4PONA 4X54A 3ZJYA 2D7DA 2WMNB 1LZLA 4XIJA 5DOZA 2JA2A 4DCSA 3HB7A 3C1UA 2JI7A 4YMUA 1ZIYA 3HO6A 2XMPA 1KY3A 4DWWA 2GEKA 1Z74A 4MV6A 4RIFA 2VCHA 3C3MA 1QU2A 4BBAA 4UW9A 3WSVA 2PO7A 4JGBA 1EFCA 4U8HA 2HR1A 2WP0A 3AWDA 4BIIA 5IM4A 4FFDA 4FW8A 1JHOA 1G8PA 1AK2A 5KYWA 2YFYA 1E69A 4U3JA 1E3WB 3U49A 4FM9A 4QEZA 1ULHA 1QMGA 3QWBA 2HMTA 1A9OA 1NR5A 2FWPA 1TEVA 5EMHA 3VFDA 2X5OA 4GZ5A 4N01A 5DM0A 3VR5H 3ICOA 5I5EA 2HA6A 5SICE 3PC7A 4OXQA 1DLJA 3R1IA 4PZCA 1TQ2A 1LVUA 5CA0A 2QRQA 1EWRA 2V7GA 1LTHR 3UGKA 3ZWNA 4EQ6B 3T3MB 1LK0A 4KQ2A 4PWYA 1B0UA 1NQ5A 4P53A 1CLUA 2L42A 2CHUA 2DUMA 4R69A 2J07A 4UFPA 3LL7A 2H5LA 4KGZA 1A8QA 4O25A 3IXMA 3S2YA 1LV8A 4RE5A 3WY9A 3AJEA 4GQBA 1XLTC 4P0TA 1RRFA 2OK7A 3OEYA 3RSLA 3VNAA 3WRXA 3Q7SA 2PAAA 1GV1A 5ERXA 4B6FA 1NI4A 3CW9A 4QATA 1OC2A 4AURA 4U6NA 2GNPA 4MLPA 3TD6A 2NV2B 4JI7B 3OPYI 4MJXA 3WZLA 2O2CA 2QZ4A 3CW8X 3WYDA 4YAIA 4G0UA 2JAHA 4L5JA 4TXLA 1JR3D 3EPPA 1C81A 3ZE1B 1G7SA 5DIZA 1XPOA 2X5JO 3PWZA 3LM8A 2NU9B 3AHGA 3JQFA 4YT2A 2RHLA 3D4IA 4A5OA 1E4EB 5B3JA 1SH7A 1Z2AA 4JITA 1Y48E 3BEDA 3ESBA 3IAS6 3ITDA 3R5FA 2ZIUB 1NSFA 4ZYYA 5I9SA 4DQVA 3R5XA 4H59A 4MEAA 4OATA 1RWBA 4TYMA 1OY1A 1UQUA 2CXHA 4FR5A 4RVCA 3HFRA 2XOXA 2VYNA 1E9FA 3EDOA 2HH9A 1I2ZA 4A6DA 3EAFA 3IPYA 4RM2A 5CNKA 1WB4A 2QL9A 3DTYA 3INNA 4UCWA 1YJXA 2VEDA 1UBUS 3BIOA 3DEFA 3EBPA 1W96A 3UPTA 1EP3B 4RK4A 2QMEA 4HDNB 4ZC1A 4PGAA 3TIIA 4XQCA 2FMKA 4ZZ1A 3E9QA 1GYRA 3LX4A 1H93A 4M86A 4URHA 4F4FA 4TV9A 5LMUB 1TYAE 1QYWA 1POXA 5JMPA 1Q7GA 3TO5A 4GWKA 2IYLD 4HGYA 3M34A 2FVYA 3L7YA 5GOTA 3GEDA 1YQQA 2BEJA 2FKAA 2OG1A 2W2VA 3GFRA 3AVQA 4UPEA 3AIKA 4BYGA 1RHQA 4UEQA 4YRJA 4CE6A 4OK3A 4I1UA 2YDXA 2IS4A 1FFYA 4BU0A 1XEWY 2QTWB 2RGDA 3H5AA 5CK5A 2JIZD 4B45A 2NZWA 1ZHOA 4AMGA 4DUZB 3ZXSA 5JDCA 3FYUC 3P9SA 3AF1A 1L8OA 1JA9A 2YUIA 1MC4A 1PL6A 2QZZA 4XD7D 4TRRA 3H0CA 2DU8A 2ZRMA 3BCRA 1YL5A 2B1QA 1N9GA 5G2OA 1KY5A 2VXOA 4PRLA 2BEUA 2AE2A 4DIOA 1ZMXA 1EAMA 1C8KA 4BRSA 2EG9A 3A58B 4JZKA 4UE3S 2DCMA 2AOVA 2EFEB 3R9XB 1BHO1 3IP3A 1I2DA 