2WMHA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 in complex with the h- disaccharide blood group antigen.
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
555
structure length
553
Chain Sequence
VQMRTTINNESPLLLSPLYGNDNGNGLWWGNTLKGAWEAIPEDVKPYAAIELHPAKVCKPTSCIPRDTKELREWYVKMLEEAQSLNIPVFLVIMSAGERNTVPPEWLDEQFQKYSVLKGVLNIENYWIYNNQLAPHSAKYLEVCAKYGAHFIWHDHEKWFWETIMNDPTFFEASQKYHKNLVLATKNTPIRDDAGTDSIVSGFWLSGLCDNWGSSTDTWKWWEKHYTNTFETGRARDMRSYASEPESMIAMEMMNVYTGGGTVYNFECAAYTFMTNDVPTPAFTKGIIPFFRHAIQNPAPSKEEVVNRTKAVFWNGEGRISSLNGFYQGLYSNDETMPLYNNGRYHILPVIHEKIDKEKISSIFPNAKILTKNSEELSSKVNYLNSLYPKLYEGDGYAQRVGNSWYIYNSNANINKNQQVMLPMYTNNTKSLSLDLTPHTYAVVKENPNNLHILLNNYRTDKTAMWALSGNFDASKSWKKEELELANWISKNYSINPVDNDFRTTTLTLKGHHKPQINISGDKNHYTYTENWDENTHVYTITVNHNGMVEMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 203
structure length 553
sequence length 555
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08306 Glyco_hydro_98M Glycosyl hydrolase family 98
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmhA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmhA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmhA02
4AXNA 1UZ4A 1W1YA 1NM9A 2AAAA 3W29A 3VDHA 1HKMA 2VRKA 3WF4A 3SIMA 4W8LA 2WC3A 1QOXA 3G6LA 3OZPA 1N7OA 2PWHA 2NW0A 4ACZB 1WE5A 1LJYA 2QMKA 5IDIA 1B3VA 3UERA 5I79A 1TG7A 5M03A 3WNNA 1E40A 2VI0A 3WD0A 2ZOXA 2O9PA 4UFKA 3W27A 3PHAA 1CNVA 5TD4A 4UCFA 4CCEA 2ZIDA 2BY1A 1GCYA 1KWKA 1E3XA 3BCDA 4LYRA 3AYRA 9CGTA 5JUVA 2JF6A 2BRVX 3W4RA 3WBEA 4CCCA 1SMAA 1KBKA 1US2A 4BQ5A 1TMQA 3O2LA 1QNQA 4E8DA 4RL3A 3NJ3A 2WWCA 4KRUA 4HZ6A 3NSXA 2Y24A 4B16A 1N82A 4UQDA 2VRQA 4U2YA 1CWYA 3SUSA 1E0XA 1PEZA 2GSJA 2JE8A 3CO4A 1V0NA 2V3FA 1V3JA 2ZWYA 2DPEA 3OGVA 4GPNA 1RH9A 1V0MA 1W91A 3LPFA 4CU7A 1LWJA 3S6TA 1JI2A 2XVNA 3AIRA 4D71A 1RWFA 3WKZA 1JD9A 4JHZA 4BZYA 1UKOA 3CTTA 1LQ0A 4LPCA 4CD7A 1OGGA 5BXPA 5CGMA 4AZ7A 2WK2A 1CGUA 3NUKA 2GK1B 1HN0A 1QHZA 1E43A 3PZVA 2V5CA 3GXIA 2WW5A 3K1DA 2EPOA 3N11A 2E40A 1XYZA 2YA0A 1ZBVA 2VX4A 2WHKA 4GZIA 3OGRA 4AIOA 4E4PA 4H2CA 3UR7A 1J0JA 1V3KA 3AS0A 1X6NA 1ZB5A 3RILA 1QW8A 3AHXA 3POCA 2BY2A 4W85A 3MS8A 3RIKA 1KXTA 3VD3A 5DT5A 4S3KA 4PMYA 2BFGA 1JDAA 3AZSA 1E0WA 4JAWA 1CPUA 2YBTA 3GTNA 1LG2A 3VGEA 4J3UA 1G01A 3AMCA 5GPRA 4PCTA 2J7EA 2YA2A 2HVMA 3QOMA 1DWJM 2YL5A 4LGXA 4ACYA 2WSPA 4CN1A 3EBVA 5A95A 4KH2A 1EOMA 1LXMA 4CKQA 4QP0A 1QPKA 4ZE5A 5C71A 1OJMA 1N7PA 1NWSA 1KGWA 1QI0A 3VKKA 1LL4A 2WKGA 3BAXA 2UY2A 3AS1A 3NYDA 5CLWA 4UZSA 1MW1A 2PWEA 3ARUA 1XH1A 4P7RA 4W5ZA 3PTKA 2VR5A 4F9JA 3ARXA 3WQWA 1NP2A 3AIBA 1L8NA 3KEHA 4J3XA 4PEEA 4HTYA 3UEQA 2QF8A 2GJRA 2D1ZA 3IJ7A 1TCMA 