2WMHA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 in complex with the h- disaccharide blood group antigen.
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
555
structure length
553
Chain Sequence
VQMRTTINNESPLLLSPLYGNDNGNGLWWGNTLKGAWEAIPEDVKPYAAIELHPAKVCKPTSCIPRDTKELREWYVKMLEEAQSLNIPVFLVIMSAGERNTVPPEWLDEQFQKYSVLKGVLNIENYWIYNNQLAPHSAKYLEVCAKYGAHFIWHDHEKWFWETIMNDPTFFEASQKYHKNLVLATKNTPIRDDAGTDSIVSGFWLSGLCDNWGSSTDTWKWWEKHYTNTFETGRARDMRSYASEPESMIAMEMMNVYTGGGTVYNFECAAYTFMTNDVPTPAFTKGIIPFFRHAIQNPAPSKEEVVNRTKAVFWNGEGRISSLNGFYQGLYSNDETMPLYNNGRYHILPVIHEKIDKEKISSIFPNAKILTKNSEELSSKVNYLNSLYPKLYEGDGYAQRVGNSWYIYNSNANINKNQQVMLPMYTNNTKSLSLDLTPHTYAVVKENPNNLHILLNNYRTDKTAMWALSGNFDASKSWKKEELELANWISKNYSINPVDNDFRTTTLTLKGHHKPQINISGDKNHYTYTENWDENTHVYTITVNHNGMVEMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 203
structure length 553
sequence length 555
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08306 Glyco_hydro_98M Glycosyl hydrolase family 98
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmhA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmhA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmhA02
2WHKA 3DC0A 4ACYA 4XX6A 5BXPA 4QAWA 1XGZA 5GNXA 3VD9A 2PBOA 5CPSA 1I8QA 2V5DA 3AS2A 3CBWA 1BG9A 3KL0A 2RGLA 3BAXA 1WKYA 2WC4A 1BAGA 1HKIA 5I5RA 3AHXA 2X0YA 3AMKA 4UTFA 1XV8A 2C0HA 2JIWA 3WQ5A 3PTQA 1OJOA 3NDYA 4UZSA 4PCSA 3AMDA 3VGBA 1CGUA 1JNDA 4QP0A 3TONA 1KWKA 1E1FA 4M82A 2WANA 3J7HA 3IANA 3AQUA 1E0XA 4AEEA 1GZJA 1TMQA 2AOSA 1NP2A 4LXFA 4EE9A 5CQ1A 1EOKA 1QI5A 1W3KA 2EPOA 3FW6A 3SIMA 1XH0A 1UR8A 2YOCA 3WBEA 4U2ZA 2WVSA 2A3CA 2ZXAA 1FH7A 3VD5A 5DT5A 3AS0A 4WKAA 1ZL1A 1US2A 3FAWA 4P8WA 2VTFA 3F4VA 1GUVA 2UY2A 1OGBA 3TTQA 3AZRA 3WENA 3VMOA 1L0PA 3WSUA 2J8GA 4HOZA 3VUPA 2DPEA 4QLKA 3AIVA 1RD6A 2CITA 3EDDA 4MAVA 2UWFA 3ARSA 4E8CA 3ZJ6A 1WZAA 1JI1A 4ATWA 4Y7EA 1UWRA 5BYWA 1JI2A 3WKZA 2VX7A 3VGEA 1Q6EA 2G8ZA 3WNMA 1SFSA 3TOPA 1W2VA 1RWGA 2WSKA 2A3BA 2Y2WA 5KZ6A 4HU0A 1EO5A 2YLAA 3QHNA 1AQMA 4PEEA 1XD0A 3ZJ7A 3F5LA 4E8DA 3L4XA 1GJUA 1WDPA 1HKKA 1MQQA 1WAWA 1GVYA 1LL7A 2GJXB 3MMDA 3PZUA 1Z32X 4M56A 4NF7A 1M53A 2BVTA 1E1EA 2DEPA 1TG7A 1CZ1A 3AHZA 5D9PA 3ZJ8A 4D6JA 2BNJA 1UA7A 3BCDA 3VX1A 3WF1A 5FOOA 4HPHA 1UWSA 4GIAA 4W7UA 1CGWA 2X1IA 3BXWA 1CB8A 3FNDA 2E40A 2UY5A 4CVWA 1UOKA 1HN0A 2V3EA 3AIQA 4PYSA 3VNZA 2WDAA 2UY3A 1OGGA 4E4PA 2W61A 1JF6A 2X03A 2NT1A 4A3YA 5A2BA 2AAAA 4HZ6A 2FHBA 7CGTA 2DSZA 3T2PA 4CU8A 2VQUA 3OZPA 4CD4A 1ISXA 1J0MA 1HMWA 4K68A 2F61A 3CZGA 3SUUA 1AMYA 2CHOA 3PZMA 1JZ6A 2VURA 3MU7A 4B16A 1W3JA 1CXLA 2V3DA 3TTYA 1TVNA 5HDRA 2OSWA 3SCSA 1E15A 1W9BM 5D9MA 4ZENA 2ZXQA 2A3HA 1FP9A 2J47A 4MNMA 1HX0A 3WD2A 4AD0A 1QI3A 3CUIA 4EAMA 3OGRA 1BYDA 3CHEA 4PTVA 1EDTA 2WSPA 1J0JA 4ATDA 2XSBA 1W3YA 3SURA 1EQCA 3N1AA 1JFXA 3W24A 4D1JA 2NW0A 3CUFA 3WD3A 1M04A 3WEZA 3W53A 4AZIA 3PZGA 5EFDA 2ZUMA 1QNOA 1WB0A 1UR1A 1UR0A 4Q22A 6TAAA 2ZX5A 1FP8A 1KGXA 1K9EA 1JYVA 3AOFA 1OJMA 1NWRA 1LG1A 2HISA 1NP0A 3NJ3A 4C7FA 4F9DA 1GQJA 4HA4A 3L4TA 4NRSA 1UD3A 3ZJKA 1NWUA 2A3EA 5DFAA 4CCDA 4QLLA 1PBGA 3VM5A 2A3AA 3WQVA 1ZBVA 3FHAA 1E72M 2EO7A 3HJEA 4TOQA 1HL9A 4UFIA 3HMCA 4WK9A 3VD3A 1NOFA 3AS1A 4XUYA 5D9NA 1JG9A 1G94A 2J75A 3PN8A 2OWXA 4OKDA 1FOBA 5CLWA 2GJRA 2CBUA 1LJYA 1WZKA 4W88A 5FL1A 2YL8A 3ZIZA 1ISZA 1UWUA 3VDAA 3AI0A 2HVMA 2EBNA 5DF0A 1EO7A 5LA0A 5D9OA 2QPSA 1OJNA 1MFVA 3FY1A 3AMLA 4IISA 3AYRA 1I1XA 2XG9A 1VEMA 1CGXA 3PZNA 3QHMA 4FK9A 4M24A 3TTSA 4H04A 3OA5A 4PMDA 1EGUA 2VRQA 3ZSTA 2ZUWA 4DUXA 3QGVA 2XIIA 2D3LA 1GJWA 3NYDA 3WH6A 3GZAA 3PHAA 2YLLA 1FH8A 1ODUA 3ZR6A 5ABFA 2JF6A 1OM0A 3UETA 4D71A 1CEOA 2FGZA 1NM9A 3BMVA 2FGLA 2X05A 3IAPA 2Y8VA 3T08A 1UKPA 1HMUA 4MB3A 3DECA 5AY7A 4CD8A 2DT3A 3OGSA 4AC1X 2E9LA 1R8LA 4MNJA 4ZXLA 4N0RA 4C7DA 3ARQA 4AD2A 2WLZA 2VCAA 4FLQA 3EDFA 2BRPA 1CLVA 4HU8A 1CNVA 2D0HA 1VJSA 2WKGA 2VMFA 1UH3A 2QPUA 2FH8A 1UD2A 4J27A 1K9DA 3BLKA 3VGFA 4LX4A 8A3HA 3WNOA 3OLIA 2DGAA 4UQEA 3UEQA 2JFEX 3SEPA 2WKLA 3N18A 1W2PA 3VO0A 2PWHA 3WIJA 2D23A 5CJ5A 2J7HA 3VGGA 2PB1A 3CZEA 5E0CA 5DMYA 4X0NA 4W8AA 3GBEA 2Q8XA 4CN1A 1VFUA 4P7QA 2UY4A 2OYKA 1B0IA 4GO8A 1JZ2A 1OINA 3GNOA 4UZUA 4XZWA 1JAKA 4GZEA 2G4FA 2D0GA 3WDHA 4OBSA 2BXYA 3BMWA 4CUCA 4WJXA 3SUWA 2VRKA 3ARUA 3GH4A 3OG2A 4AZBA 5A2AA 1WP6A 1G5AA 2BHUA 4JKMA 4D1IA 2J74A 3BLPX 5JIPA 2BXZA 4Z2IA 1CIUA 1TUXA 2D24A 1JD7A 3FN9A 4J3UA 5BCAA 2ZX9A 4PMZA 2C7FA 4UQDA 1HXJA 2DIEA 5HOSA 4WKHA 1IT0A 1MXDA 5A6BA 1QOXA 1N82A 3E1F1 2WYSA 3WUBA 3EMCA 2JALA 1V0NA 3SUSA 5FD0A 3OGVA 4Z2HA 5A2CA 2WMFA 3QR3A 3DHPA 1W1YA 3OLEA 1UR9A 1OIMA 2O9PA 4HTYA 1EOMA 3UG5A 3THCA 3CUGA 2EPLX 4RE2A 1BTCA 3UG3A 4B15A 4JFTA 4OZOA 3NIYA 3FXYA 3VDHA 5A6LA 1BF2A 2VQTA 1QHPA 3A4WA 1WDSA 3GDBA 1U2YA 2QMKA 1Q6DA 4NRRA 1V03A 2JEQA 2YDQA 1Q4NX 4R5EA 2J8FA 3OLDA 1H09A 1M01A 2DSVA 1XHGA 2VI0A 3KE0A 4F79A 1J0HA 4M81A 3I3BA 4W8BA 4GPNA 4DM1A 2Y24A 1NWTA 1XSJA 3SUVA 5JBFA 3WH5A 1F4HA 3RM4A 1NWSA 3T0AA 2CHNA 1GOWA 1G0CA 4JL2A 2GSJA 3ZOAA 2GDVA 3GBDA 5E9AA 1FH9A 4IM4A 1JZ8A 1EA9C 2YDSA 4J3XA 1UZ4A 3CGTA 1UR2A 1WNOA 1ZJAA 1MW1A 3T0DA 2BHYA 4PMVA 1E6ZA 2CYGA 1CXEA 1BYCA 3CH9A 1JAEA 1KXHA 3IJ9A 4HZ8A 3F5JA 