2WMHA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 in complex with the h- disaccharide blood group antigen.
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
555
structure length
553
Chain Sequence
VQMRTTINNESPLLLSPLYGNDNGNGLWWGNTLKGAWEAIPEDVKPYAAIELHPAKVCKPTSCIPRDTKELREWYVKMLEEAQSLNIPVFLVIMSAGERNTVPPEWLDEQFQKYSVLKGVLNIENYWIYNNQLAPHSAKYLEVCAKYGAHFIWHDHEKWFWETIMNDPTFFEASQKYHKNLVLATKNTPIRDDAGTDSIVSGFWLSGLCDNWGSSTDTWKWWEKHYTNTFETGRARDMRSYASEPESMIAMEMMNVYTGGGTVYNFECAAYTFMTNDVPTPAFTKGIIPFFRHAIQNPAPSKEEVVNRTKAVFWNGEGRISSLNGFYQGLYSNDETMPLYNNGRYHILPVIHEKIDKEKISSIFPNAKILTKNSEELSSKVNYLNSLYPKLYEGDGYAQRVGNSWYIYNSNANINKNQQVMLPMYTNNTKSLSLDLTPHTYAVVKENPNNLHILLNNYRTDKTAMWALSGNFDASKSWKKEELELANWISKNYSINPVDNDFRTTTLTLKGHHKPQINISGDKNHYTYTENWDENTHVYTITVNHNGMVEMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords FUCOLECTIN-RELATED PROTEIN
total genus 203
structure length 553
sequence length 555
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08306 Glyco_hydro_98M Glycosyl hydrolase family 98
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmhA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmhA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmhA02
1VAHA 4WK9A 3PZUA 2VNCA 4UQEA 1VJZA 3UG4A 4U33A 1CGYA 2X2YA 1VEMA 2G8ZA 3SUWA 2VVSA 2IXVA 2UY2A 4H2CA 3BLKA 4F66A 5BCAA 3UEQA 1UWQA 3F5LA 4QCEA 5BYWA 2G3NA 5AY7A 4JKMA 3TTYA 2VZSA 4PTVA 3KL0A 4NI3A 2ZOXA 1QNOA 2GJXB 1MWOA 2CBVA 4YN5A 3CZ8A 1BYBA 1SYTA 4MNKA 1E4IA 1VFUA 3SURA 3IJ8A 1ESWA 4WKHA 1B3ZA 1PEZA 3ZR6A 4AZ5A 2W62A 1AVAA 3E1F1 4M56A 4UFLA 5M5DA 1HMWA 1B3XA 2F8QA 2DT2A 4CVUA 1O7AA 1TA3A 4ZEPA 1UR2A 2G3JA 1QNQA 5A8NA 1N7OA 3AFBA 1QI5A 4WKFA 4B9YA 3F4VA 4W7WA 4A4AA 3QGVA 1R7AA 3MANA 3OG2A 2WC4A 5FD0A 5GNZA 3PHAA 1XGZA 1H11A 4D6GA 4LQ1A 2E24A 3A47A 1V3LA 3NDZA 1GHSA 5BXSA 3GBEA 2J78A 4PMRA 4AIEA 2JEPA 3SCSA 3U5YA 2WHKA 1PBGA 1XC6A 1UWTA 4P7NA 1QOXA 4DWSB 1PX8A 1TVPA 4CU6A 2DSWA 5A69A 2BXZA 4RE4A 2DSVA 2PBGA 4OOUA 1X1NA 3BMWA 1UWRA 3PZTA 8A3HA 4P7OA 1UH2A 1UD6A 4XV0A 3TTOA 3B8SA 4HOXA 1WDSA 2XPKA 1EDQA 1KBBA 3WDJA 2X8RA 4W84A 5M03A 4HOWA 2WDAA 2BHUA 4H7VA 4W8LA 1MVYA 4P7QA 1CGTA 3KEHA 1BGAA 2YJQA 1JFHA 2BRWA 1PAMA 4BZYA 3POCA 1UWSA 1KFWA 2DIEA 3VMNA 2Y4SA 4MAVA 2WHJA 3N9KA 4LGXA 1OD0A 3EMZA 3OB8A 4AYSA 3AIBA 2WK2A 1JZ8A 2DT1A 4D6EA 1UR4A 1FH8A 4D1JA 1M7XA 1TG7A 4UFIA 4QDMA 1JD7A 1GONA 1W2PA 2YL8A 1C7SA 1SFSA 1XD0A 4D6CA 6CGTA 1J0HA 3VDCA 4X0NA 2CNCA 3AMKA 1NP2A 4IPNB 2WBKA 3WF0A 3L2MA 1VF8A 1E15A 4CD7A 1DWFM 3ZT5A 1W9PA 2XGIA 3U5UA 1CXLA 4CD5A 4H04A 3NSNA 4MPKA 3W28A 1HMUA 3HU7A 1IV8A 3WF4A 4ACZB 4GKLA 5CXPA 4TX6A 1LG2A 4UQAA 3SCWA 2V3DA 2ZE0A 1ZS2A 4UTFA 1TA3B 2XJ7A 3UR8A 3ZT7A 1ZBWA 2FGLA 4HZ6A 2PI6A 2J7HA 2D3LA 2PB1A 3CMJA 4QLLA 1US3A 5FL1A 4L4PA 2EEXA 3FHAA 3SIMA 3UG5A 4Z2HA 4TVDA 1C8XA 5JUVA 1LXKA 1UWUA 4CVWA 1G01A 4W87A 4U3AA 1M03A 1R87A 1MFUA 2QV4A 1TFVA 3TTQA 4H8VA 4EE9A 2WVVB 1OIFA 3K46A 1UZ1A 1J0JA 4W5ZA 1J10A 2VC9A 1XYFA 1GOIA 4WKAA 1BGGA 3NUKA 3W4RA 1ISWA 2VI0A 1HJVA 2VX6A 2W67A 2PWGA 4B16A 1VFMA 3BCDA 3SEPA 4C7FA 3AIWA 1HKIA 4CKQA 5BRQA 3WEMA 1H0IA 2HVMA 1AQMA 4FF5A 3WKZA 1JI2A 5E6ZA 1W91A 1WZKA 5CZKA 1W9UA 5E0FA 1VENA 4S3KA 3I3BA 1HJQA 3AZRA 3L4XA 2W61A 2CYGA 4GI9A 1RD6A 1V0MA 4EKJA 3NSXA 1NH6A 1X1HA 3WH5A 5JBEA 1KCKA 3K4AA 1VBUA 3VIOA 2VVNA 1H1NA 3EMCA 2EJ1A 1O6IA 3SCNA 2WMGA 1GQKA 3THDA 3MKKA 2VQUA 1RP9A 5EB8A 4UFKA 4D72A 1DWIM 2CETA 2ZXAA 3PN8A 5ABFA 1H41A 5CLTA 4R27A 2XYLA 1JZ2A 1E0WA 4ATDA 2GJRA 4Z2GA 2VL4A 1LL6A 4AZCA 1CLXA 1BPLB 2VCBA 3WUFA 3NJ3A 4HPHA 3AISA 5ABFB 2E3ZA 4E8DA 5I5RA 1X6LA 4OIFA 2PWFA 2WLZA 4MADA 3EDEA 4XUYA 2XIIA 2XVPA 2QHAA 5JBDA 1IT0A 4D6FA 1H3GA 2WVVA 1FP8A 3HMCA 2J62A 1ZJBA 1PZ3A 2E40A 2CBUA 3WDRA 2V5DA 2E4TA 3N1AA 2WYSA 1C93A 4W5UA 1FHDA 3SUSA 1LG1A 1OGBA 2WVTA 3VTRA 5A6KA 4P7RA 1HIZA 1ZB5A 1JZ3A 1B90A 4CCCA 3AYRA 2ESCA 1W1VA 4FMVA 4AD4A 1HNYA 7A3HA 2OSYA 2VZOA 4OBSA 5KZ6A 4MNLA 2WMJA 3LPGA 2J8GA 4B9ZA 4LYPA 4TOQA 4UQDA 5BXPA 1X6NA 4W89A 1F4HA 4CCEA 1B30A 3QOKA 3W24A 1LLOA 1V3KA 4TXEA 1SMAA 1QI0A 4MNMA 1N82A 1W1PA 1HJXA 1OB0A 4M80A 4XB3A 3O2LA 1HXJA 3A4WA 2Z1SA 3VMPA 3WBAA 3L2LA 3QR3A 1QW8A 3ZM8A 3DYMA 1C8QA 1V3MA 3D5HA 1V08A 3I3DA 3VD3A 5GQBA 3N04A 2EPLX 4JFTA 5AYBA 4BS0A 3QHNA 1KCLA 3MMDA 3SCOA 4AZHA 2G4FA 4UNIA 5E0CA 2WWCA 1BVNP 2D3NA 1DHKA 2DIJA 1YHTA 2OYMA 1CPUA 1V6WA 1Z32X 4BQ2A 3AMLA 1A3HA 1OGSA 1UKPA 2VQTA 4UOJA 3OLGA 6A3HA 4DUWA 1MYRA 5LYRA 1E6SM 1E6RA 5FL0A 1L0PA 1XSJA 3N13A 1ISXA 2DSUA 1DEDA 1QBAA 4P8WA 4PCTA 3AYSA 5E9AA 3G6LA 2XHYA 4JIEA 1W3JA 4GXPA 4BA0A 3GNRA 3VX1A 5DT5A 3CHFA 1H09A 2DSKA 1C92A 4U2ZA 1KXTA 1UZ4A 4BQ3A 1E70M 1C91A 4KRTA 1R8LA 2CERA 4AC1X 3RILA 4MNJA 5AC4A 1ISYA 1B31A 2VX7A 1OIMA 2XUCA 1K9DA 2ZX8A 4DWSA 1XRVA 1VBRA 1GOWA 3DECA 8CGTA 2C7FA 1WDQA 2WMHA 1BAGA 1JI1A 4B3KA 4MB5A 4GQRA 2DT0A 1GZJA 3SCTA 4AD1A 1JL8A 2J75A 1V02E 2JEQA 2V3GA 4OZOA 1X1JA 1OSEA 1V6UA 4MB4A 5I79A 1E6XM 2WXDM 3NCOA 3ZO9A 3WMCA 1RP8A 3WIJA 4PTXA 3VIKA 3WMBA 1E73M 2WZEA 3AQUA 3VGHA 1EDTA 3W53A 1CZ1A 3EYPA 1E0VA 4GZEA 3ZIZA 3WN6A 3NDYA 2VR5A 4R5EA 1GJWA 3VNZA 3ALFA 5A8OA 3GH7A 4P8VA 1AQ0A 4PYSA 3VKKA 3GTNA 2VRKA 4OBRA 