1HJQA 2VCAA 3FNDA 2J79A 1KQYA 3EMCA 4WKFA 1BAGA 4AD5A 1UH4A 3AI0A 5GNYA 1EOKA 2OLHA 2PWGA 4W84A 1MQPA 3BC9A 1Q6GA 3AZRA 4W8BA 2ZX8A 1ODZA 2XGBA 4PSRA 2ZX5A 2J8GA 2QMJA 1UWRA 4A3YA 1JG9A 4W7WA 4PTXA 1P6WA 4B15A 4AD2A 2JALA 2NSXA 2HISA 2IXUA 2YL8A 4P8WA 2WC4A 2XG9A 3A3HA 4U31A 2ZWZA 1B31A 4XX6A 4RE4A 1HP5A 3ARYA 4GO9A 3WMSA 1H11A 4MDOA 1F4HA 1FP8A 1CDGA 2PI6A 3AIEA 1V6VA 3GH7A 2CXGA 4LX4A 1SMDA 1HM3A 1GQJA 2ZUNA 1RPKA 1QBAA 4CGTA 5A6JA 5HXMA 1C8YA 1BGAA 6TAAA 2PBOA 4GIAA 4GZEA 3WFLA 1QNOA 2ZX9A 4DWSA 5A6MA 1EDTA 2NT1A 1MYRA 1JI1A 1WDPA 3QGVA 2JEQA 3WL0A 4D6JA 1UZ1A 3VU2A 1VB9A 2FGLA 4GQRA 1GOKA 1I1XA 4XV0A 3U57A 3AMGA 1UD3A 3ZT7A 1Q6CA 1YHTA 5DEZA 5D8ZA 1EGZA 3T2PA 3SCOA 1CGTA 2J4GA 3ZM8A 1B0IA 4U33A 5DF0A 4PTVA 2DGAA 2WMIB 4U3CA 2GDVA 4PUEA 4X0VA 1VFOA 1B2YA 1FHDA 5ABGA 1MW2A 1RWCA 5A6BA 2EO7A 2YLAA 2E24A 2VL4A 1GOOA 1UWQA 5HBFA 2WB5A 4AD1A 4CN4A 2VZVA 4J3TA 2PBGA 4ACZA 3W6LA 3WQVA 5IFPA 1HL8A 5FCZA 5A2AA 1C91A 3WD4A 1V3LA 4AC1X 1DWIM 3SEPA 2YDSA 3AIUA 4OKDA 1CXLA 4GKLA 3CUHA 1GJUA 4GI6A 3SCWA 5E0CA 3CZ8A 1WZAA 5A3HA 3L4XA 3VGBA 1GQLA 2XHYA 4AYSA 2G8ZA 1JF5A 1NH6A 3DHPA 1KWGA 2A3HA 2E8ZA 1VRXA 3OLEA 2EPKX 4HP5A 2WLYA 2EPLX 1BG9A 4H8HA 4CU8A 1UKSA 4GXPA 1VENA 4KGLA 2QLYA 3UG4A 2JEPA 4MB5A 3WUFA 3OBAA 1GOMA 4UQ9A 1XYFA 1W2VA 1HKJA 1JZ8A 4HOZA 2BVYA 2GJXB 4N0RA 3W37A 3MMDA 2Z1KA 4WKAA 3BSHA 1QNRA 3G6MA 4JHOA 1H41A 3B8SA 1LL7A 1NP0A 2GK1A 2DH2A 1K9TA 1XC6A 1OIFA 1LOHA 1UYQA 3WFZA 3EDFA 3VIIA 4B3LA 1VAHA 5CGTA 5KEZA 1OB0A 1B9ZA 4PRWA 3VTRA 3THDA 2VNCA 2CBJA 1CXKA 3AICA 1BYCA 2G3JA 4B3KA 2XIBA 2FHCA 4FLRA 1V3IA 1HKKA 3VVGA 3ZJ7A 3GXFA 4EKJA 4JL2A 1E72M 1KFWA 1OSEA 2ZUUA 4D6IA 2D3NA 5I77A 3MU7A 4TVUA 2EXOA 1V08A 1B1YA 3K8MA 2D24A 4JFVA 1GVYA 1FFQA 3VGFA 5C70A 1X1HA 2UY3A 1UUQA 1UR0A 2D3LA 5D4YA 1HMWA 1JFHA 3ZSSA 3W24A 4BCEA 1UKTA 2UY5A 5BXRA 1FFRA 4J3SA 1VEOA 1V0LA 5KZ6A 2XVLA 2XSAA 3AIVA 5ABFA 2DEPA 3KL3A 1LLOA 3WELA 1OWQA 2WC7A 2ZUVA 3VMNA 4HMEA 2PWFA 2G3IA 3SCPA 1OBAA 4WJXA 3AMKA 1GOQA 3ZSTA 3AOFA 3VD9A 1OGBA 2ZXQA 1E6PA 3S2CA 4CD8A 4MNKA 3AHTA 1DWHM 2E9MA 4OIFA 5I24A 5JIWA 4HZ8A 1WO2A 3FHQA 1OT1A 4AW7A 4NSBA 1W9BM 1CXFA 1GZJA 1QI4A 3D5HA 1KGXA 1EQCA 1UWTA 1E9LA 3VDAA 3ZR6A 3L4UA 4LYQA 1GQKA 2DT2A 4IM4A 3T08A 1XSJA 5HNNA 3K4DA 4DWSB 4XZBA 4W5UA 1H49A 1E3ZA 3SUUA 4GO8A 4IPNB 2C7FA 2CYGA 3RCNA 4FK9A 4RE3A 4KGJA 1PZ3A 1UD6A 3NCOA 1QI3A 1W9VA 2VQTA 3T09A 3ARWA 1F9GA 4EK7A 3J7HA 1HT6A 4JZ5A 5A2CA 2VX5A 2Y5EA 4GI8A 3MUZ1 3VDBA 1BG4A 2BHUA 2BNJA 1RWAA 3W25A 1UG6A 2JF7A 1AQMA 1D3CA 3BCFA 1V0KA 2CERA 2ZX6A 3POHA 3JUGA 1MQRA 3VUPA 2BRWA 5I0DA 1ZL1A 2WAGA 5IXEA 2D0FA 1H5VA 5JBEA 5HDRA 2XWEA 4PBGA 1ODUA 4CD6A 