3EK2A 4LCEA 2EHJA 1EUDA 5DHTA 2RHJA 4ENRA 5KU1A 3IO3A 4A03A 3FCEA 1T36B 2YWCA 4HQLA 2C4NA 3MHTA 1U31A 5BQ3A 4TZ0A 3OLVA 1QO0D 2RI6A 4QICA 3IFSA 5KDOA 3P4YA 1LTKA 3FUTA 3ER8A 1E2QA 3FZNA 1AUPA 4G37A 3PFKA 2QAIA 3FNRA 3NH6A 4C03A 2FPPB 1ZD2P 4QX6A 3TECE 1WZ2A 4YDSA 3QYAA 5CDSA 4IV0A 1XNJA 4C87A 3DTVB 2ZDHA 1MDFA 3CX6A 2X0FA 4UTOA 1ZCJA 3KJGA 4TKLA 4B8ZA 2QSYA 3P2MA 4HWGA 1O6CA 2O7QA 2QAJA 4QYXA 1TECE 2B69A 3C1TA 1XXHE 2OCGA 4ND5A 1F2UB 2JIQA 3UMYA 2A9RA 3PEYA 1OD6A 2WLTA 5JWOA 1ZJYA 1VHWA 3DOIA 1MA3A 3H9EO 4YMTA 3BREA 2RGUA 1HLGA 5C37A 1PHRA 3WRYA 4AICA 3CVUA 4TQUS 3GGCA 1WIWA 2Q8QA 1Z3CA 3BJRA 1A9XA 3IVRA 4CLHA 3D6FA 1OPRA 3OOSA 5BXQC 4WBXC 4EHAA 3BHNA 4V02A 1V5WA 3OTOB 3VZPA 4LNUA 1GGEA 2IHKA 4F3TA 5C46F 5I47A 2BMFA 1T0HB 2LKDA 2Z08A 1FQOA 4PX2A 3AL0C 2W4IA 3PGA1 3DZ8A 3YASA 2HA7A 1K0UA 5BQFA 2PD3A 2FK8A 3TEJA 2BEVA 1JX6A 3VDXA 3CM0A 5IJAA 2A88A 5KYUB 1U3CA 2HMUA 1MUUA 4CKWB 2B1IA 1TCBA 5EHQA 4ENTA 5EE1A 2BC9A 1R00A 4MVJM 4CVNA 1LI7A 3LPAA 3ZGZA 2NT4A 1Y6RA 2BGRA 1KK3A 1Z75A 2OSBA 2Q0XA 3A1EA 1KJJA 3F5QA 4FBMA 4IMIB 4V3BA 1UM8A 3KQKA 1CZNA 1UQTA 2FHPA 3I5MA 3X1WA 3LI2A 1ZN7A 3UJ6A 1R6AA 1SG0A 3CNLA 1DADA 2AOTB 2C92A 1ZIDA 3KJQA 3HBAA 1ADGA 4P93A 4F93B 2R2GA 2WJ3A 4X94A 4BN4A 3QK7A 3RT9A 1R1DA 2RDMA 2O8DB 1LDYA 4EBBA 3N0TA 3DL4A 3L43A 4OQFA 3STWA 5H7XA 2JFYA 3WK4A 2C83A 3BEOA 2C9OA 2PEZA 3F8SA 4L4SA 4LRTB 5EXSA 3ZWBA 4F1KA 1Z25A 2F55A 1CS0B 4TV8B 4PYNA 1NUAA 5CX1B 1Z7BA 4OI2A 2ANCA 1RZVA 2QG9A 2AEEA 4CU2A 1QHIA 1WJGA 4QE3A 3H42B 4UOQA 4NOKA 4PN7A 5DXJA 1NF8A 5TQ2B 4I4IA 1T8RA 3TG8A 5KNBA 4I5EA 1B15A 2C8JA 3E03A 3ISJA 3BKXA 3L46A 1G21E 3TQTA 2YRFA 1AIPA 4IMPA 3OFJA 4H7IA 2PKRA 5HRUA 3JQBA 1ZH2A 3AF6A 5ESWA 1EWVA 1T2VA 5F9FA 4MAMA 1RBMA 1I6KA 2DHQA 2YMQA 1JU9A 4J4HA 3VGJA 1GAWA 4ZCTA 1IBKB 2QTLA 4IYRA 1CNFA 1HDIA 2JKYA 4YJ3A 2ZCUA 3TW4A 2UYCA 1JFSA 1A4XA 4IFEA 5HK9A 4BRWA 5IC4A 4UC0A 3V3KA 4IS3A 4LE2A 1OXMA 2OLJA 4KPUB 2PSEA 4WCFC 4EF5A 2GEDA 4NC9A 4TQAA 4MUMA 3T1TA 4RD1A 3NWJA 3QIVA 1G3MA 1KI9A 4OM7A 