2WMBB

Structural and thermodynamic consequences of cyclization of peptide ligands for the recruitment site of cyclin a
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Structural and Thermodynamic Consequences of Cyclization of Peptide Ligands for the Recruitment Site of Cyclin A
rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 99
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wmbB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wmbB02
1P5EB 5HBEB 4BCPB 4EOJB 5IF1B 3RGFB 4F6WB 4II5B 3EJ1B 4FX3B 4G6LB 3G33B 1KXUA 2WMBB 4EOMB 1JKWA 5ICPB 2WHBB 3BHVB 2JGZB 4IMYB 4EOPB 4YOSA 1H27B 1OGUB 4CXAB 4F7LB 5I5ZB 2UZBB 4EONB 4CFUB 4KRDB 4Y72B 2WMAB 3F5XB 3DDPB 4BCGB 5L2WB 3MI9B 2IW9B 4CFMB 3MY1B 4ROEA 5EFQB 2PK2A 2WXVB 1UNHD 4ROCA 4ELLA 5FGKB 3BLHB 1OKVB 2IVXA 2UZEB 5HNBB 1GY3B 4EOKB 4CFUD 3POMA 1JOWA 2CCHB 2I40B 3LQ5B 5HQ0B 2WFYB 2WIHB 4EORB 2C5XB 4F6UB 4CRLB 1G3NC 1H24B 1JSTB 2IW8B 4YOOA 4BCJB 4CFNB 2CCIB 5LQFB 1H1SB 2I53A 3QHRB 4BCHB 4UN0A 2C6TB 1C9BA 1AD6A 4BCFB 4EOQB 1GH6B 5LMKB 4RODA 1H1PB 3BLRB 1O9KB 2C5VB 2R7GA 3BHUB 1D3UB 3MIAB 2BKZB 2PK9B 1VYWB 1BU2A 4BCIB 4NSTB 2UUEB 3TNWB 4OGRB 3DOGB 2PMIB 2W9FA 1OI9B 1GUXB 2WEVB 2WPAB 4F70B 3O0GD 4EC8B 1ZP2A 4EOLB 2W2HA 1FVVB 1URCB 2V22B 1OIUB 5ACBA 3MY5B 3QHWB 4BCMB 2PHGA 4I3ZB 4BCQB 2IW6B 3EOCB 1OKWB 1OL2B 1E9HB 1UNGD 1FINB 4YOZA 5BNJB 1XO2A 5IDPB 2WIPB 4CFXB 1VOLA 2EUFA 1H4LD 2W99A 3BLQB 5IDNB 1JSUB 2C5OB 2F2CA 4KRCB 5HBHB 1H26B 4BCMD 4BCQD 3TN8B 2QDJA 3M03A 1OIYB 1W98B 4EOOB 4BCND 4EOIB 4F6SB 1PKDB 2BPMB 3TNIB 1O9KA 2C5NB 2B9RA 4CFWB 1QMZB 4F7NB 2W9ZA 4ELJA 4TTHA 1VINA 1H1QB 1N4MA 2CJMB 4CFVB 5HVYB 1UNLD 3DDQB 1GUXA 1H25B 4F7JB 1TFBA 2C4GB 4BCKB 4F7SB 2W96A 4BCNB 4EC9B 4OR5B 3H4CA 5CYIB 3EIDB 4YC3B 1F5QB 5HBJB 2X1NB 1AISB 4EOSB 2UZLB 3BHTB 3K7AM 4BCOB 2UZDB 3TNHB 1H28B 2G9XB 1H1RB 5CEIB 1OL1B
chains in the Genus database with same CATH superfamily