2BHYA 4GZJA 2YDRA 2ZIDA 3T08A 1I75A 3LPFA 1Y7VA 5IHSA 2FGZA 4GO8A 1JXJA 5CQ1A 3TONA 2RGLA 1ZBKA 2HISA 4MJ4A 3ZOAA 5IXEA 2DPEA 2IXUA 3K1DA 1M53A 3FHQA 1JFXA 4M1RA 1EHNA 3IJ9A 3W38A 2X1IA 3CBWA 4URIA 5FKYA 3APGA 1QPKA 2BS9A 2D0FA 4U31A 1EXPA 3ARZA 3QHOA 4CD8A 1CENA 3DHPA 5CGMA 2XFFA 3AS1A 1XYZA 5A6BA 3MS8A 4UQ9A 2CHOA 3MUZ1 1H4PA 3B9AA 3WQ5A 2BV9A 3VIIA 5FIPA 1NOWA 2EPNA 1FP9A 3CO4A 1V6XA 1NARA 2XVLA 3AS3A 3T09A 3ZSSA 1VFOA 4ZENA 2JIWA 1E5JA 2D20A 1UHVA 2ZX7A 3VD5A 1C8YA 1V3JA 2F61A 2Z1KA 3BSGA 1BLIA 2E9MA 3EDJA 2C8NA 3LMYA 3MUY1 4OJYA 3PTKA 2PWEA 1M04A 1W9BM 5A2AA 1JNEA 3ARQA 5CJ5A 1UYQA 3WQVA 1UD5A 1MQRA 3AI0A 3ARRA 2CEQA 1HKKA 1VIWA 2FHFA 4UCFA 3U7VA 2VJXA 1J0ZA 5ABEA 1TVNA 1JXKA 1LL4A 2ZWYA 3W25A 4UZUA 4AEFA 1MXGA 3K8KA 2GUYA 3CPUA 4JKKA 2PWHA 2B31A 3HJEA 1N7NA 2DGAA 1JDDA 1KB3A 2VZTA 3RM8A 2D24A 2WMKA 4HU0A 5JBFA 5A8QA 4D6DA 2NW0A 2XGBA 3GXIA 1D2KA 1HN0A 1OM0A 4CCDA 3CUJA 3KL5A 1JF6A 2DH2A 1HP5A 1BYCA 2NSXA 3VDBA 2BY2A 1GQJA 2EPOA 4PMXA 1UR0A 3CH9A 3FW6A 5BXRA 3WBEA 2WC3A 3AZTA 3GH5A 1MFVA 3FNDA 5ECUA 4QFUA 1IZKA 1WE5A 3DYPA 5C71A 3THCA 1ZBCA 3W0KA 2TAAA 3M6DA 4GQQA 1HT6A 2IUZA 4PRWA 2ZUTA 4E2OA 3BGAA 1JNDA 5DF0A 1VFFA 4AD3A 3POHA 3BH4A 1JYWA 3O9NA 3WUGA 4ZXLA 3CZEA 3VDAA 2NT1A 3S2CA 2YL5A 3II1A 3GNOA 2OLHA 2XM1A 3CLWA 3ZJ8A 5I0DA 2RGMA 1WPCA 4ZE5A 5BRPA 9CGTA 3WY1A 3QOMA 1P6WA 2J7GA 2BXYA 2YL6A 4CU8A 2XVKA 1LXMA 3T2PA 2VURA 4RE3A 2CIPA 4P8UA 3AMCA 4PTWA 1PX3A 2E22A 2WSPA 1J0MA 2WCGA 4C7DA 5IFTA 4TVCA 1ZBVA 2QLYA 5EFDA 1C3FA 3O6AA 4BCEA 1QHPA 5CLWA 4DM2A 1U30A 1UUQA 3U7BA 4J3VA 3WQWA 1E5NA 4M82A 5A6BD 3FN9A 3S6TA 1C90A 3BAIA 2BHZA 3ARXA 4Z2IA 1JZ6A 1Q6CA 4PMQA 2QMJA 2WSKA 1XSKA 3ZSTA 4KGLA 4ZFMA 2OWCA 1ITCA 3MO4A 2WZHA 2YDQA 1QNSA 3WF1A 3U57A 3VNYA 3ZT6A 3BCFA 4TX8A 3BSHA 4PEEA 2AOSA 4PMZA 2WMIA 1ZJAA 1NWTA 4AIUA 1FA2A 3WF3A 3M07A 3AMDA 1QW9A 4NRSA 4M24A 2EPKX 4HMDA 4IISA 2VRQA 3WD0A 5A2CA 3VVGA 3W37A 1B3WA 1TR1A 1WDRA 4HA4A 3W82A 2BVTA 4QAWA 2GJXA 4LX4A 3BAKA 4PSPA 1VEOA 3SUVA 4W7UA 2JF6A 1BHGA 4UR9A 1JF5A 2XM2A 1J01A 3VPLA 1G1YA 1HKMA 3MSGA 5A8PA 3PZNA 3BAWA 5A6SA 2D2OA 3AS2A 4HA1A 3ARSA 4ATLA 1GOMA 3OLIA 1NWSA 2ZUSA 1QHOA 1DP0A 4P8XA 3WSUA 2VO5A 3WH9A 4HMCA 5DEZA 1H49A 1UA7A 1CGXA 4KRUA 4TUFA 3MMUA 1KR0A 3CIVA 4JCLA 1EQPA 5DO8A 2QF8A 3L4WA 1QI4A 1UKSA 2GJPA 1E55A 3WEOA 2W92A 1N7QA 3A4AA 2D0GA 3KE0A 4IPLA 4KH2A 1BTCA 1G94A 1HL9A 4JKLA 4M29A 3ZJ6A 4AZIA 2CKRA 3AHXA 1C82A 3WDPP 2J25A 2J74A 1QNRA 4HZ8A 1DWAM 2BNJA 3AJ7A 3RO8A 1E71M 3VO0A 4AZ7A 5TD4A 1VRXA 2ZX6A 2QMKA 3QHMA 3T0AA 3AIQA 1K9EA 1KR1A 3AOFA 3IJ7A 4PUEA 2VOTA 3T2QA 1U33A 3MSDA 4WLCA 1JYNA 1NP0A 5IDIA 3N11A 4PMDA 3DYOA 1W1TA 5I6SA 4PMOA 1QNPA 3OLEA 2WPGA 1OJNA 2A3CA 2V38A 1KXVA 2OYKA 1HVQA 3N15A 4S3JA 2BY0A 1UKTA 1W9DM 2A3EA 5LA1A 4D1IA 4W8BA 3WUEA 1OJPA 3CZKA 3BMVA 1K9FA 4FLQA 2PC8A 1NM9A 3VINA 2GDUA 3GXFA 2XFYA 5D8ZA 5GNYA 3FY1A 4B3LA 2XWDA 4PMNA 4AISA 4ZE4A 1GPFA 1WZAA 2YBTA 4QP0A 3RJYA 5JIWA 5E09A 3N12A 1JZ7A 3WH7A 2E8YA 4M8UA 1XD1A 7CGTA 4CD6A 3NYDA 1JYXA 1BFNA 3MU7A 1PZ2A 1CXEA 3CHEA 2J7CA 1KQYA 3IAQA 3CZGA 4UZSA 1R7OA 2YA1A 2X0HA 4XZBA 2YA0A 1UD3A 3D3AA 2EQDA 4J3UA 3EDDA 1D3CA 5M17A 2MANA 4E8CA 4E4PA 1V3HA 4UQBA 4Z2LA 3GZAA 3NSMA 4N0RA 3OLDA 3TP4A 5ABHA 4MB3A 2CHNA 3WELA 1J12A 1CGUA 4MAZA 2W91A 2GK1B 5EBAA 4ATWA 3GNPA 3WQ8A 3VIGA 3WH6A 4IUGA 4FK9A 3WFZA 3ARUA 3GXMA 2QPSA 3RPMA 2JF7A 5HOSA 3VM5A 1CXKA 3W6LA 3PZMA 4KWUA 1FFQA 4L4OA 2ZXBA 5HBFA 1E1FA 5IHRA 3L4ZA 4Z2KA 1J18A 1CBGA 2ZXQA 4UFHA 1W9XA 5CPSA 3LPPA 3WMSA 1QVBA 1B0IA 2J7BA 3CGTA 1VB9A 2OSXA 3PTQA 1UG6A 1LWJA 1XSIA 1HM2A 4D6JA 1DWHM 4HZ7A 5D9PA 2Q8XA 4OOZA 1UD8A 2WKLA 1JAKA 2WCAA 1HM3A 2WCOA 2XSAA 4CD4A 1GVYA 4KMQA 2PWDA 5JIPA 1DTUA 1E56A 3GM8A 3RCNA 2BVYA 4QCFA 1XH0A 2YDSA 5A6JA 2W5FA 5A2BA 3DHUA 1K6AA 2GFTA 1JD9A 2G41A 3GYCA 3ZJ7A 5A6AA 3AS0A 1FH7A 1OJMA 2ZUUA 4JFSA 2OWWA 4XZWA 3W6MA 1PIFA 3T2OA 3VGDA 3FAWA 4DWSD 2BVDA 2WHLA 4GI6A 3PZOA 3VGBA 4X0VA 1YQ2A 2CXGA 5A3HA 1KXQA 3T0DA 1BSIA 3WFLA 3IANA 3L4UA 1HVXA 3JUGA 3AXXA 1UWIA 3SUTA 1WO2A 2A3HA 4TTUA 5D4YA 3VD4A 1E6PA 4FLOA 1PPIA 3L4TA 1QI3A 3RIKA 4W8AA 5CSUA 2XG9A 3FXYA 3A4XA 2QPUA 1ZU8A 4HP5A 4W85A 1E9LA 1CIUA 1TUXA 1ISVA 4YHGA 3ALGA 4JL1A 4MB1A 3VUPA 4PMUA 2VUYA 1N7RA 1VJSA 1BG4A 3L4VA 1LL7A 3PBGA 3ZJKA 5GNXA 1G0CA 1GORA 3EDKA 1EH9A 1WAWA 4U5KA 3OGVA 1US2A 3RMEA 3SUUA 1V0LA 3AMGA 1HJUA 1UQZA 3W26A 1UD2A 1NWUA 4PCSA 1JZ4A 3MUAA 4UOQA 2D23A 1MW3A 2J4GA 1MXDA 4HTYA 2DEPA 2X0YA 1CWYA 1EHAA 2J7DA 4J27A 1W9VA 1U2YA 2BFGA 3NIYA 4JFUA 2CPUA 4C7GA 3SCQA 3TOPA 2EXOA 2WB5A 3BAJA 4B15A 4QLJA 1MW1A 1PX4A 3AICA 4D71A 4NF7A 4W86A 1QI2A 4JFWA 2YA2A 5HPOA 2BRVX 5CG0A 2VX4A 2FH6A 4N42A 1DWGM 1QHZA 4J3XA 4AW7A 4F9JA 1EIBA 1I1WA 2CKSA 2Y5EA 3VOCA 5A95A 2O9PA 2WLYA 3F5KA 3WL1A 3F5JA 1RH9A 1J0NA 1XCXA 2ZUWA 1E4LA 2XTKA 1MW2A 4ACZA 5FCZA 3WDIA 5FOOA 2ZUVA 3MV11 1W2VA 2NT0A 2YLLA 4EK7A 4K68A 3W27A 4F9DA 4WF7A 1LQ0A 1UOKA 4HOZA 3WNMA 1BG9A 2JALA 1CTNA 1EA9C 2AMGA 1VEPA 3CUHA 4WSKA 4PN2A 1FH9A 4W93A 1IZJA 1RWCA 1MQQA 5A6MA 3CZLA 2VT0A 5I2UA 3AROA 2GVYA 4P7LA 3VD9A 2XVGA 1HX0A 2A3AA 2V5CA 3ARYA 4QLKA 1GUVA 1SR0A 5A94A 1BVZA 2WNWA 3DC0A 1EQCA 4TTGA 1LOHA 2J79A 