3A6OA 4H04A 4ZXLA 4W93A 5AC5A 4ZE4A 1K6AA 4PMNA 4CUCA 3FY1A 3BLKA 1PPIA 2Z1SA 4C7DA 5IHRA 2WKLA 2WMJA 2OWXA 3SCQA 1OT2A 2J7CA 2J8FA 4J7RA 3VMOA 1GONA 4W8AA 1J0YA 4R5EA 4BS0A 1C82A 4Z2GA 2WMIA 3F5KA 2B31A 3ZQ9A 2F8QA 1QVBA 2RGMA 4Q22A 4PUDA 2GVYA 2FH8A 3IJ8A 4P7NA 3W28A 5A1AA 4FLOA 5E6ZA 2WVUA 1XD0A 2WHMA 2XGIA 1G9HA 1J0ZA 1E4IA 3M6DA 4HA3A 1KGUA 3M7SA 4M1RA 4Z2LA 4FLSA 1A3HA 4Z2KA 3EDKA 1VBUA 3SCVA 6A3HA 4WKHA 2VX7A 1XH0A 1O7AA 1DP0A 4TX8A 2W61A 4PMUA 2O9TA 4LQ1A 1C7TA 4W88A 2XFYA 3M07A 4V27A 4J3WA 5CG0A 3K4AA 3WH8A 2DH3A 2EBNA 3CGTA 4HOXA 4TUFA 2E9LA 1UWUA 3O6AA 5CSYA 4OUEA 3AS2A 3ZIZA 3CPUA 4AEEA 5DFAA 3WF0A 3NDYA 3L2LA 2VQUA 2VC9A 4B9ZA 3T2QA 3U5YA 4AZ5A 4P8XA 2O92A 2Y8VA 1HJXA 2WCSA 3F5JA 3L4VA 3WH7A 2BY0A 3WQ5A 2XSBA 2AMGA 3AMLA 4IUGA 5HPOA 1FHLA 4AD0A 5E70A 3EMQA 4UQEA 1BYAA 2GJXA 1HL9A 2WSKA 2J7GA 5FKYA 5DO8A 3VD5A 2QV4A 3VGDA 5HOSA 1NOWA 1W9DM 3VD7A 3THCA 1B3XA 1CEOA 1E6NA 2W91A 1E6QM 2XFRA 3WDHA 1I8QA 1GQIA 3KL5A 4KRTA 5A94A 2VVNA 1UR9A 1W2PA 1H0IA 1NQ6A 1C8XA 1EIBA 1E5JA 5I5RA 1MFVA 4ML4A 4DWSD 1UKPA 1OJOA 5A8PA 2VZUA 5LA0A 1J0MA 1XCWA 5CPQA 1MWOA 1B3YA 5ABFB 8CGTA 2ZXBA 5CZKA 3WEZA 3AXXA 3VIGA 1UA3A 3VIJA 2X05A 3K8LA 4PTMA 2V3EA 3NSMA 1W1VA 2A3AA 2Q1FA 4H8UA 2WMHA 1HP4A 3WQ8A 1VFFA 3BMWA 5M5DA 3VDCA 1WDQA 2WXDM 4X9YA 5BWFA 1KR1A 5EB8A 1EGUA 1QBBA 2C8NA 3PZMA 4IISA 4UQAA 1A47A 1UWIA 1XHGA 2PB1A 2W66A 1IV8A 3W38A 1U30A 5A6BD 3N04A 2OSWA 3WQ6A 4HPHA 2DSKA 2G3MA 4PCSA 4UFMA 5CSUA 3EDJA 4U2ZA 3WDIA 1GNXA 3A4AA 3KE0A 2CCRA 4GINA 4CN6A 3APGA 3CHFA 3RDKA 4B9YA 2BRPA 3MO4A 4QDMA 3N15A 2X1IA 3MSDA 2W92A 2ZXDA 1TR1A 1Z32X 1J0NA 3NSNA 4C7FA 3II1A 1E70M 4V2XA 2E9BA 4F9DA 1R86A 1VIWA 2X0HA 1UR2A 3WF2A 5LYRA 1E15A 1QNSA 2CETA 3OZOA 1MXGA 1PIGA 5D9OA 3W0KA 1FP9A 4ATWA 4UNIA 1E4MM 1EH9A 5FIPA 1JIBA 3LPPA 1FH8A 1WP6A 4MADA 1MVYA 3HJEA 2WNWA 4MNJA 5E0FA 3UG3A 1GORA 1PX4A 2WHLA 4DUVA 4LYPA 2VX6A 1UKQA 3CUGA 5A8OA 1OJNA 1JDCA 4GQQA 2UWFA 1US3A 4P7LA 1UHVA 1E4NA 3PBGA 2WHJA 3T2OA 1JAKA 1HJSA 3ECQA 4JFSA 3U5UA 3VGGA 3RO8A 5I23A 1W3LA 3VIHA 1J10A 3BXWA 4W89A 3ZJ6A 2ZUSA 2V3DA 1PZ2A 3VOCA 4D6HA 4HU0A 3NDZA 4EANA 2VVSA 4BF7A 3W81A 4CU6A 1ESWA 4NZCA 3CZJA 1FA2A 3GM8A 1WCGA 3FXYA 3VIOA 4GI9A 1J0IA 1ZU8A 2WZEA 1KR0A 1HJUA 1E71M 4AZHA 2VZOA 1TA3B 1WNOA 3BAYA 1RWHA 1UR8A 2Q8XA 4JCLA 3VM7A 1WAWA 1ZBCA 5JBFA 3GXDA 1EXPA 2E3ZA 2ZUMA 3RJYA 1XV8A 3L4WA 2ZX7A 4QCEA 3CHEA 2ESCA 3N9KA 2FHBA 3CZKA 1QI2A 2JIEA 2YDRA 3TTYA 2AOSA 1FH9A 1V3MA 1M01A 2X2YA 1HVXA 3WNLA 3BGAA 3TA9A 2O9OA 4JFWA 4OOUA 3FAWA 4PMZA 2DT1A 2W67A 1ISVA 1PAMA 1F1SA 1H0GA 3T0AA 4MTVA 5BXTA 2XVKA 3AHVA 2BV9A 4HMCA 3W82A 4ZEPA 1UOKA 3MUAA 3WBAA 4S3JA 