1P5EB 5HBEB 3RGFB 1UGSB 3X28B 4BY7X 1KXUA 4EOMB 1JKWA 2CYZB 4IMYB 2CZ1B 4YOSA 2DPPB 4CFUB 1UGRB 4KRDB 2WMAB 3F5XB 3MI9B 2IW9B 4ROEA 5EFQB 3WVDB 4ROCA 4ELLA 3DL1A 3BLHB 4CFUD 3POMA 2I40B 3HO8A 5EJCA 2IW8B 1H1SB 3QHRB 5LMKB 1H1PB 1O9KB 2R7GA 2QGSA 1D3UB 4BBSM 3TNWB 4OGRB 2WEVB 3O0GD 4EC8B 4EOLB 2DD4B 3HZJA 5ACBA 4JX4A 2BS3A 2CZ6B 4JX5A 4CFXB 2EUFA 1H4LD 5DQVA 3HHTB 2ZCFB 1H26B 4EOOB 4EOIB 4F6SB 4TTHA 2ZPHB 2QDYB 3A8OB 4F7SB 4EC9B 4ZGDB 5CYIB 4EOSB 3X25B 2UZLB 2UZDB 2G9XB 4AKHA 4MFDA 3X20B 3TW7A 4AKIA 1OL1B 3BG5A 3EJ1B 4G6LB 2QFZA 3HB9A 5ICPB 2JGZB 2BS4A 4HNTA 1H27B 3VKGA 3A8GB 5L2WB 4CFMB 3MY1B 3HBLA 2WXVB 5FGKB 2IVXA 2G77A 1TD6A 3LQ5B 2WIHB 1AHJB 4CRLB 1JSTB 3A8LB 4YOOA 4CFNB 5LQFB 4BCHB 1C9BA 3QYHB 4EOQB 2KR6A 2C5VB 2CZ0B 3MIAB 2BKZB 3X24B 1BU2A 3DOGB 2W9FA 1OI9B 1GUXB 2WPAB 4Z6YA 4HLQA 3BG3A 1FVVB 1URCB 2V22B 2ZPFB 4NC6A 4BCMB 2AHJB 3QZ5B 3EOCB 1ENWA 1OKWB 1E9HB 1UNGD 1FINB 5BNJB 2W99A 3QYGB 3KHIA 5IDNB 4KRCB 4BCMD 4HNVA 3A8HB 2QDJA 3M03A 1OIYB 5IHYA 3TNIB 1O9KA 2C5NB 2B9RA 4CFWB 1QMZB 4F7NB 2W9ZA 4MFEA 1N4MA 2CJMB 5HVYB 1H25B 1TFBA 3X26B 5DQWA 2ZPGB 2WJ9A 4OR5B 3BG9A 2DD5B 3QYBA 4BCOB 1H28B 2DXCB 1H1RB 4BY1X 4F6WB 2WMBB 1QLBA 3BHVB 4ZGJB 4OB3B 1OGUB 1UGQB 4CXAB 4F7LB 1UGPB 5I5ZB 2D0QB 2BS2A 2UZBB 2ZPIB 4BCGB 4M6VA 1UNHD 3B57A 1OKVB 2ZZDB 4QSHA 1GY3B 4OB1B 5HQ0B 4HNUA 2DXBB 2QQ8A 2I53A 3TW6A 4UN0A 1AD6A 3GTMS 1GH6B 4MIMA 3BLRB 2PK9B 3A8MB 2UUEB 4F70B 1ZP2A 3QYEA 4I3ZB 2IW6B 1OL2B 1XO2A 3VYHB 2C5OB 3DTOA 4HL4A 1W98B 4BCND 1PKDB 2BPMB 2QF7A 1VINA 4OB0B 1H1QB 4CFVB 3DDQB 1GUXA 4YC3B 3VYGB 2X1NB 1AISB 3BHTB 5CEIB 1V29B 4OB2B 4BCPB 4EOJB 5IF1B 3PO3S 4FM4B 4II5B 3WVEB 4FX3B 3G33B 2DMEA 2WHBB 4EOPB 4EONB 4Y72B 3DDPB 4LOCA 2PK2A 2UZEB 5HNBB 4EOKB 1IREB 1JOWA 2ZPEB 2CCHB 2WFYB 4EORB 2C5XB 4F6UB 1G3NC 1H24B 3DJBA 4BCJB 2CCIB 4JX6A 2C6TB 2ZPBB 1E7PA 4BCFB 3QXEB 4RODA 3BHUB 1VYWB 4BCIB 4NSTB 4AKGA 2PMIB 4AI6A 2W2HA 1OIUB 3MY5B 3QHWB 2PHGA 4BCQB 2PJQA 4ZGEB 4YOZA 5IDPB 2WIPB 1VOLA 3BLQB 2CZ7B 2IN3A 1JSUB 2F2CA 5HBHB 4BXXX 4BCQD 3TN8B 3VKHA 4ELJA 2KMGA 4BBRM 3NDQA 1UNLD 3QWLA 2C4GB 4F7JB 4BCKB 2W96A 4BCNB 3H4CA 3EIDB 1F5QB 5HBJB 3K7AM 3TNHB 2LW4A 1FKMA 3QZ9B
chains in the Genus database with same CATH topology
