2WMHA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 in complex with the h- disaccharide blood group antigen.
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
555
structure length
553
Chain Sequence
VQMRTTINNESPLLLSPLYGNDNGNGLWWGNTLKGAWEAIPEDVKPYAAIELHPAKVCKPTSCIPRDTKELREWYVKMLEEAQSLNIPVFLVIMSAGERNTVPPEWLDEQFQKYSVLKGVLNIENYWIYNNQLAPHSAKYLEVCAKYGAHFIWHDHEKWFWETIMNDPTFFEASQKYHKNLVLATKNTPIRDDAGTDSIVSGFWLSGLCDNWGSSTDTWKWWEKHYTNTFETGRARDMRSYASEPESMIAMEMMNVYTGGGTVYNFECAAYTFMTNDVPTPAFTKGIIPFFRHAIQNPAPSKEEVVNRTKAVFWNGEGRISSLNGFYQGLYSNDETMPLYNNGRYHILPVIHEKIDKEKISSIFPNAKILTKNSEELSSKVNYLNSLYPKLYEGDGYAQRVGNSWYIYNSNANINKNQQVMLPMYTNNTKSLSLDLTPHTYAVVKENPNNLHILLNNYRTDKTAMWALSGNFDASKSWKKEELELANWISKNYSINPVDNDFRTTTLTLKGHHKPQINISGDKNHYTYTENWDENTHVYTITVNHNGMVEMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords FUCOLECTIN-RELATED PROTEIN
total genus 203
structure length 553
sequence length 555
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08306 Glyco_hydro_98M Glycosyl hydrolase family 98
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmhA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmhA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmhA02
1UWIA 4ZFMA 2G3JA 3AQUA 1JYNA 4FLOA 4KRTA 1JZ7A 2A3BA 5BROA 2VZSA 4W5UA 1EGUA 2X03A 2EPLX 1HP4A 3AIVA 2NT0A 2UY5A 3WD4A 1MQRA 2RGLA 2WLZA 4AEFA 2F8QA 1UD2A 5A3HA 1TVPA 1CBGA 2ZUUA 3GNPA 4M29A 2WB5A 2YBTA 4PMYA 4DM2A 1VEOA 1KB3A 4HOZA 1JFXA 1E0XA 1C8YA 4HA1A 1PBGA 4CU6A 3UG3A 1G0CA 1CB8A 3VDHA 2AMGA 3QOMA 3WSUA 4CVUA 3NSXA 3WH9A 1F1SA 1WO2A 2OSWA 3NSNA 1UA7A 4GO8A 4UQCA 2BY2A 3VIHA 3WQ8A 1C82A 1UH2A 2XJ7A 5ECUA 5BXSA 3M7SA 2ZUSA 2JIWA 4QLLA 3MMWA 4HA3A 1OINA 1B9ZA 3QOKA 2J7DA 2W61A 1QHZA 3CIVA 1AQHA 1QI3A 3MUZ1 3WBAA 4RE2A 3TTSA 1U33A 2WCSA 1QBBA 2DH2A 5BWFA 3GYCA 2WLYA 1D3CA 4KRUA 4J3XA 4D1JA 1C90A 3AHTA 3MKKA 4XB3A 1PJ9A 1NWRA 4W89A 3OGSA 3W25A 4W7VA 1UKTA 1TG7A 4P8VA 2UY3A 4DM1A 2WMIA 1UH3A 1FP8A 3UR8A 5A2AA 3GXFA 1JF5A 1Y7VA 1DEDA 1OD8A 2JEQA 3AHVA 4W86A 1UG6A 4KGLA 5AC4A 3DHPA 3GBEA 4QP0A 1JZ5A 3D3AA 1UZ1A 1HMWA 4A4AA 4J3TA 3IJ7A 1G9HA 2WM0A 4LYPA 3BGAA 1MW0A 1JZ6A 3L4YA 2A3EA 1DWJM 3WF2A 3ZT7A 1XSJA 5GNXA 2WMIB 9CGTA 3MMUA 3PZTA 2VRQA 3VD4A 1TA3B 4WIWA 5D8ZA 4CD8A 3NDZA 5IDIA 2G3NA 3T09A 3CHEA 2XIIA 5DT7A 3RDKA 3CZKA 5CG0A 1R8LA 2XVGA 4BA0A 3S2CA 2IUZA 3LPGA 2ZOXA 3WH5A 4JHOA 1UQZA 1K9TA 5IHSA 1JG9A 1NH6A 3VX1A 1EHAA 1UR0A 4L4OA 1F4AA 1QHPA 2A3AA 1GNXA 1HIZA 1GOOA 3OGRA 4FLRA 3VGHA 3WF3A 4PMRA 2YL5A 3U5UA 1EOKA 4KH2A 1FH8A 2E9LA 5BRQA 2XSBA 1JFHA 2O9OA 3TTOA 4C7FA 2D0GA 2ESCA 3K8LA 6A3HA 4IUGA 4PMNA 2QHAA 1EO5A 4EK7A 1W3JA 1W9UA 5A8MA 4E8DA 1GW1A 3BSGA 2NSXA 1UR2A 2UWFA 1KR1A 1N7OA 4WK9A 5IFTA 5C71A 2JALA 5I79A 2BXZA 1KR0A 4TX8A 1LG2A 5CPTA 2PBGA 1D7FA 1FH9A 4TXEA 2E9BA 4UQDA 2VL4A 4DUWA 2OLHA 1R87A 1E6XM 4CD5A 5GNYA 3M46A 3NIYA 2YA2A 4OOZA 4KMQA 1GQLA 3VNYA 1GZJA 4J3WA 5DF0A 3K4DA 1UD6A 3NJ3A 5CSUA 4GZIA 1HNYA 1RW9A 5D4YA 3BLPX 2J8FA 3RM4A 1GOKA 2J79A 2DQXA 5FL0A 2O9TA 5I6SA 3WN6A 1TUXA 4MNLA 2E40A 5IXEA 1QOXA 4W87A 2D0FA 2ZUMA 4PCTA 1NP2A 1W1VA 2XFFA 2ZUWA 3ALGA 2Q8XA 1E55A 4UTFA 4HZ6A 4GQRA 1OT2A 2B31A 4D1IA 1V08A 4UR9A 1JD9A 1K6AA 1J0ZA 2VZUA 4AD1A 1HVXA 2CXGA 1UKSA 3WD2A 3T0AA 2OYMA 4GI9A 2X1IA 1UD5A 4AY1A 3THCA 3U7VA 4E4PA 1XRVA 4Z2JA 3NYDA 4MB1A 1E4NA 3WBEA 1BF2A 3EDEA 1V6WA 3WQ5A 5I0DA 3PZVA 1H41A 1QI4A 3L2LA 5ABFB 1VFFA 3CMJA 1OD0A 1UR1A 1H11A 2W67A 2V3FA 2FH8A 2YDRA 3BCFA 1F4HA 1C93A 1R86A 4LPCA 1B3VA 1GVYA 1O7AA 3F5KA 1LG1A 2EPKX 3IANA 2D2OA 1OJMA 1L0PA 3M6DA 3VOCA 2Y24A 2WHKA 1W91A 4W8BA 3PZMA 4D6GA 5FCZA 3AS2A 2NT1A 4M81A 4Z2GA 1J9YA 2ZE0A 1E1EA 2YKKA 1GCYA 1SR0A 3SCRA 4GQQA 3VD5A 4OUEA 2V5CA 1J18A 5BCAA 5KZ6A 1JF6A 1ISZA 3FW6A 1GJUA 3VMNA 4ML4A 3DHUA 2WZHA 1CXLA 3B9EA 1E6SM 2VZVA 4P7QA 3ZJ6A 3LMYA 2OSYA 3U7BA 3D5HA 1UUQA 2FGZA 4QLJA 1US2A 3I3EA 4UFJA 3ZT5A 2HVMA 2J7FA 4PTWA 3AS1A 3WMBA 2YL8A 2JIEA 1UWSA 1ISYA 1HJXA 1H4PA 2VURA 2WC7A 2X05A 2ZWYA 5A6SA 2EXOA 2E22A 2CBJA 2PF0A 1MXDA 1I1XA 4GZJA 1X1NA 1HKIA 3WF1A 4PMQA 3VGDA 1V3HA 3WMSA 5A6BA 1X6NA 4FMVA 1E4MM 4F66A 3VGGA 3UETA 4B9ZA 3CHFA 3WDHA 3SCUA 1WZKA 1NWTA 1XYZA 2CBUA 3QR3A 1W9DM 4Q7NA 3AZSA 1M04A 2CITA 3RJYA 3PZUA 1WZLA 4F79A 3UG4A 2JF7A 3F4VA 3W6LA 1JI2A 2VVNA 1PZ2A 1UYQA 1J0MA 1Q6CA 2VZOA 1HVQA 3A4XA 1N7RA 1DWFM 2E8ZA 3CZEA 1JDDA 2TAAA 4H04A 1GQJA 4AZ5A 2DSVA 1W1TA 2D0HA 4AYSA 3AIEA 3UESA 3ZM8A 3IAQA 1G94A 2XGBA 2WMHA 3AZTA 3FNDA 1J01A 3BMWA 5HXMA 4LQ1A 3WH6A 2VQTA 2W66A 1KGWA 2YDSA 1BAGA 1LL6A 1K9DA 3ARPA 1JIBA 3ARQA 4P7NA 4UFLA 1KGUA 4DUVA 4HPHA 3VMPA 2Y8KA 3RILA 3N9KA 3LPFA 1B3YA 1OGBA 1V0MA 1ODUA 5TD4A 2HISA 3OIHA 4GIAA 4CN4A 4X0NA 3GZAA 2YDQA 1WKYA 3OLIA 3EMZA 2Y4SA 5E09A 1X6LA 3AXIA 4M24A 1X1JA 2WMGA 1QNPA 8A3HA 1GOIA 5E9AA 4PRWA 1Q6FA 5A8OA 5CSYA 4UQAA 4WSKA 2O9PA 1LXMA 5JBEA 1HP5A 1K9EA 2BVDA 1E70M 4F9JA 2DT0A 1JD7A 2OWWA 1EOMA 1CECA 2X8RA 3WNKA 3VKKA 1BVZA 2EJ1A 5BYWA 1LL7A 5E0FA 1B3XA 4AZCA 2JFEX 1WCGA 1K9FA 1LL4A 3OLDA 4P8XA 1V3JA 2WKGA 3KL3A 1E6RA 2VO5A 2XUCA 2PWFA 3ARZA 1M7XA 4X9YA 4NRSA 3QGVA 2ZX6A 4UQ9A 4PMVA 1MQQA 1UKOA 3KEHA 4C7DA 1C3FA 1EHNA 4HP5A 4HMEA 3MSDA 3W81A 