3ARTA 2J78A 3ARPA 1QNQA 2BS9A 1RWFA 4TXEA 4M80A 5A95A 1GNXA 3POHA 1PX8A 1E5NA 1GQIA 1E0VA 5I6SA 4JHZA 3W82A 5A94A 4GQQA 4UFHA 2XYLA 1M7XA 1UR4A 1PIFA 3WF3A 1P6WA 5LA1A 1HKJA 2OWWA 1H3GA 4J3WA 1KCKA 3CIVA 1CTNA 5IXEA 2XM1A 5AYIA 3S2CA 1SMDA 4PMRA 4IPNB 5DT7A 1W9DM 3WF4A 1E6QM 2E4TA 1CXHA 2PWGA 1X6LA 1J9YA 1XSKA 1E56A 4GZJA 2XVPA 2FDMA 4BQ2A 2CEQA 1F4AA 1BPLB 2XPKA 3AROA 2RGMA 3W6LA 1C7TA 1PZ3A 3VD4A 5ABFB 1E0WA 1G1YA 1KR1A 3SCTA 1IZKA 4LYQA 3AMCA 2YA1A 2FHCA 1QW9A 4P8VA 1KB3A 2QHAA 3EBVA 3GNRA 1B90A 1GHRA 2YBTA 3WDRA 2XVNA 2JIEA 1J18A 4D72A 3EDKA 1ESWA 4ZE4A 2X8RA 3AIEA 4AYSA 3WDJA 5D8ZA 2O9TA 1NARA 5HPCA 3W25A 1X1IA 5IHSA 3S6TA 1XCXA 3SCUA 1MW0A 4UR9A 1GQKA 4P7RA 4BCEA 1K9TA 1NOWA 5A8QA 4ZFMA 4IUGA 4KGLA 3ZT6A 5AC5A 3N9KA 1UQYA 1VRXA 2YBUA 5F7UA 4PMUA 1E40A 1SYTA 4V28A 3A4XA 1OD8A 4YPJA 1HM3A 2EPNA 5I79A 4WIWA 2GVYA 4PMYA 1TZ7A 4AZHA 4ZEPA 3WEMA 4BA0A 2QLYA 4JIEA 3BAYA 4GI8A 1GQLA 5D4YA 1BGAA 4BF7A 1JYNA 4H8HA 2G3JA 1ODZA 5HBFA 2AMGA 2ZOXA 3HU7A 3T2QA 3VD7A 1JXKA 4AD4A 1RWHA 3EDEA 2WLYA 1D3CA 2XFYA 2WCOA 3B8SA 2NSXA 2Y4SA 3DYOA 1K6AA 5A6JA 3AHVA 5CLTA 4TVCA 3L4YA 1XCWA 1GORA 1SR0A 3CLWA 5A6BD 2XGBA 2B31A 3A3HA 2WW5A 1V6VA 3BGAA 4D6GA 4BZYA 1UUQA 4DWSC 7A3HA 4M29A 4MTVA 1Y7VA 3DHUA 3FHQA 3APGA 3WH9A 1HJSA 2OWCA 1UQZA 1BGGA 1JFHA 1UH4A 5EBAA 2CCRA 4F9JA 3L2MA 4U3AA 1KQZA 3WD4A 4HA1A 2E8YA 3U7VA 4DWSA 1DWFM 3VVGA 5FIPA 1UWQA 3LPOA 3ZR5A 2ZX6A 1EHAA 2E22A 1J01A 3W26A 1O7AA 4D6EA 2WWDA 1E70M 1W1VA 4WSKA 3AHYA 2VCBA 1WO2A 4Z2KA 1W91A 1FA2A 1QI0A 3PZVA 1TA3A 2O9RA 4HOXA 1CBGA 1JNEA 3PZTA 3IJ8A 3LPPA 4MAZA 3WMSA 1BYBA 1MFUA 3NDZA 2VVSA 5CPTA 3L2LA 3VDBA 5D8WA 2XUCA 2CXGA 1OCQA 1DWJM 3KL5A 2VX6A 2OSXA 3MSDA 1MW3A 2V3GA 3PTMA 3AXHA 5GNYA 1RP9A 4GINA 1UHVA 4L4OA 1FHLA 4KMQA 5GNZA 3VIOA 2VOTA 1DWGM 2XVLA 4DM2A 4HMCA 2QV4A 4Z2GA 3RMEA 4AZ6A 1OD0A 1FFRA 3OLGA 1DP0A 3WNNA 4JKLA 1N7RA 1LF1A 4CGTA 1H4PA 2WVVB 4OUEA 3BCFA 4J28A 1W1PA 2E9MA 1GOKA 1OSEA 3MSGA 3VOCA 1RW9A 4PMNA 1V3JA 3VDCA 2BVDA 1EQPA 5DEZA 4CU7A 1WE5A 4CD6A 1QBBA 4B3LA 1EHNA 3BSHA 3WF2A 1HP5A 1N7QA 1W9PA 3WQ4A 1EDQA 3GH7A 1RH9A 1V3KA 1OB0A 4PN2A 4J7RA 1B3XA 3CMJA 1QPKA 3M07A 2ZIDA 1GOIA 1V3LA 1N7OA 3AFBA 1PX4A 2E9BA 3WF0A 1YQ2A 3OBAA 2XVGA 4AZGA 2WMIB 1L8NA 2CESA 3MUZ1 1VFOA 1OWQA 5GPRA 3WL0A 4W93A 1ZS2A 1DWAM 2DH3A 1ZBKA 4Z2LA 2WZHA 5CGMA 5JBEA 4BQ4A 2GK1A 4V2XA 4W5UA 1XC6A 4N42A 2ZXDA 2YA0A 4WKFA 4CCCA 1HP4A 1GOOA 5CSUA 5I2UA 1JZ4A 3IJ7A 4YHEA 3PBGA 3MV11 2V3FA 3WFLA 2W67A 2WK2A 2V38A 4W85A 5A8NA 1O6IA 4QCEA 3VPLA 2OSYA 1WZMA 2J7DA 2PC8A 4QCFA 1C8XA 5AC4A 2EPKX 1OGSA 2VVNA 3WL1A 1E6NA 2VX5A 3WNPA 3VIJA 4MB4A 1HJXA 4J3VA 3SCNA 5CZKA 3WD1A 1V3HA 1VBRA 5BXTA 2X0HA 1E43A 1BQCA 4MJ2A 4FMVA 5FKYA 5ABGA 4D6IA 2YA2A 3CTTA 5HNNA 3BAWA 4TUFA 1OT1A 1CENA 2VT0A 3CUJA 2DSWA 1Q6FA 4ATLA 4U31A 3VIIA 4P7OA 3UR8A 5C71A 2WMGA 1C8YA 4Q7NA 3ZQ9A 2E8ZA 1PAMA 1JD9A 4DUWA 4L4PA 1H49A 2D22A 4KGJA 5BRPA 1UWIA 2ZUVA 5I77A 1QNPA 1ITXA 3EMZA 2W63A 2D20A 1MWOA 4BQ5A 2OYMA 3AICA 1B2YA 1UKOA 2VRJA 3BC9A 4CD7A 3GXFA 3GNPA 1NOUA 1C3FA 3BSGA 4URIA 2GJPA 2DIJA 3N04A 2W92A 1E4MM 1UKTA 1JZ5A 3D3AA 3WEOA 4CKQA 3VMNA 3PZQA 1RWCA 4JHOA 3VMPA 1EDGA 4KH2A 5A6MA 2WWCA 4B9YA 1UD4A 4UFKA 3I3EA 3T0BA 4BS0A 3AISA 4EKJA 1KFWA 1JZ3A 3D5HA 1QVBA 1LL6A 3WH8A 3MMUA 1N7PA 1E6XM 1ECEA 3RDKA 3KWXA 2VZSA 4JFVA 1GPFA 3T2OA 1CXFA 2D1ZA 1XD1A 1CDGA 5BWFA 2BY2A 1DWHM 1LWHA 4GKLA 3W81A 3RPMA 2ZUUA 4TX8A 5A6KA 4DWSD 1LLOA 4TX6A 2WC3A 3CZJA 3PTKA 3VIPA 2WVUA 1MYRA 3NSMA 1TR1A 3BAKA 4MPKA 3WFZA 4DWSB 1HJUA 3PZOA 4ACZA 1V0LA 5C70A 2BRWA 1BHGA 4CD5A 1UKSA 2EPMX 3WH7A 2YJQA 4JKKA 2EQDA 4FLOA 1M03A 5E0FA 4TTGA 4IPLA 1BG4A 3L4WA 1TA3B 1NQ6A 1H41A 1PX3A 3ARYA 1E5JA 5A8PA 2J25A 4YHGA 4KWUA 3WMBA 2ZE0A 3SCPA 3K8MA 5E09A 3GXIA 5E6ZA 2VZVA 5I0DA 1FFQA 1AQ0A 2J4GA 1B3WA 2BFGA 2WXDM 5HPOA 4U5IA 4W84A 3WNKA 1R86A 3K1DA 5M17A 3N17A 5IFPA 5LA2A 3KEHA 3WQWA 2QMJA 3GH5A 3U5UA 1F9GA 1JZ7A 6A3HA 2WHLA 3A6OA 2VNCA 4AXNA 1JIBA 3AJ7A 3SCOA 2NT0A 5E6YA 3QOMA 1WZLA 3GYCA 1MXGA 3CZKA 3NCOA 2J77A 3GXMA 2BY0A 4JAWA 5I3DA 2CBIA 1CWYA 2WBKA 2EXOA 1C93A 4AWEA 4HP5A 1UD8A 1E73M 2VZTA 4E2OA 4AEFA 3VTRA 3N11A 1A3HA 3MUIA 3WDIA 2G3IA 2PI6A 4PUEA 2D3NA 4FF5A 5KEZA 1KBKA 2WMHA 3ALGA 1AVAA 1H0GA 1VEOA 2WAGA 3GTNA 4PSRA 3MMWA 2YIHA 4S3KA 5CG0A 4WLCA 1KXQA 1W1TA 2WVVA 3HN3A 2XM2A 2ZUTA 4NZCA 4D6DA 4JFSA 3VILA 4W86A 1C82A 1UYQA 1NH6A 1TFVA 2VX4A 3EDJA 1AQHA 4LQ1A 3L4UA 1LWJA 2XHYA 3ARWA 4H8UA 1GONA 3ARZA 2XJ7A 1KXTA 2X2YA 4TVUA 5A1AA 2GK1B 2XWDA 4A3HA 3VGDA 1LG2A 1E6SM 3AXXA 4PCTA 2CETA 4OOZA 4P8UA 1RP8A 2WMIA 2XWEA 4MNKA 4PMOA 4AZCB 4HMEA 1ISYA 1E3ZA 1HKMA 1QHZA 1BYAA 2J7CA 3W37A 2W4XA 1KBBA 1OT2A 4HZ7A 5AYBA 3WUGA 1D2KA 3VGHA 1X1NA 2Z1SA 4WSJA 2J79A 2BV9A 2PF0A 2W91A 1J0YA 1VIWA 4C7GA 1V08A 2JF7A 3VIFA 4PTXA 1UWTA 2VZOA 1X1HA 4B3KA 2GUYA 5GQBA 4R27A 1LQ0A 3TP4A 3AYSA 4PMQA 3WNLA 1VFMA 3CZ8A 4H41A 4LGXA 1G01A 3ZSSA 2DDXA 2FH6A 1TVPA 2YL5A 4LPCA 1E4NA 4P8XA 2PWFA 2ESCA 2DT2A 1CPUA 3LPFA 3NSNA 2CKRA 4WF7A 1GOQA 2DSUA 4PBGA 1OIFA 3UERA 1CXIA 3WDPP 1X6NA 2V5CA 4GO9A 1JYXA 5BXSA 1Q6CA 4UFMA 1J10A 1ISVA 2MANA 2ZX7A 4QDMA 2Y8KA 3AHTA 3W6MA 3OZOA 1XH2A 4UOZA 1VF8A 