1P5EB 5HBEB 4BCPB 4EOJB 5IF1B 3RGFB 4F6WB 4II5B 3EJ1B 4FX3B 4G6LB 3G33B 1KXUA 2WMBB 4EOMB 1JKWA 5ICPB 2WHBB 3BHVB 2JGZB 4IMYB 4EOPB 4YOSA 1H27B 1OGUB 4CXAB 4F7LB 5I5ZB 2UZBB 4EONB 4CFUB 4KRDB 4Y72B 2WMAB 3F5XB 3DDPB 4BCGB 5L2WB 3MI9B 2IW9B 4CFMB 3MY1B 4ROEA 5EFQB 2PK2A 2WXVB 1UNHD 4ROCA 4ELLA 5FGKB 3BLHB 1OKVB 2IVXA 2UZEB 5HNBB 1GY3B 4EOKB 4CFUD 3POMA 1JOWA 2CCHB 2I40B 3LQ5B 5HQ0B 2WFYB 2WIHB 4EORB 2C5XB 4F6UB 4CRLB 1G3NC 1H24B 1JSTB 2IW8B 4YOOA 4BCJB 4CFNB 2CCIB 5LQFB 1H1SB 2I53A 3QHRB 4BCHB 4UN0A 2C6TB 1C9BA 1AD6A 4BCFB 4EOQB 1GH6B 5LMKB 4RODA 1H1PB 3BLRB 1O9KB 2C5VB 2R7GA 3BHUB 1D3UB 3MIAB 2BKZB 2PK9B 1VYWB 1BU2A 4BCIB 4NSTB 2UUEB 3TNWB 4OGRB 3DOGB 2PMIB 2W9FA 1OI9B 1GUXB 2WEVB 2WPAB 4F70B 3O0GD 4EC8B 1ZP2A 4EOLB 2W2HA 1FVVB 1URCB 2V22B 1OIUB 5ACBA 3MY5B 3QHWB 4BCMB 2PHGA 4I3ZB 4BCQB 2IW6B 3EOCB 1OKWB 1OL2B 1E9HB 1UNGD 1FINB 4YOZA 5BNJB 1XO2A 5IDPB 2WIPB 4CFXB 1VOLA 2EUFA 1H4LD 2W99A 3BLQB 5IDNB 1JSUB 2C5OB 2F2CA 4KRCB 5HBHB 1H26B 4BCMD 4BCQD 3TN8B 2QDJA 3M03A 1OIYB 1W98B 4EOOB 4BCND 4EOIB 4F6SB 1PKDB 2BPMB 3TNIB 1O9KA 2C5NB 2B9RA 4CFWB 1QMZB 4F7NB 2W9ZA 4ELJA 4TTHA 1VINA 1H1QB 1N4MA 2CJMB 4CFVB 5HVYB 1UNLD 3DDQB 1GUXA 1H25B 4F7JB 1TFBA 2C4GB 4BCKB 4F7SB 2W96A 4BCNB 4EC9B 4OR5B 3H4CA 5CYIB 3EIDB 4YC3B 1F5QB 5HBJB 2X1NB 1AISB 4EOSB 2UZLB 3BHTB 3K7AM 4BCOB 2UZDB 3TNHB 1H28B 2G9XB 1H1RB 5CEIB 1OL1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P5E B;  5HBE B;  4BCP B;  4EOJ B;  5IF1 B;  3RGF B;  4F6W B;  4II5 B;  3EJ1 B;  4FX3 B;  4G6L B;  3G33 B;  1KXU A;  2WMB B;  4EOM B;  1JKW A;  5ICP B;  2WHB B;  3BHV B;  2JGZ B;  4IMY B;  4EOP B;  4YOS A;  1H27 B;  1OGU B;  4CXA B;  4F7L B;  5I5Z B;  2UZB B;  4EON B;  4CFU B;  4KRD B;  4Y72 B;  2WMA B;  3F5X B;  3DDP B;  4BCG B;  5L2W B;  3MI9 B;  2IW9 B;  4CFM B;  3MY1 B;  4ROE A;  5EFQ B;  2PK2 A;  2WXV B;  1UNH D;  4ROC A;  4ELL A;  5FGK B;  3BLH B;  1OKV B;  2IVX A;  2UZE B;  5HNB B;  1GY3 B;  4EOK B;  4CFU D;  3POM A;  1JOW A;  2CCH B;  2I40 B;  3LQ5 B;  5HQ0 B;  2WFY B;  2WIH B;  4EOR B;  2C5X B;  4F6U B;  4CRL B;  1G3N C;  1H24 B;  1JST B;  2IW8 B;  4YOO A;  4BCJ B;  4CFN B;  2CCI B;  5LQF B;  1H1S B;  2I53 A;  3QHR B;  4BCH B;  4UN0 A;  2C6T B;  1C9B A;  1AD6 A;  4BCF B;  4EOQ B;  1GH6 B;  5LMK B;  4ROD A;  1H1P B;  3BLR B;  1O9K B;  2C5V B;  2R7G A;  3BHU B;  1D3U B;  3MIA B;  2BKZ B;  2PK9 B;  1VYW B;  1BU2 A;  4BCI B;  4NST