3CTTA 6CGTA 2ZWZA 2W92A 1SYTA 4GO9A 3WD3A 4MB5A 2X0HA 4QAWA 4MTVA 5JUVA 3GTNA 1VENA 4W7UA 3GH4A 4PSPA 3WNNA 4AZ7A 2DT1A 2DEPA 1CIUA 4V2XA 3L4WA 1KCKA 5HNNA 3W38A 5FKYA 4M80A 1PIGA 1HXJA 3AMCA 1CXKA 4OKDA 1E6NA 3FHQA 4ZE5A 1OM0A 1KCLA 2WVSA 4J7RA 1QPKA 4W85A 1FHLA 1JNEA 4HU0A 4DUXA 3UEQA 1V0KA 1S46A 4V27A 3WQ6A 1FH7A 1UHVA 1GQIA 3AIQA 2G8ZA 3AHYA 1V6XA 2VOTA 3OA5A 4JL2A 3WL1A 4W7WA 4MB4A 3WDQA 4CVWA 3W24A 4UQBA 4IPNB 3ARXA 4KGJA 5CXPA 3OLEA 2DIJA 3KL5A 4BS0A 5A8QA 1CXFA 1UZ4A 3CUFA 4W88A 3SUUA 3POHA 1JDAA 3NDYA 1BYBA 4CN6A 2QPUA 1EDGA 4OIFA 1GUVA 1V3IA 4MPKA 4YHGA 1J0YA 2CCRA 4MAZA 4LYRA 4GPNA 4JHZA 3T2OA 1W3HA 4URIA 5I24A 2CBIA 4D6HA 1V6UA 5A6KA 1CWYA 2V3EA 2DIEA 4TUFA 3W29A 2BS9A 3ARWA 4JZ5A 3VD3A 2MANA 2WWCA 1CXHA 1JZ2A 1CXIA 1W3KA 5CLWA 1EO7A 1JZ3A 3PZ9A 3U57A 4XZWA 1UD3A 4B3KA 3SCWA 5JBFA 2ZIDA 4LGXA 1ISWA 1MVYA 4MNJA 1B3ZA 3WMCA 5A95A 3AMGA 2DSUA 5AYBA 1HF6A 1OSEA 1OGSA 3SCVA 3VIKA 3RM9A 1KGXA 1JXJA 1HJUA 3W27A 1FOBA 3T08A 3UERA 1XD0A 3EMQA 3CUHA 4V28A 1UR4A 4B9YA 4IM4A 1VAHA 2BRWA 3BAWA 1ZU8A 2J74A 1ZBKA 1AVAA 1J0IA 2BVYA 3ARSA 2W63A 2BHYA 1VFUA 3SCPA 2VUYA 1KFWA 3VX0A 3FHAA 3OLGA 2W91A 4CD6A 1ZS2A 4ZEPA 5HPCA 4F9DA 2WCOA 3BSHA 4AD0A 4N42A 3JUGA 4WKAA 2G3MA 1Q6DA 2V38A 1I8QA 3PZGA 3N17A 5IFPA 4P7OA 2WZEA 2ZX7A 2WVTA 3WQVA 4JFUA 4P8UA 5A94A 4H8UA 1WNOA 1UA3A 1IZJA 5GQBA 1B0IA 1OJPA 1L8NA 3PTQA 4PMUA 1E56A 3VIMA 2UY2A 1H0IA 3AS0A 5HDRA 3BC9A 4D6DA 3UCQA 4PEEA 1N7NA 3MO4A 2DT3A 4OOUA 2DSKA 4Q22A 2J75A 1VIWA 1XH2A 3VM7A 1TR1A 3N18A 4PN2A 2E4TA 4JKLA 3EYPA 3WEOA 1C8XA 3TTYA 2WBKA 1NOFA 3AIWA 5DO8A 1QI2A 4U5KA 5BXPA 3CH9A 2GJRA 2C7FA 1J0NA 1CYGA 1F9GA 3OZOA 2XYLA 1C8QA 1BSIA 2WVUA 3SUVA 4HZ7A 5HBFA 1JDCA 1MYRA 1A3HA 3WDJA 2WVVB 2F2HA 5EBAA 2J62A 1CGTA 3N1AA 4GXPA 1CLVA 2VRJA 4PMOA 3W28A 1V02A 1H3GA 1HM3A 2ZXBA 1LQ0A 1W3LA 3WIJA 5A6AA 1E72M 3VDCA 1BG9A 3EMCA 4CU7A 1JAKA 4DWSA 3KE0A 1EQPA 1G1YA 4UOJA 2WSPA 2VJXA 1H5VA 3GH7A 3BAYA 3ECQA 1J11A 4PYSA 3GM8A 2WZIA 4GZEA 4W84A 1WAWA 1AQ0A 2JE8A 2FHBA 1TMQA 1EDQA 3VMOA 1IZKA 3POCA 1Z32X 3DYOA 1BHGA 2Y5EA 1E71M 2VX6A 1RD6A 3N11A 4UOZA 5FL1A 4JAWA 3CO4A 2PWHA 3WDIA 3AYSA 3NSMA 1UD4A 2YA0A 4MNMA 3K46A 1KXHA 3EDKA 3WH7A 1V03A 2WW5A 1BYAA 4M56A 5DT5A 1JXKA 1NARA 3UG5A 1OB0A 1ZBVA 1E43A 1OT1A 3GXIA 4HOXA 1MW2A 1HX0A 5EB8A 1ESWA 1W1PA 1PPIA 1JL8A 2VX7A 2WAGA 8CGTA 1MW1A 4FLSA 1LJYA 1OCQA 1C92A 2A3CA 3CZLA 2YLLA 3GBDA 3K8KA 4UQEA 1KBKA 1UQYA 1XSIA 4H41A 2D22A 1B30A 4UZSA 5D9MA 3CMGA 3DYPA 1NWUA 4R5EA 3WDPP 3VD7A 4P7RA 4CD4A 4PTVA 4UFKA 1LOHA 2ZICA 1DWIM 1HJSA 4CUCA 3SUTA 1ZB5A 1OIFA 4XV0A 1E73M 4AD4A 3ARTA 2VX5A 2E24A 4GI8A 4UZUA 1VF8A 1J10A 2J7BA 2VR4A 4U33A 1QW9A 3CZGA 3VVGA 4MJ4A 4BQ3A 1CTNA 3MUAA 3MV11 2PC8A 4GINA 3WNPA 5LYRA 1HN0A 2YJQA 2WHMA 3AMLA 1ZL1A 3VIIA 3MV01 4ZXOA 5EFDA 4MDPA 4OBRA 4ATWA 3APGA 4TX6A 2BXYA 3A47A 5E6YA 2WPGA 3VU2A 1E1FA 2UY4A 2W4XA 1X1HA 2VRKA 4TTGA 4HMCA 1CPUA 3GXMA 4RE3A 3AROA 2D20A 1LWJA 5C70A 1UR9A 1HJWA 3BAIA 3FAXA 2F61A 4PSRA 3A6OA 2XVNA 4ATDA 4S3KA 1PAMA 2VVSA 1U30A 2WHJA 1E4IA 1MXGA 5CQ1A 3AXXA 2X0YA 1KBBA 1W9XA 1V6VA 3WELA 2BFGA 2VT0A 3L4TA 3RM8A 1E5JA 3PZNA 4FLQA 1RWHA 1VBRA 2BRPA 1OGGA 1VJSA 4U2YA 1DWHM 1V3MA 4L4PA 1XGZA 3GH5A 7CGTA 4N0RA 1GORA 3AYRA 3WFLA 1XV8A 1BG4A 2XVKA 2OSXA 1CENA 3AXHA 4MDOA 1HL8A 2J78A 5IHRA 3ZR5A 1XC6A 4BZYA 4PTMA 1E5NA 1O6IA 1QHOA 1QI5A 2O9RA 2VZTA 3WF0A 4UOQA 4AZHA 4EKJA 3B9AA 5ABEA 1NWSA 4AD5A 2E9MA 2Y2WA 4WF7A 1WE5A 4XX6A 3RPMA 3EDDA 2ZXDA 1NP0A 4HPGA 3K8MA 2YLAA 5D8WA 5EMYA 4A3HA 2ZUVA 3PN8A 1UWQA 2EPNA 2Y8VA 3I3BA 4W5ZA 2JEPA 3SUWA 1MWOA 1ZBCA 2GVYA 2GDVA 3WNOA 3AOFA 2CKRA 2WC3A 3WD0A 3AFBA 4QCFA 3II1A 4JKKA 1W2VA 1UWTA 4MB3A 4BQ4A 5HPOA 2QLYA 4H8HA 2FDMA 5A1AA 3VIFA 2YIHA 4NZCA 4ZE4A 2WWDA 1J12A 2VCBA 4TVUA 5JIPA 1QNOA 2BNJA 1GHSA 2EQDA 4AZ6A 3BXWA 1R7OA 2CIPA 3CBWA 1XSKA 1P6WA 4ATLA 4WKHA 1E4LA 1E0WA 4U5IA 1HKKA 3T0DA 4KWUA 2G4FA 4HTYA 4P8WA 2DSWA 3AIUA 5CJ5A 3MU7A 1KQZA 3A4WA 2XIBA 3L4UA 4JL1A 4CCCA 1YQ2A 4XUYA 1LF1A 1NOWA 1HKJA 1QI0A 1E3XA 3CGTA 3M07A 4CN1A 4AXNA 3OB8A 1EQCA 2J7EA 5I5RA 3U5YA 1ODZA 1B3WA 3SCTA 2J77A 3ZQ9A 2VQUA 3W53A 2WMFA 4FF5A 3WY1A 2GJXA 2D3LA 3PBGA 2EPMX 2E3ZA 3MUIA 1I75A 4AWEA 3W37A 2YBUA 2D3NA 3VINA 3T2PA 1V0NA 1B90A 3QHNA 1WB0A 3ZJKA 3KL0A 3OZPA 1XD1A 1CEOA 1CDGA 3CUJA 4JFWA 5M03A 2G3IA 4D6FA 4B16A 4AZBA 3ARUA 2XVPA 4P7LA 1GJWA 2PBOA 2FH6A 1DTUA 3PHAA 4RL3A 1CZ1A 4U2ZA 3ZT6A 1RH9A 3WENA 4D6EA 2FHCA 1JYWA 1FP9A 2WHLA 3WNMA 5GNZA 2X09A 3VIJA 2GK1B 4AZIA 1XH0A 5A69A 2VCAA 3IAPA 1C91A 3AHZA 1MQPA 4DWSC 2NW0A 2GDUA 2WCAA 4UFHA 3IK2A 3FAWA 1HN1A 1ISVA 4R27A 3WEZA 2BV9A 3PTMA 4JCLA 4IISA 1UKQA 1DWAM 2WANA 7A3HA 1ISXA 4AD2A 3RJXA 5A8PA 2CNCA 5E0CA 3AS3A 1B2YA 3AZRA 3WL0A 3SCSA 1JZ4A 5I77A 1QNSA 1UR8A 4J3VA 1W32A 1KWKA 1XH1A 3BAJA 1JZ8A 4WJXA 1VEMA 3S6TA 1M03A 1PIFA 5ABFA 1ZJBA 4PBGA 4J27A 1TVNA 3WQWA 1BFNA 1VB9A 2CERA 2CHNA 2VC9A 5CPSA 3WQ4A 3WUEA 1TFVA 3MANA 4BCEA 1XCXA 3AICA 2RGMA 5BXTA 4OJYA 2YA1A 1WP6A 4W8LA 1FFRA 3O2LA 2ZUTA 1J0JA 1RP8A 5D9PA 2FHFA 2WYSA 1AMYA 3WUFA 1IV8A 4CCEA 1MW3A 4OBSA 1V02E 1I1WA 1BQCA 1SFSA 1HT6A 2ZX9A 4F8XA 1J0HA 1V3KA 3WEMA 4Z2KA 1ZJAA 4U3AA 1XCWA 2VX4A 3QHOA 