2ZUTA 4F79A 4ZENA 3W53A 4BA0A 4FF5A 5I6SA 1U2YA 3SCUA 1CGXA 3N18A 3KZSA 3PZUA 1HMUA 3IAQA 4PSPA 4UR9A 4URIA 4CCDA 3CUFA 4KWUA 3B9DA 4TX6A 5BRQA 2F61A 1BFNA 4M56A 2W63A 3T0BA 2YBUA 4AD3A 2JIWA 3CIVA 3RM4A 3IAPA 1Q4NX 5CLTA 2QPSA 4W86A 4D72A 1KXHA 2MANA 2J7BA 1VF8A 1JZ3A 1JD7A 3SCTA 2YJQA 3ZMRA 1JZ6A 1BLIA 4FLQA 2VMFA 4UZUA 4GZJA 3ALGA 3PZNA 3VMPA 3UESA 1ITCA 1HXJA 1G5AA 3OA5A 1FH7A 1JL8A 1J9YA 4P7QA 5CJ5A 4E8CA 3CHCA 1MW0A 4BQ4A 2OSYA 3MKKA 3N1AA 2DSUA 2NT0A 2XWDA 3RPMA 1CXIA 1W1PA 1Q6FA 3EYPA 2W5FA 2CNCA 5LA1A 1GOWA 1NOFA 4DUWA 1QHPA 3EDDA 1VEMA 2WCGA 4QAWA 1MW3A 1KQZA 3AXHA 4UFLA 5A8QA 3WD1A 4YHGA 5M3WA 4XUYA 4YHEA 4M8UA 3OB8A 4XB3A 5A8MA 3I3BA 4AZCB 4UQCA 3QHOA 1JF6A 3HN3A 1EDQA 4J27A 3VM5A 1BGGA 1D7FA 3VNYA 2VR4A 5DMYA 2WVVB 2VTFA 2CBVA 4U5IA 2ZXAA 3VO0A 3L4TA 1RP8A 1BSIA 3CMJA 1N7RA 4AISA 1TVPA 1XD1A 3QHNA 3GBDA 1TFVA 1G1YA 1EHNA 1GHRA 1HF6A 1WZKA 1ISZA 2G4FA 4X0NA 1JGIA 1KB3A 2JFEX 3WH5A 2E22A 2G41A 2A3EA 1WZMA 3BAWA 4JL1A 5LA2A 3AFBA 4AWEA 4D6CA 1NOUA 1QNPA 1B3ZA 1MFUA 3ZT6A 5FL0A 5EMYA 3WF1A 3WY1A 4OOZA 1VBRA 3FAXA 1NWTA 1XSIA 3VGHA 1OD8A 3CZEA 3CBWA 4PMXA 8A3HA 4HU8A 3PTMA 2YDQA 2W4XA 3CUIA 3OLDA 3ZJ8A 1DHKA 1KXVA 3AHYA 3BSGA 1E73M 3CZLA 2FDMA 2CHOA 4NF7A 1W32A 1CXEA 4IPLA 2EQDA 3IK2A 3PZIA 4NRSA 4AY1A 3F4VA 3D3AA 1E0VA 2YLLA 1UD4A 1DWAM 4C7GA 1VJSA 2D0HA 2J7HA 1V6YA 2UY4A 2PF0A 5M17A 1VEPA 2CIPA 5FOOA 1S46A 2D22A 3VIFA 4JKKA 2D2OA 3IANA 4PN2A 2QHAA 2WVTA 4Z2JA 2X03A 1ZJBA 2J75A 5BROA 3A4XA 4M24A 4DM2A 1H1NA 2DSWA 4PMVA 1WDSA 3GNOA 4D6EA 1M03A 1IZKA 1AQ0A 2TAAA 3SCNA 4UTFA 2GFTA 5BRPA 4MB4A 2Y4SA 2OYKA 1EA9C 3U7VA 4WIWA 5EBAA 4JFTA 1PIFA 2J78A 4JKLA 5A8NA 1LL6A 1BHGA 1K9EA 1CGYA 4UFHA 3CMGA 5D9NA 4U3AA 3EMZA 4ATDA 1CGWA 1MQQA 1VFUA 4NI3A 3L2MA 2WBKA 4DUXA 2BHZA 1ITXA 3N13A 4MB3A 3WNMA 1WB0A 3LPOA 5JBDA 3QOKA 3AROA 5A6KA 1TA3A 2XVGA 3WSUA 1BVNP 4JCMA 4E2OA 3ARRA 5ABEA 4D6FA 2CKSA 2CPUA 1C8QA 4Z2HA 1WKYA 3ZOAA 4D1IA 4HA1A 2X8RA 2V38A 3PZ9A 3N12A 1N7QA 5C8BB 3GH4A 4JFUA 2WZHA 4MAZA 1K9FA 2C0HA 5E09A 1L0PA 1HX0A 1TVNA 2OWCA 1CTNA 5AY7A 2CHNA 4H41A 4WF7A 1W3YA 1CB8A 2XM2A 1B90A 1EDGA 3AYSA 1PBGA 1OJPA 1NWRA 3ARQA 1HIZA 4MNLA 4QFUA 4WLCA 4U5KA 2GJPA 2DIJA 2OYLA 4UFIA 1TZ7A 1I75A 1NARA 2RGLA 7CGTA 4P8VA 4HZ7A 4BQ2A 2W62A 2EJ1A 1AMYA 4QCFA 2V5DA 4TVDA 4QLJA 2WPGA 3WDQA 1R87A 2D23A 1W9UA 3GNPA 2DT0A 1KBBA 3WH9A 2VJXA 3WEMA 4UQBA 1CIUA 3OIHA 3WDRA 1TE1A 4BQ3A 5A6AA 2VUYA 3PZQA 5CQ1A 1E6RA 7TAAA 2PWDA 5D9MA 1I1WA 2WDAA 3QHMA 3BAIA 3IJ9A 4PYSA 3WUBA 1UQYA 2BHYA 3AXIA 1V6WA 2G3NA 3VILA 3WN6A 3WNOA 1JZ7A 4Y7EA 4F66A 1BTCA 3PN8A 2E0PA 7A3HA 1O6IA 3GYCA 3CZGA 1CLVA 4M80A 5AYIA 3MANA 1ZBKA 1JNDA 3WMCA 