1HJVA 2G3NA 2J7BA 3BH4A 1U30A 3U7BA 3W29A 3WELA 2E3ZA 2VZUA 4MDOA 5A8MA 3K4AA 1JXJA 2JEPA 3VKKA 4MADA 1JYWA 4W89A 3IK2A 3POCA 1H2JA 2PWDA 2BRVX 2E0PA 4HOWA 4P7NA 5BXRA 4OOUA 1ZBCA 1EGZA 1W9VA 1PZ2A 4AMCA 4FLRA 4JFUA 4AISA 1VJZA 5E70A 1TE1A 2VL4A 3M7SA 2CERA 1J0KA 5HXMA 2WMKA 1XYZA 4QLJA 3WN6A 4AIEA 2QF8A 2W62A 3ZM8A 5IFTA 5A69A 4GXPA 4OBRA 4ACZB 2VO5A 1V0MA 3GM8A 1E6PA 2EJ1A 5CGTA 2YDRA 4UOJA 1OJPA 5EMYA 2GDUA 1E71M 3LMYA 3AIRA 2ZWYA 4PTMA 1HL8A 1PEZA 3TA9A 3MV01 3TTOA 1C90A 4CVUA 4H8VA 3ARVA 3KL3A 3K46A 4ML4A 1GHSA 1B3ZA 2WHJA 1X1JA 3UG4A 1QHOA 1W3LA 1DTUA 1XYFA 2D0FA 3A4AA 4YN5A 3L4ZA 4MB1A 1EIBA 3ZT5A 8CGTA 3AIUA 3VNYA 1MQRA 5TD4A 2J7FA 1JGIA 1E4LA 1E4IA 3JUGA 1B3VA 1ZBWA 1IV8A 3RM9A 4CN4A 3MKKA 3AIBA 2TAAA 1BVZA 3MS8A 7TAAA 4CCEA 1J12A 5I23A 1CECA 3DYMA 2ZWZA 1E3XA 4UCFA 1V02E 4W7VA 1UZ1A 4U3CA 3K4DA 2CPUA 2ZX8A 4XB3A 4H7VA 1ISWA 4AZ5A 2XFFA 3RCNA 1A47A 1W3HA 3I3DA 4J3TA 1VEPA 3N15A 2YL9A 1PIGA 4ZXOA 2BY3A 2WC7A 1MVYA 1J0NA 1J11A 2VUYA 3W4RA 4GZIA 3ARXA 4UQAA 1MQPA 2DT0A 2VC9A 4GI9A 1ZU8A 1CXKA 3O6AA 1V0KA 4JZ5A 4NI3A 1XSIA 4AD3A 4TTUA 1JL8A 5FL0A 4UQ9A 1UG6A 5EFFA 4LYPA 1VFFA 4D6FA 1R85A 1R7OA 4UFJA 1B9ZA 1V3IA 3M46A 2O92A 1KR0A 2WM0A 3NSXA 2WVTA 5DO8A 3SCRA 2W66A 2J7GA 1N7NA 1DHKA 1Q6GA 1FHDA 1QNRA 4AZ7A 4JFWA 1B1YA 2PWEA 4UNIA 1BSIA 3T09A 4PSPA 1ZJBA 2DSKA 3M6DA 4PRWA 3EYPA 2XTKA 5M5DA 2IXVA 2BY1A 4W7WA 3RIKA 4GI6A 1EXPA 1E55A 2WHMA 1KXVA 3VU2A 1KQYA 3RJYA 4V27A 3DYPA 4D6CA 2CIPA 1H1NA 2Y5EA 1ITCA 4XZBA 2ZUNA 4AZCA 5M03A 2IXUA 1W32A 1PPIA 1BVNP 3ZMRA 4KRUA 5A8OA 4AD5A 2XSAA 1S46A 1DWIM 1B31A 3QHOA 6CGTA 5M3WA 4BQ3A 4A4AA 3CO4A 4DUVA 4HPGA 3RJXA 3SUTA 2WMJA 3WDQA 2ZUSA 3O9NA 2G41A 2CBVA 3ZO9A 1W9XA 4TVDA 3AIWA 3A47A 1SMAA 3VINA 3VIHA 4P7LA 1C8QA 4LYRA 1DEDA 4HA3A 1HM2A 2YKKA 3VIKA 3RILA 3CHCA 1C7SA 1W9UA 1VENA 1CGYA 5JIWA 2BHZA 2Z1KA 3N13A 3B9DA 2WPGA 3B9EA 1B30A 3K8KA 4MB5A 3B9AA 3THDA 1UD6A 4UQBA 3CZLA 4QFUA 3OIHA 5CPQA 4JL1A 1QI2A 1IZJA 1UKQA 2WCGA 1CGVA 1OBAA 2DT1A 4AW7A 3MUY1 1J0ZA 1LXKA 3G6LA 3N12A 1HT6A 1V3MA 2CNCA 2Q1FA 3CHDA 3WQ6A 3G6MA 5C8BB 1ZB5A 3AS3A 4ZE5A 5FCZA 4F8XA 3WUFA 3U57A 5CXPA 2F8QA 1I1WA 1C92A 1R87A 3ALFA 5BROA 4M8UA 4F66A 5IHRA 3WBAA 1V6WA 3PZIA 3W38A 4GQRA 5BRQA 1KGWA 1HVQA 1D7FA 1JF5A 3U5YA 3VX0A 5A3HA 3O2LA 1HJWA 2WCSA 1HF6A 3LPGA 1HNYA 2DQXA 3EMQA 1JDAA 4UQCA 2G3MA 5ABEA 4B9ZA 1EH9A 1BLIA 1HJQA 1U33A 5EB8A 3RO8A 1V6UA 2WNWA 4U33A 4NSBA 1WDRA 3WUEA 1F1SA 5A6SA 5JBDA 1UD5A 4JCLA 3UR7A 2J62A 1KGUA 2J7EA 3KZSA 1QBAA 3II1A 1KCLA 2CBJA 1GOMA 4CN6A 3F5KA 1I75A 3ZT7A 4AD1A 5LYRA 2O9OA 3AXIA 4AY1A 1GW1A 4X9YA 4Z2JA 1XH1A 5ABHA 3L4VA 1H0IA 4PMXA 1C91A 2FHFA 3WQ8A 5IDIA 2PBGA 1H5VA 4W5ZA 1MW2A 1HVXA 1E6RA 1BFNA 3AMGA 3WMCA 1YHTA 4EANA 3CMGA 1CGTA 2WZIA 3QOKA 3ARRA 4W87A 1WCGA 2XIBA 2BVYA 4EK7A 3W27A 2GJXA 3UCQA 2WCAA 2IUZA 1HIZA 3GXDA 1LL4A 1RWAA 4PTWA 4JCMA 4FLSA 3SCWA 3MO4A 2D2OA 4H2CA 3CHFA 1VB9A 3IAQA 3VIMA 3UESA 3SCVA 5I24A 2VR5A 4OIFA 2CKSA 1QW8A 2WZEA 4XV0A 3ECQA 4HMDA 4MDPA 3VIGA 4RL3A 3SCQA 5ECUA 1VAHA 1GCYA 4U2YA 1JDDA 3W0KA 2XVKA 4U5KA 4AIUA 3PZ9A 3WD0A 1XRVA 1G9HA 2EEXA 2X09A 1WDQA 5I78A 2XGIA 4M1RA 5CSYA 4D6HA 2GFTA 2VCCA 1QI4A 2ZXBA 9CGTA 2WBGA 2C8NA 1VBUA 1V02A 4W8LA 1JDCA 3CPUA 4RE3A 3MANA 1GVIA 2VJXA 1PJ9A 1K9FA 2XFRA 3K8LA 1RPKA 1H11A 1US3A 1KWGA 4AIOA 1B3YA 4S3JA 3BAIA 1TCMA 1V6YA 2VR4A 3W28A 4X0VA 1V6XA 5JUVA 4OJYA 2OYLA 4PUDA 1LOHA 3CUHA 2DH2A 1E9LA 3OB8A 1J0IA 3AZSA 1R7AA 1CYGA 4MNLA 3VM7A 2YL6A 2F2HA 4UFLA 4KRTA 1CLXA 1WPCA 3BAJA 2OLHA 3NUKA 3WY1A 2WB5A 5A6AA 1HN1A 4UOQA 1QNSA 3FAXA 4RE4A 4J3SA 4MJ4A 2W5FA 2JE8A 2ZICA 3AZTA 1UA3A 1LXMA 3MUAA 2E24A 3RM8A 4CU6A 1UH2A
chains in the Genus database with same CATH superfamily
5FF3A 2PLMA 1V4YA 1AUSL 4DYKA 4Q8MA 5BXPA 1XGZA 1FBAA 2OELA 1IR2A 5CPSA 1WOAA 3CBWA 3S1UA 2G5WA 3KL0A 4JN6A 5MKGB 1EJUC 3W22A 1KFLA 4B90A 4IHCA 4UTFA 4IJCA 4RXGA 2NVDA 3WK1A 4UXDA 2G50A 3KM8A 1I2PA 3ZXWA 3VGBA 4MPQA 3TONA 1T5AA 2ZZ5A 1KWKA 4M82A 5AYYA 3T7VA 5K4ZA 3TJXA 3BO9A 3NZ1A 3J7HA 3AQUA 2GOUA 1N7KA 1OK6A 1R6WA 1XDJA 3GUWA 3L21A 2PDJA 3W86A 3NXLA 3C2YA 3APYA 4TMBA 2PRHA 1XLIA 1EOKA 4L6DA 3W1AA 4UTKA 1NQKA 3FW6A 3SIMA 5AHMA 1C9WA 1UR8A 2OQYA 3SRHA 5LIWX 2A3CA 2ZXAA 1FH7A 1Z41A 2J24A 3FAWA 4P8WA 2GQ3A 3E2QA 1DVJA 3LSBA 1GUVA 2UY2A 4PULA 3ME3A 2PD5A 1ONWA 3AZRA 4M19A 3WENA 1FWTA 5EKYA 4NILA 1EX1A 4PFHA 1L0PA 2YEPF 4H1ZA 3W1LA 1A4LA 3RHGA 4QLKA 3PUDA 4O13A 3AIVA 4X60A 4QJ3B 3TU9A 1RD6A 3UZXA 1XLJA 1EJSC 4MFEA 2YCEA 4MAVA 3ARSA 3LDVA 3NL2A 5H8PA 3GIPA 1RUSA 3CV2A 3F4WA 4Y7EA 4HNNA 4A8RA 2ACRA 1JGMA 3VGEA 1Q6EA 3NQDA 4MJMA 1VCGA 5KZ6A 1XD0A 3H23A 3UPMA 8TIMA 3L4XA 3ID7A 1JPKA 2WJEA 1GJUA 1WAWA 2C79A 3GIYA 3CK5A 3L68A 1GVYA 3ATYA 1MUWA 3TR2A 2X1UA 4ZO6A 4F0KA 1M53A 2BVTA 1E1EA 2WQPA 4DELA 1IIHA 3ZJ8A 3E12A 1NF0A 1RZMA 4HPHA 8RUCA 1NJJA 3S2MA 3CQKA 3E0LA 2UY5A 2NV1A 4PYSA 3SJ3A 1EP1A 4E4PA 1JF6A 1GTEA 2GGHA 2NT1A 3WQFA 1UP3A 3S42A 2AAAA 2FHBA 2DSZA 4DN1A 4CU8A 1TPUA 4RDVA 4YU1A 1H5YA 3DDMA 2HV5A 1GWJA 3OVPA 1AMYA 3C0LA 5C9ZA 3MU7A 1VHCA 2GL5A 2YX0A 4CEXC 1LQAA 2V3DA 3TTYA 5REQB 3W73A 2DZUA 4HMNA 1LORA 3D46A 4JTJA 1JDEA 1W9BM 4ZENA 2V6AA 4LC8A 2EAWA 