4AG3A 4RTQA 1SQ5A 1KJWA 3IVAA 4N7BA 5KOJB 1SA0B 1Y1PA 3PCRB 4Z0PA 1UL1X 3RUPA 3SBXA 2E87A 1NHWA 2AMVA 4ALNA 4B76A 3LKBA 4JB8A 1I13A 3R3JA 5IABA 1ZS9A 1TK3A 4EVQA 3H11A 4F91B 1Q74A 4H77A 1OAAA 2AG0A 1SBYA 3QXSA 1RPAA 3WYGA 4IDCA 2VOJA 4K1XA 2IFTA 1WNFA 1NVDA 1ZYUA 2FPWA 2ZJ6A 3BGOS 4ZVKA 1GNQA 1Y7HA 1U0HC 2CMDA 2LR0A 3FLEA 2RK3A 3OESA 4D96A 4ERNA 4EL0A 1GAQA 2C2MA 2H1IA 4Z7JA 5F3WB 5T8KC 4S05A 2XAUA 3JTEA 4BNGA 3CF4G 5D87A 3PT9A 5BSMA 4RTNA 1K66A 2CZGA 3EOAI 3GBSA 4TVBA 4UBIA 5FPSA 2ZAOA 5DT9A 4BP3A 3L18A 5KTOA 1S2LA 3TGWA 1EXDA 3HY4A 4QHYA 4Y98A 2ZFUA 2XR1A 1YULA 4JIGA 3SOZA 3DDUA 1SXPA 1NBIA 4BO5A 2PX4A 3NASA 1P5HA 1UDCA 4MKHA 5EMNA 3RVDA 1YJ8A 2BFMA 1TO6A 3L79A 4JI2B 5D3ZA 1XOIA 4TSFA 4ZAWA 3R77A 2NUTA 4ASUA 2XXAB 2F64A 1MC5A 2PPVA 4IJQA 5E8RA 1M2OA 4M7WA 4RO0A 1KAMA 1YCFA 2D8MA 4KJXA 3ZS8A 1QZ3A 3FA2A 2HL6A 1GCGA 2P5TB 3PXEA 3ILYA 3BCUA 3NTQA 4LRSB 1IONA 4QBTA 4XUEA 1KEVA 2VJDA 3QYJA 4EHNA 2VWQA 1SCBA 1NNUA 2I7TA 2COEA 2HM7A 4EF6A 5EJ5A 1N1MA 1WF6A 2DQYA 4G8CA 4NECA 3PSAA 4WIAA 1IJFA 2JFXA 2H54A 3CRRA 3HKCB 3O8RA 2NSLA 1VCHA 3VYUB 5GJBA 3IXLA 2LV8A 5EJ8A 1LCIA 1MEJA 4NR0A 4HVTA 5AI0A 2X2FA 3KZCA 3O8BA 5FA6A 2R4UA 3GFTA 2X3UA 2XDQB 3NC0C 4N54A 1NVVQ 3TQSA 1PJSA 3ACBA 3HN6A 1E9SA 1PTKA 3CZCA 3JSXA 3OCCA 2PL1A 5LLSA 3CEAA 1P5RA 5AHRA 1ZVQA 3U48A 3VU0A 1GGHA 2GAFA 2Z8ZA 4IZ6A 4FB5A 4AB1A 1VQ1A 4L28A 4F5WA 3P2KA 5L6LB 1STOA 4KPFC 1L5OA 2ZROA 3K35A 4FUTA 4C7OA 2HRCA 4G1MB 3PXUA 1QANA 2NXCA 3MGAA 6AT1A 1RIIA 3IOEA 3NMUF 3TTVA 1Z0SA 2WNSA 2IIPA 3HCFA 4D80A 4EJ0A 1HFJA 6Q21A 4F4IA 3MMSA 4RPCA 3CEHA 5LUBA 3JWPA 3P0JA 1IDOA 2HGSA 4I3GA 4XXHA 4CG3A 3F5MA 5MN6A 1DU4A 3Q5EA 1NULA 1RCUA 3E7WA 4RIIA 4NX2A 2EIXA 2X8JB 2EJBA 4CT0A 1XNQB 1AKRA 3ZWCA 3FCOA 4WGGA 1GNLA 1SUWA 4CU5A 4E03A 1O58A 3EXHB 1AKVA 2ZZNA 2G1JA 4Q1AA 4ATNA 3PVCA 2WE8A 4YDQA 2C99A 2BR3A 3L6OO 3CZMA 1O9GA 1ZEJA 4PZ0A 5A5GA 4AX8A 4HZUA 3T0FA 3HU3A 3D8TA 3IODA 1MT3A 2HHAA 2R751 1GNTA 5JNSA 3GMIA 1PK9A 2NUAA 2ZRCA 5TPZA 3WYEA 1ICIA 3E7PA 5ER9A 1JFLA 1JSXA 