1W3HA 1X1NA 4UOJA 3RJXA 3W6MA 3WENA 3CLWA 1B30A 1XSKA 2ZICA 4JIEA 3OGSA 3WF3A 4CVWA 3SUWA 2ZE0A 1C92A 4OJYA 2O9RA 1CBGA 4YPJA 5EFDA 1HVQA 1C7SA 2IXVA 3AIQA 2J74A 1GJWA 3LMYA 4OBRA 2V3GA 1UWSA 3TP4A 4HPGA 2VCBA 1C93A 1AQHA 2WCOA 2A3BA 4FMVA 4EE9A 1LF1A 2BVTA 1IT0A 3LPGA 4AZGA 4JKMA 2XJ7A 2YOCA 4PMRA 1Q6EA 1C3FA 3BAKA 1EQPA 4MJ2A 5CXPA 1VJZA 1N7NA 1KCLA 2FGZA 3ARSA 5DT7A 2DT3A 1H09A 3VNZA 1M04A 3GH5A 1OM0A 5E9AA 3AS3A 1V03A 1HJVA 4PMQA 5BXSA 4AZCA 5AYBA 3CHDA 2E8YA 4K68A 3VINA 2EEXA 1LXKA 4AZ6A 4AD4A 1DWFM 4HOWA 1CENA 3AJ7A 1LG1A 2WVVA 3WMBA 1Y7VA 1E1EA 2GDUA 5BCAA 1JXKA 3WD2A 1ISYA 1AVAA 1V6UA 3HU7A 4ATLA 4PTWA 1RW9A 3TONA 2CEQA 4TOQA 2BXZA 2XM1A 1J0KA 2PC8A 1W3JA 2QPUA 2FH6A 5D9PA 3HMCA 1K9DA 1QI5A 5I78A 1JZ5A 4Q7NA 1BYDA 1JFXA 1JYVA 2XPKA 3GXMA 2DSZA 4TTGA 2D0GA 1LWHA 2WBGA 1H2JA 2EPMX 2ZUWA 2WMGA 1OINA 3AIWA 3AHZA 3AZTA 1UA7A 4HA4A 5ABHA 4OZOA 3WD3A 3WIJA 1X1JA 4WSJA 2YA1A 4NRRA 2Y2WA 1ZBWA 5A2BA 1J12A 1J11A 4A4AA 3O9NA 4CD4A 3PZTA 1UD2A 2X0YA 2DDXA 3F5LA 2XFFA 3ARZA 5F7UA 3WNPA 1D2KA 1BYBA 2DIEA 3NIYA 3EDEA 5D8WA 2XTKA 1CECA 1M53A 3DC0A 1GUVA 2WYSA 3QR3A 3MUIA 1OCQA 5I2UA 2OWWA 3VIKA 3FN9A 3DYMA 2WLZA 1U33A 3AISA 2WCAA 3MMWA 2IUZA 1HNYA 1HM2A 1BVZA 3BAJA 4PMDA 5AC4A 2VO5A 1EHAA 3MV01 3I3DA 1F4AA 1ECEA 1OIMA 1JYXA 1B3WA 3OLIA 1QW9A 3GBEA 1RP9A 1UH2A 3ALFA 1GVIA 2WZIA 4M82A 5E6YA 1V3HA 2XUCA 3L4YA 2YKKA 3T0DA 1G94A 1V02E 3RM9A 4L4OA 3VX1A 4KMQA 3VIPA 1UH3A 4M29A 4QLKA 4D1JA 4CD5A 1IZJA 5ECUA 3KWXA 3MMUA 3BH4A 4LXFA 1BPLB 4AIUA 2DSVA 4DM1A 1H4PA 3SURA 1EO7A 1E5NA 3W26A 1E6XM 4J3VA 3DECA 4R27A 1HKIA 4P8UA 3K8KA 1J01A 3FW6A 2XVPA 1JYWA 3ZO9A 4OBSA 1R85A 1EO5A 3ARVA 3VX0A 3PTQA 3KL0A 3MSGA 2WM0A 2DQXA 2WMFA 2BVDA 1E6SM 4W7VA 1GW1A 1RWGA 4RE2A 1SR0A 3U7BA 2VT0A 3B9EA 1GHSA 4UFJA 2CESA 3MUY1 2YL6A 4AZIA 3TTQA 3DHUA 1E6ZA 1ZJAA 2BY3A 4AZBA 3RMEA 2F2HA 4A3HA 1HJWA 4QLLA 1UD5A 3MV11 5IHSA 1OD0A 1KCKA 2CBUA 4N42A 1V02A 3K46A 1XGZA 1C90A 1X1IA 4V28A 3WEOA 5BYWA 2XYLA 2EPNA 4F8XA 4MPKA 3DYOA 2WWDA 1E1FA 3FHAA 1R7AA 2OYMA 3BLPX 4L4PA 3UR8A 4MAVA 3UETA 3OLGA 5A6SA 1ISWA 1J18A 3WL1A 1QHOA 4CVUA 3I3EA 3A47A 3AMDA 2J47A 2WANA 3ARPA 4MNMA 2VCCA 4AMCA 5A6LA 2J25A 4W87A 5IFTA 3ARTA 1GOIA 3VPLA 2WVSA 4UOQA 2VURA 4ZXOA 1V6XA 4UOZA 1Q6DA 3GDBA 5FL1A 1UR4A 1BQCA 1JDDA 3WDJA 3WNKA 3TTSA 4P7OA 1W9XA 3E1F1 1YQ2A 5JIPA 1W1TA 2YIHA 1J0HA 1DEDA 4D6GA 3AQUA 3M46A 3WQ4A 5CPSA 3TOPA 2BS9A 3GNRA 4MJ4A 1G0CA 4MB1A 1E4LA 3L4ZA 2E4TA 1MXDA 2BXYA 2VOTA 6CGTA 3UCQA 4M81A 1W9PA 4DWSC 5FD0A 1CLXA 4D6DA 1HN1A 2J77A 3VIMA 1JAEA 1R7OA 1R8LA 4H7VA 4MDPA 1ZS2A 2Y8KA 2VRJA 2FHFA 2J7DA 1XCXA 4PMOA 3SCRA 4Z2IA 1UD8A 1E56A 3B9AA 4J28A 