4Q4SA 4AD0A 1NY1A 2B4GA 2E09A 2NSOA 2DZXA 4DXKA 3CHEA 5KZDA 5HQLA 1X8FA 1EDTA 1XIFA 4HIBA 8XIMA 1EJWC 3N1AA 4HGXA 3R8GA 1M04A 3V75A 4H7ZA 2BGQA 3W7IA 2OQLA 4Q4PA 2ISWA 1UR1A 1TJ1A 1CB7B 3FGCA 1H50A 1LBFA 1K9EA 4Q4MA 4DBSA 1JYVA 3TJIA 2QCLA 3IARA 1FDYA 3LSCA 4O0QA 4D9PA 2HISA 1NP0A 1O95A 4NRSA 5DFAA 3N3MA 3KTXA 2PDLA 2A3AA 1ZBVA 5LNUA 1E72M 4BK9A 2OTDA 3VYLA 1PKMA 2YCJA 4IIHA 3GTFA 4XUYA 2E28A 2OWXA 2WZMA 1XIMA 4FX7A 2YL8A 3ZIZA 1UWUA 2HVMA 3TYZA 3KCLA 5DBTA 1U1HA 4PBFA 3RPDA 3HA1A 5CPNA 4AY8A 1TPVA 3MHUA 4YXGA 1IIGA 4GX8A 4LU0A 1FKXA 2GSEA 2PZNA 3PZNA 5I07A 3B03A 3SY8A 4H04A 3N6HA 4GYKA 5FEPA 4DUXA 1KD0A 2LLEA 4ADUA 1GJWA 2OU4A 4K7YA 4J1OA 1ODUA 2JF6A 4D71A 5CC3A 4LW7A 1WYIA 3IAPA 2VGGA 1HMUA 2FKPA 4MB3A 4E2BA 3DECA 5D04C 2DT3A 3R2GA 2OR2A 4AC1X 5IBXC 4E38A 3OW1A 4GXMA 2HK0A 2C3ZA 4C7DA 3ARQA 1TWIA 3QF0A 3NGJA 1QW7A 3AYTA 2VC5A 1Q2RA 2VCAA 4MUPA 4HU8A 4P5UA 2D0HA 1VJSA 2WKGA 1UH3A 3UJEA 2FH8A 1UD2A 4JIIX 3T0TA 1QU4A 2FTWA 3OLIA 4R88A 1UB3A 2R14A 1WX0A 3N18A 1W2PA 4ZCWA 3VO0A 2QJNA 3E2VA 1DOSA 1P6CA 2J7HA 3VGGA 3UZYA 2PB1A 4ASTA 4X0NA 4W8AA 4Z17A 3GBEA 1VFUA 1IEQA 4P7QA 2UY4A 2OYKA 2RHGA 3IRDA 2QIWA 3KP1A 4UZUA 2CZEA 3MKVA 4AWTA 2G4FA 2FZNA 3E0VA 4UUIA 3IGUA 1V93A 3SUWA 2NXIA 2IQDA 1XWYA 3ARUA 3GH4A 1PIIA 2PU0A 3OG2A 3PJWA 5A2AA 4DPQA 4D1IA 1G5AA 2NQJA 3BLPX 1VFSA 3W85A 3QMSA 2FVLA 1M7JA 2D24A 3NPVA 2C18A 2P88A 3QW4B 2C7FA 4FNPA 1HXJA 4MM1A 2R1LA 5J8LA 4ERIA 3W7KA 3GRIA 3PNZA 3LCHA 1A5MC 3WUBA 4LAOA 3OGVA 4Z2HA 3N25A 3QR3A 3O63A 5DMNA 3RCMA 1DPMA 2QDDA 3QQ1A 1UR9A 1IXQA 5DELA 1OX5A 4RZ5A 3THCA 3CUGA 1GYLA 3AO0A 3G1VA 4N9BA 4JFTA 3VDHA 1BF2A 1U2YA 1Q6DA 5FAGA 2FQIA 3O05A 4F2UA 1Q4NX 3WX7A 1DIOA 1H09A 2PTYA 1PTGA 2DSVA 4F79A 3KE0A 2Y24A 4HHPA 4RX0A 1EA0A 3P14A 4R7JA 3S4TA 1OC5A 3FVMA 1E1CA 4XG1A 4QQUA 3B0VC 2F7FA 4JL2A 2GSJA 1SW7A 4M0XA 4H9MA 4BHYA 2GDVA 3HFTA 2YDSA 4HYWA 1G4PA 2EG6A 1XIHA 1UR2A 3WG6A 4FI4A 4K8HA 4PMVA 2CYGA 3FGCB 3W2LA 5KITA 3WO8A 3REQA 5LXEA 4HZ8A 1QOPA 5FJPA 4DF1A 1I2QA 1GNXA 3LBCA 3TYEA 1IEXA 1L6GA 4JHZA 4LSBA 1RHCA 1M7XA 4FXFA 4D2JA 3WF3A 1Q4WA 1P6WA 4JNMA 3DESA 5B80A 3URAA 4J3WA 2EKGA 3CIVA 5IXEA 1MZRA 3H22A 5AYIA 4Z0JA 1TMLA 3WJSA 1ZJHA 4Q8VA 4PMRA 2E68A 1ADDA 2PGRA 1W9DM 4K8GA 3TIMA 3APTA 3QBUA 4ERGA 4N9CA 2WM1A 1E56A 3BGJA 4BQ2A 4ZB0A 3GB6A 5BMXA 3W71A 4EPDC 3FIGA 3GYEA 4ZB2A 2KXSA 1QO5A 1YADA 4V15A 2Y7DA 3TWBA 9RUBA 4LB4A 1RD5A 3E74A 1KR1A 4O57A 4BEUA 3SCTA 4LYQA 2NWRA 1QW9A 1OX6A 4P8VA 2QHAA 3GNRA 3NQVA 1GHRA 4XKYA 1SZGA 2XVNA 2EJAA 4WQ6A 2JIEA 1XINA 1UMLA 2NVAA 3LHUA 3V5CA 1RQHA 1D8WA 2GOKA 3NQMA 3R79A 4ZE4A 4IZGA 4IX0A 1V7AA 3RLGA 1TKKA 1X1IA 1B5TA 1K6WA 2J88A 5IHSA 1XCXA 3SCUA 4PB3A 4UR9A 3OEXA 1J2BA 1D3HA 3TFXA 1TJ0A 1Q6RA 4ZFMA 1UBPC 5C2XA 1P5BA 3NAVA 4DJEC 1ME8A 3LBOA 4V28A 3A4XA 2G95A 1PE1A 4YPJA 5BNKA 4Z42C 4AZHA 4BA0A 2DZSA 1WBJA 4YIWA 4GI8A 3ONBA 3TAOA 3W7JA 4BF7A 4DHGA 1DQUA 4E3TA 5HBFA 1PKNA 2AMGA 3VD7A 2PRMA 2YGYA 1JXKA 3GS6A 4AD4A 1HGYA 1D3CA 1I2RA 5CC7A 1VPQA 3AWOA 3OOQA 2O4QA 4GFSA 3H7VA 1RY8A 4J4KA 4TVCA 3L4YA 1XCWA 1GORA 1UR3M 2ZVIA 2B31A 3A3HA 4HNOA 2RJHA 4L1XA 4J9JA 2O4MA 2A21A 4DWSC 3WH9A 4PCPA 5CPOA 1OHLA 1JFHA 5T26A 1UH4A 3STGA 2ZRUA 3MSYA 4XBKA 5LKYA 2PP0A 4QAIA 1RR2A 3PUGA 2OEKA 3ZR5A 3C52A 1PO9A 2WWDA 3P5YA 5D30A 1ZLPA 4WSKA 2D2GA 1WO2A 3NG3A 1XI3A 1M5WA 1SZNA 3GVWA 3ERPA 1CBGA 5D37A 1JNEA 1WBHA 3H70A 4AU0A 1BYBA 2Y7FA 4XTIA 2PCEA 1E1CB 3VDBA 2XUCA 3MQTA 3LV6A 2RAGA 5D02A 2OSXA 2V3GA 4CQCA 1F6YA 3UWZA 3GHSA 1V51A 3ABRA 1UHVA 1SFLA 2VOTA 3G5EA 1GVSA 1TWSA 3NNTA 4Z2GA 1S3TC 1A5LC 2GWGA 4IQEA 4LYKA 1MUMA 4CGTA 1EF2A 5D2WA 2QR6A 3BCFA 3TW6A 2AQOA 2E9MA 1SO5A 4I6VA 3MSGA 5CZTA 1GVRA 4PMNA 1V3JA 1W5PA 2ISFA 2Z00A 4CU7A 3H2AA 1ZPTA 4UMAA 3IEBA 3BSHA 3WF2A 1W9PA 1N7QA 5EU9A 3GH7A 4ORIA 5G2IA 3CMJA 2ZIDA 3AFBA 3WF0A 1P6BA 3CAVA 5ENLA 1T8QA 1L8NA 3MUZ1 2V5KA 1BVWA 4ALDA 3O07A 4FHAA 3TXZA 1TV5A 3UJRA 1DWAM 2PUZA 4Z2LA 1GK8A 1VS1A 3PBVA 1XC6A 2FYMA 5HANA 2ZXDA 4CCCA 3S5ZA 5I2UA 3WFLA 3R89A 3NVDA 4XKYB 5EMJA 3TW9A 3QQ0A 2PC8A 4IP7A 4QCFA 2GJLA 2VVNA 4LY8A 3NQ6A 2X0HA 1E43A 4Q6JA 4MJ2A 5FKYA 3FVDA 5HNNA 1F3XA 4WOZA 1S5NA 2WSRA 3G18A 4TUFA 2VT0A 1XQKA 4P61A 4ATLA 4U31A 3UR8A 2J13A 5FF0A 1C8YA 1H7RA 4Q7NA 3W7QA 1IGSA 2OOGA 1K8YA 1TTIA 2YSWA 1UP0A 1VJIA 2D2HA 3DERA 5G4HC 2XIQA 4KWWA 4ENLA 2OO6A 2GGGA 5K2ZA 4HU4A 4NJJA 5HNRA 3G1HA 2GJNA 2C19A 2W63A 4CD7A 4M51A 3GXFA 3GNPA 3V1PA 3DHDA 3VKAA 3M41A 4K7VA 3DFOA 3KOFA 3VOHA 2W92A 3DFPA 1E4MM 3BGGA 4NXSA 5FJIA 1CW2A 3DKLA 1IT8A 3VMNA 3PZQA 1RWCA 4JHOA 3VMPA 4R3UA 3N2CA 4KH2A 2WWCA 2GQ9A 4B9YA 2PDXA 3W70A 2VZKB 4BS0A 3AISA 3TC3A 3D5HA 3WH8A 4DF2A 2I9EA 1K03A 2G96A 1XD1A 1DXEA 1CDGA 3RITA 4LCQA 1MDLA 5FJTA 5BWFA 3LA4A 1LWHA 2XIMA 4GKLA 3W81A 5A6KA 4TX6A 3MJYA 2WC3A 1H7WA 3VIPA 4Y96A 1TJRA 2FTYA 1KV8A 1EZWA 4FNSA 2CLKA 2QDEA 4H01A 5CSRA 1BHGA 3KW3A 5AZ1A 2EPMX 3WH7A 1NFGA 2YJQA 4JKKA 4FLOA 1H7OA 4UTIA 1S1PA 3WK0A 4JHMA 1Z8AA 3U8GA 1NQ6A 4JX6A 3ZLFA 3LV5A 1PX3A 3CAKA 3L23A 3O7UA 4L80A 1H7XA 3FSUA 3UXDA 3SCPA 3K8MA 4FIRA 3U2CA 5HMDA 2QAFA 1FFQA 2J4GA 3EX2A 4JTCA 4PB4A 2OKOA 4U5IA 1R86A 5M17A 1MEIA 3H24A 2QMJA 6A3HA 4ZQOA 2HXUA 4JTLA 5CC5A 