3ZIZA 1US3A 2FGLA 1B31A 4MADA 5FD0A 1GOWA 4GI6A 4AC1X 3A4AA 3WD1A 4B3LA 4Z2IA 4OZOA 3CUGA 3O9NA 1ITCA 4WLCA 3WUGA 4AIUA 5CZKA 1E0VA 3BMVA 1JYVA 5E70A 4EE9A 3G6MA 3N15A 2CYGA 3RMEA 5E6ZA 4QDMA 4M8UA 1BYDA 5I78A 1DP0A 4S3JA 2XM1A 2XGIA 3O6AA 2C8NA 3PZQA 4W93A 4UCFA 2OYKA 3DECA 2YL9A 3VO0A 1UH4A 4PMDA 1EH9A 4U31A 5DEZA 4EANA 1FA2A 3THDA 1KXVA 3GDBA 1OWQA 5AY7A 4AW7A 2QMKA 3W6MA 1RWCA 2IXUA 2DGAA 2BHZA 1HKMA 3G6LA 3PZOA 1LWHA 2J8GA 5CGTA 4B15A 3BH4A 3WUBA 2ZX8A 3DC0A 4PMXA 2ZUNA 1NQ6A 2W62A 1N7PA 3LPOA 1UD8A 3F5LA 1SMAA 2YOCA 1W9PA 1VEPA 3TP4A 1KXQA 5ABGA 1IT0A 2DPEA 3BLKA 1UWUA 3HMCA 5A2BA 3B9DA 3AIBA 3N13A 2XWDA 2GK1A 3VDAA 2WVVA 1E6PA 3F5JA 2QV4A 1GONA 2J25A 1YHTA 1WDSA 3ARRA 4MJ2A 5I2UA 1A47A 3KZSA 2V3DA 3GNOA 3WDRA 5M5DA 1CNVA 4HZ8A 4AISA 1RWGA 4QLKA 4NRRA 2EBNA 4NF7A 1RWFA 3I3DA 3ALFA 4MAVA 4K68A 3NCOA 1E6QM 1ECEA 5I3DA 4YN5A 1FHDA 5LA2A 1H2JA 2WMKA 3HJEA 5KEZA 3WKZA 3RCNA 3W82A 5I23A 2GFTA 4PTXA 5LA1A 2VTFA 4H7VA 5CGMA 3PZIA 4PUDA 2XSAA 5D9NA 2IXVA 3EBVA 4J28A 1H0GA 3MUY1 3ARVA 3BCDA 2XFYA 4QCEA 1DWGM 2WNWA 2QPSA 4HOWA 3VGBA 2Z1SA 1N7QA 4HMDA 1M53A 1E40A 2DT2A 2AAAA 1BPLB 4AZGA 3CPUA 1SMDA 2BVTA 2ZX5A 3OG2A 3TA9A 1CGUA 3CHCA 1UOKA 3WNLA 4M1RA 1W2PA 2DSZA 1EIBA 1XHGA 1OJOA 1KXTA 2VI0A 4GKLA 1JGIA 1R85A 1FFQA 2X2YA 2OYLA 2VR5A 3GXDA 4E8CA 3WFZA 1HMUA 5JIWA 2E8YA 1VRXA 3EDFA 1LLOA 2DDXA 1WZAA 2WBGA 1JAEA 4TOQA 2W5FA 3MS8A 2VCCA 5C8BB 4JFTA 4Z2HA 2BY3A 1ZBWA 4NI3A 2J47A 1BGAA 4JFSA 3GNRA 4CCDA 3VD9A 1H09A 4J3UA 2WMJA 1TZ7A 5A8NA 4ACZA 4A3YA 6TAAA 5A2CA 4ACZB 1W9BM 4LX4A 1PX8A 1NM9A 2WDAA 3CZ8A 4MNKA 2CKSA 1HM2A 3UR7A 1RPKA 3ZSTA 4D71A 3AISA 4H8VA 4TTUA 5LA0A 5CPQA 1WDQA 1M01A 2CPUA 3SCNA 4D72A 4Y7EA 3W4RA 1CGVA 3LPPA 1Q4NX 2WXDM 2J7CA 2VNCA 2CHOA 3TOPA 1V0LA 4UFIA 3RO8A 4AEEA 1GOQA 1QNRA 4UNIA 3AMKA 4BQ2A 1GOMA 3K1DA 1D2KA 1VBUA 4EAMA 2GSJA 5M3WA 1N82A 2YL6A 3SUSA 4C7GA 5DMYA 2CESA 1RP9A 2GJXB 4HA4A 2G41A 3A3HA 1BYCA 2QMJA 3ZMRA 2JF6A 2WC4A 4YPJA 3SURA 1EA9C 4WKFA 1V3LA 2D24A 3FY1A 3IJ9A 5FOOA 1W9VA 1WDRA 3VIOA 3QHMA 5EFFA 4JCMA 7TAAA 4D6JA 3MSGA 4U3CA 1W3YA 1QW8A 3N04A 1VJZA 3W26A 1EXPA 5A6MA 3VNZA 2XG9A 1CGWA 2XWEA 2WSKA 5GPRA 4E2OA 1PEZA 4JKMA 1GVIA 2XFRA 1JI1A 4NSBA 2XVLA 1WDPA 3KWXA 1JYXA 5BRPA 3SCOA 4AIOA 5JBDA 1GQKA 1H1NA 2QF8A 1RWAA 3AI0A 2EPOA 3VDBA 2C0HA 4CGTA 4WSJA 4BF7A 1G01A 1BTCA 1ITXA 3FXYA 5F7UA 5A6JA 2E0PA 1CLXA 2XHYA 3FN9A 3BAKA 3ZR6A 3B8SA 3TONA 4ZXLA 1NOUA 2CETA 3ZJ8A 1HJVA 3ZJ7A 4H2CA 4ACYA 1AQMA 4D6CA 2CEQA 4X0VA 3J7HA 1H49A 3E1F1 3PTKA 2GUYA 2XPKA 2D1ZA 2GJPA 3OBAA 1OBAA 5HOSA 1J0KA 3CLWA 5D9OA 3VIGA 4AMCA 3IJ8A 2A3HA 3MMDA 1WPCA 4TVDA 1X1IA 1GPFA 2ZXQA 3SIMA 4CD7A 2AOSA 2Q1FA 4XZBA 1OJNA 4PCSA 5CLTA 4M82A 2WKLA 3WF4A 4PUEA 5FIPA 1XYFA 1E6ZA 3ZO9A 3AIRA 3VPLA 1MFVA 4LYQA 1TCMA 4CKQA 1DHKA 1PZ3A 2PWGA 2BY0A 3ARYA 1W1YA 3VGEA 2Z1KA 4RE4A 3DYMA 2WK2A 5AYIA 3CUIA 2V3GA 3L4XA 1EGZA 1G5AA 1E3ZA 5DFAA 2ZXAA 3AHXA 4BQ5A 5AC5A 1BLIA 4J3SA 4W8AA 1MFUA 2EO7A 4JFVA 3T2QA 1LXKA 1QVBA 2XTKA 1V6YA 4Z2LA 1EDTA 3N12A 3SEPA 3CHDA 4DWSD 3ZOAA 2O92A 1VFMA 5BXRA 1B1YA 1HL9A 2J7HA 2D23A 3HN3A 2XM2A 1Q6EA 1TE1A 3AJ7A 3WH8A 3ZSSA 1KWGA 2V5DA 1GHRA 2CBVA 4FK9A 4JIEA 1UWRA 2PI6A 5A6LA 1E9LA 2BY1A 1QNQA 3SCQA 3VM5A 4QFUA 4YHEA 3HU7A 3OGVA 4AD3A 2J4GA 3BAXA 1BVNP 3VILA 3VUPA 3TTQA 1QBAA 3L2MA 3L4VA 1U2YA 2WCGA 1C7SA 2PB1A 3T0BA 4IPLA 2PWDA 1WZMA 5ABHA 3AMDA 3VTRA 4UFMA 5M17A 1CGXA 4AIEA 2EEXA 3RIKA 3CZJA 3K4AA 2BRVX 1HJQA 1CGYA 2PWEA 1C7TA 4TVCA 2J7GA 1Q6GA 4D6IA 2BHUA 4DWSB 1CXEA 2DH3A 1TA3A 3VGFA 4ZENA 1BGGA 4LXFA 1PX4A 4HU8A 3W0KA 4AZCB 3NUKA 2OWXA 3EDJA 4CU8A 3VIPA 1KQYA 3L4ZA 2OWCA 1VFOA 2VMFA 1OIMA 5A6BD 1PX3A 1R7AA 1UKPA 4PMZA 1JNDA 1E15A
chains in the Genus database with same CATH superfamily
1OABA 2G3JA 4FLOA 1FWBC 3VCCA 4KRTA 2Y70A 2QDDA 2VWTA 2BGQA 2OZ8A 4W5UA 1EGUA 2EPLX 5IM51 2CLEA 5HJLA 4OQVA 2FPYA 2RGLA 2X1UA 2H9AB 1UD2A 2O7QA 1TVPA 4ZO6A 1CBGA 3GNPA 4M29A 2WB5A 2YBTA 1ZALA 1KB3A 1JFXA 1C8YA 1JPMA 1PBGA 4CU6A 4TV6A 4WDXA 3VDHA 1GT8A 3W00A 1EPVA 3WSUA 4PULA 1H62A 4O17A 2VFEA 3NSXA 4DF0A 2XSXA 3FVDA 2OSWA 4C6PA 1TQJA 2PGRA 4GO8A 1P0KA 2WKJA 1M7OA 5C7VA 2F9RA 3F4NA 3G3DA 1DJXA 2XJ7A 5ECUA 5T8GA 3FJNA 3WLKX 4CQ8A 1K6WA 2JIWA 4QLLA 4HA3A 1XRTA 3DU0A 3HBLA 1DXIA 2Z25A 2J7DA 2IPJA 1AQHA 2X1RA 3MUZ1 3W01A 2E1DA 3WBAA 2Z29A 4XD6A 2IQ0A 4FX8A 2Y85A 3GYCA 2WLYA 3C3UA 1D3CA 4KRUA 4J3XA 4JTEA 3SR7A 2ZZ5A 1Q6QA 4XB3A 1PJ9A 1DE5A 3AO0A 3PB0A 4W89A 3W76A 1HO1A 4W7VA 1UKTA 4CQCA 1GVEA 1TPB1 4P2VA 2VC6A 2UY3A 4DM1A 1O94A 1UH3A 3NO1A 3TLQA 3M0LA 1JF5A 2JEQA 2YGYA 3BZGA 4KGLA 1JZ5A 2TPSA 3CB8A 4W9TA 1UZ1A 3TW9A 1R2TA 5CZJA 1G9HA 1MW0A 3L0NA 3WF2A 5GNXA 9CGTA 3MMUA 4DPQA 4WIWA 3FEQA 2CZEA 1P0BA 3MC5A 3T09A 2OQLA 1XLIA 3UPBA 4QSFA 3AWOA 3KOYA 2VELA 2ZOXA 3WK3A 3WH5A 4S3DA 2D69A 4JHOA 4XZNX 2XFWA 1EHAA 1LWIA 4FLRA 3TQPA 1KTNA 1W5OA 1Z48A 4I7VA 1QFEA 4CQDA 2V5LA 4MUZA 2YL5A 3SN1A 1EOKA 4V1YA 4KH2A 5K4XA 2E9LA 5DMMA 3T0CA 1RVGA 2VGFA 4KFNA 3B8UA 1VCVA 1UUOA 1GYLA 6A3HA 2QHAA 3QPEA 4EK7A 4LBUA 2UWFA 1N7OA 5HJYA 4TX8A 1YBQB 1LG2A 2PBGA 3DG6A 1FH9A 4UQDA 3BTNA 4DUWA 1E6XM 4PUNA 4HMNA 3U48A 4N6FA 5C9XA 1GQLA 1XUUA 3L21A 5C6MA 3K4DA 