2VZTA 1BF2A 3DYPA 4WSKA 3WUEA 1SFSA 1UR1A 2J62A 2OSXA 1W3KA 2CBIA 1WZLA 3BMVA 2CKRA 1H3GA 5GQBA 1JZ4A 1JXJA 1VFMA 2WMKA 1PX8A 1FOBA 2VZSA 4TTUA 3SUVA 3RM8A 4TVCA 4YN5A 5HPCA 2J7FA 1PX3A 4TXEA 2D20A 1WDRA 3WUGA 4XZWA 3WH6A 4AIEA 4EAMA 4HMDA 1PJ9A 1GPFA 1E55A 1JYNA 3PZOA 1ISXA 2XIIA 3WDPP 4AEFA 1XRVA 5CPTA 5I3DA 3TTOA 2YL9A 2X09A 3PZGA 1RD6A 1CZ1A 3UG5A 3ZJKA 1TUXA 2A3CA 4WK9A 2CITA 4H8VA 3CH9A 1WPCA 3SCSA 3CUJA 1UQZA 1JNEA 3N17A 2GUYA 3ZT5A 1JZ2A 1CYGA 1CXHA 1DTUA 3OG2A 4W7UA 5GNXA 5A69A 1XH2A 1NWUA 1M7XA 3VD4A 1CGVA 1KXQA 3GZAA 1X6LA 3ZR5A 4ZFMA 1OGSA 3SUTA 1SYTA 5GNZA 5EFFA 3A4WA 1DWGM
chains in the Genus database with same CATH superfamily
4FX8A 1UZ4A 4LUIA 1W1YA 2Z24A 3W29A 3E5PA 3SGZA 2VRKA 2VFFA 4BI7A 2WC3A 1QOXA 2NW0A 5KZMA 1DJQA 4ACZB 3HPSA 4UTWA 1LJYA 3WQCA 4HKPA 3LGDA 1SSGA 4MGGA 3WNNA 1E40A 2Y7EA 2YYUA 2VI0A 2ZOXA 2O9PA 4O13A 5AB3A 1CNVA 3DGRA 4UCFA 2HXUA 2NLYA 2BY1A 1E3XA 1IQ8A 3BCDA 3AYRA 5JUVA 1F5ZA 3VYLA 3W4RA 1SMAA 1HL2A 4E8DA 4EPBC 3UCDA 3V0TA 1U1HA 3PM6A 1A50A 5TBOA 3BW2A 1CWYA 3HO8A 4C6EA 3BLFA 3TN6A 3GIPA 2JE8A 5LIYX 1QU4A 1DJHA 2ZWYA 4GPNA 3HB9A 1RHCA 1V0MA 1PKYA 4D8LA 3AIRA 3CQIA 3UPMA 2Z1BA 3VZZA 4LVFA 3WKZA 1R47A 4X60A 4BZYA 4CD7A 1H60A 3TR9A 3NUKA 1VRAB 3QZEA 5DRCA 4X2PA 3A3WA 1JRBA 3GC2A 3EZ4A 2YA0A 2WHKA 2HS8A 2POTA 4AIOA 5F2MA 3E02A 4XK2A 4H2CA 2ZRXA 3DBPA 3UR7A 1J0JA 5DANA 2PDBA 1QW8A 3R43A 3VD3A 2OJPA 3KCLA 4S3KA 5D02A 3W22A 2OKOA 4YL2A 4JYEA 3DOPA 4LNCA 3AZSA 1E0WA 1EF3A 1OG6A 1CPUA 3PWGA 4XD6A 3GG7A 3HQPA 2ZC8A 3PB0A 1GYNA 2VC7A 1S1PA 3AMCA 3QY6A 2J7EA 2HVMA 1YX1A 3DFSA 3OQEA 3ITXA 2J66A 2WSPA 4CQ8A 5A95A 4KH2A 1GKRA 1TPWA 4LVGA 4ZE5A 1OJMA 1NWSA 2NX9A 1KGWA 3B8WA 2WKGA 3BAXA 3DG3A 1HTIA 2PPGA 4UZSA 5DCDA 1FWBC 1A5AA 4LVDA 1GZ1A 1XH1A 3UZXA 1L9WA 2VR5A 3Q67A 3ARXA 4IGSA 3WQWA 1I0BA 3KEHA 1L8NA 2I9EA 1Q6RA 2DZWA 4C1KA 2JQXA 2QF8A 3SQSA 1UJPA 1GQNA 4MG4A 6XIAA 3EMCA 3UA4A 4D9PA 1BAGA 1ZAIA 4A8NA 1V4YA 1UH4A 5I07A 5GNYA 1Q65A 3T8LA 4Y9MA 3BC9A 1QWKA 1Q6GA 2F7FA 3V7PA 2ZX8A 1ODZA 2XGBA 2J8GA 1SFJA 1Y5VA 1UWRA 3H2MA 1JG9A 3GW3A 4QRNA 5K4ZA 1WXZA 2YCIX 2JALA 1TJ0A 1Z48A 3TWBA 2YL8A 3MTWA 1RY0A 2WC4A 3BQ5A 1N8IA 4V15A 3DFYA 4U31A 2DZVA 2ZWZA 1DQUA 4XX6A 4RE4A 4GK8A 2DVTA 3QFEA 4E4FA 1CDGA 2PI6A 3AIEA 5LKYA 3IIOA 3CUXA 4O50A 4K1WA 3DFNA 3GH7A 3SN1A 1HM3A 1RPKA 2DW6A 3YPIA 4CGTA 5A6JA 6TAAA 3FVMA 5CJNA 4Z1BA 3BK0A 3SO7A 3BWWA 4C65A 3WL0A 1UZ1A 2FGLA 3CB3A 3C5QA 1GOKA 1AW1A 2GVLA 4HNLA 3O15A 1UD3A 3ZT7A 2WOQA 4H7CA 5DEZA 5D8ZA 3WLOA 3IJDA 1M5WA 3TN5A 4DY1A 4E4UA 3T0CA 1SU5A 1B0IA 4M7SA 4U33A 5DF0A 4RDWA 2WMIB 1YDVA 4ZB5A 1VFOA 3PBWA 2ZTKA 2YLAA 3A22A 3M5YA 1YTEA 1UWQA 5HBFA 