5EQFA 1EINA 1X3LA 2O6HA 1Q83A 1RFGE 5K1ZA 3NVMB 3OT4A 3UXYA 4X64B 4EDHA 1MO5A 2BM8A 5DULA 1UWCA 4YCAA 2CEAA 1T2UA 3K6KA 4V2UA 5MF6A 4KO2S 3SS9X 2FP3A 4I9GA 1LQTA 1R0WA 2VJAA 4B3DA 1RVV1 4HMOA 5AFSA 3QWFA 2ZSJA 3D4BA 3REQB 2FCAA 2ZWPA 1L5ZA 2QTZA 5AHXA 2F00A 3FUVA 1PJ4A 4WXEA 3TBKA 1IWBB 2QMQA 1JLSA 1TI7A 2DFVA 3ZJTA 2X0DA 5KYTA 3LCJA 4PV7A 3HWRA 1ODJA 1HNZB 2WF7A 5C7OO 4GP9A 4JLOA 1R27A 1NXSA 4UTZA 4YUXA 1IH8A 3WYFA 5AT1A 2NX2A 4UM5A 4DOMA 1G38A 3EPRA 4MV9A 4WUVA 2NXJA 2VQ3A 4J0GA 2Z5GA 4EGFA 1UJCA 1U7PA 3TCKA 4V03A 5ALMA 3G82C 3DZGA 3TIXB 1OB2A 3GVXA 4P7FA 2O8NA 2GHIA 1YDFA 5KKAA 3TOZA 3GDHA 3ZI7A 2JKVA 1XELA 3F46A 4L5YA 1DVRA 3LHIA 5F12A 2F17A 2F48A 2QN6A 2A9VA 3D5TA 3KFVA 4ZANA 4QLBA 1J5EB 4MGKR 4ZOLF 5IVDA 3UK2A 4IHJF 1AGRA 4Y2RA 4JB2A 4I9HA 1EGVB 4JUFA 5TF0A 3TDKA 5JJLA 2Q8NA 3A6EA 5TS2A 1KOJA 1NMXA 1EA5A 2WW8A 2D5LA 3JZMA 1YNSA 3M5CA 4PNEA 1TF2A 1A9SA 1W49A 2J09A 2OGZA 2ZIXB 1LPPA 3JPYA 1L7NA 3PC4A 4CCWA 2OYCA 3SSMA 1RAGA 3N39C 5A6VA 3R4CA 2CXSA 1E1NA 4GPBA 1QQ7A 2V54A 3QMWA 4Z9BA 1JQ5A 3SSAA 4Z4IA 3U0BA 5DK6A 1U0FA 4ALKA 2WINI 3EIUA 3VPDA 2XX3A 4QAJA 2QB5A 2FZLA 2YY6A 2R47A 4NJEB 3AHHA 5AJHA 3T3PB 2HWUA 2GN8A 2GF9A 2JGJA 4GD3Q 4XOIA 1DEHA 1IEWA 3BXHA 4EEKA 1DG1G 3CVYA 2PUJA 1NJ8A 1S3FA 4JYMA 4F5DA 4Y1EA 1U2EA 2OESA 3RC1A 5BSWA 3B1VA 4PQRA 3ONDA 4CLRA 1POWA 3U4IA 4B0PA 1PW7A 1VI2A 3OI7A 2G70A 3DTVD 4PLWA 4FFPA 4KWCA 1OHHA 1EFRA 4IRXA 1HWYA 3KBBA 4U2GA 3HXPA 5EVJA 3PJDA 2WHPB 5A4AA 3G0CA 2AN9A 3NHLA 4OSEA 3UMGA 3E27A 4MARA 2DR0A 3QVWA 3USCS 1DBSA 1FX0A 3KKPA 1VFNA 3VR5D 1NLYA 3DL0A 3PFIA 3PXAA 3MJVA 1GTL1 4FFOA 2IIBA 3EFEA 1XSEA 4I14A 1E1KA 4PIMA 4EMSA 3T7KA 2ZJZA 5CVVA 4JKOA 4QEDA 5E1MA 1LU9A 4F9GA 3ZX4A 5CDYA 1MIOA 4KI7A 3ICWA 3ZZTA 5LPNA 2YFHA 3CO5A 5CK4A 2J3IA 3L0OA 4D3SA 4WL0A 1N2CA 4HNRA 1FLDA 1PJBA 4L95C 1NI5A 1RI1A 1IQPA 3O4GA 1I7DA 2IW1A 4X20B 1XCGB 3UOAB 3P52A 1XQYA 2P9QA 3B53X 3EVCA 3IS3A 4LJ4A 4WESA 2YQ4A 3X1DA 1PIWA 3L6CA 3R24A 2TMYA 4R5MA 1T1RA 5JIBA 5I7EA 2C5EA 5ILQA 2YUTA 3G9QA 