3WDQA 3B9DA 2UY3A 1AQHA 3VGEA 4MJ2A 2D0HA 4OKDA 3OA5A 4TVUA 1OINA 4YPJA 4W88A 4U5IA 5KEZA 2GDVA 1E4MM 5I3DA 2J7EA 2CBJA 4PSRA 1UR8A 3GDBA 1UH4A 4MDPA 4ZXOA 1CGWA 2ZWZA 5HPCA 3TA9A 5BXTA 4CN1A 1CXIA 1B3VA 1Q6EA 4AY1A 4BQ4A 1FHLA 2XSBA 1GOQA 1GCYA 2VCAA 3SCRA 5M3WA 3CHCA 4J3TA 1J0KA 3CMGA 1WZMA 4LPCA 4RL3A 2D22A 1V6YA 2DH3A 1XV8A 1HF6A 3BAYA 2XIBA 4JL2A 5EMYA 3N18A 5CPQA 1V03A 2DT3A 2ZICA 5CGTA 2O9TA 2UY5A 5BWFA 1CECA 4BF7A 4J3WA 3PZGA 4W7VA 4BQ5A 4PBGA 1Q6FA 4PMVA 5DT7A 3KZSA 4AIOA 3WD2A 3MMWA 1GJUA 2VR4A 3VILA 3VD7A 1KWGA 2W4XA 3KL3A 1GVIA 1ODZA 4Z2JA 3MV01 5E6YA 3WH8A 1EOKA 3WNOA 1OD8A 2ZUMA 2X09A 3VMOA 4IM4A 1RW9A 3ARVA 3WL0A 2YOCA 5HNNA 2XFRA 4Q22A 4JZ5A 2V3EA 2ZX5A 1CGVA 1WP6A 3VGFA 1E3XA 1WB0A 3G6MA 1W32A 3OZPA 3N17A 4AZCB 1UKQA 3BLPX 3GXDA 4AD0A 3RJXA 2FHBA 2YL9A 4AXNA 3IK2A 5D9NA 3ZR5A 2Y8KA 1JYVA 1W3LA 4WIWA 1JG9A 4JHZA 1UR9A 3FAXA 1FFRA 4X9YA 1OBAA 3WDHA 4EAMA 4GZIA 1ISZA 2J7FA 2J8FA 3A6OA 3PZQA 1TE1A 5D9OA 1F9GA 4HPGA 4RE2A 3AIEA 1J0IA 4GO9A 4ACYA 3VIPA 3TTSA 1ZL1A 1EO5A 3VM7A 1E3ZA 2OYLA 3CUFA 4PMYA 2FHCA 2Y2WA 1MQPA 4A3YA 2ZXDA 1WNOA 2E8ZA 4DM1A 4HA3A 5DMYA 3ARPA 2YBUA 1XCWA 2CITA 2X03A 3MUIA 1E4NA 3ECQA 4NSBA 2FDMA 1V3IA 4H8UA 3VIMA 4Y7EA 1TMQA 2C0HA 1WCGA 4CU7A 1W3YA 2O9RA 1GHRA 4AWEA 1JAEA 2WANA 2JE8A 2Q1FA 4PUDA 1KWKA 1J0YA 1KBKA 2Y8VA 2WBGA 4AZGA 3AHZA 1Q4NX 3I3EA 1F1SA 1J9YA 1K9TA 4NZCA 2GK1A 1NOUA 4NRRA 2WKGA 2F2HA 2J77A 4GPNA 3EMQA 3A3HA 5AC5A 1BF2A 1BQCA 1UKOA 3EDFA 4AMCA 2VTFA 4AZBA 2VX5A 4FLRA 2WVSA 1LJYA 2CESA 3AZSA 4GI8A 3WF2A 1GOKA 2D1ZA 1RWAA 1EGUA 1E6ZA 1UH3A 4DWSC 2X05A 3OZOA 3VIHA 2BY1A 1HJSA 5BROA 1G5AA 2E9LA 3W29A 2J47A 4FLSA 4LYRA 5I24A 2OWXA 2DSZA 6TAAA 1JGIA 3WNNA 1WZLA 2O9OA 1H2JA 3RM9A 5LA0A 1I8QA 3BXWA 1KGWA 5C8BB 2OSWA 4V28A 5I23A 1RWFA 1JDAA 3WQ4A 3ARWA 2E0PA 3WUBA 3K8MA 4AD5A 1EOMA 4LXFA 1WKYA 4UFJA 1KGUA 5HXMA 1HP4A 1XHGA 3W81A 1E1EA 1CXFA 4JAWA 5AYIA 5D8WA 2JFEX 1B9ZA 1WDPA 2WCSA 1C7TA 4XX6A 1HKJA 2YIHA 4J7RA 3B9EA 2Y24A 1NQ6A 1R86A 2JIEA 4WJXA 3UG3A 1CYGA 3VIFA 5I78A 3IAPA 1UD4A 3AIVA 3AHYA 4F8XA 5A8MA 3BAXA 2WMIB 2W63A 3OGRA 1EO7A 2WHMA 1B1YA 1RWGA 1S46A 3UCQA 3OBAA 3GBDA 4YHEA 3M46A 1RPKA 4OUEA 3WNLA 1JZ5A 4AZ6A 4JHOA 1KGXA 4UQCA 3VIJA 2EPMX 4V2XA 2VRJA 4CGTA 1AMYA 2VMFA 4HU8A 3AIRA 4GINA 1TZ7A 4D6HA 2VZVA 4KGJA 1V02A 4A3HA 3UETA 1KXHA 3VX0A 3KWXA 2EO7A 3RDKA 3K8LA 4CN4A 1HJWA 1W3KA 3WNPA 2BY3A 1NWRA 2VZUA 4J28A 1PIGA 2ZUNA 3VDHA 1OJOA 1CNVA 2ZX9A 1L8NA 1Q6DA 4LYQA 5CPTA 2YLAA 2CBIA 1GNXA 1RWHA 4CN6A 1GQLA 3OGSA 1V0NA 3WNKA 1HN1A 1GOOA 1M01A 1NOFA 3PTMA 4UFMA 1QBBA 2UY4A 1B2YA 5E70A 3PZVA 5A1AA 1E6NA 2O92A 3AXHA 3CTTA 4EANA 7TAAA 4H8HA 4ML4A 5I77A 1BYAA 3WD4A 1JDCA 2DQXA 3J7HA 3WENA 1I1XA 4AEEA 1SMDA 2EBNA 3CUIA 1A47A 2E9BA 3ARTA 1OT2A 3K4DA 1XH2A 1XH1A 1CEOA 1KQZA 1R85A 3AXIA 3GH4A 2WM0A 2AAAA 4F79A 3L4YA 1E6QM 5GPRA 1LWHA 2WAGA 4DUXA 2W66A 1X1IA 2WWDA 5ABGA 3RM4A 1E72M 1UQYA 1E43A 3BC9A 3VU2A 3SCPA 4Q7NA 1DWJM 3CUGA 3AHVA 2YKKA 4H41A 3WQ6A 2VCCA 3WD3A 1UR1A 1E40A 5CSYA 1N7PA 1EGZA 1EDGA 4AD2A 2DDXA 3SCUA 3WD1A 4CUCA 2PF0A 1GW1A 3PZ9A 2XWEA 1V0KA 3VGGA 2WW5A 2WMFA 1HL8A 4WSJA 5A6LA 1ITXA 2CCRA 4D6IA 1OT1A 4JFVA 5C70A 1TCMA 4GIAA 2WZIA 1CDGA 2UWFA 3PZIA 1ODUA 2BRPA 2A3BA 3CZJA 1W1YA 1LF1A 4U3CA 5F7UA 1BYDA 3EBVA 4M81A 1V6VA 5DFAA 1JIBA 5EFFA 3WEZA 2WC7A 3AHTA 1H0GA 2XVNA 3UESA 5IFPA 1F4AA 2GSJA 4MDOA 1OWQA 2V3FA 4U2YA 1GQIA 1B3YA 2WVUA 1CXHA 1J11A 3CHDA 1FOBA 1CB8A 2G3MA 4PTMA 4J3SA 3UERA 1Q6GA 3OIHA 3M7SA 1W3HA 2FH8A 3SCVA 3LPOA 5HDRA 4DUVA 4MTVA 1PJ9A 5D9MA 4JCMA 2PBOA 1MW0A 1OGGA 1CLVA 3HN3A 3ZQ9A 3UR7A 1ECEA 3T0BA 4V27A 1H5VA 2G3IA 1D7FA 1E0XA 1OCQA 4UOZA 1G9HA 3AIUA 4HMEA 3ZMRA 1UA3A 5LA2A
chains in the Genus database with same CATH superfamily
5EL1A 2VNCA 1VJZA 5HK4A 2PZ0A 4GWEA 4K8GA 1CB2A 1H7RA 2XDFA 2ON3A 2Y6ZA 4FEZA 3T4WA 3SUWA 3ISIX 4A2RA 4G1NA 1PSCA 3EX6A 3BLKA 3F4WA 3UEQA 1NEYA 1YRRA 1IGWA 3ELFA 1IEIA 1W0MA 1TJRA 2VZSA 1T7LA 2BX7A 3PM6A 4LNYA 4R33A 1TZZA 2FPVA 3GDKA 5LIYX 3O7UA 3CZ8A 1SYTA 3RLVA 1KO0A 1NY1A 4LC8A 3IJ8A 3SURA 1PYFA 1X1OA 3B40A 3ZR6A 4AZ5A 1AVAA 4UWMA 3GO2A 4O8RA 2F8QA 3KM8A 2NXHA 4ZEPA 5FJTA 1UR2A 1IQ8A 1QI5A 4WKFA 4A4AA 4HNLA 1OFPA 4BWLC 1A3XA 4QDWA 1XLFA 3OG2A 5HJYA 2WC4A 3PBYA 3EOLA 3PHAA 3CAVA 4GC4A 4IPPA 4LQ1A 3GDTA 4PCPA 2E24A 3P5ZA 3A47A 3NDZA 3GBEA 3W71A 2E67A 1XFCA 4O52A 4K6AA 4DWSB 2QXWA 1PHQA 2BXZA 1GK8A 4IX2A 3SRHA 2WNQA 1R9YA 5LXEA 4Q6JA 1EJ7L 5IM51 2FKPA 4ZL1A 1NFGA 3A3WA 3S1GA 4XV0A 2QGHA 2ZDSA 2HE8A 1EDQA 1W3NA 4MYXA 5AVHA 4W84A 5K4XA 2OG9A 4W8LA 2VP8A 1IE7C 4P7QA 1CGTA 3KEHA 3KTCA 1BXNA 1KM0A 1NF0A 3H53A 2BRWA 1PAMA 3KWSA 4BZYA 2C0AA 1UWSA 3JS3A 2Y4SA 1X39A 1S5NA 2WHJA 5AB3A 2XH7A 3CK5A 5K7JA 4XG1A 1RSCA 3G18A 4AYSA 4DXXA 2WK2A 3IPWA 2PTDA 3L65A 2QW5A 3MHFA 5FF2A 4NJGA 1UR4A 4AY8A 2VYOA 1QWKA 1M7XA 4MSSA 3I7SA 1EEXA 1JD7A 3Q4DA 2JKPA 2Z7KA 3GVQA 1C7SA 2I9EA 2P3EA 1VF8A 3S0CA 4V33A 4CD7A 2ZBTA 2FPYA 5HA7A 2Z24A 1O1ZA 1W9PA 5LGXA 1GYMA 1CXLA 3TCSA 1T99A 3PBVA 3W6YA 4NX0A 5T26A 3T6CA 1LG2A 4G7EA 3DGBA 4OVXA 2XGZA 1QNVA 3UR8A 2R6OA 4UTJA 1KBLA 2PUZA 1M7PA 3TZFA 3E0LA 2PB1A 3NL6A 3STEA 1FWBC 1NJJA 4R7OA 5FL1A 3DHDA 3EPNA 2HCVA 