4QM1A 3GTFA 3UGRA 3W6LA 4QTGA 2R82A 1W5OA 5FCZA 2X0SA 1C91A 1V3LA 4AC1X 4HB7A 3AIUA 4Z0SA 4FNSA 5DQPA 2Z2UA 4GKLA 4QBXA 3EOEA 1QUMA 3LK6A 4YCOA 5TNVA 1GJUA 4PR4A 3SCWA 4O8RA 3CZ8A 1WZAA 3VGBA 2ZBTA 1P48A 4AYSA 1ADOA 1K8ZA 1O5XA 4ZO9A 3GK0A 5G2IA 2B81A 4B5NA 1JF5A 2OO0A 1LYXA 3LD5A 3VAVA 1XDMA 3LBCA 2P3ZA 2WSYA 2NQ5A 4H1ZA 2R1MA 5E5CA 3WLRA 1U1UA 2WLYA 1BG9A 4QS5A 4Q8UA 3PNZA 1OADA 4L6OA 4DX3A 1BWVA 1GOMA 3CASA 1W2VA 4FNRA 3LS9A 3TYAA 3W37A 3MMDA 1RLDA 4C90A 1VCFA 1RCXB 2DU2A 2OEMA 3WQGA 5HMSA 1J93A 4IL0A 5AC8A 1OYCA 1RJRA 1K03A 2R24A 1NP0A 2GK1A 4PODA 1TKKA 4NY2A 1PWLA 4HNOA 4EWND 4B3LA 1VAHA 2QCNA 1OB0A 4MWAC 2OKTA 3D6NA 5TQLA 3GW0A 4ZZ9A 2XIBA 4FLRA 2ZDSA 4LC8A 1V3IA 3GXFA 4EKJA 3MI2A 4R7OA 2GJNA 1A5BA 1B1YA 3UFYA 4RZBA 4GLEA 3JRKA 1GVYA 3VGFA 4A2RA 1FVPA 2UY3A 5D04C 2C19A 1HMWA 5LGZA 1JFHA 4R7WA 2V81A 4UTTA 1EKOA 1Q66A 4N7QA 1LROA 3L0GA 7REQB 4V33A 1XFBA 5ABFA 4AHPA 3HIJA 2Z2AA 4PCNA 4S3FA 1OWQA 3TN3A 3VMNA 1O5QA 2G3IA 1TTPA 3KTSA 4IMGA 4WJXA 2C1IA 4NZ4A 2NSOA 3ZSTA 4C5ZA 3QBUA 3AOFA 3TQVA 3K5XA 1YXYA 4YU1A 4L6HA 3TLQA 5I24A 2HXTA 3EX1A 4X9SA 5BZAA 4AW7A 4BF5A 1ONEA 1GZJA 1GK8A 1FHVA 1GOXA 1VJIA 4KWVA 1UWTA 1WDDA 1SO5A 3VK5A 3BLOA 2FJKA 4IIBA 1GQKA 3FK4A 3U48A 1XSJA 2PDPA 4R7JA 3RCYA 1UMYA 3FYPA 3TMLA 1E1CA 3SUUA 3S0CA 1QTWA 4IPNB 3RF9A 3G0UA 3RCNA 4RE3A 3TH6A 1WX0A 1QI3A 3G1FA 3J7HA 1TMLA 4YWIA 5FJTA 3VCRA 1HT6A 2WSQA 1JPKA 3TE9A 2F9RA 3P61A 3AUJA 2BHUA 3ANUA 4O54A 3W25A 2P76A 1UG6A 1JR1A 2JF7A 3P84A 2R1PA 2W0UA 3C61A 2AQWA 3GD6A 3QMSA 3ID7A 3BCFA 2ZX6A 5IM51 4I90A 1O0SA 4FPSA 3S3GA 2P50A 3M9YA 5JBEA 3E6EA 4H83A 4AVOA 3BTNA 3UPBA 3E0IA 2VC6A 3E0WA 3KRUA 4ZXLA 5AC5A 1O94A 2Q3RA 2KXRA 4KEMA 1IZCA 5AC7A 3FVDA 1K6AA 4PMNA 5IHRA 1O5KA 3BLKA 4WOZA 2OGYA 2WKLA 3SCQA 1OT2A 4D8ZA 3KRZA 4GCXA 3F4NA 1BF6A 1KD0A 2OPJA 3LENA 3PG8A 3PQIA 1C9DA 3TXVA 3ZQ9A 4TV6A 4DNHA 3UY7A 4P7NA 3W28A 4FLOA 4Q8OA 2XFWA 2WVUA 4GG9A 1G9HA 1XLBA 3RN6A 2ZRWA 2OOGA 1XDJA 5CC3A 3W7LA 4BEUA 3M7SA 4M1RA 4FLSA 1A3HA 1JULA 4Z2KA 3EDKA 3SI9A 6A3HA 4WKHA 3C0JA 3W2MA 3UWWA 4ADUA 4AX7A 1YW1A 4KKXA 3RU8X 4D2JA 2QUUA 2XFYA 4GI4A 1QPNA 4IUOA 1WDWA 1G67A 3K4AA 3WH8A 2IQTA 3QPZA 4ERGA 5H8MA 3T8QA 4TUFA 1OFQA 1OX5A 3MO7A 3CPUA 3ZS4A 4AEEA 3WF0A 4XTIA 1A49A 3L2LA 4B9ZA 3T2QA 4AZ5A 5FA5A 3TR2A 4P8XA 2O92A 3KAOA 1I2NA 1V8EA 5CC5A 5D38A 2B7PA 4HSOA 3W88A 2BY0A 2XSBA 2Y7DA 5BMWA 1PCWA 2HQAA 2WJFA 1ZY9A 1M41A 5BWAA 4KWSA 5HPOA 1FHLA 3L5AA 4AD0A 3TVAA 3W1RA 4NNCA 5DMNA 2GJXA 1HL9A 1HG3A 1TSIA 3VD5A 3E0VA 2TMDA 3FYOA 3THCA 3NO5A 3P5YA 2RDUA 1CEOA 3NTYA 2I7GA 2XFRA 3URQA 3UYCA 1W31A 1I8QA 2FKPA 4GX8A 2VEPA 3E96A 4HGXA 3WJZA 3TYDA 4C1LA 1W2PA 