3I30X 3CUSA 3V2IA 4S24A 3HDQA 3U7EB 3CH6A 3QXHA 1XLTA 3BKWA 2BFCB 4FYJA 5BWMA 1E8DA 1PQ4A 1YRHA 4Q9DA 1BGWA 1R3UA 1GU7A 1V8FA 4R1TA 3R44A 1RBQA 1T4CB 5EL0A 3O8DA 5KNCA 3D3WA 3HJHA 5HJ5A 3RLIA 3DAYA 2C7BA 1FZQA 2HTEA 2Q0HA 3CRQA 4U7PB 3CZRA 2CZQA 3D8RA 3A1CA 3C3WA 3UT6A 5LP1A 1SB9A 5K8UA 3IDZA 1K9SA 1W35A 1FTQA 1U8AA 3IUNA 4LBZA 4IVRA 5DBEX 1T4MA 3CWCA 3RBZA 3PX7A 3M0EA 2XUGA 1E1MA 1NBMA 2WBLC 2J4DA 1PV4A 3TF5A 5BW5A 2YV2A 4YRAA 1NYTA 2D0PB 3HY6A 4HNQA 2OD7A 1WXQA 3S27A 4BNZA 2Z5FA 1NFRA 3HWWA 5I4BA 2FH5B 3GLKA 1JQEA 3UJHA 1X92A 2IE0A 2LIPA 1NKSA 4EY6A 1K7YA 2QX8A 5AYVA 1DKPA 1MXHA 3B1FA 3KUDA 2HKIA 3ORHA 5GZ6A 3F97A 1G3UA 3WGMA 3QWIA 1AGXA 3GLHA 4X66B 3UMJA 2PO5A 1HE1C 3TNYA 3E9RA 1A8HA 3ILHA 4PHGA 5ALIA 4FE4A 3RT1A 3F2IA 3HKEB 3H1FA 1SU8A 4P9NA 1MMFB 4NHEA 4B3MB 4PG7A 4LJ6A 3U56A 1OXVA 1LWNA 4EI9A 1TC1A 3BERA 5LZ2A 5FEMA 4C4SA 1COZA 2ZUWA 3E35A 1KEKA 2O59A 5LR6A 1CU1A 5B6PA 3CJQA 2A94A 1Z6PA 3VX4A 2E5WA 2XUHA 2QTTA 2ZWOA 3FYUA 3NT4A 3IYLW 1ABBA 2Z9CA 5J2TA 1N3LA 5T4HA 2QDKA 1PFQA 3H3FA 3LUPA 3NXKA 3WFZA 4OKIA 2W4QA 1TF5A 3QYPA 3DMGA 7GPBA 4DR6B 2K2QB 2ZAYA 3KE8A 1BO6A 4EKGA 1FPQA 1T4BA 4AJKA 4B2YA 1FW8A 1AB6A 2IDJA 2ZJ7A 1V7CA 2OAQ1 3L8MA 3OFSA 5SZIA 4RKRA 1U04A 1UT5A 3QE2A 2ECOA 1DRUA 1JHUA 2ZTVA 3E5RA 3LECA 3PHIA 5AKXA 3AILA 2WE7A 3EHDA 6NULA 4ZI7F 1V6CA 1DDGA 1J33A 4HQOA 3RJ9A 2FPKA 3FZYA 4MWDA 2WFLA 4QVKA 3WNQA 1TAQA 2H0RA 3UH1A 3B85A 5CB4F 3VV2A 1ZNQO 2W2NA 4EYOA 1I1HA 4DA9A 4IJ6A 1PWZA 3GUUA 4UVIA 3HJGA 3SYMA 2IHYA 3GJQA 2VH5R 1T8TA 3GZNB 4HLQB 2B83A 1JDJA 1SOWA 2HRQA 2Z2YA 4R2XA 4X1IA 3Q2IA 1IUOA 1J25A 2HY7A 1FNSA 3EXHC 2I6FA 2QR2A 3N76A 1L5HB 3Q41A 4GX5A 3VX3A 3DVQX 2HDNB 3P45A 2HCBA 3D31A 1OASA 2GJ4A 2J7KA 2BUBA 2YJ6A 1TUBB 2KQUA 3DDNA 3LYLA 1AXGA 5AXAA 1Y4DE 1QF6A 2CMHA 1HOTA 5CLJA 2Q7DA 3M3HA 2X9QA 3R6DA 3VGPA 5A4FS 2R65A 2C0QA 1LLCA 3BXOA 2C5FA 3QW4B 4EYSA 1WU8A 3PRHA 3QU5A 2ERXA 1KO7A 4KLCA 4YFVA 4MWZA 2G25A 2Z43A 1M2KA 2ONKA 4BLSA 5C4MA 2WWHA 4S1NA 4RA9A 1BXGA 4KUEA 2AH5A 4BL5A 3L07A 