3QQWA 4PUNA 4TVDA 4IF2A 3NQ6A 3F4DA 2XZ9A 5LIKX 4CVWA 2HQAA 4RR4A 1G01A 2HS6A 4W87A 3KOYA 2QV4A 4B91A 1TFVA 2WVVB 5FJOA 4F2UA 3I65A 4W5ZA 3KLLA 3Q65A 1GOIA 4WKAA 3OVQA 3RRXA 5M2FX 3W4RA 3EAUA 2VI0A 1F7BA 4K1GA 1SO6A 4B16A 4C7FA 4B5UA 5AYZA 3EOEA 2G96A 4H9UA 2HVMA 1DIOA 1T96A 3WLMA 2PGWA 1U5JA 1JI2A 4HSHA 3W02A 4PRTA 3G1SA 2PWVA 3T0TA 5CZKA 3AYVA 4WDXA 2FJUB 4HSOA 4MIMA 4S3KA 1HJQA 3L4XA 2W61A 3GVGA 1NF7A 4MJZA 1RD6A 3UP8A 2FTPA 1NH6A 2OGJA 2ACQA 2NXIA 4LY4A 1U5VA 2O4QA 1L6GA 1WXYA 4S38A 3QZAA 1OYCA 1O6IA 1XL9A 4BWLA 5HWNA 2WMGA 3LGEA 1M6JA 2BGSA 3R1ZA 3MKKA 4UFKA 1DWIM 1E0WA 4ATDA 2GJRA 7ENLA 1O5RA 4XO7A 4AH7A 3GD6A 4E8DA 5I5RA 3A22A 4O8AA 1SJBA 4MADA 3EDEA 3GW0A 3QLDA 2XVPA 4GYPC 3PJUA 1H3GA 2WVVA 3FEMA 2E40A 1X8FA 3WDRA 3H4XA 3W7OA 4Q4PA 2CU0A 1XPYA 3DFTA 3V0SA 1TTQA 1XUZA 3UCCA 4OU1A 3GVVA 3DIPA 3P74A 3W83A 1HIZA 5D2VA 1LT8A 3V0TA 1B90A 2VFDA 1XUUA 4CCCA 5TIMA 4IZGA 1OX4A 7A3HA 3GXNA 4HJFA 4M51A 4C6JA 2VEIA 3LPGA 3OEXA 4B9ZA 2PCEA 1BRLB 3N73A 4TOQA 5A6TC 4KCVA 3M0VA 1X6NA 1Q4WA 4XAZA 5KMYA 2GJLA 3Q45A 4XZHA 1F4HA 3S5SA 3FJ6A 2ZRUA 4Q8NA 1N82A 1A5OC 1W1PA 5CSSA 1YEYA 1HXJA 4DRSA 3VMPA 3G1XA 3ZM8A 1V77A 3I3DA 1V08A 3E0WA 5CC7A 3R0KA 4BHYA 3QHNA 1G4EA 4TMBA 3SCOA 3W3OA 3M0XA 4MMWA 4UNIA 4DZ5A 1BVNP 2V2HA 1KW1A 3B8IA 1A0DA 4ORMA 1FWCC 1V6WA 2ZA1A 4O1AA 1UKPA 3W75A 4JX6A 1QASA 3H2NA 2PLKA 1XSJA 3N13A 1QBAA 4P8WA 5E9AA 3OBKA 3W7RA 4ECLA 3Q94A 3LXAA 3FDGA 5FJPA 1KXTA 4NYYA 1UZ4A 4BQ3A 3S9ZA 2QCGA 3RRAA 4IMGA 3PUGA 3GC5A 4AC1X 2DZBA 1LTDA 4MLRA 4ONVA 1XPGA 1ISYA 4GCXA 2VX7A 3BE7A 4D8AA 3D47A 3BGJA 2Q6ZA 2ZX8A 4DWSA 4JY9A 2BOFX 1VBRA 3NGJA 2E7FA 3UR2A 1GOWA 3DECA 2PU0A 2ASHA 4B4FA 1WDQA 4WXYA 1T0OA 3E0VA 2DZXA 5G1YA 3SCTA 1AZ1A 2V3GA 1X1JA 2I17A 1RCOB 5FJUA 4AVNA 3NQMA 3GHTA 3W7CA 5KZMA 1XRTA 1EB3A 3WMCA 3PWAA 1G4PA 4KEUA 1EPXA 2WZEA 4YWSA 4BEUA 3VGHA 1G4SA 1EDTA 1PE1A 3QVQA 1V6TA 1AQ0A 1R6WA 4C1LA 2A21A 4PYSA 4JNYA 1Y65A 1RQBA 4AQLA 4OBRA 1TWZA 1EIXA 2BHYA 4GZJA 4RUBA 4ZR8A 1I75A 3LPFA 1FXQA 5IHSA 1PWMA 2FGZA 2Z4GA 5CQ1A 4XSLA 8RUCA 3T55A 2DPEA 3JR2A 2QJNA 5D09A 3R79A 4HCLA 5FKYA 3APGA 1QPKA 3G1AA 5MHBA 4U31A 1OF8A 4CD8A 2HNEA 3RHGA 2DZTA 2FPTA 2CHOA 3MUZ1 1FBAA 5FIPA 1NOWA 4WVXA 2WM1A 1NARA 2XVLA 1I4NA 4MYAA 1VFLA 1MXSA 1MDRA 4LCQA 3UXIA 1EUAA 2ZX7A 1KV8A 4F3HA 4Q33A 1LOLA 2V2DA 3BSGA 3H7RA 3TDFA 3EDJA 4QTGA 3LMYA 4YL2A 4OJYA 2C79A 4GABA 3KBWA 2JGQA 3BANA 2DUAA 5A2AA 4FXFA 5CC3A 2CEQA 4HK6A 1Z41A 1BXBA 1TQXA 4O13A 1JUKA 1GGOA 4FXRA 3GU1A 1VIWA 3EOUA 4DAFA 3LCWA 3U7VA 5CJNA 1J0ZA 5ABEA 4FNUA 1JXKA 4DPQA 4L6OA 4KETA 2HRWA 3TSDA 4R3UA 4R85A 2VDHA 3B3DA 2J6XA 4E4FA 2OKTA 4JKKA 8XIAA 2B31A 5FJIA 2P3ZA 1JDDA 1FQ0A 1W8SA 2X1RA 1DVJA 4ZOAA 4LVBA 1XBYA 5JBFA 4QGCA 3DUGA 1YADA 1NDYA 3GXIA 3OZYA 3CUJA 3KTXA 1JF6A 2DH2A 4FXSA 2C3ZA 1HP5A 2C16A 1TV2A 2YYUA 1BYCA 5J8LA 3MBFA 2NSXA 3SGGA 4PMXA 3CH9A 3B8UA 5F4XA 5CAKA 3DKJA 6XIAA 4CNOA 3P3BA 3FNDA 3TR2A 2AAMA 4KEMA 2VFIA 2TAAA 1RXOB 3R0UA 1J2WA 2IUZA 4L1GA 5TNVA 3MP4A 5DY3A 3TW9A 3P93A 2J66A 4G7EB 1NIUA 5TAOA 1JYWA 1K7FA 4KFOA 1KTNA 3BQ6A 2NVDA 1X7FA 1IT7A 3GNOA 3STCA 4QQ3A 2CZEA 4F0KA 3C2OA 3LQGA 4AHPA 1NQKA 3S6OA 9CGTA 3WY1A 1P6WA 1XIEA 4DF1A 2CLIA 4NY2A 2E22A 5IFTA 5C9WA 5EFDA 4HYWA 4GKTA 1HGWA 4QS5A 5H91A 1E5NA 1DQUA 5A6BD 3T44A 3BAIA 3FS2A 1VYPX 3W9ZA 2VELA 2QMJA 1XSKA 2OWCA 1LQ2A 1ITCA 4QM1A 3DEQA 1V7AA 4E2DA 5FF3A 3ICJA 2G4JA 3QF0A 2J88A 3GU2A 3O0FA 1LROA 2POZA 2KX9A 3GQYA 1Z48A 1PL9A 3O6CA 2J24A 3VNLA 2WMIA 5AZ0A 1ZJAA 2ISWA 4XISA 4JR5A 2FVMA 1FA2A 3IK4A 5HNTA 3UFYA 4FX6M 3W37A 4DJFA 4GUFA 1H7PA 2WSYA 4JIRA 3SUVA 5C9UA 4W7UA 4PGLA 4YCOA 1OFOA 4UR9A 3S9YA 3HA1A 1W5QA 4C1NB 1G1YA 3NO1A 3PANA 1KFCA 2Z2AA 3PZNA 3E6EA 4ATLA 3O63A 4C1NA 3IIXA 4KF1A 3OLIA 3RNDA 1NWSA 2ZUSA 1TELA 4P8XA 5JH1A 4HPNA 2VO5A 3LV5A 4I7UA 4HMCA 4PODA 4U10A 2F2KA 4H6QA 4HNUA 4Z0SA 3LM7A 2OLAA 1IZCA 3MMUA 4N9CA 2XISA 1TPVA 3RX2A 2QF8A 3L67A 3I7QA 2A85A 3K13A 2W92A 1N7QA 4B5SA 1VYSX 3KE0A 2D0GA 4HKPA 1BTCA 1G94A 3ZJ6A 4GJ1A 1YTDA 1EF3A 1C82A 1KD0A 1RBLA 4CQ9A 3AC0A 4KERA 1DJZA 1TYGA 1XBVA 3R12A 5E1QA 3V16A 3AJ7A 3B03A 3VO0A 1RD5A 1VRXA 2P76A 2E1DA 2GGHA 3EEZA 5BWAA 1I45A 5HWMA 3MCMA 4UTTA 5PTDA 4PUEA 1WA3A 4NZ3A 4W9TA 1JYNA 5XIMA 5HMDA 1JULA 1XKJA 3OLEA 3WQGA 3LN3A 4WR3A 1ZQ5A 1M41A 1UUMA 3LEPA 3N15A 4PCNA 4S3JA 4Y9NA 4RXFA 1SO3A 1FVPA 2CWXA 5LA1A 2BGNE 4UMCA 3WUEA 5I00A 1ALDA 2HXUA 2DFAA 3BPWA 2HBVA 1A5CA 2HZGA 1GPFA 1WZAA 1YDVA 4AB4A 5JIWA 3V5OA 2GGJA 3NEHA 5E09A 5T8GA 1PO9A 2I1OA 3THUA 4M8UA 7CGTA 4CD6A 4CCZA 1KBJA 1QJWA 4RZ6A 1CXEA 1KQYA 3W2LA 1O1HA 1R7OA 2YA1A 1HO4A 2F7FA 2MANA 3FYOA 4YU1A 3P5YA 2VWSA 2PDFA 1AJ2A 2JQXA 4UTIA 3OLDA 5ABHA 4MKNA 4TU1A 5HULA 2WQPA 1CGUA 2OELA 2R1KA 4LFYA 1G69A 5EBAA 3SQSA 4IUGA 4NI8A 1GZ1A 3ARUA 2XIOA 2J9ZA 3NEVA 4X61A 3QV8A 3PPFA 5C9RA 3EKGA 2NLYA 3VDGA 2PDNA 2P10A 4PUUA 1DV7A 1H5YA 1ZAHA 4J4KA 2ZXBA 1JPDX 1VFHA 3TSBA 4Z2KA 2C1GA 3IGSA 2E68A 3CGTA 1R3VA 3EX3A 3L0NA 2I14A 1TPUA 4D6JA 1RCXB 1DWHM 2Q8XA 4NIRA 1XM3A 4IIGA 1EC9A 5C2XA 1XC4A 1DTUA 2QCDA 3GM8A 2BVYA 4IGSA 1M1BA 1XH0A 4LS2A 1K8XA 2W9MA 3BMXA 5A6JA 1K6AA 4A8RA 2ZUUA 1ICQA 1FTXA 2VENA 4XZWA 1TV5A 1PIFA 4F2TA 2FMNA 