3QOMA 3GYCA 1MXGA 3CZKA 2J77A 3HGOA 1W3TA 3A24A 3R0DA 5DQPA 5I3DA 4Q4RA 1G69A 2EXOA 1C93A 2A6NA 3PB2A 2OVLA 4AEFA 3VTRA 3TC6A 1BWLA 3QZAA 1M7PA 4OTKA 4D8LA 1O5QA 4FF5A 5KEZA 5EPDA 2WMHA 1TVLA 1AVAA 4DAFA 2WAGA 3GTNA 3QGKC 4DZAA 5CG0A 1POJA 2HVNA 2WVVA 1CT5A 1JQVA 3TYDA 2IPWA 3MCMA 4LQ1A 3Q67A 2VR2A 2VEPA 3MP4A 1DL3A 3ARZA 3GFYA 4A3HA 3VGDA 1S39A 1LG2A 3AXXA 2CETA 4GCAA 3GZ3A 4PMOA 3N3TA 1SO3A 1AW1A 1HKMA 1OCNA 3UFYA 3GX9A 4REQA 1BYAA 4PGLA 1DJWA 3VGHA 2WOQA 1R47A 2Z1SA 4YNGA 1C8VA 3GIQA 2C14A 1DJYA 2W91A 3O06A 3VIFA 1P48A 3QLDA 1AZ1A 1JCXA 4B3KA 1F5ZA 3G1SA 4XAGA 2Q3OA 4PMQA 3WNLA 3CZ8A 3UD2A 4LGXA 1G01A 3UPBA 1K1DA 3CIXA 4JIHA 4FR6A 3ENLA 5AOUA 3C2EA 4NJKA 2PWFA 2XN2A 3VCNA 2PP1A 1CPUA 3LRMA 1W8SA 4G1KA 1FHUA 1DJXA 3CASA 1FCBA 3WDPP 1NFBA 4ADTA 1JYXA 1Q6CA 1F2JA 3W6MA 1AW2A 3CPRA 1XH2A 2C16A 1VF8A 3BH4A 4FA3A 5EBUA 3NFUA 3G1YA 4L9ZA 4UC5A 5F2MA 5A8MA 3VOGA 3K4AA 1SFTA 1D9EA 3BJTA 4MADA 3WQGA 4JIRA 4B5SA 4W89A 3IK2A 1YXYA 2ZZ4A 3W83A 3PPFA 1FWHC 1FWBC 3NO3A 1KFKA 1S2WA 4QG8A 1EGZA 3R1ZA 1SPQA 3LQGA 3KLLA 2X2GA 4IPJA 4JX4A 1S3HA 4I8YA 4KEVA 2NQLA 3K13A 5E70A 1TE1A 2VL4A 3M7SA 5G1TA 4C6CA 4PUUA 4OFCA 4XBSA 3QGAC 1M7OA 4FNTA 3ZM8A 1H61A 5A69A 4GXPA 4CQBA 4OBRA 2AKMA 3B9OA 3R58A 1M9HA 5CGTA 2YDRA 1ICPA 3KVLA 3QFEA 2FMNA 5H2ZA 2FZBA 2GDUA 2AL1A 3ZFHA 5HWNA 1Q8AA 3P0XA 4TR9A 1PEZA 1KFBA 1HG3A 1IEWA 1ZCCA 3CO8A 4CVUA 1C90A 4B5XA 2PDNA 3W6YA 3IJLA 1EJ7L 2E77A 1X1JA 4EPEC 1W3LA 1DTUA 3W1TA 4CQ8A 3MI2A 1EBHA 1I8JA 3VNYA 4GCXA 1KM4A 1E4LA 3TN5A 1W31A 1TB3A 1R3TA 3AXKA 2W3ZA 3KAOA 2TAAA 2PDGA 1XLDA 1J12A 3KVJA 5AVNA 1CECA 3CL7A 1QNVA 2ZWZA 1HZYA 4Q4KA 3SGZA 3EOSA 3LX9A 1V02E 3R43A 3ABZA 3TLQA 1XRSA 2CPUA 2ZX8A 4XB3A 1ELSA 5DMMA 1AJZA 5DLCA 4JYEA 1XP3A 1ISWA 4AZ5A 2ZFAA 5HJXA 3RCNA 1P0NA 1P0DA 3RX3A 4IG2A 3A5VA 1LROA 3PFRA 1OFOA 3N2XA 2YL9A 3WCZA 2WC7A 1MVYA 1J0NA 2C71A 2VUYA 1WDDA 4GZIA 1QATA 2DT0A 2VC9A 3O6AA 4JZ5A 2KX9A 4RZBA 1NEYA 4AUBA 4HJWA 1RBLA 3NQ8A 4GABA 2OCZA 4UQ9A 5AC8A 4ZQNA 4NL1A 1VFFA 3CB8A 4F2TA 1QAPA 3HOJA 3SRDA 1UASA 2Z29A 1Z9AA 3UCCA 5HR7A 1PZ1A 1K8ZA 1KR0A 2WM0A 3NSXA 1T96A 4JQAA 1KBLA 1Q7ZA 5FI8A 5D2XA 2W66A 3SRFA 4O8RA 1R2RA 2DZAA 4AZ7A 1W56A 3HBLA 4JFWA 1RALA 2YFNA 1RCQA 3NOYA 3RMJA 4REQB 3FJNA 1BWVA 2CZ5A 2NUWA 1ZJBA 3B8VA 5F4SA 4ZQCA 4QEEA 2XTKA 3IGXA 2BY1A 2WHMA 2FZMA 4H19A 3RJYA 1H1NA 3BLFA 2VFDA 3TMLA 3EEZA 4KRUA 2Y6ZA 3ITXA 3T4CA 2XSAA 1S46A 1PUDA 1B31A 1XYMA 1KRCC 4GYPA 4LS0A 1TTQA 2ZUSA 3O9NA 3WQOA 4M7TA 4GH1A 2V2DA 1EYWA 3HPXA 5AFDA 4ONVA 4FSAA 3UY8A 3B8TA 1C8QA 4LYRA 4A29A 4HVXA 3VFCA 1W9UA 1VENA 4QGCA 1RQEA 3N13A 1B30A 3K8KA 4B92A 2CLIA 4HCHA 1UD6A 4HKPA 1ML1A 1Q13A 1L2UA 4UQBA 3OIHA 5CPQA 1UMYA 1UKQA 3CL8A 1G7VA 2PEVA 1LXKA 3G6LA 3N12A 4NYYA 1V3MA 1VC4A 1M1BA 2Q1FA 4ILSA 1XBXA 5HULA 3RN6A 2ABAA 2QCCA 3U57A 2F8QA 1R87A 3LZ3A 4RPQA 1Y8BA 4F66A 1GKPA 4R9OA 3L5MA 1V6WA 3W38A 2NQ9A 4GQRA 1OFPA 3ITOA 1D7FA 3U5YA 3O2LA 2BLEA 3C8FA 3PPGA 3FEMA 3MCOA 3EMQA 4UQCA 1DE6A 4XKMA 5C7VA 5ABEA 1EH9A 1BLIA 1MZHA 2IMRA 3RO8A 3TZNA 1UJQA 1FWJC 1KLZA 3OJGA 4XO7A 2YXGA 1KCLA 2CBJA 6TIMA 4ES4A 3UBPC 4HNCA 1KKRA 4CN6A 4GQ0A 1I75A 4AFYA 4AD1A 3Q58A 1VGAA 1XIDA 4Z2JA 4WGHA 1XH1A 1MRAA 5FSDC 3KCJA 3EKGA 1VPYA 3O3RA 3WQ8A 2PDWA 2AGKA 2ZC1A 2PBGA 3IIXA 1XR2A 4W5ZA 1M41A 5TAOA 4AHQA 4IFOA 3GW3A 4DLFA 1BD0A 1XG4A 2VHLA 3ARRA 3CUZA 3LZ5A 2DZTA 4AHPA 1YE4A 2WCAA 1IEVA 3EB2A 1XBYA 4Q32A 2IUZA 1ZP3A 4O0KA 4XZMX 3HO8A 5I7GA 4Z1AA 5GJNA 1LL4A 4H6RA 3GQYA 4FXJA 3G1AA 3MO4A 3SCWA 3SY5A 3CHFA 1VB9A 3IAQA 3VIMA 1KFCA 3HIJA 3SCVA 1UC4A 1YTDA 2VR5A 4OIFA 1R3VA 3QR0A 4IG2B 3CC1A 3CT7A 1V8EA 4RL3A 2VWSA 1SFJA 3W0KA 1XX1A 2YB4A 2XVKA 4KWOA 3FDKA 2GZXA 1Z48A 3W7RA 1A50A 4GUFA 1F61A 2XGIA 2XN0A 2IQ0A 4M1RA 4ZOBA 2GFTA 1W37A 3PJUA 2WBGA 2O56A 2WNNA 4JN8A 4RE3A 4INFA 3MANA 1PJ9A 4PUJA 1RPKA 1S5VA 3PUEA 4LANA 4S3JA 3BAIA 1FCVA 3H4WA 2WJFA 4OJYA 1DJQA 2OYLA 1VBHA 4EIVA 1E9LA 3QMTA 1EBGA 1NSJA 5TBOA 3RX4A 3B4UA 3VM7A 2YL6A 4NX0A 3BAJA 2WB5A 5A6AA 1HN1A 1OFDA 3FAXA 3A5FA 5BOFA 4L4LA 2YZ5A 1TPC1 2QEZA 2W5FA 3WLIA 4FS9A 3AZTA 9XIMA 5MHBA 4KERA 2ZZ2A 1W1ZA 3HPZA 4AVOA 4QAWA 1YDNA 1POKA 5GNXA 3S5NA 3VD9A 1GGOA 2PBOA 1I8QA 4K38A 2RGLA 1WKYA 1R0MA 4GYFA 1HKIA 1WXZA 1RCXB 2G37A 4BY3A 5I5RA 1FWAC 2X0YA 2C0HA 5HJYA 1LBLA 1OJOA 5FF4A 3NDYA 4UZSA 4S3FA 3AMDA 2FDSA 3EOLA 3W01A 1CGUA 1JNDA 4JICA 5I02A 5AYXA 3DAQA 3GK0A 4QJ1A 2WANA 2D69A 5DN1A 4PBEA 3IANA 4G6CA 5JXQA 3OIXA 4HHLA 4MLRA 2E7FA 1TMQA 3N9SA 4OVXA 2PPGA 1NP2A 4LXFA 3GSMA 2OFJA 3ABOA 5LIXX 1XYAA 2Q02A 1W5MA 3MWCA 5CQ1A 4QDWA 1QI5A 3OVRA 1XH0A 3KRZA 3WBEA 5EY5A 1OVDA 2X1SA 3VD5A 4Z1CA 1OC6A 2DIKA 4IWWA 4H9UA 3BSMA 2VTFA 3VZZA 3VNIA 1VCVA 4O52A 3TTQA 5I3KA 1X96A 2GVGA 2QUUA 4HD5A 2VUNA 4UTLA 1EC7A 2V81A 3WSUA 2J8GA 3GHTA 5AHLA 4YLWA 4O54A 4WD0A 2ZRZA 3S83A 3PM6A 4CNSA 3EDDA 3F7JA 3Q94A 4KFPA 5ABTA 1OZMA 4E8CA 1VLWA 5G1MA 3E2SA 4QM1A 1WZAA 4JQ4A 2XDFA 1UWRA 1H7PA 1JI2A 4E2VA 3WKZA 1A5AA 3V5FA 2VX7A 3WNMA 1HTIA 1SFSA 1TWWA 3P8JA 2R9RA 2PRLA 3T55A 2V2HA 2Y2WA 4HU0A 3FDGA 2PGWA 4PEEA 1W0MA 1AODA 1TWDA 4E8DA 1WDPA 3BG5A 3C2FA 4NT0A 4M56A 4OU1A 3GFXA 1ZSXA 1TG7A 2W9MA 1R9ZA 3PBYA 2BNJA 1UA7A 3VX1A 