3L8CA 5E6SB 1M6VA 1N5OX 3JWJA 4GEGA 1MLDA 2I8LA 5JXHA 4ID9A 1CIPA 1FTYA 3H8SA 4OHBA 1CR4A 1T8UA 5IYZA 3LKZA 4NYIR 5B1HA 5LFAA 5C31A 5B2EA 2IS2A 3PFHA 3TL2A 5JW6A 4BV3A 2EJWA 2HJRA 2ZTLA 3ISTA 1CEQA 4ONEA 4PINA 1QKIA 4PVCA 3SYNA 2OO7A 4G4IA 4HDRA 4QDZA 3WOHA 3IAEA 4X61A 3KB2A 3L77A 3QEKA 5K0NA 2I2DA 4NE7A 4RELA 5T6MA 2IYFA 1E2IA 3F6RA 3GJRA 5U1PA 1L5GB 1ISGA 1TPZA 1OF1A 3AFMA 4RTRA 2VUIB 3FUUA 2YJ3A 2BE9A 4MGYR 4E21A 2A33A 3C0KA 3BHIA 1KZ9A 2YDYA 2V98A 3PPVA 5BN3B 5JDIA 3VAAA 3K3PA 1FFXB 5DFAA 1JEDA 1P7PA 1XAIA 4Y2UA 3U19A 5AKHA 3L7LA 2ZIEA 1ND6A 2PKYX 1H2XA 4I99A 4BWFB 1OA0A 1T9DA 3AZOA 1EWKA 1FSZA 5JYCA 2R60A 4FC6A 4DCCA 3HB1A 5FNVB 1YUNA 2PX8A 2RGWA 3LXMA 4A27A 3AB7A 3I8SA 3TG2A 3CVWA 5THQA 1U8UA 2PXAA 1G6Q1 2XWBF 1C4OA 1JLLA 2Y6VA 3OPXA 3QPVA 3PE3A 4NAVA 4YQYA 3I04M 4X8MA 2QJOA 4C0BA 4REQB 3L5KA 4BVEA 2PR2A 3MWDB 1BXZA 1SU4A 3A6JA 3AVPA 3L6EA 4I4NA 5CVDA 2IU3A 4EAAA 4UXHA 4TTSA 2P0YA 3RD5A 1CS4C 3BTUA 2DT8A 4LHEA 5BYAA 1D2NA 2LVBA 2NWQA 5E4TA 3W5SA 4D8XA 2VPIA 3FJ1A 3MN1A 1AKEA 3MJRA 3EMVA 1XEWX 1UKBA 5CVUA 4B7UA 4W5NA 3NOVA 2P79A 5IANA 5K8VA 2CYBA 2JFQA 4I66A 4R8MA 4BO0A 1ND5A 1JALA 1C9MA 1SXJC 2IPLA 1E94E 1X1RA 1NVEA 3NVDA 5CP8A 1OWPA 3SF8B 3GWZA 4Z4HA 3RNOA 3ZXXA 5ERGB 2DYKA 2AG6A 2V8OA 3QPWA 4NFSA 3LZDA 1T10A 4IIYA 1Z63A 4K9NA 5TJ9A 3ZZ1A 2ZT7A 2C9MA 2YWJA 1PFGA 2WSBA 1PJ2A 2AYXA 3TLCA 4L6AA 3C97A 2R1TA 2QRNA 3BWEA 3R6GA 1I5EA 2SKEA 4INPA 4OA8A 3U7FB 4XDHA 3I5YA 4GX2A 2YQZA 3KOOA 3HEAA 5B37A 2AC7A 4RZIA 2WSSD 3ET5A 3RWOA 1QS0A 3LHSA 3N9IA 1L8LA 3GQBB 2AVDA 1OROA 1ZK1A 4A91A 4RY8A 2A3NA 1S1CA 2MR5A 4GZ6A 1NU8A 3WZMA 1DKUA 4NABA 2JIRA 3V4OA 3UHFA 3KQTA 5KTSA 1QP4A 4YCNA 1Z4LA 1U2SA 1HX7A 1OT5A 1I4WA 1IM5A 1WKVA 4L51A 2A7XA 2AJLI 3NBFA 4JODA 2QW8A 5MFZA 3A11A 4MR7B 5JD3A 3EDCA 5H4GA 4H3KB 4WJZA 1VBFA 4TL9A 3ERCA 3E0QA 4RVSA 5F2KA 5G0TA 2FX2A 4JDPA 5FIUA 2CMKA 1BW9A 3PC6A 2XB6A 4G8JA 2P6OA 3ZCVA 3DA8A 1P0CA 4JL6A 4M0PA 2EG5A 2Y9MB 3NBZC 1I1OA 4P7JA 5AJXA 1UP4A 4YAGA 1AJEA 4GXTA 4Q05A 4IG4A 5TX7A 