2WHLA 2CXGA 6ALDA 2ADAA 2OEMA 2RKXA 1TIWA 2A3HA 1YBQB 1UMYA 2O0TA 4GHRA 1FWIC 2F6KA 3L4TA 3WLNA 5BOFA 2PRHA 5CSUA 3A4XA 4W85A 5HQEA 1CIUA 3H2FA 7PTDA 3RFAA 1TUXA 4PR4A 1X38A 1X96A 4L65A 3GDRA 4YVXA 3HG2A 1HFBA 3QXBA 1N7RA 3N6JA 4H1ZA 4HTBA 3H55A 1P6BA 4QE4A 1EH9A 3M47A 3SUUA 3AMGA 2J9XA 4S3BA 4LVFA 1KTBA 1JZ4A 4GYJA 3JU2A 1MXDA 1W1IE 4HTYA 2X0YA 1CWYA 4GH3A 5C9ZA 3ANYA 1TX0A 4RV3A 1U2YA 2V5BA 1QDSA 2P8CA 1RJPA 2WB5A 4JEQA 2NQLA 4LH8A 3TTEA 4FXJA 1PX4A 3IIZA 1MUMA 2AL2A 1UIOA 3UBPC 3CAWA 2BRVX 3M41A 1QUMA 2VX4A 4BI5A 4LAOA 1Q3NA 1EIBA 3HO8A 4NHVA 4IMEA 3QRHA 2WLYA 4QE5A 1UPMB 1JQVA 1J0NA 4LAZA 3B0UX 2XTKA 1R30A 3MV11 2WJDA 4GNVA 3F4NA 2YX0A 1UOKA 1OCBA 3CT2A 1BG9A 4IT1A 4Z08A 1SW0A 4P2VA 3OHMB 4HB7A 5MKGA 3O8AA 3KVLA 2PDCA 1Q2RA 4W93A 1IZJA 3FGCB 1S5WA 5A6MA 5AVNA 3CZLA 4L6HA 3DG3A 2GVYA 2YR1A 4XIAA 4P5UA 1GUVA 2ZFAA 5A94A 3CAKA 5BU9A 1ZP3A 1LOHA 1R3SA 1ZUAX 3NOEA 1OC6A 2J79A 3CPGA 2UY3A 4MJ2A 2D0HA 1QWGA 3OA5A 2PDXA 3AU2A 4LCSA 4U5IA 4NZ4A 5KEZA 3V3WA 1CW2A 2GDVA 4B5NA 4ES4A 4XKMA 4XVDA 2FFIA 1UH4A 4ZXOA 5HPCA 3TA9A 3WJYA 1AW5A 4CN1A 3NQDA 1FHLA 4IMCA 4LW7A 3PBMA 3LCXA 2VCAA 5M3WA 4J3TA 3LSCA 1IXNA 2Z7GA 4RL3A 1UMLA 5BZAA 2V5KA 3LI0A 4MKVA 1HF6A 3BAYA 1HQTA 1OCJA 2IPJA 4LAMA 2ZICA 4CQBA 3KDOA 3C5QA 4HN4A 4J3WA 3PZGA 2R1NA 2DZVA 4H2HA 5I02A 1Q6QA 2YFOA 3MMWA 3W7IA 1ZJIA 1KWGA 3QYSA 1AMKA 1VHCA 3ORWA 3P2VA 3VMOA 3FA3A 1P1MA 1RW9A 3WL0A 3AXMA 5REQA 4UNKA 2WZMA 2V3EA 3E2SA 1WP6A 3W73A 1SZRA 1WB0A 3UY8A 3B06A 1OABA 3N17A 3GXDA 4AD0A 4FR6A 4JS3A 4B5XA 2YL9A 1WKDA 3ZZ1A 1YE4A 3ZR5A 4DX3A 2Y8KA 1W3LA 4J35A 4WIWA 1JRBA 4RW3A 2VZKD 5HINA 3VE9A 3MI6A 3UNTA 3F7JA 3SY1A 3A6OA 3N6QA 3PZQA 4MPQA 5DCDA 2PTYA 3FVMA 3C0JA 4L4LA 4ACYA 3VIPA 3LLDA 4QNWA 4LAKA 3TCEA 1EO5A 3VM7A 5HMSA 3E0IA 5DQPA 2AKZA 4LCRA 2P53A 3ARPA 4F2BA 1VBJA 2D2HA 1DJIA 1ICSA 4NSBA 2FDMA 4Y7EA 1TMQA 3QFWA 4LRSA 5EGRA 1ZCCA 1JAEA 3O6YX 1TQJA 2L5HA 5HNRA 4PUDA 3SN1A 1J0YA 3TYBA 1OK4A 1L9WA 2Y8VA 3I68A 5CCZA 1Q4NX 3I3EA 3NL5A 3SZ8A 4C6MA 2GK1A 5DN1A 4DI8A 1EJTC 3QM3A 3SRDA 4F0LA 2F2HA 1O0SA 4LBUA 2CC0A 3APYA 3A3HA 2QF7A 3UNDA 1FWGC 3TFXA 3TIMA 5D32A 2RAGA 2CESA 1XLEA 1GOKA 1GG1A 3S1VA 4Q7IA 4EPDC 1EGUA 4O0KA 1E6ZA 2OU4A 3W86A 3KHJA 2BY1A 1XG3A 4TQTA 1HJSA 2NQJA 2J47A 4LYRA 3F59A 1LOSA 5DRCA 2TODA 2DSZA 3OZMA 1JGIA 1WZLA 2XIQA 1H2JA 2ATMA 5LA0A 4GE8A 4I9TA 1QXLA 3C3UA 4J5NA 3ARWA 4BFAA 1EOMA 4LXFA 1KGUA 4V1YA 1KV5A 5HXMA 1E1EA 3TE9A 5AYIA 4H00A 2WCSA 4J7RA 2YIHA 3U4AA 5AHNA 3VNDA 4WJXA 3R2GA 3EX2A 4Y8EA 3AIVA 4ZB2A 1AK5A 2NUYA 4LUTA 2FTWA 2ISFA 3BGGA 2W63A 3OGRA 4H7ZA 1RWGA 4GISA 3COTA 1GEQA 3QEZA 3VIJA 3O05A 2NQZA 4V2XA 4CGTA 2VMFA 1F3TA 4FI4A 4DJEC 5SWUA 1Q5MA 4IFOA 2QCNA 4FHAA 1QU4A 5HWJA 1IGSA 2H8XA 2YSWA 4RZ4A 4QG9A 3RMJA 3HB9A 4JN8A 1GT8A 1K7EA 2VWTA 5DCBA 3MW7A 1PIGA 2ZUNA 3VDHA 2DZUA 3M16A 3H4GA 4OE7A 4A29A 1L8NA 2ZRYA 1WKFA 2E1WA 2YLAA 1GNXA 1PTDA 1JJKA 4JYFA 3LHVA 2V9DA 1M01A 3LLXA 5I06A 4MKSA 4FPSA 3CV1A 4OV4A 3W2JA 4M3PA 2MNRA 3U48A 4LTSA 1E6NA 1P0NA 4N7QA 3PPCA 4DO6A 3VOIA 3CUIA 4GI4A 1KM3A 1XH2A 3TVAA 3U3HA 4X9SA 2JKAA 1CEOA 1ML1A 3IS4A 2AAAA 3W7EA 1E6QM 4AIBA 4M6QA 2OQYA 3W1TA 2W66A 3AYTA 2CLEA 2WWDA 3BQ5A 1UQYA 1E43A 4HHLA 3EB4A 1DWJM 7REQA 1WAUA 3CUGA 2VCCA 1N8FA 2GVEA 1IXPA 3V5FA 3C4UA 4NZFA 1RUSA 3C2RA 4DF2A 4YVPA 3VGGA 5FEPA 1HL8A 4IMFA 3GC4A 4N4QA 2XH2A 4POCA 4AVFA 2WZIA 7TIMA 3NPVA 2UWFA 4IFKA 2OODA 3VYLA 1PTAA 2A3BA 4WD0A 4RPQA 3EBVA 3MCNA 4M81A 3T1GA 3LTSA 1JIBA 3N25A 3VA8A 1LT7A 1F4AA 3EWBX 5KITA 3UGVA 2WVUA 4GX8A 1TJPA 5CBBA 1QR7A 4MY9A 1W3HA 4O1FA 1NAL1 2OT1A 2ZTJA 4LU0A 3DBNA 4MTVA 1JCXA 1X1ZA 1QTWA 4TO8A 5D9MA 5BOEA 3CO8A 4GJIA 1MW0A 4LUJA 1DBTA 1VRDA 2IQTA 1EZ2A 3N4AA 3KOZA 3QGAC 2WV8A 4G8TA 4ERIA 1G9HA 3AIUA 3UT0A 3VZZA 1EPVA 5LA2A 4DNMA 1DE6A 4KESA 4WK9A 3PZUA 4KWVA 4UQEA 3UG4A 3ENLA 3B04A 4U33A 2X2YA 4JNZA 4JGDA 2H3BA 4FZIA 3SI9A 4H2CA 2I5QA 1OCNA 1VLIA 5BCAA 1UWQA 2OTDA 5BYWA 5AY7A 4ZTYA 1F73A 1LQAA 3NR0A 1FWDC 2PDQA 4Y9AA 3CV2A 1M3UA 5TF0A 3W7MA 1QNOA 4XUGA 3LCIA 2CBVA 2VEPA 4B2DD 2CFFA 3B0YA 4MNKA 4G9PA 3WQPA 3IV3A 1X7IA 2W62A 3B4UA 3KZPA 1HMWA 5E93A 1B3XA 4CVUA 3NL2A 4N2YA 4R9OA 4KW2A 1KRMA 3CIXA 1SUXA 4PUWA 1QNQA 2ZZ5A 5A8NA 4B9YA 4E3TA 1VGAA 1R7AA 4Z1BA 1TPDA 1YDNA 3RN6A 1H11A 4H7CA 2C18A 1XIDA 5AHMA 1RY8A 3LQLA 3EWWA 4Q4MA 2Z1VA 3E5PA 1V3LA 2W27A 1IR1A 4LF1A 4AIEA 3GUWA 2JEPA 2BASA 5G2IA 3N4EA 1PBGA 1RJQA 4O16A 1TVPA 2GZXA 1PDYA 5A69A 4I3GA 4G5DA 2DSVA 1DQWA 2PBGA 3BMWA 3OIXA 1MRAA 8A3HA 2W3ZA 4XKYA 4I8DA 3B8SA 4L1WA 4X60A 1GPWA 1I60A 1KBBA 3MUXA 3IV8A 4GACA 1OZQA 1S2TA 3H21A 3VNIA 3Q2DA 1IWAA 1S3HA 4C90A 3POCA 2OB3A 1NVMA 3LTYA 3VMNA 4MAVA 1JPHA 1UBSA 1O5QA 4IL2A 4W4QA 3DG6A 3H23A 4ZMGA 4DB7A 4ZFCA 3UD2A 4FAMA 1KCXA 2OX1A 4G1KA 4UFIA 1F6YA 3VNMA 1AD1A 1XD0A 1J0HA 3WF0A 3GAYA 4Q4SA 3L2MA 2E25A 1E15A 3RU8X 1ZCOA 1DWFM 2QQ6A 3GIYA 3ZT5A 4YCPA 3O6DA 3DKLA 3U5UA 5FSDC 4GRSA 1PS9A 1POJA 3NSNA 3GNDA 4ACZB 5DY2A 3UW6A 3LCFA 3KFTA 4RDVA 3SCWA 2XJ7A 4YLWA 4PA8A 1YMYA 2FGLA 4HZ6A 2ZCGA 2PI6A 4QE1A 4YVVA 2PDUA 2OLSA 3WYZA 4K8HA 3CMJA 3LRMA 4QLLA 1XDLA 4JN7A 1WUEA 4DBWA 3EB3A 2EEXA 3SIMA 4WSHA 3NZPA 2ZRVA 2FZMA 4NNAA 1R87A 4BF9A 3LU2A 