4O19A 3NVTA 1XFCA 5FOOA 4GIAA 2G0WA 1CGWA 1Z6KA 3FNDA 5LNVA 1UOKA 5LNWA 1OQFA 2RDWA 5E5CA 2UY3A 1OGGA 2W61A 4A3YA 1U1JA 4K36A 4HZ6A 3PWGA 4N7QA 4MZ1A 3WLRA 4WX2A 1AH0A 3T2PA 2VQUA 4CD4A 1SO4A 3HMJG 1NAL1 4HN8A 3G77A 1O1ZA 1XF0A 5IRPA 2F61A 3MDWA 1DQXA 3NDOA 1JZ6A 3ZWSA 5HMEA 3W2MA 1W3JA 3DEQA 2KAUC 5HDRA 3UNTA 5T8GA 1E15A 4NZFA 2ZXQA 2A3HA 1FP9A 4GGHA 4ML9A 4MNMA 3FXGA 5D2VA 3WD2A 2BASA 3CUIA 1BTMA 3H7UA 1GVEA 1BYDA 3WLTA 4PTVA 4B5VA 2BOEX 3W23A 2XSBA 1EF3A 3UVIA 1RLCL 1EQCA 3QY8A 1YNPA 2A7RA 4LWWA 3W24A 4KKXA 3W53A 1J5SA 1W1A1 1A80A 3MWAA 5EFDA 4DLOA 1QNOA 2HNEA 2ZDSA 1S2CA 1R3YA 1XKYA 1O60A 4WVXA 6TAAA 3PJTA 1FP8A 3N4EA 4QITA 1FXPA 4FR1A 1JRCA 3T6CA 3VCRA 1O94A 1A3WA 1PXGA 4B5NA 4J40A 1UD3A 3ZJKA 5J5RA 1F7BA 2YCLA 4CCDA 4QLLA 4IXHA 3YPIA 4ROPA 3VM5A 5LNRA 4KEZA 2OZTA 3FHAA 2Z2UA 4IGSA 2AL2A 3HMCA 4PODA 4U10A 5D9NA 3LM7A 3ES8A 2GJRA 4HPXA 3TWAA 1LJYA 3VDAA 1M6JA 3AI0A 5DF0A 4HJFA 1EO7A 4DAIA 1GPWA 4XZNX 5LA0A 1VFLA 1MFVA 4IQLA 2V5JA 5CZ0A 1BXNA 4XIAA 4FAMA 2KXRA 2R94A 4PMDA 4WDUA 3QPYA 2ZUWA 2XIIA 2F6XA 1KM5A 1UOZA 3PHAA 3R4IA 1FH8A 4Y9AA 5ABFA 1KTCA 5CPLA 1HUVA 1OYAA 2FGLA 3LUTA 4JY9A 1KTNA 3LHYA 2XIOA 4YTUA 4XZLX 4CD8A 4OBTA 1R8LA 4MNJA 4H3DA 4AD2A 1YTEA 2WLZA 1RV8A 2QPUA 8A3HA 1Y5XA 4QXIA 3UJFA 3UJSA 1EC8A 3UEQA 4C6MA 3SEPA 2WKLA 2D23A 1PV8A 4NAEA 1BEUA 3CZEA 4PUKA 3NWRA 5DMYA 3THAA 3PSWA 1B0IA 4GO8A 5KETA 1OINA 1PWLA 3DX5A 1XCFA 1JAKA 3WDHA 2RDUA 2BXYA 3BMWA 4J2MA 2VFHA 3P84A 1KBJA 4CUCA 3IUDA 1CLKA 4F0SA 3W1XA 3C2RA 3MUXA 4AZBA 3G0SA 3ANYA 1W8GA 4Z2IA 3G0UA 1TUXA 1EUAA 1JD7A 2JK2A 2ZX9A 3PUOA 4KBXA 3UWWA 4Z1BA 2AQWA 5HOSA 4DYJA 1DXFA 1N82A 3SIZA 1YLVA 2FZDA 4GG9A 1DORA 2JALA 1MNSA 1V0NA 3SUSA 3C0SA 3MT1A 1QK0A 3DHPA 2HXTA 4JTRA 1M3UA 5LNSA 4TV6A 4HTYA 3TQKA 3NZGA 1CB2A 1EOMA 3U6WA 3AU6A 3W1NA 1CI1A 1ZAJA 4JXCA 2EPLX 4O17A 3UG3A 4MZ8A 2ZA2A 1TELA 3TN3A 3GR4A 2VQTA 3NEHA 4NRRA 1UJPA 2HPIA 4Z08A 2JEQA 3E2RA 4R5EA 2QJGA 3MB9A 1M01A 1XHGA 2VI0A 2VDHA 3GC2A 1J0HA 1NWTA 2Y62A 3L9CA 5D09A 2NLIA 1F4HA 1VYPX 1NWSA 2CHNA 8XIAA 3SADA 1B4KA 2GGJA 1U5HA 4WRHA 1EA9C 4J3XA 1GZ1A 3KFTA 3CGTA 4A3QA 1MW1A 2WQDA 1E6ZA 1CXEA 1BYCA 3UPWA 4DJFC 4O8AA 3NA8A 1XLAA 3F5JA 4ZR8A 4QNEA 2J78A 5MF5A 2BS9A 4TXEA 4M80A 1E5NA 1N8FA 1E0VA 1IHIA 1L9WA 3Q2DA 1WKEA 5A94A 5M2FX 2YCLB 4GQQA 2Y61A 1VYSX 2AL2B 2PDCA 2Z2BA 2GYIA 1U5JA 2EHHA 3TC7A 1JCLA 4Y90A 1CTNA 2OX4A 3OP2A 2GUBA 2RH9A 3TYAA 2JKPA 1T40A 3WF4A 4M3PA 2E4TA 3S1WA 4L7ZA 1P0BA 1J9YA 3E6EA 2XVPA 4O1FA 1VZWA 1BPLB 2XPKA 1TPDA 3S0CA 3DKJA 4XTDA 5H6HA 1PZ3A 1BXCA 2X16A 5B7YA 4NIRA 4LRTA 1EPXA 3KLKA 5ABFB 1E0WA 1G1YA 3KTCA 4GMEA 1IZKA 4PL1A 1KB3A 1XGEA 4FXRA 2HNHA 3WDRA 2Q8ZA 3M1ZA 2NWSA 4JGDA 2PDYA 4D72A 2PDUA 1L6YA 3B04A 2X8RA 3AIEA 4JQ1A 4H83A 5D8ZA 5F1UA 4X22A 3B8UA 1J2WA 5HPCA 4C6IA 3S6TA 3EA3A 4GGBA 1MW0A 5CG7A 4TQTA 2OB3A 1ZHAA 4P7RA 3OTRA 4IJRA 4BCEA 1NOWA 4GIEA 2QJHA 1ITUA 5I3IA 1FKWA 3HG5A 4JY8A 1M65A 3TLLA 3BK0A 2PP3A 3WQEA 2YBUA 5F7UA 4PMUA 1FWFC 1E40A 4KRZA 4QTGA 4IGMA 5LHEA 3KBUC 2Y5JA 3CM4A 1OD8A 1HM3A 1QO2A 3IVSA 3PF3A 5I79A 4IP4A 4NAEB 3VA8A 2GVYA 4LCSA 3BCJA 2F84A 1VRDA 3BL3A 3H2OA 3LHWA 3DCPA 2NUYA 1LCOA 4H8HA 4DLMA 2G3JA 1ODZA 1F07A 3HQ1A 3HU7A 1Q8JA 3IJIA 5KZMA 1RWHA 2WLYA 3QZ6A 1ONXA 3M43A 3W07A 2Y4SA 4JTKA 2D2JA 2J8TA 4M1BA 4YTRA 4DJDA 1XQLA 1YXCA 3W7LA 5A6BD 3TJLA 3RRAA 1O1HA 2WW5A 4G56A 1AJ0A 2PDMA 4D6GA 4BZYA 3BZJA 4MTVA 3DHUA 3FHQA 4KEMA 1EJRC 4QG9A 3L7RA 5EBAA 4F9JA 4U3AA 2UV8G 3PTDA 5M1TA 2E8YA 3NM1A 5E0KA 1DWFM 4QE4A 2BOGX 4B3ZA 3B97A 1AD4A 1RQBA 3UYIA 1PZ0A 2NX1A 4U4MA 1EHAA 4HT3A 1A5CA 1J01A 4E3VA 1W1VA 3MVTA 3AHYA 2FZ9A 3S9IA 1W91A 1FA2A 3PZVA 1TA3A 2PS2A 3L5AA 4HOXA 4HHHA 3PZTA 3IJ8A 2VFEA 1UZDA 3S6DA 4MAZA 4S2BA 1EUNA 3LYEA 2J6VA 3I6EA 2VVSA 1O66A 1UUMA 1OADA 2QZRA 1OCQA 1YNQA 4HSOA 5CKSA 3MSDA 3ITVA 4OWGA 3WZ0E 5DXYA 4GINA 5BWAA 4L4OA 5GNZA 2WV8A 3EPMA 1KM0A 1H1ZA 3LM3A 3SRKA 4DBWA 2QV4A 2HWGA 1IR1A 1OD0A 4JKLA 3DFSA 1H4PA 3NQ7A 4J28A 2DUAA 5LZLA 1OSEA 4L64A 1RW9A 3MTWA 3VDCA 2A5HA 2BVDA 2VYOA 5DEZA 2C1HA 1WE5A 4CD6A 2CLFA 4B3LA 1EHNA 2OMAA 3WQ4A 1HP5A 1E51A 4Q8NA 1RH9A 1OB0A 4QS5A 1B3XA 1L8PA 2QQ6A 1I0BA 1V3LA 1KO0A 1N7OA 3BARA 1PX4A 4JTGA 4LUSA 1HO4A 1YQ2A 2VXNA 2VGFA 3OBAA 4AZGA 2WMIB 3B05A 4S3CA 4MMWA 2EG8A 1TJPA 2BZNA 5LIYX 1OWQA 4CQAA 5LXXA 2HQAA 3NTYA 5JH2A 5J04A 2DH3A 4OV4A 4BR1A 3N4AA 5CGMA 1XXXA 3BJSA 3EX6A 1P7TA 2WSQA 2GK1A 4V2XA 3SDOA 3CEUA 3TK7A 1MI3A 4EWJA 3JR2A 1OFAA 5CSUA 1G4EA 4YHEA 2E1DA 3PBGA 4NHVA 2W67A 4JEJA 2F2KA 4I7VA 3T9PA 4DBEA 4GY0A 3N2OA 1C8XA 1J6PA 1OG0A 2ANUA 4ZO8A 1OGSA 3VIJA 4MB4A 3KOWA 1XLCA 3KBJA 2Y89A 4J3VA 5CZKA 3WD1A 1UROA 3DZ1A 1N8IA 5ABGA 1REQA 3DXIA 3V1HA 3CUJA 3PJXA 1Q6FA 5AN7A 1RA5A 1XJBA 3GC5A 3PY2A 5C71A 3A64A 5U7SA 3I65A 3U0HA 1SW3A 3ZQ9A 3GTXA 3TW7A 4L4PA 1H49A 1OEPA 3BW3A 5BRPA 5I77A 4QSHA 1PS9A 1IE7C 1ITXA 5IBXA 1MWOA 3G8RA 4UR7A 3BC9A 4GVGA 2V4IB 1NOUA 1C3FA 3BSGA 4URIA 4LCRA 4IGHA 3TZFA 1LUCA 2QIIA 3R11A 7ENLA 3P67A 1Q6QA 1UD4A 3I3EA 4GD0A 4HN4A 4H6KA 4EKJA 3W2UA 1QVBA 2PZ0A 4N6EA 1XICA 1S5MA 1ECEA 2QV5A 1TRDA 7XIMA 1WQ5A 3W7PA 3KBTC 5G1YA 4Z0SA 1CXFA 1G4SA 1DWHM 1BSLA 5FA5A 3RPMA 3F2BA 4DRSA 2ZUUA 