4O8RA 3EOOA 4FNUA 3NJ3A 3GY1A 4GZIA 1XRFA 3N2BA 3BLPX 4US6A 3GU1A 3F03K 3F7JA 5I6SA 1SFLA 4MNLA 1QOXA 2IKHA 3UXDA 4Q4QA 5MF5A 4S2CA 4PCTA 1ML1A 3GD6A 2OZTA 4F0HA 2V0TA 3REQB 1E55A 4HZ6A 1YXYA 1R3RA 3I68A 4M19A 1V08A 2TSYA 1ADOA 3Q94A 6TIMA 3WX7A 3NL5A 2UBPC 3NQGA 3UJ2A 2VZUA 1J0ZA 1KM5A 2CXGA 1KBIA 5FACA 1IHIA 3WCZA 3WBYA 1YIXA 2X1IA 3LDVA 2HZGA 4K37A 1XRVA 4Z2JA 1Q65A 3NYDA 5BWAA 2OPJA 3PFMA 4LV9A 4XZIA 1J79A 4DY1A 3H24A 3CMJA 1OD0A 1UR1A 1XRSA 3BCFA 2F6KA 4KWSA 1BQGA 2PRMA 3T42A 3OIXA 3R10A 4OBTA 3IANA 2GUBA 3W74A 3ZVHA 3B40A 1W1ZA 4D6GA 1E9ZB 3C86A 3B4YA 4RJEA 3AS2A 2ZE0A 1E1EA 1SR9A 5KINA 4ZSTA 1SR0A 4KF1A 3A22A 3SCRA 1VLWA 1J18A 5BCAA 1JF6A 4Q4RA 3KRBA 1TV8A 1RR2A 3DHUA 3TFCA 4QDPA 1YNQA 4O1FA 2XH2A 4Y2WA 4DZAA 4P7QA 3U7BA 3BG9A 3V3WA 2VEMA 3AWNA 1US2A 3L68A 4H9UA 3I3EA 3LBCA 2XH4A 4EOUA 3I10A 1HGWA 3TXZA 1ISYA 2D2JA 4GI4A 3IIXA 3W02A 3UFYA 4DBSA 4AQLA 1UBPC 4O1CA 1ENUA 4H01A 2CBJA 2PF0A 3LRLA 1OJXA 1I1XA 4GZJA 4QDWA 1X1NA 1TPFA 1VCFA 4UTJA 3BCJA 4G7FA 5K3VA 4I5RA 1H51A 3RHGA 4EWJA 4J4KA 3VGGA 1S5VA 4B9ZA 1W17A 1WZKA 1NWTA 1VHNA 1W9DM 4FNPA 4Q7NA 3O8AA 5HATA 1WZLA 3FJLA 4O0QA 3GLCA 2VVNA 4JTTA 2VZOA 4GNKB 3CZEA 4HK7A 3VDGA 1YTEA 2D0HA 4AYSA 4JTRA 4I7UA 3SJNA 3BMWA 5HXMA 3NGJA 3L67A 3TR9A 4Q8PA 4MZ8A 2GSHA 1MZHA 3DG7A 4P7NA 4UFLA 4DPPA 3UW6A 1ELSA 3LPFA 1OGBA 2GOUA 1XG3A 3OIHA 1DYSA 2V6AA 4CN4A 4X0NA 4XSLA 3S2NA 1V51A 2YDQA 1KM2A 4UTLA 2DZVA 3NQAA 3LSCA 4LSBA 5AC8A 1W3TA 1X6LA 4RW5A 4V33A 4PGLA 3EKGA 3HO8A 4WHBA 4D8AA 3C2RA 4AUBA 4GIEA 1Q6FA 1IWAA 3HGRA 3LMZA 5CAHA 5JBEA 3ZWSA 3IWPA 1K9EA 4NJGA 2DIKA 1CECA 2X8RA 2Z1BA 3HIJA 4KPLA 1LL7A 3EKZA 1T8QA 3NNTA 1K3UA 3RXZA 1B3XA 1C29A 2JFEX 2R1PA 5CBIA 4KESA 1PTDA 1A5UA 1V3JA 3BVJA 3KL3A 3OHMB 3LCIA 2VO5A 4I3GA 3ARZA 4LTSA 1ITUA 3KLLA 4X9YA 3T55A 3QGVA 2HE8A 4UQ9A 4C7DA 3MSDA 3S9YA 2ZWZA 2W92A 4AF0A 1SYTA 2CLKA 4AF0B 3RPDA 3GDRA 3APYA 5LXEA 4GFSA 3GTNA 2V63A 4IG2B 3PWGA 4JQ3A 2ADAA 3EX2A 4AZ7A 4JD4A 1CIUA 3L5MA 1KCKA 2HJPA 3W38A 5DXXA 5G2HA 3VAVA 1M68A 4R7OA 4ZE5A 5AC6A 3CEPA 2WOQA 1ICSA 4IF2A 5DMNA 3OW1A 3G3MA 4C6KA 3L23A 3PANA 2ZC8A 1UHVA 4L1GA 2G0WA 1SSGA 1PCKA 1VBHA 1B3OA 3PPHA 3AHYA 2VOTA 1TZ9A 1H61A 4UQBA 4IPNB 1P1XA 1ME9A 4BS0A 3LCLA 1RXOB 2G4JA 3DUGA 1FWTA 3UCDA 2QZRA 2WSRA 5C9UA 5LNWA 1TSIA 5CKSA 1JDAA 1W8GA 1GUVA 4V15A 4YHGA 1Z89A 4MAZA 2WSQA 3BLEA 3NFUA 2CBIA 3WQGA 3NQ7A 2V3EA 3QQ0A 2DIEA 1I45A 4JZ5A 2RJHA 4ZQMA 3UR2A 4DJEC 4KFPA 1CXIA 4OTKA 5CLWA 4HZMA 4QG6A 1RQEA 1KTBA 3SCWA 4J2PA 2ZIDA 4LGXA 1MVYA 4MNJA 4ADTA 3QMRA 3G2GA 4OV4A 3M5ZA 4LC8A 3N2CA 1HJUA 4WJ8A 3WJSA 2PAJA 4HHMA 3T08A 4Q7BA 1XD0A 2QS8A 3CUHA 1G69A 3DDMA 3L5LA 3BANA 1P7TB 4DB7A 4LEQA 4KWVA 1ZBKA 1AVAA 1MUWA 1J0IA 1V4YA 3D46A 1Q8JA 2YX0A 1XLEA 2W63A 2BHYA 2G5WA 2W91A 4CNSA 3GHSA 4QITA 2WCOA 3L9CA 5HJXA 7ODCA 5AFDA 3P60A 3LA4A 1FCQA 3JUGA 1QPOA 3E3HA 3RX2A 2E28A 2C1IA 2D73A 3KVJA 3O3RA 4AWTA 3GXTA 3TFXA 5MHBA 2WZEA 4KEZA 4MHBA 3WQVA 3CC1A 3M0ZA 4JFUA 5A94A 4J40A 1IZJA 5DLCA 2B7OA 1B0IA 3JR2A 1MNZA 2PFHA 1H0IA 2A2IA 4D6DA 3UCQA 3SQLA 2DT3A 4B5NA 2EKCA 3KBSA 4DF2A 1B5TA 4LF2A 1A5CA 1TR1A 3EWXA 2ZFAA 3OPSA 2E4TA 4M5PA 4MJZA 3W7MA 1OYCA 1RBLA 5AYZA 1QPQA 5EMLA 1K7EA 3CM4A 4L1XA 1WDWA 3NEHA 2XYLA 1C8QA 1BSIA 1R3VA 2WVUA 2X2GA 1KO0A 5I09A 1GOXA 1XW8A 3TCEA 4LJ3A 4M6UA 2WVVB 3B0YA 1MSSA 2F2HA 2PDFA 2J62A 3QBUA 4US5A 3N1AA 4PMOA 3KBUC 3W7QA 1V02A 1H3GA 5G5IA 4BK9A 1BTMA 1X96A 3WIJA 1E72M 3WLJA 3EMCA 4CU7A 3KE0A 4LRTA 4F4RA 3GO2A 1KFLA 4B5TA 4QHRA 1H5VA 1ZTVA 1R46A 2QEZA 2WZIA 4LUYA 3UY8A 1WAWA 4B4FA 1AQ0A 4IFKB 2FHBA 3LYEA 4ICMA 1IZKA 3VMOA 1OX6A 4NX5A 2FB3A 1GTHA 1BEUA 1SJAA 2VX6A 1R3WA 2PD9A 4Y9NA 4UOZA 1ZUAX 3CNYA 4JAWA 1MEIA 3NM1A 5TIMA 2PWHA 4LS0A 3NSMA 4N4QA 4GWEA 3K46A 1E0TA 3CPGA 3ONCA 3EDKA 1PHWA 1QJWA 2WW5A 2ZA3A 4M56A 4AIBA 4F48A 1R3SA 1J6OA 1QPRA 3QJAA 3U0HA 2JK2A 3HA1A 3PJTA 3GXIA 4S3FA 5EKYA 3LHVA 4UIOA 1VRAB 3ABQA 1ESWA 1R47A 3CUZA 1L6GA 1PPIA 2VX7A 8CGTA 1LJYA 2A3CA 3PTDA 2YLLA 2HV5A 1KBKA 2D22A 5D9MA 5CEWA 3DFPA 3VOGA 5ECVA 3VD7A 4CD4A 1HUVA 1W5QA 5BRBA 4R3UA 3TJ4A 4CUCA 2J27A 3ARTA 4ZVJA 3KLKA 3R94A 4UZUA 4U33A 5DBTA 1YEYA 4BQ3A 1GVFA 1JRBA 1X8CA 2IQTA 1AL7A 4Z1YA 3TNBA 3WNPA 1KFBA 2WHMA 4C60A 1XLDA 1ZL1A 3MV01 1VYRA 3MO7A 4MDPA 3P7YA 3BWWA 5LNSA 3APGA 4OUIA 1YNPA 5AZ1A 4M6QA 4TO8A 4EXAA 3G5EA 2ATSA 2PLMA 4HMCA 3GXMA 3AROA 1FTXA 1QWKA 1UR9A 1HJWA 3BAIA 3FAXA 1ONEA 2XH7A 2F61A 1EPXA 3BOLA 4H00A 4ATDA 1PAMA 1XUZA 3M0IA 5AVNA 2B0MA 1V6VA 1CI1A 3MDWA 2I14A 1E5JA 4K8GA 5FAGA 5H8MA 1I2RA 2BRPA 4U2YA 1V3MA 3GNXA 3W7RA 3K4WA 4ZO7A 5G1YA 3UXIA 3W73A 3W23A 2ISWA 1ZAHA 1BG4A 5DCDA 3DOPA 5IHRA 4O19A 1AH0A 3HGSA 2Y61A 3WMLA 2I17A 4D8OA 4JYDA 1XC6A 4ZOCA 1FCVA 2Q8ZA 4NAFB 4CCZA 1GG1A 2RJGA 4D9PA 2BVWA 2ANUA 1EZ2A 3NG3A 3TK7A 4NILA 1ONWA 3W7LA 3B8TA 2IPWA 3M5YA 4UOQA 5FJPA 5BMWA 4EKJA 1NWSA 2NQZA 3U9IA 2BTMA 1WE5A 1DORA 1NP0A 2ZUVA 3PN8A 3I3BA 4Q8QA 2DZSA 1XLBA 1X7FA 1QASA 3SUWA 3WLOA 1FXPA 3AOFA 3WD0A 3AFBA 1LBLA 1YX1A 1T99A 1AD4A 5D38A 4O13A 4IL2A 4H8HA 1KFKA 2C18A 2VHLA 2Z26A 1XPYA 4NZCA 2Z1VA 3NQ6A 4L9XA 2QR6A 5TF0A 1GHSA 4YVXA 1N8WA 3CBWA 2CIPA 1Q85A 1TIMA 3W1XA 2L5HA 3VOHA 3DBPA 1E0WA 1FCUA 