4M6VA 3TTQA 1H1YA 4EE9A 3ONBA 3K46A 2VC9A 3NUKA 3STFA 3S1UA 1HJVA 3GHRA 3GU9A 1ZP4A 1HKIA 4S3EA 1H0IA 2FTYA 3F1QA 4FF5A 4RLIA 4RZ5A 1QAPA 4NJJA 3CJPA 1BF6A 1TPH1 5CBJA 5E6ZA 4WY0B 3E2VA 5IBXC 1WZKA 2XN1A 1W9UA 2V81A 4I5UA 3T42A 3AZRA 1PYMA 2CYGA 2P88A 2YB4A 4RXGA 3O0KA 1V0MA 4EKJA 1VLWA 3WH5A 2ZA2A 1KCKA 3KUMA 4BY3A 3IUIA 3WLRA 2HEJA 4RZBA 2WZTA 4GUJA 2R9RA 2E09A 3STGA 3F03K 1RP9A 4D72A 2CETA 2V6AA 5ABFA 5CLTA 4R27A 2VXNA 2OZTA 2XYLA 3REQB 4Z2GA 4XZ9A 5B7YA 4EPEC 5ABFB 2E3ZA 4DJEA 4OIFA 2GVGA 4XUYA 1S39A 3NZQA 1RV8A 2QHAA 5JXQA 4LV9A 1FP8A 1ZJBA 1PZ3A 2CBUA 2QEZA 3N1AA 2GJNA 1C93A 4OGZA 4W5UA 1FHDA 1BWLA 1TPC1 1N8WA 3VTRA 3T78A 4P7RA 5U4NA 1WQ5A 3G0XA 1ZB5A 1JZ3A 3PB0A 3HBLA 3NG3A 4KWSA 1W5OA 2Y7EA 4FMVA 4BJHA 1HNYA 5BOOA 4ZSTA 1E1CA 4IGHA 4UNLA 4GY7A 5I3FA 3V1PA 5KZ6A 1FWFC 2QCDB 4FOUA 4MY1A 4HBKA 4QDPA 1S2VA 5AYYA 4W89A 4NAEA 1AUSL 3QQ1A 1P0DA 1UZHA 3L66A 1Q7ZA 2E6AA 1VQTA 1V3KA 4MNMA 4HHPA 1TX2A 4M80A 1A4LA 3EWDA 5G4EA 3A4WA 1GG0A 3EXRA 4H83A 2Y7FA 4LOCA 4GFSA 5EA9A 3UZZA 3N04A 4JFTA 5AYBA 1TUFA 3MMDA 5KINA 3GG7A 3N9SA 2WWCA 3CV6A 2D3NA 2DIJA 2OYMA 1Z32X 4BQ2A 3BVJA 1MUWA 1OGSA 2VQTA 4UOJA 1OC5A 1W3TA 1MYRA 3LCGA 3H7VA 3MTWA 2FQIA 3LHTA 3H2AA 1DEDA 4FX8A 5D2XA 2CWNA 2PP1A 4JIEA 1JCJA 1W3JA 4GXPA 4ZQNA 4ORIA 9RUBA 3CHFA 2V30A 2DSKA 1C92A 3U2EA 4NASA 3XINA 4HA0A 2E5DA 3M9YA 4HPXA 4HT3A 1E70M 1O66A 3S47A 1C91A 1PKMA 4PTDA 2CERA 3RILA 2B7PA 1R3WA 1F5ZA 3N2TA 3CIWA 3LB0A 1OIMA 5G1TA 2XFWA 4XO6A 5F4SA 3B9NA 3ID7A 1XRVA 1A5MC 2C7FA 1YX1A 4ROPA 4Q4RA 1BAGA 1H7XA 1JI1A 4MB5A 2VFHA 2C15A 4AD1A 1JL8A 3GNXA 1V02E 4OZOA 5GJMA 1V6UA 2V5JA 5D04C 1E6XM 4Z1AA 2Z1XA 3N2BA 2V69A 4NX5A 1JUEA 2YCLB 3ZO9A 3BO9A 3QPZA 2J13A 2YW3A 3WMBA 1BWKA 3EYPA 3PAOA 3ZIZA 4WDUA 3NDYA 2ZDRA 5A8OA 3GH7A 4P8VA 3B05A 3QY6A 1ZHAA 1XIGA 2B7QA 1XLIA 3A13A 4IICA 8XIMA 4S39A 1TPB1 1KM2A 1ONXA 4LT9A 3T08A 3W72A 1UBPC 3LRLA 4FX7A 4GO8A 1JXJA 4NL1A 1Y8BA 4C1KA 5C54A 3TONA 4QEEA 4KS0A 3TFCA 2VC6A 2RGLA 4DXKA 3UU0A 4GIEA 3CHVA 1M53A 3FHQA 1JFXA 1EHNA 3IJ9A 4GC3A 4URIA 3LCLA 2D0FA 4NP7A 1TE6A 3QHOA 1CENA 5B7ZA 2XFFA 3N6HA 3GE7A 1EFZA 1XYZA 4GVGA 2Q09A 3WQ5A 3C2VA 2X7VA 2EPNA 4C5ZA 1XF0A 1K4HA 4C6PA 5C55A 1VFOA 4R9XA 1FCUA 4J9JA 1UHVA 5K3VA 1VYRA 1WDDA 3N3TA 3KBMA 5DANA 1IXQA 3PTKA 1M04A 2FLIA 3ARQA 3GR4A 5CJ5A 3T05A 1UYQA 1MQRA 3AI0A 1SQ7A 4ZGYA 3H8AA 3P6LA 5JU6A 3TKFA 3W25A 3IEBA 4UZUA 5FI8A 1B54A 1MXGA 3K8KA 2GUYA 5HUPA 5REQB 2PWHA 3HZ3A 4XBSA 2DGAA 3D3FA 5MKGB 3AUOA 3W7DA 5A8QA 1DJYA 3P84A 4CQAA 1OM0A 4JDYA 3KL5A 5F1VA 4NXSA 3PULA 1PCKA 3I6RA 4MGGA 3VDBA 2ISDA 3KHDA 3NWRA 2BY2A 1HW6A 3USBA 4N6FA 4AUBA 1T6MA 3FW6A 3A9BA 4XD4A 3TC3A 3GH5A 2E6DA 2PP0A 3PPHA 1UC5A 3FX4A 3AWNA 1XKYA 3DYPA 3TH6A 4X2RA 5G2WA 3THCA 2RDUA 3W0KA 2J8TA 3H70A 3ES7A 3M6DA 4H9XA 3SO7A 5BMWA 5DF0A 2VGBA 5AECA 1VFFA 2G97A 5DCEA 5DXYA 3NQVA 5AFDA 3CZEA 4EP8C 2YPIA 2EJAA 4XZMX 1FWJC 3W7JA 2BSLA 4XZNX 1WPCA 2PDGA 2EG8A 3TQVA 4MVAA 5BRPA 3QOMA 1OFRA 2XVKA 1IEVA 1O95A 3T2PA 1XBXA 3NFUA 3HG3A 4PC8A 1SFJA 4H6RA 2WSPA 1SZFA 4C7DA 4ZOCA 3IJDA 1NFBA 3TQ0A 1EJXC 2QLYA 1GYNA 2FB2A 3LM3A 4DUOA 3Q67A 4OFCA 3NNTA 1UOZA 2QDGA 1GVSA 1IWBA 4JTJA 4B2DA 5CLWA 2QR6A 1U30A 3U7BA 4J3VA 3E96A 3QC0A 1NU5A 1DJXA 4UTUA 3FN9A 4LF2A 2BHZA 4Z2IA 3LZ5A 1Q6CA 4I90A 3UYIA 1AH0A 3DC8A 4KGLA 4ZFMA 4AWTA 3HPFA 4GZ7A 3C61A 3VNYA 1JEZA 4QBXA 1JQXA 4LBSA 3KBVA 3NL3A 4EVZA 3ZT6A 3EPOA 2EF9A 3OQEA 4PMZA 1TWIA 3AU6A 1ONEA 1V5XA 3WF3A 3AMDA 1VBGA 1BKSA 3W1UA 1K3UA 4IISA 3FIGA 4PRRA 3MA8A 2XU2A 1WDRA 3KOXA 4HA4A 4QAWA 2GJXA 4LX4A 3BAKA 2IPGA 4PSPA 1VEOA 2GWGA 2JF6A 4GCAA 2FZNA 4KCUA 1R0MA 4XBKA 3KAOA 2PA6A 2DZSA 1J01A 3VPLA 2I5IA 1HKMA 4JTKA 1X98A 1I2QA 3BAWA 3QN3A 2D2OA 3AS2A 4HA1A 4WQ6A 1SFLA 4IP4A 4IQJA 2R1PA 2XN0A 2HBXA 2CLLA 3FSUA 1QHOA 4IX0A 1SW7A 4NG3A 4RNJA 3CNYA 4KRUA 1K8CA 1IXOA 4B5TA 4N9BA 2QJIA 1LLQA 1UUOA 4I6VA 3THQA 3ABSA 3BZJA 3PP7A 1UKSA 4GQ0A 5HNUA 3QQ0A 4IXXA 1ZAIA 4KH2A 1HL9A 5BMXA 3ZXWA 2CKRA 3L21A 3QPYA 3ZLHA 1XGEA 1DTNA 1XIIA 2Z1BA 3ZLFA 1FWAC 4H4IA 3NGFA 4C65A 4AAJA 3P62A 5TD4A 4A3QA 2RDXA 3WJWA 2OPJA 4S3AA 3HG5A 4S2BA 3UWZA 4NAEB 2OJPA 3ABOA 1TJ0A 3OO2A 3R8GA 1NP0A 3DYOA 1I2OA 3PTDA 1I2PA 1W1TA 5I6SA 1QNPA 2WPGA 2A3CA 4O11A 1KXVA 2OYKA 1HVQA 2PZNA 3DFHA 3PUEA 3MYPA 4DZAA 3NXFA 4H9MA 1UKTA 4W8BA 1LDCA 3DFPA 1UWAA 3BMVA 2PC8A 1NM9A 3A24A 2XFYA 2QAFA 4B3LA 4ZE4A 2YBTA 3HGJA 2AL2B 1BTMA 3RJYA 3S1WA 1ZY9A 4IXHA 3WH7A 2RH9A 1PZ1A 1XD1A 3CB3A 4O15A 4L9YA 1JYXA 1DJWA 3UZYA 2C6QA 4JD4A 1BFNA 1F8MA 1PZ2A 3PQIA 5EU9A 1NFPA 2J7CA 3C52A 3CZGA 4UZSA 2X0HA 1UR3M 1PIIA 4IGMA 4O12A 3REQA 3TOYA 1QOPA 3D3AA 4J3UA 3EDDA 5M17A 4O57A 3W23A 3PPGA 4Z2LA 3EGJA 4WGXA 3NSMA 1OF6A 5D02A 3CL7A 2QS8A 3LLFA 3EEGA 4M6UA 1J12A 4LS0A 1N7KA 3O15A 4MAZA 1GKQA 4LB4A 2X0SA 3GNPA 3NQEA 2WSRA 3WFZA 3WK3A 1Z44A 2V2CA 4KPLA 4DBUA 4NJKA 2CLOA 3VM5A 3FLUA 4Q6XA 4MZ8A 4N02A 4L4OA 2HPIA 1U83A 3GVRA 2YCLA 2ZXQA 3GR8A 5CPSA 1R3QA 2Y62A 3LPPA 3WMSA 1B0IA 3M5ZA 2OSXA 3PTQA 4G2DA 1LWJA 5HAOA 2XZ7A 1M68A 2UV8G 1FWWA 4OOZA 1JAKA 5K9CA 2XSAA 4CD4A 1GVYA 4KMQA 3WLQA 4XK2A 2EG7A 2PWDA 4N9EA 3KOFA 5G2HA 3RCNA 4QCFA 2GQ9A 3QKZA 4GH1A 3DCPA 3DHUA 4HNVA 1JD9A 1NDWA 