4KXNA 1MABA 1OOEA 2VHQA 3JYHA 2B8JA 1KMQA 2DWOA 4YJGB 4BNTA 4FZ3A 1I6WA 3IP8A 2GPSA 4PXYA 4E2FA 3W7AA 5DX0A 4NYJQ 3LSTA 3K4HA 3PUWA 3I9V1 2GFHA 4J1SA 2AT1A 1M1YB 3ZVKA 4YAKA 3PDIA 4KR6A 3QKRA 1SMKA 2IPXA 2Y93A 3D3KA 4I4LA 2WU3A 4RSHA 1OLOA 4IWNA 4IXWA 4F8YA 4A2PA 4JB3A 4MUHA 5AHWA 5D3MB 5ICSA 4E2ZA 3T7IA 4KQWA 3G5MA 2IYXA 2PBRA 1G21A 1QVRA 4I1RA 4MS1A 4FONA 4KOAA 3V1NA 5CDTA 3AY0A 4G0PA 1IVSA 5JYBA 2Q3LA 2R25B 3TTTA 4NBNA 3F1KA 3WGKA 4DMRA 3ZWVA 3TAUA 1VE3A 1Z6GA 3HEMA 4XYEA 1BKSB 3RTCA 4YBRA 4J8PA 3UYLA 1A9QA 2FZ4A 1D9ZA 2Y9PB 2CXPA 3O84A 3ORQA 3VNBA 2PLNA 1XJQA 3SD7A 1DNPA 2FRDA 3FB4A 3RVKA 3E05A 2UUAB 1THGA 2UDPA 2CE2X 3DGFC 5FPPA 3D7RA 3M1LA 3TFOA 2FLKA 2WA2A 3DEIA 2IYEA 2RG7A 2YCLA 4XVCA 3DOOA 1B8OA 3OEWA 4L4YA 4R9UC 3CG4A 5ALHA 1CUDA 3KHTA 2VHEA 5LXTA 3TR6A 4KPEC 3I12A 2V5VA 4UBOA 4IF6A 3WIVA 4RIEA 5TMBA 2AMLA 4JT4A 1AS2A 1P9WA 3LO5A 4EMBA 3HCWA 4KPYA 4OHRA 1BHSA 1B6TA 3S2GA 1TUGA 4IKEA 8LDHA 1WD5A 1F06A 3MK31 1WB5A 3DS8A 3ZTTA 3T4PA 3OH8A 1QGAA 3WKBA 4E3WA 1J42A 2OQ2A 4ZMSA 2ZSKA 4UKDA 4GSKA 3STHA 5EJ7A 4WBNB 4URZR 3C3CA 2CJYA 4R2JA 3RBVA 2XQIA 4O4IB 2D1FA 2RAVA 3EUAA 3WGUA 5LJIA 4D6XA 4XCXA 5EE5B 1YF3A 1TQHA 3NDBB 1GKKA 3PGMA 4JP8A 3ECSA 1TU0A 5C8DA 3ZKWB 5D2CA 3T5CA 2PWZA 1Y3FE 3EARA 5C4GB 2ZYDA 2ZWAA 1B8UA 4JLPA 5D6NA 4EM6A 2B5OA 4HWOA 2YXEA 1YS7A 2A8YA 3HXMA 1MG5A 1YCGA 1MPTA 2JF0A 4QREA 2DWUA 4Z7QB 1V3UA 4D9GA 4MKGA 4G8BA 4HEA1 1DKNA 5DBHX 1E1QD 1L7XA 1M2WA 1OWOA 2QSJA 3GO4A 4P4NA 4OQEA 1W0JA 1G20B 1NLFA 3O73A 3PXGA 3UEOA 1NGSA 5FP0A 4D3DA 5A04A 2OFXA 4A36A 5DHSA 5I7HA 2PWYA 1OI7A 3PQFA 5I3ZA 2R84A 1GZ5A 1YHYA 1UBJS 2J9GA 2UZAA 1OBHA 4LVNA 3W2FA 3LPCA 3A1UA 1XPJA 4R4JA 3UN1A 3HBLA 2VJKA 2IF0A 4OD0A 2C1EA 2I2WA 2OO3A 4QUIA 1OPXA 2OV1A 3ABRB 4H0CA 4C4RA 3SQNA 4ER3A 1V5IA 2GERA 3ANLA 1E79A 1WSBA 2FHSA 4PQFA 3PYXA 1IHUA 1AGNA 1ZD5A 2NTEA 4O8ZA 4Q9KA 4UNPA 1C0PA 2Q7OE 2HEIA 3RTDA 4D41A 2W2XA 3CB2A 4MZDA 4KAAA 3W77A 3CN7A 3VDQA 7MDHA 2BD0A 1JR6A 1A69A 3FMPB 1QGOA 1CRQA 1HGXA 3OIYA 1JR4A 1ISSA 3FZQA 