3S6DA 3P5ZA 1WXYA 4IJCA 1L6YA 1KFEA 5KZMA 4JIPA 4B4HA 4HTYA 4XZLX 5CJ5A 3A4WA 4ZQPA 3VE9A 1B4EA 4JTGA 5DELA 3DHFA 2PODA 1EJ7L 4GGBA 4NJJA 1LF1A 3TA6A 3W86A 1T7LA 2OEJA 1HKJA 5FJJA 4CN1A 1EQCA 3QM3A 2X16A 2ZDRA 1G4PA 4MZ1A 2J77A 1F61A 3ZQ9A 2VQUA 4ROPA 3W53A 2FTWA 3TMQA 2R24A 2GJXA 2D3LA 2X30A 5A8GA 1I75A 4M0XA 3GC2A 1F73A 1OFRA 2ZBTA 4S39A 3W37A 1V93A 2HE5A 4JQ1A 3V0SA 1Z6KA 3T2PA 2V30A 3DESA 4HCLA 3CUJA 1KA9F 4JFWA 2QV5A 4O12A 4UTWC 3LZ5A 1KC7A 5B80A 4U2ZA 3ZT6A 4ECLA 1X7IA 2FHCA 2X09A 2VCAA 3S83A 1R5YA 2QUUA 5I03A 1UIPA 3CPRA 3LHWA 2GDUA 2WCAA 2QCMA 1ISVA 4R27A 4IIDA 4O52A 3MW7A 3LSBA 4IISA 2RH9A 2QAFA 3QR8A 3EA2A 1TTIA 3GG1A 7A3HA 1EJTC 2AMXA 4IOTA 1VLIA 1FVPA 2X40A 2CNCA 3HGJA 4QX4A 3E49A 1D9EA 3AS3A 4GY7A 1LLWA 3PQIA 2PP1A 3AZRA 3SCSA 5AHNA 1KWKA 3BAJA 1VEMA 1TPDA 1PIFA 5CSSA 5ABFA 2B7QA 1LQAA 4PBGA 4IJRA 7REQA 2CHNA 1UZHA 2GZXA 2LLEA 1XCXA 4Z0SA 4DI9A 3T7VA 3TYDA 2EKGA 1M9HA 1ICQA 1FDJA 3R7MA 1J0JA 4YTUA 6REQB 3MP4A 2INEA 1IV8A 3STGA 3M16A 1V02E 1F3EA 5FF7A 1R9ZA 4F8XA 1J0HA 1W5MA 3TV8A 4Z2KA 1RUSA 3EPNA 2HPMA 3QHOA 1US3A 3UQNA 4RUBA 3DFSA 4B5SA 1BKHA 4B3LA 4MMWA 4GVGA 3O9NA 2B7NA 4KCWA 4DRSA 5CZKA 4RPQA 3VOJA 3S4TA 3M5XA 4EE9A 1KCZA 3G6MA 3B06A 3AC0A 4L6HA 1SM9A 1DP0A 1LRQA 3O6AA 2Q01A 2XGIA 4BI6A 4UCFA 2YL9A 3IVSA 1EH9A 4U31A 4EANA 3QMSA 3VI2A 1KXVA 4LNCA 4PCFA 2QXWA 4EACA 3B8IA 3TYUA 3UBPC 1Z7AA 1OWQA 3DFNA 2C15A 3UZYA 1A3WA 1IYXA 4JIQA 1OCJA 1WA3A 1DJZA 1RWCA 3UJEA 5F2IA 2IXUA 1TWDA 1HKMA 1GG0A 2BHZA 1LWHA 2J8GA 5BU6A 5CGTA 4B15A 3BH4A 5JH2A 1NQ6A 2W62A 1UD8A 1W5NA 2YOCA 1KXQA 2PDHA 5ABGA 2PCEA 3TAKA 3BLKA 3TN5A 4S1FA 1ZFJA 2EG6A 2H8XA 1E6PA 4JEQA 5DX7A 3QPZA 2DUZA 4ASTA 1WDSA 3KVMA 3UT0A 4EPBC 4QM1A 2V3DA 1BKSA 3WDRA 3UD2A 4RXFA 1FWDC 2Q3OA 1FXQA 4S38A 4NRRA 2HBXA 2WJEA 4RKAA 2I9UA 3RCMA 3OVRA 1E6QM 1ECEA 3N2MA 4Z1BA 1H7PA 1FHDA 4Q8WA 1H2JA 5KEZA 4PTXA 2VTFA 2ASHA 2Z24A 2A7RA 4AMAA 3OVQA 4RDWA 4LUTA 4NUWA 4LUTB 3GSMA 2IXVA 1H0GA 3UD1A 3ARVA 3KDOA 4GRSA 2QPSA 4AC7C 2ZRVA 4HOWA 1EX1A 2Z1SA 1N7QA 3W1MA 2YZ5A 4ERGA 5BOOA 1SMDA 4DEFA 3TA9A 3CHCA 2DSZA 3KCLA 4E2DA 2OKOA 1R85A 1DPMA 1YE6A 4I9JA 4HPJA 1XLHA 5JIWA 1VRXA 1LLOA 2DDXA 1WZAA 2VCCA 3FJ6A 2KAUC 4JFTA 1YRRA 4YWSA 1BGAA 4J5NA 5FJIA 1YDOA 3TYEA 3EWDA 3W88A 3V5OA 1UJQA 6TAAA 5A2CA 3N29A 4LX4A 1L6WA 3UZ5A 4MNKA 2PLCA 2CKSA 3HMJG 1RPKA 2QUVA 3ZSTA 3AISA 4S3AA 2YXOA 4Y6GA 5LA0A 3SM0A 5FSEC 2JKPA 1M01A 2NXHA 1RCXB 4D72A 3SRDA 3TWBA 1GKQA 3W4RA 5HMFA 1P4CA 1V0LA 3PUEA 3QV6A 1D2KA 1AZ2A 4H9YA 4C5YA 1N82A 4XD5A 2A0NA 1MNSA 4HA4A 2MNRA 2QCEA 1C9WA 2OQHA 1IF2A 3CB3A 1OC6A 5I3KA 3MDUA 4GACA 3DFOA 3CAQA 3MSRA 4XBSA 4YPJA 1EA9C 4I7WA 1DXEA 2CLHA 5DY2A 3MKCA 3KBNA 4JTJA 1W9VA 2F6XA 3VIOA 5EFFA 3NQCA 3TSMA 5XIMA 3OODA 1W3YA 1QW8A 4JX6A 1VJZA 3W26A 1EXPA 5A6MA 3VNZA 1CGWA 2VZKB 3W7PA 2XWEA 2WSKA 5GPRA 5F2GA 4JKMA 2XFRA 3C2YA 2BOGX 1R9XA 1HGYA 2CXEA 1XIMA 4AHOA 4D8LA 3EX6A 4YNGA 2QF8A 1RWAA 5AECA 3KWSA 3BQ6A 2C0HA 2QCHA 1FWGC 4BF7A 1NQKA 1BTCA 4R7JA 3GTXA 2P0IA 4NG3A 3B8SA 3BDKA 3TONA 3LXCA 3ZJ8A 1XC4A 3H54A 1LP6A 3INPA 3VZYA 4H2CA 3TYAA 1AQMA 3T0TA 2CEQA 3DBNA 3UJFA 2JKAA 1TMHA 1IEWA 3B0PA 3PTKA 1YNYA 2GJPA 3OBAA 4JPGA 1GVQA 2V69A 1F8IA 2HCVA 5B7YA 4ZCWA 4JN7A 1Y5WA 2VUNA 4MYXA 1GPFA 2ZXQA 1EJVC 3N2OA 2R6OA 1RPXA 1MUMA 1XYFA 3GWQA 3AIRA 3QSTA 1RBAA 3N73A 2I9EA 1TCMA 1UROA 2ZC1A 1DHKA 3ES7A 4RCXA 1Q2RA 2PWGA 5CPMA 3ARYA 5FJTA 1ITQA 3RFAA 1AH4A 2Y89A 1TE6A 2ONEA 5AYIA 2QUTA 4GIYA 4NNAA 1KV5A 1G5AA 2PE4A 3THUA 3EX1A 5DFAA 2ZXAA 3AHXA 5AC5A 4J3SA 3LEPA 4AWUA 1J2WA 3ISIX 2XTKA 3P84A 3SAZA 3R0KA 2O92A 4F0LA 1FDZA 1B1YA 1HL9A 5HQEA 3DX5A 2IPFA 2Y8UA 3AJ7A 3GAYA 3IT6B 4FK9A 3QFWA 3NQEA 2NXGA 2TYSA 2EF9A 3SCQA 5H2ZA 4YHEA 1X1OA 3MHGA 5CJMA 3VZXA 1L6SA 4C6OA 3VUPA 3L2MA 4DJFC 1U2YA 4KQNA 2GVGA 4IPLA 3VC5A 3NZPA 2QCCA 3E2QA 4UFMA 4MKSA 4AIEA 5I3JA 3IIPA 1F3XA 2VP8A 1WKEA 1MI3A 2PDYA 3LNMA 1CGYA 1LOLA 4TVCA 1Q6GA 1XYBA 3WQDA 3QYQA 1CXEA 4DWSB 1K8YA 4WZHA 2CZFA 7XIMA 1K02A 3NVTA 1NFBA 2CLOA 3L4ZA 3TH6A 1OIMA 1TQXA 1F74A 4PMZA 1JNDA 2VFFA 1IEQA 3GR7A 5LNRA 1Q5MA 1UWIA 4H83A 4BY3A 3AQUA 4XKYA 1TZZA 3GVGA 2VZSA 1HP4A 3TC7A 4QE5A 1F76A 2QT3A 2NT0A 2YB4A 1S5TA 2PTZA 3FKKA 1YYAA 1MQRA 1X97A 4LVBA 1OEPA 2WLZA 3PPCA 2WSYA 5LNUA 1TPC1 2F8QA 1FUYA 2E6YA 4MM1A 3FOKA 3DI1A 3LRMA 3OVGA 4ZOEA 4LC6A 1XLFA 3UG3A 4L7ZA 3QOMA 3CV6A 4GJ1A 1Q63A 3WH9A 1WO2A 4L65A 3NSNA 1UA7A 1K4GA 4GYKA 3WLSA 3VIHA 3QRHA 3E0IA 3EWCA 4L5ZA 4HVXA 5BXSA 2QUMA 3ZWTA 2VYOA 1B9ZA 2PDJA 3OHIA 1CCWB 4LBSA 3S9ZA 1W1A1 2W61A 3HQNA 1QHZA 4ZOBA 1Z69A 3GIPA 3MYOA 2WO5A 5HQLA 3EEGA 3ABRA 2YW3A 3FA5A 2NWRA 5HUOA 2WQDA 2FZBA 2WCSA 2DH2A 3IGHX 2DZXA 3S5OA 4EX4A 4D1JA 1C90A 1XLKA 1N8IA 3OGSA 4M1BA 3W25A 4ZTYA 2Z7KA 1TG7A 2WMIA 3HG3A 2Z7GA 1PDYA 5A2AA 4CNOA 5E93A 5A5WA 1Y7VA 1OD8A 4W86A 1UG6A 3CL7A 3WK1A 2D2GA 2OZ0A 4J3TA 3IJ7A 4IMDA 2J8TA 3UYCA 1DWJM 1FCBA 3R79A 3PJWA 4U28A 2VRQA 5D8ZA 1T8XA 3B0VC 5K2ZA 2GUUA 1I60A 1KTCA 2YFOA 2VGBA 3CZKA 2W0UA 5IOBA 1I6NA 4BA0A 5DCBA 4RR4A 2Y5JA 2Z6JA 4XBJA 1UQZA 5IHSA 3LK6A 1NH6A 3VX1A 4I8YA 3LB0A 3GDTA 2NQLA 1S5WA 1UMYA 1K77A 3W7HA 1GEHA 4WOQA 1F4AA 1QHPA 1GOOA 3VGHA 3WF3A 4KT2A 2ACQA 4IUOA 3STEA 