5CEWA 3ZJ7A 1OJMA 4WZHA 1JDFA 5HJLA 2OWWA 4NVTA 3HIJA 3RK8A 3W6MA 3FAWA 3W7QA 4EXAA 2BVDA 1GYLA 3PZOA 2ZC1A 3NA8A 1BSIA 3BLIA 3BG5A 3P60A 4E3VA 3IIVA 3L4UA 4GD0A 1LP6A 3A21A 2QUNA 3JUGA 1VZWA 3AXXA 1UWIA 4ZO9A 1HGYA 4FLOA 3MCOA 1PKNA 1PPIA 2NVCA 1SR9A 3DERA 3RIKA 3BJFA 2QCEA 5CC5A 2XG9A 3R11A 3CXOA 4C5YA 2QPUA 1ZU8A 1E9LA 4YTUA 3M0KA 4YHGA 4FNPA 3UPWA 3TYCA 3NDOA 2ISSA 1VJSA 3N3MA 2OVLA 2HMCA 3L4VA 2QUTA 1LL7A 3QR0A 5GNXA 1FWTA 3EDKA 3TROA 1WAWA 4U5KA 4IIDA 1HJUA 2GVLA 3W26A 3TUUA 3P0XA 1OZMA 1TPFA 3VKBA 3MUAA 1M9HA 4UOQA 4H9TA 4JTEA 4B4HA 2D23A 3T81A 1MW3A 2J4GA 4CQ8A 9XIAA 4PULA 1RALA 3NIYA 1H61A 3MKVA 4JFUA 1ZLPA 2PWUA 5CPNA 3TOPA 3CEUA 3BAJA 4B15A 5BNKA 2R1MA 3AICA 4NNBA 4D71A 3V5CA 3DG7A 1W1B1 1K4GA 1V93A 4W86A 1PTGA 2TSYA 2YA2A 3IACA 3EPMA 2PTXA 4F40A 2FH6A 1RVGA 4J3XA 3OG3A 2QJMA 2O9PA 4IQDA 4INFA 3VKDA 3NPUA 3WL1A 4IFRA 3UA4A 5H2ZA 1XCXA 2ZUWA 4ACZA 3WDIA 3JW7A 4EK7A 1EP1A 3GB6A 1C29A 4N9DA 4C6FA 3HJZA 1WUFA 3WNMA 2VEFA 1TTIA 3GS6A 5F2IA 3CUHA 4WSKA 5T9CE 1Z89A 5EY5A 1LBMA 1MQQA 4XD6A 4WGHA 3AROA 2A79A 3RAOA 2XVGA 3QBUA 2V5CA 3LHUA 4QLKA 2ZZ4A 2BP1A 2DU2A 3CL6A 2Y85A 3VXGA 5C0QA 3R5EA 4US6A 4B5VA 4A3RA 4OKDA 1IIHA 5HJXA 1WDWA 2OFJA 4W88A 1EJRC 1S1RA 3FFSA 4GGBA 3GWQA 2J7EA 3MVTA 1UR8A 4O1EA 1R38A 1RK5A 3T7VA 3C2FA 1KRCC 1FWRA 4AY1A 4BQ4A 3I4EA 3NM1A 1GOQA 3OODA 1J0KA 3CMGA 3JVAA 1WZMA 1TRDA 4S23A 1ENUA 2DH3A 2GSEA 3WCZA 3NZGA 5EMYA 3N18A 1ZENA 5CPQA 1Z3NA 1V03A 2HK0A 1CECA 3M0JA 3C3NA 1OJXA 4W7VA 5I7GA 2REQA 4AIOA 2DZAA 2FDSA 3TN4A 3VD7A 1ODZA 5FACA 4Z2JA 3WH8A 3WNOA 5EMMA 3IRDA 2ZUMA 4HPJA 3PR2A 1BVWA 1HKWA 2QCMA 1GZGA 3UWVA 2ZZ3A 4C6BA 2YOCA 4GVFA 1F9CA 3CQIA 2ZX5A 1ZAJA 2VD9A 1KM4A 4OTKA 2A7PA 1W32A 1EC7A 3ATYA 1UKQA 1Q7QA 3U2OA 2FHBA 4MZ1A 3LNPA 1LOQA 1KFEA 1T40A 3IK2A 3UWUA 2ABBA 3IRSA 1I0DA 4LUSB 4PZVA 3FAXA 1OBAA 2G3FA 3WX7A 4AVOA 4KIEA 3L5LA 4DYJA 4UTMA 3GHSA 3QZ6A 4GZIA 2FZDA 1D8WA 2R82A 1TE1A 3YPIA 3H2CA 2J6VA 4XAYA 3AIEA 1F2JA 2QCLA 2OKOA 2OYLA 2NQ5A 5DMNA 1LBLA 1MQPA 1WNOA 5DBUA 2YBUA 4Z1YA 2CITA 3DOPA 4XAPA 3ECQA 4IOTA 4H8UA 2Z6IA 3T9PA 3B8WA 3ES8A 2C0HA 3SDOA 4CU7A 1W3YA 5J5DA 4NNCA 2O9RA 1GHRA 3L9CA 2Z28A 1FY6A 2PU1A 2WBGA 3M4HA 4AZGA 3UGRA 3S42A 1DQXA 5EMLA 1KKRA 4NRRA 3CTLA 1KCZA 1WXZA 4C91A 5JH2A 5AC5A 2PEVA 1TTJA 1BF2A 3LZ3A 2GPTA 4AC7C 1UKOA 2X40A 2VTFA 2UZ9A 1SZNA 4FLRA 1LJYA 3AZSA 4GI8A 2E6YA 4AHOA 4DJFC 3R8HA 1UH3A 1TIMA 1L6FA 4DWSC 3OZOA 3VIHA 1Q6LA 4XTIA 4KIRA 2E9LA 4OHQA 3LHYA 4A35A 2OWXA 4N6EA 2EHHA 2YCKX 2Z2UA 6TAAA 5FF7A 1YNPA 1I8QA 4JTGA 1U1UA 3BXWA 1KGWA 4OWGA 3UF9A 4DLOA 1MI3A 4P61A 4V28A 7XIMA 1ECQA 3GTHA 3PC0A 1RWFA 1JDAA 3WUBA 4I6KA 3K8MA 3VNJA 2RDWA 4MFEA 1VRAB 1HP4A 3W74A 1RVKA 4EX4A 3KBSA 4JAWA 5D8WA 3VZYA 2C71A 1C7TA 4DLFA 4X63A 1NQ6A 2JIEA 3ABZA 4UR8A 4F8XA 3BAXA 2WHMA 3OBAA 4YHEA 1AQFA 1RPKA 3O07A 3WNLA 3VKJA 1PUDA 4AZ6A 4UQCA 4GGHA 2EPMX 3BURA 1TZ9A 1O5XA 5CPLA 4NT0A 3PB2A 3O3RA 4YTSA 1TZ7A 4D6HA 2OT0A 1TV8A 2GWNA 4LVGA 1KXHA 3FOKA 4QRNA 1K03A 4ADUA 4CNTA 2PDKA 4OV9A 1ICPA 4UTHA 2BY3A 4YS1A 5E9XA 4CNUA 3LNMA 5HR6A 5I3JA 1I9CB 1Q85A 3QC3A 3BOXA 3GVWA 4WJ8A 1Q6DA 4LYQA 2CLPA 2CBIA 4TR9A 3VOGA 3H54A 3WNKA 1WX0A 3KVMA 4LVAA 1NOFA 3PTMA 5KTLA 4UFMA 3PWIA 1RCQA 3QMTA 2UY4A 1K6WA 3GK0A 4HSNA 1AODA 4QXIA 2JGYA 4Z17A 3R0DA 5C9XA 3CTTA 3B8DA 4ML4A 3P81A 1BYAA 4HCHA 3J7HA 4XZLX 4IJCA 4UUIA 3WENA 1XRSA 1SMDA 2VZKB 3R43A 1EL3A 1S38A 1R85A 3GH4A 4HNNA 2PLMA 4QG8A 2Y7DA 2QUMA 3N29A 2RJHA 4O4WA 1LWHA 3OYXA 1FXPA 3MHGA 1X1IA 3WBWA 2OMAA 4Q7NA 2BWGA 2XINA 3H12A 1SO5A 3UJSA 4YJ5A 3QY7A 3AHVA 2OQLA 2YKKA 4UTTC 2VC5A 1F3EA 1LORA 1DL3A 5CSYA 1EDGA 2DDXA 3WD1A 4CUCA 3IVUA 1B4KA 2PF0A 3FK4A 1GW1A 2XWEA 2GVJA 2WMFA 4HHHA 4D6IA 2BXVA 4Q8TA 1P5BA 1S1PA 4ZQOA 4JQAA 1CDGA 1ELSA 3PZIA 3MHUA 2BRPA 2HK1A 5BW6A 4DF0A 5MF5A 2ZTKA 4F0SA 5HATA 4U3CA 5F7UA 3NQGA 4JPGA 3MP3A 3VUSA 1V6VA 1K70A 2A7RA 3E12A 3OOQA 2V67A 3UESA 5IFPA 2GSJA 4CNNA 1OWQA 4U2YA 1B3YA 1J11A 4GBDA 1P7TA 3CC1A 1D7KA 3LOTA 4PTMA 4J2PA 4JIPA 1TKKA 3M6YA 3LD5A 4PUMA 1ZFJA 4A22A 5HDRA 4DUVA 1XIJA 1PJ9A 4JCMA 2PBOA 1OYAA 1UC4A 4V27A 2DVXA 1D7FA 3IJLA 5CPMA 4IGNA 4JTTA 1IIGA 3VI2A 3ZMRA 1UA3A 2GGEA 1FCBA 5K9XA 4UXDA 2ZVIA 4K2SA 3SBFA 4R34A 4NJHA 3CQ0A 1E0TA 1P0KA 4QSHA 1Z7AA 2G8ZA 3KW3A 2IXVA 4C6CA 4F66A 3F5LA 4QCEA 4TX9A 3W22A 2G3NA 4C6QA 1IF2A 4KT2A 2XH4A 3TTYA 1R3TA 2WOQA 3VAVA 3NQ2A 4PTVA 2ZOXA 3KP1A 1MWOA 1C9DA 1BYBA 2ZYFA 5C6MA 1A5SA 1E4IA 3DZ1A 5AHEA 1TJ2A 1B3ZA 3L5AA 4UFLA 5M5DA 1R3YA 2DJXA 4R7WA 2X30A 2DT2A 1MZHA 1O7AA 3LRKA 5LNRA 1W5PA 2Y70A 1N7OA 4Q8WA 1UJPA 3QGVA 3MANA 5CZSA 4AXKA 5FD0A 5GNZA 1WKEA 1REQA 1XGZA 3BLEA 2P0IA 5CZTA 1FDJA 3JZEA 3WLOA 5BXSA 1ZJHA 1ME9A 2J78A 2Z6JA 4PMRA 5U7SA 2OZ3A 4IJBA 1WYIA 1XC6A 1C9WA 4JHMA 2PTZA 4P7NA 3DFYA 3S5ZA 5CC6A 3CV7A 2BZNA 4CU6A 2DSWA 4RX0A 4J3ZA 1X1NA 1MO0A 3W2MA 2HNHA 3PZTA 4H8NA 1AW1A 2HTMA 2QT3A 5D33A 4HOXA 1WDSA 4LUYA 3WDJA 2FZBA 2PRLA 5L9FA 4BI6A 2X8RA 3MWAA 2BHUA 4H7VA 1TREA 1Y5VA 1P0BA 1JFHA 2GOKA 1JPIA 4GUGA 1KFWA 2DIEA 2PDYA 1IWPA 1S5VA 4GIYA 4LGXA 3KBUC 3KS5A 3C0SA 1GTEA 1US0A 2B4GA 4JEJA 4EPBC 3UJ2A 5G4WA 1N8IA 3SM0A 3KBTC 1FH8A 4D1JA 1E1CB 4QDMA 1GONA 1YE6A 1BQGA 3P67A 4CLMA 