B;  2UUE B;  3TNW B;  4OGR B;  3DOG B;  2PMI B;  2W9F A;  1OI9 B;  1GUX B;  2WEV B;  2WPA B;  4F70 B;  3O0G D;  4EC8 B;  1ZP2 A;  4EOL B;  2W2H A;  1FVV B;  1URC B;  2V22 B;  1OIU B;  5ACB A;  3MY5 B;  3QHW B;  4BCM B;  2PHG A;  4I3Z B;  4BCQ B;  2IW6 B;  3EOC B;  1OKW B;  1OL2 B;  1E9H B;  1UNG D;  1FIN B;  4YOZ A;  5BNJ B;  1XO2 A;  5IDP B;  2WIP B;  4CFX B;  1VOL A;  2EUF A;  1H4L D;  2W99 A;  3BLQ B;  5IDN B;  1JSU B;  2C5O B;  2F2C A;  4KRC B;  5HBH B;  1H26 B;  4BCM D;  4BCQ D;  3TN8 B;  2QDJ A;  3M03 A;  1OIY B;  1W98 B;  4EOO B;  4BCN D;  4EOI B;  4F6S B;  1PKD B;  2BPM B;  3TNI B;  1O9K A;  2C5N B;  2B9R A;  4CFW B;  1QMZ B;  4F7N B;  2W9Z A;  4ELJ A;  4TTH A;  1VIN A;  1H1Q B;  1N4M A;  2CJM B;  4CFV B;  5HVY B;  1UNL D;  3DDQ B;  1GUX A;  1H25 B;  4F7J B;  1TFB A;  2C4G B;  4BCK B;  4F7S B;  2W96 A;  4BCN B;  4EC9 B;  4OR5 B;  3H4C A;  5CYI B;  3EID B;  4YC3 B;  1F5Q B;  5HBJ B;  2X1N B;  1AIS B;  4EOS B;  2UZL B;  3BHT B;  3K7A M;  4BCO B;  2UZD B;  3TNH B;  1H28 B;  2G9X B;  1H1R B;  5CEI B;  1OL1 B; 
#chains in the Genus database with same CATH topology
 1P5E B;  5HBE B;  3RGF B;  1UGS B;  3X28 B;  4BY7 X;  1KXU A;  4EOM B;  1JKW A;  2CYZ B;  4IMY B;  2CZ1 B;  4YOS A;  2DPP B;  4CFU B;  1UGR B;  4KRD B;  2WMA B;  3F5X B;  3MI9 B;  2IW9 B;  4ROE A;  5EFQ B;  3WVD B;  4ROC A;  4ELL A;  3DL1 A;  3BLH B;  4CFU D;  3POM A;  2I40 B;  3HO8 A;  5EJC A;  2IW8 B;  1H1S B;  3QHR B;  5LMK B;  1H1P B;  1O9K B;  2R7G A;  2QGS A;  1D3U B;  4BBS M;  3TNW B;  4OGR B;  2WEV B;  3O0G D;  4EC8 B;  4EOL B;  2DD4 B;  3HZJ A;  5ACB A;  4JX4 A;  2BS3 A;  2CZ6 B;  4JX5 A;  4CFX B;  2EUF A;  1H4L D;  5DQV A;  3HHT B;  2ZCF B;  1H26 B;  4EOO B;  4EOI B;  4F6S B;  4TTH A;  2ZPH B;  2QDY B;  3A8O B;  4F7S B;  4EC9 B;  4ZGD B;  5CYI B;  4EOS B;  3X25 B;  2UZL B;  2UZD B;  2G9X B;  4AKH A;  4MFD A;  3X20 B;  3TW7 A;  4AKI A;  1OL1 B;  3BG5 A;  3EJ1 B;  4G6L B;  2QFZ A;  3HB9 A;  5ICP B;  2JGZ B;  2BS4 A;  4HNT A;  1H27 B;  3VKG A;  3A8G B;  5L2W B;  4CFM B;  3MY1 B;  3HBL A;  2WXV B;  5FGK B;  2IVX A;  2G77 A;  1TD6 A;  3LQ5 B;  2WIH B;  1AHJ B;  4CRL B;  1JST B;  3A8L B;  4YOO