3U5UA 1H7XA 3H8AA 4DJED 3LTPA 2RDTA 4TMBA 4WVXA 3DZ1A 4UCGA 2D0GA 2ESCA 1RV8A 4ADSA 3H2MA 4Q4MA 3NQ2A 4IUGA 4KEUA 3S9IA 1W9UA 5D02A 4C1LA 1S39A 3TJXA 4FNTA 3CJPA 3LN3A 2PDKA 3KOWA 1IR1A 1KR1A 2YYUA 1YTDA 5IFTA 2JALA 4GH1A 4LFYA 3VCNA 4Q4PA 1U1JA 4IGMA 4ZTXA 4IGSA 2E9BA 3TZNA 2VL4A 2OLHA 1R87A 1R9YA 4CD5A 1L2UA 3OYZA 2E5CA 3P0XA 4ZQCA 3REQA 5HAOA 1ZP4A 1UD6A 4KCTA 4FNQA 2FVMA 2OMAA 3GNNA 1GOKA 2J79A 2FDSA 3URBA 1LBMA 2YR1A 2O9TA 4JYFA 4ZR8A 4HB7A 5D2XA 3WN6A 3ANVA 1LUCA 5D37A 2E40A 5IXEA 4IPPA 4W87A 2XIJA 1PKMA 2VFHA 2DVXA 4R7WA 3XIMA 3MCOA 5ENLA 2WZTA 2ACUA 1JR1A 4GQRA 4UR9A 1IXNA 4DJEA 2PDBA 3VOFA 1K6AA 4WX2A 1UKSA 3V75A 3WLRA 1GW9A 3IEBA 1R2SA 2E09A 3THCA 3IJQA 3S5ZA 3WBWA 4E4PA 1DIDA 3TIMA 1KV8A 4DZIA 4HCDA 3W71A 3QEZA 1BF2A 3T4WA 3PZVA 1Q6RA 3MI6A 1QI4A 3L2LA 1H11A 2W67A 2V3FA 2TRSA 2FH8A 2YDRA 1F4HA 4JGDA 1PKYA 1R86A 1DIOA 1O7AA 3IJ6A 2P8BA 3M5VA 2Z4GA 1TPH1 2ABAA 3EOSA 4JR5A 2H3BA 3VOCA 1J2BA 2WHKA 1XP3A 1W91A 2ATMA 3PZMA 1Z42A 2NT1A 4M81A 3MHFA 1J9YA 4XZ9A 2TMDA 5AHEA 4C65A 1PTGA 5AB3A 4WY0B 4OUEA 1ISZA 1TTJA 3FW6A 1ZP3A 1JCTA 4HT3A 4O11A 1NAL1 3VMNA 3EA3A 2WZHA 5D05A 1E0UA 3A5VA 4HTBA 3YPIA 4AB4A 4E2BA 4NP7A 3W1UA 1O5QA 5LHEA 1YXCA 3LMYA 1UUQA 4FF7A 2AQVA 3OJGA 3ZT5A 4LCRA 4FXJA 4PTWA 3ZXWA 3WMBA 4LY4A 4Y9PA 2YL8A 2JIEA 1A4MA 1UWSA 3BK0A 4ERIA 1MDLA 1BXBA 1H4PA 2WC7A 3KAOA 1NDVA 2QF7A 3GTIA 2E22A 2WJDA 1MXDA 2PGWA 3MI3A 4LH8A 1HKIA 3WF1A 4F2TA 3WMSA 4ILSA 4MY8A 4GUGA 3GXNA 3BOFA 4LB3A 5AKQA 4F66A 4FZIA 3CHFA 3WDHA 3SCUA 3S5SA 3QR3A 5HUPA 1M04A 3OO2A 4C91A 4F79A 1EEPA 3L0KA 2NQ5A 3W6LA 1Q6CA 3FIGA 1N7RA 1DWFM 3CQ0A 4JIIX 2E8ZA 3CTLA 1JDDA 1KFJA 3PSWA 3NQMA 1XS2A 1GQJA 5CBBA 2AQOA 2ACRA 3FGCA 2GSEA 4FP1A 2CC0A 3IAQA 4KRZA 3CAVA 2WMHA 3AZTA 2X7WA 5PTDA 3N9RA 3WH6A 2YDSA 3CH0A 4MLRA 1BAGA 3B9NA 1LL6A 3TQ0A 4LNYA 1IEIA 3ARPA 4GGHA 4LVFA 5EMUA 5FEWA 4DUVA 2H90A 1ONXA 3VMPA 4J3ZA 3RILA 4GC3A 3QW3A 4NHVA 4Q8UA 4UBPC 4NJIA 4FI4A 5IRPA 2C1HA 1P7TA 4RZ5A 1IXOA 3IUHA 2Y4SA 3Q37A 3LTSA 1J8VA 3R4IA 4J35A 1QNPA 3FCPA 3UXLA 3KTCA 2P5NA 4JX4A 1VGAA 4K36A 5DQPA 3S46A 2HNEA 4UQAA 3S6OA 3CQJA 2BSLA 1SPQA 2OLSA 5BU9A 4CNNA 1A0DA 4FR6A 1E70M 2QCLA 1CW2A 3DKLA 1EOMA 3LZ3A 3MB9A 4KS0A 2OKTA 5G2WA 4AZCA 3SRHA 1XLCA 2OB3A 5LNVA 3OLDA 3GTHA 5CZ0A 4FOUA 3LV6A 4MWAB 6ENLA 2XUCA 2PWFA 1JUBA 1M7XA 1WAUA 4DZHA 2E25A 2HVOA 4IP7A 4PMVA 1W3NA 1UKOA 1DE6A 1C3FA 4HP5A 3JRKA 4V1XA 3W81A 4K8EA 4MWAE 4GO9A 2X0HA 5JUVA 4MTVA 4JEJA 4W7UA 3SQSA 1FBAA 3M7WA 4PH6A 3L4WA 2C0AA 4HCHA 6XIAA 3LCWA 3GKFA 1HXJA 3KS6A 3FYYA 5HNUA 3FHQA 4XAZA 4DJFA 5AHFA 4CNTA 3BV7A 3IUDA 4HHLA 3G77A 3QLDA 1FHLA 4HU0A 3A9BA 1FH7A 5HA7A 4UTUA 2G97A 3F4WA 1V6XA 1E1CA 5CPOA 3DI0A 4EP8C 4W7WA 4MB4A 3RO6A 3LG3A 2OEKA 1TUFA 3ARXA 4MWAD 1KBLA 2DIJA 5A8QA 3M0JA 4HSHA 1CB2A 4WY0F 3HZ3A 1BRLA 2YZRA 3SUUA 1VFLA 3STPA 3PNZA 2R91A 3NDYA 4BI5A 1SSDA 2OO0A 4CN6A 4OIFA 3D6NA 3DN5A 2ZZ2A 4MPKA 1J0YA 2CCRA 1S2UA 4URIA 4PRRA 2OELA 1EL3A 2PTXA 1LUCB 3PP7A 3EOLA 1XINA 2PTDA 3W29A 3NURA 4YMZA 2MANA 1TO3A 2YEPF 1CXHA 5D2TA 2OX4A 3QH2A 1W3KA 3PUOA 3PZ9A 4XBKA 4XZWA 3RRAA 1SZFA 1DBTA 5KITA 1TWIA 1TIWA 2NVAA 5A95A 1HF6A 3FFSA 3V35A 5CSRA 5KMYA 4PL1A 2W6RA 1I2QA 4FALA 2OGYA 5LGXA 4NJKA 3PC0A 4IM4A 4ZQOA 5C7HA 3BAWA 1QO5A 3KOZA 2J13A 3IPWA 2J74A 3S2MA 3N4FA 3UZJA 1PVNA 3ARSA 5FF3A 1ME8A 3TJLA 1F5ZA 4HBKA 1P6CA 4FIQA 4C6NA 4F9DA 1SUXA 3TN6A 2HXTA 2BMBA 2XIMA 4X60A 3GVWA 3B0XA 3NM3A 5DN1A 4N42A 4IMGA 3G1DA 1Q6DA 2V38A 3FSUA 2B4GA 2A1YA 1RAKA 4P7OA 3EOUA 2I7GA 2ZX7A 1D7KA 1JGMA 4WD0A 4BR1A 4H8UA 1WNOA 2NWSA 4HJWA 1OJPA 3ZLGA 1DQXA 1L8NA 1E56A 1S1PA 1YE4A 2UY2A 3AS0A 5C9RA 4NJHA 5HDRA 4RNJA 2PDLA 2ALRA 4GYPC 4OOUA 5CC3A 4Q22A 2J75A 1VIWA 1XH2A 3VM7A 3ATYA 2A5HA 5AC7A 3N18A 1EGVA 4MY9A 4NNCA 3TJIA 2VEIA 4EXQA 1R6WA 2I5GA 1XYAA 1NOFA 5DO8A 3QV7A 3TYZA 2ZRWA 5BXPA 4DAIA 2GJRA 5H8UA 1QK0A 1CYGA 4UTHA 4JTUA 2BX7A 3MCNA 1LLQA 4RZBA 2VENA 2V4IB 4HZ7A 1QOPA 1ADSA 3GW3A 3PBYA 2GVJA 3WDJA 1JUKA 2J9YA 3SDOA 1JQVA 5D33A 1WOAA 1SO5A 1HM3A 3VNDA 2ZXBA 1LQ0A 4HNLA 4NZFA 2GJLA 1BG9A 4U4MA 1RY8A 1EQPA 1PUDA 4UOJA 3TSBA 3RU8X 5D2WA 3M43A 2KXSA 3ITVA 3URNA 1IWBA 4A8NA 4GZEA 2P1FA 2JE8A 3POCA 2BGSA 2Y5EA 3TUUA 2QVNA 5HMEA 4QG9A 1QATA 1F7BA 1RD6A 5FL1A 1T41A 2YCEA 4I6VA 3NZ1A 1P5BA 2VFGA 2CLPA 2C13A 2VDHA 3VNJA 1BYAA 4S23A 1JXKA 3ITCA 1NARA 5L6UA 4IZGA 2E68A 3TYBA 3UG5A 4B92A 2CFFA 1ZBVA 1E43A 1LRNA 1TRDA 3STFA 1BWLA 2FMNA 4E38A 4Q6JA 2OFJA 3CV2A 4Y9OA 3HGOA 4IH3A 3NPXA 2WAGA 1C92A 2VZKD 2PS2A 3CZLA 5T26A 4GYFA 1XSIA 4H41A 1IEVA 2VDGA 5K9DA 4AX7A 2Q02A 4IIBA 4R5EA 4KETA 3VKBA 2FVLA 4GOAA 4PTVA 4UFKA 1LOHA 1GVRA 3SUTA 1OIFA 4RPPA 3NXLA 3LTYA 1OFOA 3HG4A 3M0HA 2E24A 5LXXA 2VR4A 4LU0A 3N14A 3O0FA 3VVGA 5JQ9A 3KFTA 2ZRUA 5BOEA 4BWLC 4LF1A 3VIIA 4NZJA 2E77A 5LKYA 4OBRA 4TX6A 5E6YA 3T07A 2WPGA 3IUIA 4DZ5A 1UWAA 3UWYA 3L65A 2BP1A 2D20A 5C70A 1R38A 3D47A 2XVNA 3R0UA 1FWHC 4INFA 2VVSA 1U30A 4AU0A 5CQ1A 3AXXA 2PRHA 1ZY9A 1TREA 1HTIA 4IX0A 2QULA 2QDGA 4YTTA 4DXVA 1RLCL 2NUYA 1P6BA 7ENLA 2BFGA 2ACSA 2FGBA 4EPDC 3TMLA 1OZMA 3SGUA 1SZNA 3LLFA 1XBVA 1OCBA 3P82A 3WLNA 1U5HA 1VBRA 4B5XA 1UPMB 3PBUA 1XGZA 2Z00A 3GH5A 5K7JA 2ZZ7A 1VYPX 3HG2A 