3G8CA 3IIJA 3OURA 1C9KA 1Y9JA 4TKMA 1Q2UA 4N0PA 1H1DA 3P0RA 4I55A 4J29A 4KQFA 1E0JA 3OZUA 4R05A 2FSUA 3AERA 4J03A 4E51A 1B26A 2HJWA 2OZLA 4Q3AA 1S4MA 5IFLA 1XYVA 1GWNA 4JUAA 4PQEA 2Z4TA 4D3FA 4CDMA 4BVFA 3KXDA 3NWBA 2DPGA 2DHDA 3K2IA 4HFNA 2A35A 5HKAA 1KA9H 1MPXA 3KRTA 1CZLA 4RXMA 4EPVA 4ZALA 2ZJOA 1U1CA 3Q8XB 4BTLA 5H3CA 3ZHYA 1C1DB 3W06A 1Z83A 4E0BA 1PWEA 2WAYA 5EA2A 3NUZA 2QV0A 3RS3A 4R83A 1CY2A 3W0LB 1DJLA 3C3EA 1D1PA 5BRJA 5C7LO 5ARCA 4BBZA 1GUFA 4DNFA 2YIVX 1XB2A 1QZXA 4J49A 4WA7A 1W4ZA 5JZ9A 3K09C 1IY9A 4ETMA 3NJ4A 4FTWA 1W2WB 1S89A 1J21A 3Q3CA 4ZU1X 4J76A 4Y0NA 3IAM1 3GFPA 2BOVA 1F0NA 4YI5A 4ZT7A 2FQXA 3Q7TA 1A9TA 2XCLA 4HS9A 1LLFA 4S1WA 1URPA 3OCZA 4OM8A 4DHEA 4ZN6A 3JRWA 5ICFA 1QRRA 1WUIS 4RUKA 2V96A 5BSGA 4MVJD 1RWXA 1UJNA 4HEJA 5IDXA 3IUPA 4BNIA 4GYJA 1RAIA 3Q9SA 1XRMA 4RGYA 1H3EA 3UCXA 4GS5A 2CLKB 1RIFA 4XGQA 3VSCA 3AVVA 1GPYA 3W05A 4BMCA 3G1WA 2XQJA 5B1IA 2V3WA 2AG8A 2Y0CA 1OX5A 1U5BA 3DZDA 4UUOA 4AXXA 3NHYA 3FWYA 3PRJA 3WO0A 5CT9A 1IHXA 1SHLA 4N4AA 3DXFA 3PPIA 2O0LA 2PKWA 4MUNA 1P5FA 4E22A 2OMKA 3AH8A 3ZLVA 2HV8A 3PQCA 2GKOA 4GI5A 4OUDB 3ZDYB 1T9GS 3E3NA 5DTRA 4HRYA 3SIWA 4DM4A 4KYUA 2ONZA 4FHDA 1V9SA 3CBQA 3M1YA 3R40A 1XAJA 4B3BA 3W90A 2FRXA 4C6TB 3ENVA 1YA4A 3JASA 3DF9A 4HB2A 1QBKC 2CDAA 1QKJA 4TTPA 4W1SA 3WWYA 3ANXA 1ZGAA 4DM3A 4Z3KA 1RDFA 4YT4A 5A2QA 5TIIA 4PG4A 3HA7A 2O1WA 2WTAA 3L7MA 4OJKA 4EFMA 2A2ZA 3S6JA 3RYFA 4LSMA 2AVNA 3HBFA 5AJTA 2R1ZA 4FLEA 2C4MA 2ZIWB 3S3TA 1EP2B 4CM3A 4Y7CA 2J48A 3DMRA 3IP7A 4DEXA 5HM8A 3FMVA 2JCVA 2GN0A 3ESXA 3WGTA 1V45E 4PM4A 4JLKA 1VL1A 1G8KA 3DPIA 1TCUA 4EFLA 5COBA 2W6PA 1NNSA 1GP2A 3B1YA 3KZKA 5K0FA 1KE1A 5DLEA 3EGEA 3D64A 13PKA 3HM2A 3ST7A 3WHLA 1H2ZA 4HNTA 1X7XB 2QPOA 1PW5A 1K6JA 1S3IA 1RPTA 1JIUA 2XYPA 3QVGB 1GTRA 1FRNA 2FKNA 2BV3A 1R6BX 3P9IA 4KTTE 5HRAA 2A6PA 3R6TA 3CXUA 4KODA 3UICA 1X87A 1KKUA 4KQMA 4RETA 3WB9A 2ZUFA 5DYWA 1KEUA 2IYTA 4LRUA 4D8YA 3NQ41 1Z7WA 3LLCA 2WOOA 1L7EA 4J6FA 2H4ZA 3WBFA 4M7PA 3BWBA 4RVHA 5KTRA 3QKUA 2Z9BA 4PYLA 3C5VA