A;  4CFN B;  5LQF B;  4BCH B;  1C9B A;  3QYH B;  4EOQ B;  2KR6 A;  2C5V B;  2CZ0 B;  3MIA B;  2BKZ B;  3X24 B;  1BU2 A;  3DOG B;  2W9F A;  1OI9 B;  1GUX B;  2WPA B;  4Z6Y A;  4HLQ A;  3BG3 A;  1FVV B;  1URC B;  2V22 B;  2ZPF B;  4NC6 A;  4BCM B;  2AHJ B;  3QZ5 B;  3EOC B;  1ENW A;  1OKW B;  1E9H B;  1UNG D;  1FIN B;  5BNJ B;  2W99 A;  3QYG B;  3KHI A;  5IDN B;  4KRC B;  4BCM D;  4HNV A;  3A8H B;  2QDJ A;  3M03 A;  1OIY B;  5IHY A;  3TNI B;  1O9K A;  2C5N B;  2B9R A;  4CFW B;  1QMZ B;  4F7N B;  2W9Z A;  4MFE A;  1N4M A;  2CJM B;  5HVY B;  1H25 B;  1TFB A;  3X26 B;  5DQW A;  2ZPG B;  2WJ9 A;  4OR5 B;  3BG9 A;  2DD5 B;  3QYB A;  4BCO B;  1H28 B;  2DXC B;  1H1R B;  4BY1 X;  4F6W B;  2WMB B;  1QLB A;  3BHV B;  4ZGJ B;  4OB3 B;  1OGU B;  1UGQ B;  4CXA B;  4F7L B;  1UGP B;  5I5Z B;  2D0Q B;  2BS2 A;  2UZB B;  2ZPI B;  4BCG B;  4M6V A;  1UNH D;  3B57 A;  1OKV B;  2ZZD B;  4QSH A;  1GY3 B;  4OB1 B;  5HQ0 B;  4HNU A;  2DXB B;  2QQ8 A;  2I53 A;  3TW6 A;  4UN0 A;  1AD6 A;  3GTM S;  1GH6 B;  4MIM A;  3BLR B;  2PK9 B;  3A8M B;  2UUE B;  4F70 B;  1ZP2 A;  3QYE A;  4I3Z B;  2IW6 B;  1OL2 B;  1XO2 A;  3VYH B;  2C5O B;  3DTO A;  4HL4 A;  1W98 B;  4BCN D;  1PKD B;  2BPM B;  2QF7 A;  1VIN A;  4OB0 B;  1H1Q B;  4CFV B;  3DDQ B;  1GUX A;  4YC3 B;  3VYG B;  2X1N B;  1AIS B;  3BHT B;  5CEI B;  1V29 B;  4OB2 B;  4BCP B;  4EOJ B;  5IF1 B;  3PO3 S;  4FM4 B;  4II5 B;  3WVE B;  4FX3 B;  3G33 B;  2DME A;  2WHB B;  4EOP B;  4EON B;  4Y72 B;  3DDP B;  4LOC A;  2PK2 A;  2UZE B;  5HNB B;  4EOK B;  1IRE B;  1JOW A;  2ZPE B;  2CCH B;  2WFY B;  4EOR B;  2C5X B;  4F6U B;  1G3N C;  1H24 B;  3DJB A;  4BCJ B;  2CCI B;  4JX6 A;  2C6T B;  2ZPB B;  1E7P A;  4BCF B;  3QXE B;  4ROD A;  3BHU B;  1VYW B;  4BCI B;  4NST B;  4AKG A;  2PMI B;  4AI6 A;  2W2H A;  1OIU B;  3MY5 B;  3QHW B;  2PHG A;  4BCQ B;  2PJQ A;  4ZGE B;  4YOZ A;  5IDP B;  2WIP B;  1VOL A;  3BLQ B;  2CZ7 B;  2IN3 A;  1JSU B;  2F2C A;  5HBH B;  4BXX X;  4BCQ D;  3TN8 B;  3VKH A;  4ELJ A;  2KMG A;  4BBR M;  3NDQ A;  1UNL D;  3QWL A;  2C4G B;  4F7J B;  4BCK B;  2W96 A;  4BCN B;  3H4C A;  3EID B;  1F5Q B;  5HBJ B;  3K7A M;  3TNH B;  2LW4 A;  1FKM A;  3QZ9 B; 