4N0RA 3VUSA 1GORA 1MMFA 1QW7A 1ZRQA 2FFIA 3MUCA 4LUJA 2XVKA 2OSXA 3P3BA 3AXHA 4MDOA 3S3GA 3C8NA 1K4HA 3SFKA 2ZQ0A 1VBGA 3GC4A 1N2VA 3GG8A 1FDYA 4X63A 4LUIA 1O6IA 1XBYA 2J66A 1QHOA 1EB3A 1O12A 2O9RA 5FEZA 3NTYA 3T78A 4IPJA 3P80A 3TXVA 4XX6A 1F6KA 3CYVA 4HPGA 4A3HA 3P2VA 2EPNA 4W5ZA 2W79A 2GVYA 2NQHA 1V7AA 5F2LA 4BF9A 3II1A 1UWTA 3KBJA 3TLLA 4L9ZA 2CHRA 3RR4A 4MB3A 1IWPA 2PTWA 3R5EA 2QLYA 2FDMA 3FKRA 4UC5A 4QXIA 5A1AA 3VIFA 1WXZA 2WWDA 3CUXA 1QNOA 4A3QA 3ME3A 3CWOX 4AZ6A 1Q13A 1P6WA 4K2SA 1RJRA 3GXPA 4WKHA 3TW6A 3GVRA 4GXWA 4LWWA 3M0YA 4U5IA 1HKKA 1IXPA 3T0DA 4KWUA 1JCNA 1VJIA 2G4FA 4P8WA 1XFBA 2RDXA 4J1OA 4DIAA 2ZZ3A 3H4GA 4IQJA 2VR2A 3AIUA 3MU7A 3WJWA 1FY6A 2RFGA 2ALDA 1WQ5A 4DLOA 4HKPA 4QG8A 4AXNA 3LCGA 3U5YA 1ODZA 1M7JA 3QZAA 2V5BA 3WY1A 5KTLA 1G4TA 2EPMX 1LM1A 1J93A 5DXYA 4IP5A 2VM8A 2OT0A 4ZSUA 4O0ZA 1RLDA 4KEVA 4ADUA 3C4UA 1LDCA 2E67A 3OP2A 5LGZA 3W1PA 3ZJKA 4O1BA 3KDNA 3KL0A 3OZPA 1XD1A 1CEOA 3L5AA 2Q09A 5M03A 3BV4A 3QZEA 3BUVA 3BW2A 1GJWA 4QJ1A 3TKFA 3BW4A 3OZYA 3PHAA 2GL5A 1RH9A 1QPNA 4IGHA 1FP9A 2WHLA 5XINA 3VIJA 2GK1B 3GRIA 5A69A 3IAPA 1C91A 3AHZA 4DWSC 1XX1A 3H7RA 3IK2A 4UTKA 3FAWA 1HN1A 1NELA 3M6YA 1KRAC 3WEZA 2BV9A 4HPXA 3UCCA 3PTMA 2BZNA 3PR2A 1UKQA 2NLYA 1DWAM 4ENLA 4TMCA 4PB5A 4KIEA 3KCOA 3RJXA 1A53A 2W9MA 2OO6A 5F1VA 2E5BA 2F7FA 4F0RA 4MFDA 1B2YA 3PG8A 2AAMA 1J6PA 4J3VA 3SFWA 1W32A 1XH1A 1QK2A 1F07A 1OFPA 3W2JA 3RMJA 3G8RA 1P0DA 4YYFA 5E1QA 1KM6A 1TVNA 1NFPA 1VB9A 4G7EB 2VC9A 5CPSA 4M51A 3PUDA 3WUEA 1TFVA 3EA1A 5BXTA 5LIUX 4PBEA 3O2LA 2ZUTA 4HQVA 4GQBA 3M0VA 3WUFA 1XWYA 1XYLA 3EX4A 4CCEA 4LOCA 3WQOA 4MIMA 4GCAA 1SFSA 1ALDA 2ZX9A 3LY0A 3GVVA 3M44A 1K7FA 5AZ0A 2VX4A 1GYMA 1TWWA 1YBQA 1B31A 4GI6A 4ZO8A 1V8EA 3BG5A 3N9SA 3A4AA 4Z2IA 1XBXA 5FJOA 1MEHA 6REQA 2C79A 4LAKA 5E0KA 4DO4A 1E0VA 1NJJA 5IBXC 5I78A 4ROQA 1RA0A 4QS6A 3PZQA 2QCDB 4W93A 4O8AA 2OYKA 3G24A 3W6YA 1W6TA 3QMTA 4REQB 4PA8A 1EWEA 1LTDA 3GDKA 4FA3A 3E0LA 4GJIA 3COTA 3UZXA 3G6LA 2R1NA 4PMXA 3LPOA 2I5QA 3F5LA 3PWAA 1BRLB 1EBHA 3TP4A 1SW0A 3EAUA 2DPEA 3HMCA 1EUAA 3H2AA 1RJQA 2GK1A 3S0CA 2QV4A 1GONA 4OHQA 4DYEA 1YHTA 2R94A 3ARRA 3T9PA 4NVTA 1ZNNA 1A49A 3HPXA 1UC4A 1A47A 1ZAIA 3MP3A 3A23A 4GMEA 4EPKA 3QXBA 5D32A 1H7OA 5DRIA 5HR6A 4H9VA 4DXKA 3OTRA 4QLKA 4IGNA 3CAKA 4DYJA 3SRFA 2EBNA 1AFSA 4N9CA 4ZQRA 3I3DA 3ALFA 3NCOA 2NSOA 5I3DA 2QJIA 3SGGA 3TQKA 3HJEA 3A3WA 1B9BA 3W82A 3OYXA 2GFTA 5CGMA 4ES4A 5SWUA 3L12A 3NPWA 4J28A 3MUY1 1SU5A 3BCDA 5CH9A 4RDZA 2WNWA 4PFMA 4HNNA 1E9IA 4FXRA 1M53A 2XIOA 1W5PA 4ZL1A 4BF5A 3OG2A 2ZX5A 3SECA 4B5UA 1V5XA 1OX4A 1IGSA 1I4NA 1UOKA 3PUGA 4MWAA 1OJOA 2Y88A 4GKLA 1JGIA 2X2YA 3WFZA 3QC0A 3EDFA 3N6QA 4C6CA 1JAEA 1FKWA 3N3TA 2W5FA 2BY3A 1ZBWA 4XAGA 4NI3A 2FJUB 2J47A 4QEEA 5LIXX 5CZSA 1H1ZA 3PBMA 3VYLA 1H09A 4J3UA 4XK2A 5A8NA 7PTDA 4JHMA 1PHQA 2QJJA 2OCZA 4K7VA 5I07A 2PP0A 3ZLHA 1HM2A 2V81A 3UR7A 4BFAA 3SB0A 4D71A 2RHGA 2A7PA 4TTUA 1VCGA 3C61A 3P81A 3SCNA 4Y7EA 3TQVA 1CGVA 1VFTA 2WXDM 4LUSA 2J7CA 2VNCA 2CHOA 4UFIA 4BHYA 4AEEA 3AMKA 4XG1A 3E0WA 3K1DA 3KXQA 1VBUA 4JDBA 2Y62A 3EXSA 4G1NA 1YLVA 3R11A 4C6IA 3GX9A 1RALA 3N4EA 5DMYA 2GJXB 1RP9A 2C14A 2JGYA 5REQA 2G41A 1BYCA 3H21A 3ES8A 3BLOA 2JF6A 1EP3A 1WBHA 3TSDA 2H8ZA 4XWUA 2QJNA 3CMFA 4JCMA 1GTEA 4HIBA 4UWMA 3GB6A 2C71A 1IIGA 2CW6A 4ZB0A 4DBUA 2FPVA 2X41A 1GVIA 4H19A 1RCQA 4G8TA 4NSBA 2BOEX 1WDPA 2A79A 4DJDD 3P14A 4AIOA 5G1TA 2NX1A 1TYGA 4HHHA 2EPOA 4ICCX 2F2KA 3ONBA 1G01A 2CZ5A 4XIAA 1W1IE 4L4LA 2PDQA 4JXCA 3FN9A 5KZDA 4ZXLA 4GQ0A 1R0MA 2A4AA 2CETA 1OF8A 3KOXA 3Q2DA 1A5OC 1HJVA 1X39A 1BSLA 1JCLA 4X0VA 1H49A 4WGXA 3O6DA 5I02A 3OA3A 2D1ZA 2VDIA 3VIGA 4AMCA 3VK5A 3B03A 3BW3A 2A3HA 3MJYA 3SY1A 1X1ZA 3BGGA 2H3DA 3N6JA 4RZ4A 4CD7A 2Q1FA 1OJNA 2P3EA 2YFNA 3O7UA 2WKLA 4K8HA 4MVAA 1VR6A 5FSDC 1MFVA 3WYZA 4OT7A 2EG7A 4QAIA 2QIWA 3SQMA 4LALA 1TWSA 2HSAA 2Z1KA 4RE4A 5C54A 5FESA 3DYMA 5TBOA 4GUHA 4LAZA 1ZSXA 3CUIA 1EF3A 4N9DA 4L4MA 3FS2A 2WJZA 1TJ0A 4FXSA 4PE8A 1RA5A 3W7IA 1MFUA 2XU2A 3QKEA 1LXKA 4A2SA 2BXVA 3IJLA 4Z2LA 3QTPA 1SZEA 3N12A 3SEPA 1VPYA 3NOYA 1DOSA 1ZJIA 5BXRA 1JRCA 3A4JA 4D2JA 3V0UA 2D23A 3HN3A 3GFZA 3MUXA 1TB3A 3TE9A 4Q8MA 1XIGA 5H6HA 1M1BA 1GHRA 1AQFA 3XISA 2CBVA 1O4UA 2IKJA 2KZHA 2BY1A 1GKRA 1QNQA 4YIWA 1H63A 1PXGA 3MMTA 3OGVA 2J4GA 3BAXA 1Z3NA 4BI7A 3TTQA 1QBAA 2GGIA 3LCHA 4FAMA 1WZMA 3GYEA 3UF9A 5BOFA 5FF0A 3MYPA 3H2CA 4LBRA 2FB2A 2EEXA 4G6CA 4K6AA 3W1NA 1HJQA 1C7TA 4D6IA 2BHUA 3KUMA 5ABTA 1TA3A 2PMQA 2AQWA 4LXFA 4HU8A 3P6LA 3TN3A 4Q4OA 4DELA 1YDYA 2OWXA 1VFOA 1CLKA 4KKXA 2E6DA 3UP8A 2VEFA 3AUJA 4JTLA 3UNDA 4ZFMA 1SJCA 4R85A 1S3HA 1JZ7A 5BROA 2C6QA 3I6RA 1B4KA 2X03A 4F3HA 3MHUA 2NQ9A 3ELFA 4GD0A 3PF3A 3H2EA 3V0TA 1EJXC 5A3HA 2WM1A 4PMYA 1Y8BA 4DM2A 2A3LA 1QDSA 3ITYA 4HOZA 1E0XA 3BG3A 4HA1A 4RV3A 1CB8A 3UJSA 2AMGA 1XLLA 4CVUA 3NL2A 3SADA 1LROA 3TR2A 2DW7A 3WQ8A 1C82A 1UH2A 4PFHA 4Q8TA 3M7SA 4ZBCA 3LD5A 1OINA 4KCVA 1QU4A 4X2PA 1QI3A 3PY2A 2XZ9A 3N3MA 5HWJA 4RE2A 3E0FA 3TTSA 1JCJA 1PTAA 1U33A 2NQJA 4PUKA 2G3FA 3GUGA 4PEKA 3I6TA 4WQ6A 1S2WA 5REQB 5J8LA 3W7NA 5BWFA 3RR1A 1EUNA 2R9RA 3KTXA 2ZRYA 3GHUA 4DO6A 4S3EA 4AHQA 3TX9A 2BLEA 4QNEA 4DLMA 3PS7A 3SGZA 4N4PA 1Y5VA 4P8VA 1S38A 