1FY6A 4TX8A 1PHWA 4DWSD 3NZPA 3S3GA 3SQMA 3QTGA 2WVUA 1MYRA 3NSMA 3CHVA 3WFZA 3HQPA 3TEVA 3L2IA 1SQ7A 3MY9A 3RG6A 1VIZA 1V0LA 2PA6A 1ZAIA 2REQA 3DG3A 2HPMA 2V82A 4MYXA 3OVGA 1UKSA 5E0FA 4UTTC 3RLHA 4WDXA 2ZDRA 5I06A 2NZLA 4IPLA 3L4WA 1TA3B 2P1FA 3MZ2A 3ATZA 2B7PA 3KVKA 5I3HA 3AUJA 4IL2A 1E5JA 5A8PA 3MYOA 2J25A 1EEXA 2DW7A 1FWSA 3N2BA 2VZVA 5CZJA 1O5XA 5E9XA 4HHMA 1GKRA 4YVVA 1KM6A 5HPOA 1DBTA 1QWGA 3ZS4A 1YDYA 3N17A 5LA2A 3M0HA 3KEHA 3GH5A 3U5UA 1YE6A 4GHRA 1DQWA 3IT6B 4GRSA 3UD1A 5DXXA 1WZLA 1RSCA 3NCOA 5K9DA 3GXMA 4JTIA 3TSBA 2BY0A 2Y70A 4LBRA 4IJBA 1PKYA 4JAWA 3U2EA 5EGRA 5FEZA 1CWYA 2WBKA 3CTLA 5KINA 3SFWA 5JVLA 1UD8A 3N11A 5CZSA 2G3IA 2XZ9A 4PUEA 5PTDA 1KBKA 3ALGA 4NUWA 1VEOA 3LENA 3W2JA 4KIEA 3W7EA 3LRKA 4WLCA 3QV8A 4X3ZA 3FEQA 3QVQA 1VR6A 2DVXA 4RUBA 3VILA 3S2NA 4UBPC 2QJIA 2XGZA 1EX5A 3CV7A 4QIUA 4C1LA 3L4UA 2VENA 3MMTA 4L1WA 1A5OC 1ME9A 3A22A 1KXTA 2A3LA 2AKZA 2FFCA 4TVUA 1LP6A 3VNLA 4O28A 3HQNA 1P7TB 2GK1B 2XWDA 1HGWA 2AGTA 1E6SM 1QPRA 2PTXA 2Z6JA 4P8UA 4AZCB 3UG8A 4H8NA 3VDGA 3Q4DA 1QHZA 5CH9A 3W37A 1JEZA 4RKAA 1SUXA 3A3WA 3RCYA 4LAMA 4C6EA 2QCFA 3R6IA 7PTDA 2QVHA 1J0YA 4C7GA 1V08A 3IJ6A 4PTXA 5EMLA 1O5RA 4LTSA 3RLVA 4A35A 2GUYA 5GQBA 1REQB 1LQ0A 3FK4A 3TP4A 1KTBA 1VD6A 1XISA 3H4XA 1VFMA 3B4YA 4WXZA 3ZSSA 2DDXA 3RU8X 3HZ3A 2YL5A 4WGXA 3JS3A 4H00A 2ESCA 1MMFA 4QHRA 3NSNA 3PBUA 1GOQA 1K8XA 3M0MA 4G2DA 3GE7A 1PYMA 2DSUA 4EP8C 1KCZA 3UERA 5LGXA 4LUYA 4C6FA 3VKDA 1BWKA 1X39A 1X6NA 3A12A 2Z24A 3RO6A 4UFMA 1J10A 2P0IA 2P50A 1HJVA 2G3NA 2DJLA 1FWDC 1U30A 3INPA 3IPWA 3U7BA 3WELA 2E3ZA 3E0IA 3B9NA 2DFAA 3GDRA 3M6YA 1LUCB 4NVTA 3SW6A 4HYRA 2X1TA 4DJEA 2INFA 2ZCGA 4HK5A 1CX9A 1G67A 4N4PA 1OFQA 2E0PA 4HOWA 3QSTA 3TMQA 4DZ5A 3LS9A 1W9VA 2ZQ0A 2VGIA 4FLRA 4FNUA 1VJZA 1F74A 4WZHA 1J0KA 5HXMA 2W6RA 4BWLC 2WMKA 3CU2A 3WN6A 3CWHA 3HPAA 2QF8A 4MWAC 3BQ5A 2DW6A 4UMBA 3RAOA 2REQB 4XIMA 5H8UA 1XBZA 3NQAA 2W27A 3T42A 1GEQA 4EACA 5BOOA 1XKJA 2BBFA 3LMYA 2PWUA 3ONCA 4PTMA 1HL8A 3JRKA 3TA9A 3WMLA 1W54A 4H8VA 1JUEA 4B5WA 3VABA 1TE6A 2J66A 4O16A 1QHOA 3VAVA 3UWQA 3Q45A 1XYFA 3NEVA 3A4AA 4YN5A 1QRQA 4MB1A 4FEZA 4NYUA 3ZT5A 5DY3A 3AIUA 1LOSA 3FCPA 4IOTA 2TPSA 2J7FA 2GDQA 4AH7A 4R7OA 1E4IA 3VK5A 2PF8A 1TV7A 3JUGA 1J96A 1B3VA 3ZVHA 4J3ZA 1ZBWA 1IV8A 4C1KA 4CN4A 3MKKA 3MP5A 3TA6A 7TAAA 4CCEA 2D73A 4RLIA 3P82A 1V6TA 1UZ1A 5GVJA 4U3CA 1P1MA 2EF9A 4FB7A 2DQWA 2WO5A 3DI0A 3SBFA 3UWEA 2XFFA 5GJMA 1Y65A 1A47A 1W3HA 3I3DA 5HMFA 4J3TA 1VEPA 3N15A 2ONEA 5DMLA 1XLGA 4O15A 1Z44A 3ARXA 3EWZA 4UQAA 4Y9OA 4XZIA 3VCCA 4NI3A 4XAPA 4TTUA 1JL8A 5FL0A 1TIMA 4CNOA 3XISA 4D6FA 4FOUA 4EF8A 1XW8A 3GKAA 4JNZA 3W1MA 5DO8A 3SCRA 4DEFA 3W1QA 2QCMA 2INEA 4UNIA 3N19B 1G7UA 1BSIA 4GVIA 3R5EA 1SJBA 2DSKA 4QNWA 3DC8A 3EYPA 2WZTA 3GO2A 4HNUA 2IXVA 4GI6A 4IIDA 4PA8A 4HYVA 4V27A 3DYPA 4XWUA 1X7IA 5M03A 3MI3A 1PPIA 1BVNP 3A21A 2QCHA 1JJKA 4AD5A 3BUVA 1DWIM 6CGTA 4A4AA 5C6MA 1TPWA 1WOBA 5LSMA 3ZO9A 1XLFA 2ACUA 4TVDA 1LRNA 1TSIA 3AIWA 2YYTA 1HM2A 1MEWA 1GW9A 2YKKA 3RILA 3CHCA 3V0UA 1CGYA 3GHUA 3UR5A 1B57A 5JIWA 2BHZA 2WPGA 3B9EA 3M5YA 1H1YA 3THDA 3VZXA 4KPLA 1K7FA 3IWPA 3CZLA 3IIZA 4QFUA 1X98A 3H2FA 3TX9A 4YVXA 3RPTA 1QI2A 3D0CA 2HK1A 1I2NA 4IQJA 2WCGA 1OBAA 2DT1A 3GVVA 3MUY1 1FWEC 1J0ZA 1YXDA 2I1OA 3UNDA 2UZ9A 5C8BB 2RKXA 3MSRA 3UWYA 1EJVC 4ZE5A 5CXPA 1I1WA 1C92A 3K4WA 5DANA 3CAQA 3K30A 1XPGA 1OX4A 3GW0A 3HGJA 3VOIA 3KRBA 3WBAA 2PFHA 1KGWA 2NQHA 2R24A 3VZYA 2VEKA 4ORMA 2WCSA 3URQA 3WBXA 3SQLA 2WKJA 4N4QA 1Z69A 4S3AA 3STPA 3H8AA 1HNYA 4NZ5A 2DQXA 1CCWB 5AECA 1RVKA 2G3MA 3D6NA 1DIDA 4HBKA 4C6JA 4MWAE 4DZIA 5EB8A 4NSBA 3QFWA 1F1SA 1UD5A 3M7WA 3UR7A 1KGUA 2J7EA 4A22A 1GOMA 1KKOA 2DZBA 3F5KA 2BOFX 3W7NA 4XSMA 2JGYA 3AXIA 3MC5A 4X9YA 1AA1B 4MYAA 5ABHA 4FIQA 4IPIA 3L4VA 1H0IA 4PMXA 4TU1A 2FHFA 2QDHA 4HPJA 4IIGA 4E4UA 5JU6A 1Q5MA 2BX7A 3LCFA 2WPBA 4HNLA 3EOEA 1BFNA 2FLIA 3AMGA 3DG6A 5F2LA 3CLMA 1PHQA 4GX9A 4JYDA 1YHTA 3T78A 4EANA 3QOKA 3W1PA 2FVKA 3ZVHB 2GJXA 3TSMA 4ICCX 4ZQPA 4DWDA 4LT9A 3GDKA 2DUXA 4K3ZA 1KFJA 2C1GA 1RWAA 4WOQA 2XIJA 5FJUA 2D2OA 3UESA 3QSRA 1A0EA 2I7GA 4Q3MA 4PTDA 3NM3A 2CHRA 2CKSA 2DUZA 2X42A 1K02A 2VELA 4A2SA 5HWJA 3ECQA 4H2HA 4TMCA 4RW3A 2Y7GA 1GCYA 4U2YA 2DZWA 6XIAA 4S3BA 4AIUA 5HAOA 2DV0A 2EEXA 4C6QA 2C0AA 3GR8A 3NO5A 1WDQA 3ANUA 3DOPA 4JYFA 5D33A 2ZA1A 4D6HA 2VCCA 1QI4A 3SI9A 1VBUA 3EXRA 3JW7A 5H8MA 1V02A 2NXGA 2FZ8A 3E38A 2OZ3A 2ASHA 2VJXA 1K9FA 3M0ZA 4WY0A 1X97A 2QT3A 4AIOA 4YTTA 3BE7A 1V6YA 2ATSA 2PSNA 1K7XA 3R0UA 1V6XA 3MPGA 1ZAHA 4MKVA 1PKLA 3CUHA 4X2RA 2DH2A 3OB8A 3VUSA 3G0XA 4BI5A 1C29A 4US6A 4KRTA 3GY1A 4XD3A 3NUKA 5DRIA 3NZQA 4JQ3A 3G24A 2CZDA 1EWEA 4ZVJA 4GUJA 4RV8A 2V68A 2JE8A 3HTWA 3AYVA 1YKWA 1UA3A 3MUAA 1ZUAX 4CU6A 2WHKA 3ITGA 3DC0A 4ACYA 5GJPA 3BDKA 1YNYA 1IXOA 1FWIC 3Q37A 3P93A 2V5DA 1BG9A 3IVUA 4M6PA 1BAGA 1QPOA 4US5D 3AHXA 3AMKA 4V33A 5TIMA 4XO6A 2JIWA 2ZZ3A 3M64A 1Q7MA 3GUGA 1GEHA 4QP0A 2IPJA 1QFEA 3H26A 4AX7A 2MNRA 5CCZA 4AIBA 3VI2A 1YYAA 4S3EA 1US0A 1AG1O 2Y1HA 1OX4B 1RBAA 1A5KC 4RZ4A 4YCOA 3M5VA 4EE9A 1W3KA 5F2GA 1AJ2A 4NNBA 4WKAA 1K70A 1G4TA 2PDHA 1EP3A 3GU9A 3VMOA 4GBUA 2PDQA 3GTHA 3CXOA 2QULA 4IQDA 3DFNA 3NQFA 3VUPA 3NR0A 3LCIA 