#chains in the Genus database with same CATH homology
 1P5E B;  5HBE B;  4BCP B;  4EOJ B;  5IF1 B;  3RGF B;  4F6W B;  4II5 B;  3EJ1 B;  4FX3 B;  4G6L B;  3G33 B;  1KXU A;  2WMB B;  4EOM B;  1JKW A;  5ICP B;  2WHB B;  3BHV B;  2JGZ B;  4IMY B;  4EOP B;  4YOS A;  1H27 B;  1OGU B;  4CXA B;  4F7L B;  5I5Z B;  2UZB B;  4EON B;  4CFU B;  4KRD B;  4Y72 B;  2WMA B;  3F5X B;  3DDP B;  4BCG B;  5L2W B;  3MI9 B;  2IW9 B;  4CFM B;  3MY1 B;  4ROE A;  5EFQ B;  2PK2 A;  2WXV B;  1UNH D;  4ROC A;  4ELL A;  5FGK B;  3BLH B;  1OKV B;  2IVX A;  2UZE B;  5HNB B;  1GY3 B;  4EOK B;  4CFU D;  3POM A;  1JOW A;  2CCH B;  2I40 B;  3LQ5 B;  5HQ0 B;  2WFY B;  2WIH B;  4EOR B;  2C5X B;  4F6U B;  4CRL B;  1G3N C;  1H24 B;  1JST B;  2IW8 B;  4YOO A;  4BCJ B;  4CFN B;  2CCI B;  5LQF B;  1H1S B;  2I53 A;  3QHR B;  4BCH B;  4UN0 A;  2C6T B;  1C9B A;  1AD6 A;  4BCF B;  4EOQ B;  1GH6 B;  5LMK B;  4ROD A;  1H1P B;  3BLR B;  1O9K B;  2C5V B;  2R7G A;  3BHU B;  1D3U B;  3MIA B;  2BKZ B;  2PK9 B;  1VYW B;  1BU2 A;  4BCI B;  4NST B;  2UUE B;  3TNW B;  4OGR B;  3DOG B;  2PMI B;  2W9F A;  1OI9 B;  1GUX B;  2WEV B;  2WPA B;  4F70 B;  3O0G D;  4EC8 B;  1ZP2 A;  4EOL B;  2W2H A;  1FVV B;  1URC B;  2V22 B;  1OIU B;  5ACB A;  3MY5 B;  3QHW B;  4BCM B;  2PHG A;  4I3Z B;  4BCQ B;  2IW6 B;  3EOC B;  1OKW B;  1OL2 B;  1E9H B;  1UNG D;  1FIN B;  4YOZ A;  5BNJ B;  1XO2 A;  5IDP B;  2WIP B;  4CFX B;  1VOL A;  2EUF A;  1H4L D;  2W99 A;  3BLQ B;  5IDN B;  1JSU B;  2C5O B;  2F2C A;  4KRC B;  5HBH B;  1H26 B;  4BCM D;  4BCQ D;  3TN8 B;  2QDJ A;  3M03 A;  1OIY B;  1W98 B;  4EOO B;  4BCN D;  4EOI B;  4F6S B;  1PKD B;  2BPM B;  3TNI B;  1O9K A;  2C5N B;  2B9R A;  4CFW B;  1QMZ B;  4F7N B;  2W9Z A;  4ELJ A;  4TTH A;  1VIN A;  1H1Q B;  1N4M A;  2CJM B;  4CFV B;  5HVY B;  1UNL D;  3DDQ B;  1GUX A;  1H25 B;  4F7J B;  1TFB A;  2C4G B;  4BCK B;  4F7S B;  2W96 A;  4BCN B;  4EC9 B;  4OR5 B;  3H4C A;  5CYI B;  3EID B;  4YC3 B;  1F5Q B;  5HBJ B;  2X1N B;  1AIS B;  4EOS B;  2UZL B;  3BHT B;  3K7A M;  4BCO B;  2UZD B;  3TNH B;  1H28 B;  2G9X B;  1H1R B;  5CEI B;  1OL1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...