3GG7A 1LOSA 3KCJA 5F1UA 5I7GA 4FXFA 1DEDA 3IGUA 3AHVA 5AC4A 3GBEA 3S5YA 2AL2B 3CV7A 3P67A 1HMWA 5I3HA 4A4AA 4YU1A 2WM0A 4HNOA 1GGOA 2A3EA 1XSJA 3PZTA 4N6EA 3VD4A 1TA3B 1SFJA 1B57A 3NDZA 1DJYA 1O5RA 3W72A 3RDKA 3B3DA 1UBSA 1UJPA 1TV2A 2XVGA 2IUZA 2YCJA 3A9IA 1KRCC 4XIMA 3W9ZA 3R6IA 2PDGA 2HWGA 3VNLA 3T44A 5M2FX 1AG1O 2QGHA 1UR0A 1U1UA 3TVAA 2HVNA 3W2LA 3NL3A 3KHDA 4NYYA 4FS9A 3UY7A 5BRQA 3LX9A 3GFYA 2O9OA 3UWEA 4C7FA 2HMCA 3IRSA 4XSMA 3UXKA 3PSVA 1O0SA 1WBJA 3QPYA 3I4KA 4O57A 1OFQA 3T05A 1W3JA 2O4QA 5A8MA 3TC6A 3RAOA 4E8DA 3JW7A 1GW1A 3VABA 3LGEA 4HJFA 3JU2A 4H1ZA 2NSXA 1DJWA 1UR2A 3B8VA 4WK9A 3W85A 5C71A 5I79A 3UZWA 4JS3A 1KR0A 3WLTA 1D7FA 3H22A 4TXEA 3M0XA 3WO8A 1Q3NA 2P0OA 5GNYA 2F38A 2E7FA 2CLIA 2YA2A 4OOZA 5GJMA 3E2VA 4YYCA 2POZA 2FQIA 3W1LA 4XKMA 4J3WA 1A5LC 5DF0A 1JPKA 1JCYA 2DP3A 3T8LA 1RW9A 1P0NA 1Q6OA 3RF9A 3ZFHA 4M3PA 2DQXA 2Y0FA 5FL0A 4JTQA 4S3BA 2GWGA 1TUXA 1JDEA 5CJNA 1NSJA 1NP2A 3ALGA 4JICA 1H7NA 3JZEA 3QQWA 2Q8XA 1AZ1A 4OFCA 2I16A 3CL6A 1OT2A 3HFTA 4EAYA 3DFQA 3E6EA 3FEMA 4G2DA 3NVDA 3C2VA 1JD9A 1FWWA 2NUXA 4OWGA 3ITTA 3WD2A 1ADDA 3KRZA 3T0AA 2OYMA 4GI9A 4K1GA 4AY1A 2GGHA 1JEZA 1PZ1A 1E4NA 3HV8A 3EDEA 1KLYA 1V6WA 3WQ5A 5I0DA 4E3VA 3ZS4A 1VFFA 4H8NA 2XN1A 4RDVA 1B3VA 1GVYA 2HS6A 3F5KA 3UWVA 4IMEA 2EPKX 4FNRA 3G1XA 3MZNA 3M6DA 1O68A 2D2OA 1L0PA 1QMLA 3EWYA 2OOFA 4KW2A 5FCZA 1LZOA 1KKOA 2AGKA 4Z2GA 3UVIA 4RDYA 2YKKA 3GDMA 4NI8A 1GCYA 4RNHA 2XIQA 4GQQA 1UIOA 3VD5A 2V5CA 6PTDA 3GVQA 5KZ6A 3T6CA 1LOQA 1GJUA 4J2MA 4ML4A 4F2BA 5D30A 1CXLA 1QNVA 2E6AA 1EC8A 1OG0A 1XI3A 1SZRA 2FZMA 4IIFA 2VC5A 2OSYA 1PKNA 4QLJA 1UMLA 4GKTA 4H2HA 2HVMA 2J7FA 5K9CA 3AS1A 2ZADA 2ZCGA 1TJ2A 4JY9A 3RLHA 3O6CA 1X6UA 3SY8A 3NEVA 1HJXA 4QJ5B 2VURA 2YXGA 2X05A 4WUIA 2ZWYA 2EXOA 2Z28A 4DNHA 3NYZA 1BF6A 3DG3A 3S5NA 1V3HA 3PAJA 4AXKA 2QNEA 1ECQA 1HKWA 2CBUA 4L6DA 1HO4A 3AZSA 2CITA 2V2DA 3RJYA 3UG4A 2JF7A 1QT1A 3HOJA 2FFCA 1VZWA 3KZPA 3FDKA 1GYNA 1UYQA 4IFRA 3TC3A 1OFEA 3TW7A 2DSVA 3M47A 4QIUA 3QY8A 4HK6A 4UTIA 5BMXA 3UESA 3FGCB 1G94A 1JDFA 5EL1A 4Q3MA 2ZKMX 2W66A 4YVPA 1EFZA 2EGZA 2O7SA 2XH0A 1K9DA 5AYYA 1JIBA 1S2CA 2PDNA 1KGUA 4HPHA 1V0MA 3IT4B 1D3HA 3SRKA 3GZAA 3CU2A 1TJPA 3ORWA 1O60A 2HROA 1SJBA 3O63A 3FYPA 2V8ZA 1EBGA 2HXUA 2KX9A 3UWWA 3QGAC 3AXIA 4M24A 2ZVIA 1X1JA 4YTQA 8A3HA 1XQKA 4HNUA 1XJBA 1SO6A 5T9BG 3W7KA 4R88A 5A8OA 1SW3A 3C0JA 5RUBA 4WSKA 1F3WA 1LXMA 4QNWA 2DT0A 2OWWA 1X38A 2HK0A 3WNKA 3VKKA 4X22A 1BVZA 1BD0A 5BYWA 5HWNA 5JMUA 3RCYA 4QISA 2Y7GA 3GS6A 1K9FA 1LL4A 3JVAA 4P8XA 1NEYA 5C2XA 1Z8AA 1XIDA 2WKGA 4XTDA 3LENA 1W31A 2ZX6A 1KW1A 2ABBA 3H2FA 1EYEA 4HMEA 3T1GA 4RXGA 3CTTA 3FV9A 3FA4A 1A4LA 4MB5A 3C2FA 4QAWA 4UUIA 4G56A 1TVLA 3AJXA 1A3XA 5DBUA 4PSPA 2DT1A 3GR8A 4V2XA 5HNNA 5FKYA 3S2JA 4J9JA 3HM7A 3EPOA 4HN4A 1CXKA 1Q45A 4QQ3A 1DL3A 1E6NA 3H6OA 4UTWA 3LHTA 2P76A 2NVDA 4J7RA 3LXBA 1QPKA 3Q65A 1JNEA 3UEQA 4H6KA 4PBFA 4PUUA 1V0KA 1S46A 3G1YA 2GGJA 1GQIA 3AIQA 1TV4A 1XYCA 2G8ZA 4C5ZA 1O1ZA 2VGGA 4JL2A 4FO4A 4QJ3B 4CVWA 4LB4A 1VP5A 4C6FA 3UXAA 3FVMA 4DJFD 4KGJA 2DU2A 2RDWA 1OVDA 5H8PA 3OLEA 3KL5A 1IQ8A 1POJA 1CXFA 1UZ4A 3CUFA 2ISDA 4W88A 3POHA 2P50A 4AX6A 2QPUA 1EDGA 3P0WA 3T8QA 4GABA 1AJ2A 2I1OA 4JHZA 3T2OA 1W3HA 1GJPA 2QKFA 3M0MA 3QFEA 2IKGA 5HNTA 1G4EA 1V6UA 5A6KA 1CWYA 2HBVA 3S8HA 2BS9A 3ARWA 3VD3A 2WWCA 1JZ2A 1W54A 4JN8A 4NU7A 1JULA 1BXNA 1EO7A 1JZ3A 3DERA 5D03A 1UD3A 5JBFA 3RITA 1ISWA 5I3GA 1B3ZA 5FJUA 3WMCA 1DKWA 1WUEA 3EB4A 5AYBA 1OGSA 4TR9A 3SCVA 3RM9A 2FZDA 1EWDA 3G0SA 1XFCA 1FOBA 1TX0A 4DX3A 2X0SA 3EMQA 4V28A 4B9YA 3C0QA 1VAHA 2BRWA 4BWLA 1ZU8A 2OJPA 4I9AA 4FIRA 4XAFA 2H9AA 3PPGA 4MLJA 3SCPA 2VUYA 1KFWA 3VX0A 5LIYX 3FHAA 4AEOA 4CD6A 4CQ9A 3IRDA 1O95A 3K2GA 2E6FA 4AD0A 1A5SA 4US5D 2C16A 1MO0A 2QDEA 4PUWA 1MZRA 4WKAA 5F4XA 3A64A 2O0TA 2JKEA 1I8QA 2INZA 3N17A 5IFPA 2ZDSA 1JPDX 4Z1CA 3VKJA 4A29A 4WSHA 1NDWA 1UA3A 2QYGA 4HK5A 2DORA 2FPTA 4H9MA 3PTQA 3VIMA 5JVLA 2BASA 4BKNA 3W87A 4QEHA 3BC9A 1N7NA 3MO4A 3GU2A 3W1TA 3A24A 1FQ0A 1JUEA 3FXGA 3E02A 3O6YX 4JKLA 1W37A 3MT1A 1EX5A 1FX6A 4GVFA 3ABOA 1AW2A 1BWKA 2X1SA 4O50A 4I5UA 1A5NC 4U5KA 4N9BA 1N8FA 2YXXA 3CH9A 2INFA 2Y63A 1F9GA 1NVMA 1FWEC 4QBXA 1M65A 3TEVA 3BJTA 2EHHA 1RD5A 1A3HA 3EWWA 4PUJA 3PVFA 5EBAA 2NV9A 3H53A 4EF9A 3THAA 2IPGA 3CV1A 3DGRA 5HULA 4GXPA 4JIRA 3R8RA 3S1UA 1CLVA 3W28A 3B0UX 3E12A 4O18A 4Q8NA 3F2CA 4RE0A 1W3LA 4JQAA 3F2BA 4DWSA 2CWNA 3R8GA 1XG4A 3CWHA 1EP2A 1EC7A 2WSPA 2VJXA 3ITGA 1VKFA 9XIMA 3QYSA 4HN8A 2QCNA 2CZDA 1QRQA 3O1NA 3KP1A 1Z32X 1BHGA 5G1MA 1E71M 3M1ZA 3LUTA 1ZCCA 2DVUA 1KKRA 2WQPA 3N11A 3F1QA 3CEUA 4LW7A 3C2OA 3CO4A 2FKPA 2REQA 3AYSA 3WDIA 3NQDA 4CEUC 5EGRA 1UD4A 3ENLA 3S1GA 4MNMA 3GHRA 2OGJA 1UP3A 3S42A 1V03A 5DT5A 1OB0A 1BXCA 3O06A 3EXTA 3URQA 1LCOA 4R9XA 4R33A 4HSNA 4XKYB 2GQ3A 1YKWA 1MW2A 3HTWA 4NAFA 2J6XA 4FPSA 6XIMA 2IKIA 2FZNA 4O1EA 4XAPA 4A2RA 3B04A 1W1PA 1YPIA 2Z6IA 4FLSA 1OCQA 3BLFA 4Y8FA 1LORA 3K8KA 3GBDA 4UQEA 3TAOA 1UQYA 1B30A 4UZSA 1TPVA 3CMGA 1NWUA 3MWAA 4FSAA 4P7RA 7TIMA 2ZICA 4DWDA 5MKGA 1C8VA 1A5KC 4ICNA 3SY5A 4AD4A 4MJMA 2J7BA 3LQLA 1QW9A 1FWJC 4B3ZA 4MJ4A 2PSNA 3MV11 2PF8A 1UC5A 2PC8A 1GZGA 4YVVA 1Q8AA 3TTEA 3M9YA 4CLMA 8XIMA