4RKAA 1MMFA 2YL8A 1XYAA 5AHFA 3UWWA 1JDEA 4JN6A 2QUUA 3TZNA 4X0NA 4H6EA 3GYEA 2CNCA 1NP2A 2WJZA 2WBKA 3CAQA 3LBCA 3LSBA 2PDMA 3JZUA 3PJWA 2VD8A 3SR7A 4I7VA 1A5KC 3P14A 2XGIA 5D03A 2OO0A 4EXBA 4DBEA 1HMUA 1GQNA 1IV8A 3CPRA 1VJIA 2RUSA 3NQBA 4LY8A 3OBEA 3S9IA 1ZS2A 1TA3B 3ZLGA 3DFOA 4F4RA 4NAFB 1ZBWA 3SJNA 2G37A 5FF0A 2J7HA 4FIQA 3W1MA 3B0XA 3FCPA 4JTUA 1EWDA 3LY0A 3TYUA 3QYQA 4M19A 1FCQA 2PDHA 1MNSA 5K9DA 3QJAA 4L4PA 1F07A 3FHAA 3UG5A 4Z2HA 3G0SA 3TAOA 5JUVA 3WJXA 1Z69A 1UWUA 3KRUA 1XP3A 4H19A 1ZNNA 4H8VA 3QSRA 2DJLA 3ITCA 1DIKA 3PVFA 4ZB5A 3NURA 1ISWA 3T0CA 2PWGA 3IT6B 4JIQA 1CI1A 4CKQA 5BRQA 3WEMA 4H9ZA 1A50A 2R24A 1P1XA 1UW9A 5XINA 3IJIA 3QMRA 4PBFA 5H8PA 5EPDA 4GI9A 3N4FA 2FVLA 1JCNA 3NSXA 1X1HA 3RF9A 5JBEA 3TYZA 4V1XA 2Z26A 4JNMA 4AF0B 4QJ5B 4EAYA 3LK6A 2VVNA 5IRPA 4ZQRA 3EMCA 2PP3A 2EJ1A 3RX3A 4JYDA 3SCNA 2D2JA 3THDA 4IUOA 1PZ0A 1OY0A 2C1IA 3PN8A 3UD6A 3SQLA 3E02A 3NVDA 5BU6A 1EX5A 1LL6A 3EWXA 1BPLB 4A05A 4BI7A 3AISA 3VOFA 1X6LA 2WLZA 2E28A 1YNYA 2XIIA 4D6FA 3ZVHA 3MDUA 3HFYA 4Y8FA 2E4TA 3CWOX 4OT7A 1FWSA 1XLLA 2QNEA 2IQ0A 2WYSA 3M5XA 3VE7A 1A0CA 3S8HA 1LG1A 2WVTA 3CQKA 3GDLA 5CZ0A 5LNUA 5A6KA 1E9IA 5HMEA 1VFSA 3AYRA 1Q13A 4KEVA 4AD4A 4I5RA 4OBSA 1IEQA 3C2EA 4MNLA 2WMJA 1J2BA 2YGYA 2J8GA 2YW4A 5EMUA 2BTMA 3R94A 3IARA 4UQDA 5BXPA 3HFTA 2TPSA 3M0HA 4Q8MA 1F76A 4CCEA 1I2RA 3QOKA 3W24A 1LLOA 2DVUA 4TXEA 1SMAA 4K38A 4PB5A 5AKQA 2VHLA 1QOQA 3O2LA 2IKHA 3E5BA 3L2LA 1J93A 2QZRA 4JBRA 1S2UA 3MUCA 4S3GA 3F2BA 2HDJA 2BBFA 3LHWA 1XLCA 2RHGA 2EPLX 4BEQA 3R58A 1DPMA 1KC7A 1KCLA 3K5XA 3GXPA 4AZHA 5FEWA 5FAJA 1B9BA 2DY3A 5E0CA 2A2IA 3KRBA 1CPUA 3MI3A 4JXCA 2QVNA 3AMLA 4E4UA 3TNBA 3GFZA 4NU7A 3OLGA 1S2WA 4DUWA 2Y63A 5LYRA 1JCLA 1E6SM 1E6RA 2OOGA 1KFKA 5FL0A 3EA2A 3RO6A 4PCTA 4CQCA 3AYSA 4IIEA 3G6LA 2XHYA 4ZODA 3UXKA 3TMLA 4BA0A 3GNRA 5DT5A 4U2ZA 4E8GA 1PKLA 1HL2A 2EGZA 4KRTA 4RDWA 1POKA 4MHBA 4JQ4A 4AX7A 4MNJA 2BB0A 1B31A 5C7VA 4Y2WA 1W56A 1K9DA 8CGTA 2BVWA 2HV5A 2HROA 2POTA 5AZ1A 4R53A 1QT1A 2BOGX 3A4JA 4GQRA 2DT0A 4OECA 1YXCA 2J75A 3G1FA 5DELA 4C6EA 5I79A 2WXDM 4Y9OA 2E6FA 3N34A 3NCOA 1YPXA 3C0LA 1HKVA 1E0UA 1T41A 4PTXA 3WIJA 3VIKA 2PD9A 3NQCA 1CZ1A 4GZEA 3AJXA 2VR5A 4R5EA 1TPWA 3VNZA 1EBGA 3NM3A 4KCTA 3GTNA 3VC6A 1S5MA 1EX1A 3MB9A 2YDRA 4IL0A 3IJ6A 4HGXA 4JDBA 1TV3A 1ZBKA 2Y61A 5IXEA 3ZOAA 3G1HA 4XIMA 2IXUA 1L8PA 4M1RA 1YTKA 3W38A 2OOFA 4WJEA 4L6DA 3CBWA 1ITQA 2CLKA 2DUXA 1YPIA 1QK0A 4RNHA 1AH3A 3ARZA 3MWCA 2NSOA 4TV6A 3HGSA 5CGMA 1AL8A 1ONWA 1REQB 3HQPA 3MS8A 3W01A 1SO4A 4QS6A 1O4UA 1H4PA 2C1HA 4YIWA 1V6XA 2P1FA 3CQJA 3T09A 1PDZA 4FNSA 4GYFA 4WEVX 1E5JA 1A0EA 2D20A 2GSHA 2R14A 2I5GA 3VD5A 1C8YA 1V79A 1YNQA 2Z1KA 1SM9A 2C8NA 3MUY1 3S2NA 3R8RA 1VKFA 5C2CA 4PE8A 1W9BM 2ZC8A 4EF9A 4O19A 4J2MA 3K4WA 1F3WA 4UBPC 1HKKA 3OJGA 3UPMA 2FJKA 3NQFA 5CKSA 2G5WA 1WBJA 1TVNA 1LL4A 2ZWYA 3WG6A 4LUSA 3SGZA 5DBTA 5K2ZA 1F6PA 1G6CA 4Q4QA 4Z1CA 2DP3A 2Z0IA 2ZRWA 3HJEA 1N7NA 1XYLA 4U4MA 2VZTA 3RM8A 3E2QA 2D24A 3WJSA 1P43A 4BK9A 1TTPA 1XLAA 2ALRA 1J5SA 4D6DA 2NW0A 4J40A 2PRMA 2G50A 5LZLA 2ACSA 3APTA 4GNKB 3S2MA 2RFGA 2W79A 2DIKA 3KBJA 4EIVA 1XYBA 2EPOA 3S4TA 4V15A 4PFHA 4UTKA 2YXXA 4JIIX 3BSMA 5BXRA 3WBEA 1OADA 2WC3A 3LGGA 1UZDA 1MFVA 4QFUA 1WE5A 4ICCX 5D38A 3UXDA 5C71A 2NVAA 2J27A 4GQQA 1I8JA 1QCWA 2HSAA 4E2OA 1V4YA 1JNDA 1JRCA 1RY0A 5F4WA 2ZZ6A 5FJRA 3BOLA 2OXNA 3BH4A 4XTDA 3O9NA 4JTHA 3WUGA 1SVDA 2GDQA 4PTNA 4ZXLA 3VDAA 2NT1A 4O1BA 1Y0EA 3S2CA 4LANA 2XM1A 3CLWA 2RGMA 4GNJA 3EWUA 4ZE5A 3HOJA 3M64A 3LCHA 3ME3A 2PODA 5JMUA 3SSZA 4CU8A 2WSQA 4IPJA 1LXMA 3HV8A 2CIPA 4EF8A 4P8UA 2GLKA 1WBHA 3UXLA 3N2OA 1H60A 1DOSA 1J0MA 2WCGA 5D05A 1ZBVA 4GK8A 3AALA 2OCZA 2F84A 4NYUA 4JYEA 2GQ3A 1JGMA 4IPIA 1OX4B 3IUDA 4DM2A 1UUQA 5EMJA 4PBEA 3ITLA 3L12A 3WLTA 3MPGA 3ARXA 3WLJA 1W54A 4PMQA 3PAJA 5JVLA 2XIJA 2WSKA 3MO4A 2WZHA 3WF1A 4LYKA 5F2GA 1GEHA 5XIAA 3ZVIA 3LV6A 3GUGA 4ADTA 4XVEA 3BCFA 4EPKA 3BSHA 4DJDD 4PEEA 1XIFA 4DZIA 1NWTA 1XXXA 2A6NA 4AU0A 4IP5A 2ZADA 3KLKA 1QW9A 2R94A 2CZVA 2EPKX 4HMDA 1VPQA 1C8VA 2VRQA 5H8UA 1D3GA 3WD0A 1O68A 4X2PA 1B3WA 1TR1A 4WXZA 3ONCA 1L6YA 4MJMA 4QISA 1SJAA 4HD5A 1XDJA 1JF5A 4L64A 4YTTA 2Q3OA 3KCJA 5CJMA 5ENLA 4O17A 1SZEA 5A6SA 1LRTA 2IKJA 3HV9A 4US5A 3ARSA 1DJQA 1GOMA 4LVDA 5I3GA 4QSFA 3WSUA 3WH9A 1TJ1A 3UWYA 5F2MA 3LG3A 4ZOEA 1AW2A 3TQKA 3BLOA 1KR0A 1RLDA 4HK5A 4JCLA 4UR7A 1W5NA 5DO8A 1NELA 1RR2A 1QI4A 1PVNA 3WEOA 1E55A 1F74A 3A4AA 4IPLA 5C2GA 3DENA 4JKLA 4M29A 3HTWA 4XWUA 3TWAA 3AHXA 3WDPP 2J74A 1QNRA 3LTPA 3BLFA 4HZ8A 3C8FA 2OZ8A 2PMQA 2Y0FA 1VIZA 3RO8A 3W2KA 1X97A 4AZ7A 1YLVA 3DXIA 3H4WA 1VC4A 1ZSXA 2YFNA 4FNTA 2ZX6A 2QMKA 3ZYZA 3T0AA 2R8WA 5HR7A 1KR1A 4RV8A 3AOFA 3UA3A 3WK0A 3B0VC 1U33A 3MSDA 4LS1A 4WLCA 5IDIA 3LBOA 3N11A 4HCDA 3QV9A 1EJWC 3ANUA 1OJNA 1DIEA 4AWUA 3H6OA 1DE5A 3K1GA 1LUCB 2BY0A 4HVXA 1W9DM 2A3EA 4I8YA 1SJDA 4QHRA 3S1XA 4IJRA 4FLQA 3UCDA 4ADSA 3FY1A 2XWDA 4PMNA 2NX1A 1OFAA 1Y5XA 4EOUA 4QP0A 3RGTA 3N12A 1A80A 4GX9A 4Z42C 4HNOA 2PCQA 4JTSA 4L9XA 4G56A 3P61A 2FVKA 1YW1A 4O18A 4XZBA 2YA0A 1XLJA 3CS2A 5FEXA 1UD3A 2PS2A 1U5HA 4E8CA 1V3HA 3UYCA 4JQ3A 3GZAA 1OFEA 2Z25A 3VZXA 2AL1A 4N0RA 3BV7A 2CHNA 2V4IB 3WELA 4RDZA