4E4FA 2BGSA 2DZPA 4O4WA 5CAKA 2UWFA 4RJEA 4YMZA 4AEOA 3N2TA 4ZB5A 1FX6A 4ATWA 3AXMA 5EMUA 3PPHA 2Q01A 2ON3A 1NF7A 2CLLA 2IS7A 1JR1A 3R94A 2HDJA 1MRQA 1NU5A 1AQMA 1DKWA 3ZJ7A 3MBFA 1HKKA 1MQQA 1LL7A 2GJXB 4MF4A 3CIWA 3MMDA 3PZUA 1Z32X 1Q6LA 3KBVA 4PH6A 3G1XA 1EXBA 3GKFA 1TPH1 2DEPA 3FJLA 4D6JA 2ZRXA 1E9IA 1TPB1 3EXTA 1UWSA 4W7UA 4NNCA 2X1IA 3BXWA 1ENUA 3GDMA 3ZZ1A 4CVWA 3DN5A 2OG9A 4LAZA 2YCIX 1GQNA 3W2NA 3AIQA 3VNZA 2NVCA 3P6LA 3NQCA 2X03A 3FJ6A 2Y5SA 3MA8A 5A2BA 3NPWA 5CBBA 7CGTA 3BMXA 4OECA 3IIVA 2YPIA 1YRRA 1BRLA 2TYSA 1J0MA 2H6RA 4K68A 1M68A 3V18A 1YDOA 3N6QA 3PZMA 4XK2A 3OYXA 4B16A 4M6VA 3IUHA 4F2BA 1TVNA 2BVWA 3MKCA 1DXIA 1YPFA 3PPCA 3TJ4A 1J6OA 1GVFA 1HX0A 1QJWA 1QI3A 5I00A 4WY0B 3M4HA 3W75A 1Q85A 3ITCA 3REQB 3LCXA 1WXYA 3SURA 1FWNA 1KV5A 3F1QA 4J2PA 1IT7A 3WEZA 5CBJA 3S2LA 2QYGA 1U83A 3PZGA 5E93A 5D05A 2PDPA 4DNMA 1WB0A 1UR0A 1EL3A 1U5VA 4Q22A 5LIUX 3H54A 3AOFA 4CLMA 1OJMA 1XUUA 4C7FA 4F9DA 4HA4A 4S39A 3EEGA 3L4TA 3G3DA 5HNUA 2A3EA 4GKTA 4LV9A 3HJEA 2HEJA 2MUCA 4TOQA 4UWMA 4KCVA 4UFIA 2CZFA 4WK9A 3VD3A 3AS1A 1SZEA 5HJLA 1OFEA 2DZVA 3WQCA 2CWNA 5AC7A 1FOBA 5K7JA 1R30A 3P60A 2CBUA 2VKZG 1L6SA 2XZ7A 1WZKA 1XS2A 5FL1A 1PB0A 1THFD 1ISZA 1JULA 1EP2A 1UW9A 5D9OA 2QPSA 3W2KA 3AMLA 3NL5A 3ZLGA 3WLKX 1A53A 1VEMA 1CGXA 1GJPA 3SFKA 3TTSA 1EGUA 3SB0A 4RNIA 4PFMA 3QGVA 3C86A 1YDVA 4A6GA 2YLLA 3ZR6A 3OQ8A 4LVDA 4W9TA 2HS6A 3LRLA 4US5A 2JBMA 4Q8PA 2FGBA 1VCFA 3QY6A 3NOEA 2E9LA 3WBWA 2DVUA 5KZEA 2BB0A 1W1B1 4GACA 3USBA 4E2DA 3EDFA 1CNVA 2F38A 2R1MA 4I5UA 3QPZA 4DX3A 4WJ8A 4LUIA 3KBNA 4J27A 1K9DA 3VGFA 4LX4A 3GWQA 3UZ5A 1W6TA 2DGAA 3F03K 5BU6A 4UQEA 3B0YA 2QGYA 3N14A 4GUGA 5E0CA 1WUFA 1UIPA 4CN1A 1ZP4A 4NJGA 4XZWA 5A8GA 4GZEA 3CNYA 1LLQA 2D0GA 4OBSA 1TX0A 3LLXA 5FF2A 2B7NA 4WJXA 4H6QA 3EXSA 4DI9A 4NJIA 1WP6A 2BHUA 1UIOA 1LRTA 3L12A 4JKMA 5TNVA 5LHFA 2R91A 4JEQA 5JIPA 2BXZA 1R38A 1IWPA 4B91A 4J3UA 4JR5A 4JPGA 2DIEA 4PC8A 1FDZA 3AALA 1QOXA 3E1F1 2WYSA 4S23A 3WBYA 5FD0A 2WMFA 1JCYA 4JTDA 3WLPA 3B40A 2A1YA 3OLEA 3EX3A 3SAZA 1OIMA 1W5OA 1NVMA 2O9PA 5CSSA 3UG5A 4K8EA 3VFLA 1BRLB 2V67A 3V0SA 4YVPA 1OC7A 4B15A 3TV8A 1RAKA 1XIJA 2BWGA 3OYZA 3S5OA 4OZOA 3TYBA 3NIYA 3H6OA 3WLSA 1A0DA 2VFFA 3GDBA 1QHPA 3A4WA 1GYMA 2QMKA 4QBXA 1TREA 3O6CA 1V03A 2Y88A 2HBVA 2YDQA 4Q6XA 3UA4A 4UTWC 4LNCA 5CAHA 4I6KA 3IT4B 4AF0A 3I3BA 4GPNA 2Q71A 4JTSA 5JBFA 3WH5A 1KM3A 1MO0A 4WJEA 3P8IA 2YXXA 5ECVA 1GOWA 1G0CA 4XVDA 4YWSA 3MBDA 2XSXA 5E9AA 4IL0A 4HK7A 5AC6A 4IM4A 1JZ8A 1UZ4A 3W76A 4HZMA 1IWBA 2YZRA 2I9UA 1YTKA 2ISSA 3CH9A 1MEHA 1KXHA 3IJ9A 3ARPA 1RWFA 5A95A 3POHA 4KEUA 1GQIA 4GQGA 5I6SA 3UYCA 2ZTJA 3GAYA 1XL9A 1UR4A 3F4CA 1PIFA 4IMDA 4QE1A 5LA1A 2XH0A 2FPTA 1HKJA 3M16A 1H3GA 3WLJA 1QXLA 1KCKA 4IT1A 2BXVA 3O15A 2XM1A 3ITLA 1LWIA 4B5UA 1PYFA 4IPNB 5DT7A 1E6QM 2R1KA 1CXHA 2PWGA 1TUFA 1Q65A 1X6LA 3P74A 2FDMA 1NDZA 3U2OA 3T05A 2CEQA 2IKIA 2A7NA 7ODCA 3BG3A 2SFPA 3KBSA 2RGMA 2ZTKA 4RDWA 3QMRA 3C5QA 5HWMA 3K1GA 2V63A 1XGDA 1Z7AA 3UU0A 1ZZMA 3GAKA 2PMQA 4ZZ9A 1S2VA 4HSNA 3EBVA 4ZODA 1W3IA 3S5YA 2YBTA 1PDYA 4K1GA 1J18A 1RVGA 1KW1A 1W17A 4AYSA 3PBWA 2O9TA 1W5NA 4C6LA 5TF0A 4AYGA 3KUMA 1V5XA 1K9TA 2OEJA 3EX4A 2CZVA 3GVGA 1E0UA 4FXSA 4KGLA 3ZT6A 4OE7A 5H1WA 1R46A 2HCVA 4FF7A 3MZNA 3EGJA 3NXFA 2J6XA 3KS5A 2QKFA 3KS6A 1TZ7A 2IQTA 2VWTA 4ZEPA 6PTDA 3WEMA 2NX9A 2O0TA 2QLYA 3BAYA 4DJDC 2J9XA 4QX4A 3KRSA 1I60A 1UP2A 3UP8A 3T2QA 3A3XA 5D03A 3EDEA 4MUZA 2XFYA 2WCOA 3LMZA 3KOYA 2NSXA 1EJTC 3C61A 1K6AA 1XRFA 5CLTA 5AHFA 2NXHA 2PD9A 1SR0A 3CLWA 1HKWA 2XGBA 4JTTA 3P7YA 4O18A 3IRSA 1OFBA 1VBJA 4L61A 4WCJA 5CPMA 3HURA 5C2GA 7A3HA 2Z7GA 1PWMA 1HJSA 3M0YA 1W5QA 3MUCA 4LF1A 5TQLA 1T7LA 2ZADA 3SN1A 4XD4A 3RR4A 4K37A 1GOXA 4HA1A 2OJPA 4JDYA 3KZPA 3HGRA 4AG0A 5FIPA 3V36A 3E96A 3MHFA 1UWQA 3LPOA 3UW6A 1S2TA 3SZ8A 2ZX6A 3E0FA 3S9YA 2C91A 2E22A 4JIPA 3W26A 1O7AA 1E70M 1ZALA 1ZY9A 1YPIA 2VCBA 4JTQA 3N2MA 3BV4A 4ZGYA 1QI0A 1EJXC 3VNDA 3OBEA 4DO7A 4AF0B 1LBMA 2H3DA 3LPPA 3E02A 4DBUA 1MFUA 3FSTA 3ANVA 3S2JA 3LEPA 3L2LA 4HA0A 3LCGA 1DWJM 3WYZA 3KL5A 2VX6A 3KOZA 3AJXA 4R53A 3TUUA 1MW3A 4FZIA 5DCBA 3PTMA 4Y9PA 3LY0A 3AXHA 4NU7A 1RP9A 5F4XA 1ADSA 2C1IA 1FHLA 4KMQA 3KP0A 1SVDA 1QDSA 1KBIA 5C9RA 2HVOA 1DWGM 3OODA 4DM2A 5FEWA 3SR7A 4HMCA 3RMEA 3E49A 1FFRA 3ELFA 2ZRYA 4IFRA 4ZA0A 1ADOA 1N7RA 1D7KA 1LF1A 4EXBA 2WVVB 2YXOA 2YYUA 1F76A 4DJFD 4PCNA 1R3SA 3KX6A 3DBPA 4JTUA 5KSWA 4I90A 2I5QA 3DGRA 1H62A 2I16A 4IMCA 1EQPA 3U48A 1OFRA 1VQTA 1EDQA 4PN2A 5HA7A 4J7RA 4S2CA 1GOIA 3NGFA 2E9BA 4B5TA 3TDFA 4XVEA 3DUGA 3FV9A 5G2WA 3SO7A 1I2OA 2CESA 1GZGA 3STCA 2BODX 2ZZ7A 3UXAA 1DTNA 2PU1A 4RZ6A 1ZS2A 3BZGA 3V0TA 2WZHA 5JBEA 3WLMA 2O7QA 4W5UA 1D3GA 2J9ZA 4UCGA 1WXJA 1HP4A 1SJDA 4I8DA 1JZ4A 2QUNA 4L4MA 1VH7A 3CB3A 4W4QA 2HROA 2V3FA 3MV11 3CL6A 2WK2A 4XSLA 5A8NA 1BF6A 1XIEA 1XPYA 2OSYA 1WZMA 1QPQA 4O1EA 2HE5A 2YR1A 3SSJA 4LJ3A 1JVNA 5AC4A 2EPKX 1QPNA 2YB1A 1P43A 4NX5A 5T9CE 5G2HA 3WL1A 1E6NA 3WNPA 3LNPA 3TNOA 1I6NA 1HJXA 3ABXA 3SCNA 1V3HA 1ZENA 2IPFA 4FMVA 1D8CA 2GUUA 2YA2A 1OT1A 1FWGC 4GH3A 3AWNA 4DB7A 2DSWA 3VIIA 4P7OA 3THUA 4IUOA 3L5LA 2WMGA 3H53A 3W7GA 4EX4A 3BOLA 4H9XA 2E8ZA 3CQIA 3HG2A 3K5XA 2D22A 4MLJA