1HW6A 1SZRA 3LSCA 3KBUC 1J0MA 1XCWA 1P0EA 2QZRA 1H1YA 4IFOA 5CZKA 3U4AA 1HGWA 4O53A 4PTMA 8XIAA 2A3AA 3TW7A 4Q4PA 4H8UA 4PC8A 2WMHA 2AKMA 1SZGA 1WDQA 2WXDM 4X9YA 5BWFA 3V4BA 3VXGA 1YADA 3W71A 2IS7A 5D09A 3SGGA 2W66A 3PJXA 1R30A 1X1ZA 3JZEA 1RCQA 3W38A 1U30A 2Q71A 3VNIA 4HPHA 5CSUA 3EDJA 4U2ZA 3RG6A 3VOJA 3ONBA 3KE0A 1SR9A 4R3UA 4Z42C 4XKMA 4HIBA 2AL2B 4GVHA 4CN6A 3APGA 3CHFA 4PRTA 3UGVA 3G1DA 1BQGA 1UP0A 3N15A 3MSDA 1J0NA 3NSNA 1E0UA 3FIGA 3II1A 3PY2A 4RNFA 1QJWA 2E9BA 2BVWA 4F9DA 1FHUA 3MHGA 2WO5A 3UJRA 5BU6A 1R46A 4DEFA 2B0MA 5LYRA 1QNSA 2ZZ3A 4IQDA 4JQ1A 1MXGA 1PIGA 4M6QA 3AXMA 4HNUA 4QG8A 4WOQA 4G1NA 1A5SA 3W02A 2B4GA 1O1ZA 3LPPA 3V75A 4MADA 1MVYA 3HJEA 2WNWA 4MNJA 3MZNA 1POJA 4HK6A 3QKZA 4HN8A 1PX4A 2VFGA 4LYPA 4LVBA 3CUGA 1OJNA 4JIIX 4P7LA 4ZQRA 3LM7A 3P67A 3ECQA 3TNOA 3U5UA 1R9XA 1ZAHA 3MKCA 3BICA 2NUYA 3KOWA 2V3DA 4MY9A 2WJDA 3W7IA 2VVSA 4US5A 3EPMA 3TC7A 1NTHA 3CZJA 1S2AA 1NELA 3SY8A 4U4MA 3E0LA 1ONRA 2AAMA 2ATSA 1TPEA 2OU4A 4AZHA 3EB3A 4WVXA 2DZTA 1VYSX 1R3RA 3BG5A 1RWHA 2Q8XA 1WAWA 1XR2A 5JBFA 1R3QA 3GXDA 4MUZA 1PDZA 4NASA 3TOYA 2ZX7A 3IIXA 1XYLA 3C3UA 3TYBA 5CZTA 4DN1A 3TTYA 2QDGA 1HVXA 3CT7A 4LUTB 5T9BG 1VC4A 1ZQ5A 2OT1A 1QR7A 5ENLA 1RK6A 2DT1A 3FEQA 1XPYA 4L64A 4HZMA 4ZO6A 5T8GA 4MTVA 3M64A 3OZMA 3EOOA 2G95A 2PD5A 1F3EA 1AUSL 3T4CA 5CBBA 4S3JA 4C5YA 3W53A 3GDRA 3OYZA 3SCUA 3MUXA 3KZSA 3IAQA 1L8PA 1YXCA 2H8ZA 4URIA 1H63A 3GTIA 5AYZA 3L0KA 3QN3A 5BRQA 2F61A 2CLIA 2W63A 2JIWA 3RM4A 3IAPA 2QPSA 4W86A 1HQTA 3AC0A 3MP5A 2J7BA 1O5RA 3IVUA 3H21A 2J9YA 2YJQA 4LUJA 1I2PA 3PZNA 4G9PA 2GGIA 3VMPA 3UESA 1ITCA 3BMXA 1G5AA 3GDKA 4Y9NA 2X1TA 4LH8A 4P7QA 3E38A 4E8CA 1MW0A 4UTHA 1NDYA 5MKGA 4BQ4A 3THAA 3NGJA 3CV6A 1DXFA 4LY8A 1J2BA 4S3AA 3G1HA 2XISA 5LA1A 3FCPA 3E2VA 4XIAA 4XAZA 3UG8A 1XP3A 3EDDA 3WQOA 3OZYA 4QAWA 4WUIA 4KFPA 2WJEA 4DBEA 3WD1A 1F76A 4YHGA 5M3WA 3EOSA 2VD8A 3QR0A 4DXVA 3OB8A 5GJNA 1NDZA 1V51A 4LB3A 1LOSA 3W7DA 4RDZA 3I3BA 4YVXA 3W7CA 3GG8A 3QHOA 1ZPTA 4M6PA 1EDQA 1D7FA 3NQMA 4I5RA 2IQ0A 3C86A 4U5IA 3SFWA 3CMJA 1N7RA 1TVPA 4CNOA 3QHNA 1XLKA 4Q4KA 4ZVJA 3LQLA 1R6WA 1GHRA 1HF6A 4V1YA 3H8AA 1ISZA 2P3EA 2G4FA 1JGIA 3VOGA 3LLDA 1KB3A 2E22A 3WQDA 2G41A 4PUWA 3ABXA 3MHFA 1VRDA 1FX6A 2AGKA 3AFBA 2QDDA 2VDGA 3BG9A 2ZVIA 4DWDA 1QNPA 3VE7A 1V93A 4OOZA 2BGQA 1PYMA 4DF2A 2GUBA 3U8GA 1KM6A 3FAXA 2BDQA 2VZKB 4H2HA 3UZZA 1AMKA 1OX4B 4Z17A 1TWZA 2YX0A 3PTMA 3EA1A 3NL5A 2YDQA 3S5SA 3B0UX 3CZLA 2CHOA 3W75A 2IKGA 5I7GA 3L66A 5CZSA 1SJCA 3W7RA 3IK2A 4O8AA 2GQ3A 4LCSA 1ZZMA 3VCNA 2UY4A 5M17A 4MPQA 5FOOA 1S46A 2CHRA 2PDKA 2XH0A 4IIFA 1P7TA 2YZRA 4NT0A 1T41A 5BROA 2GZXA 3A4XA 3B9OA 1ONXA 3WLSA 4MUPA 1AQ0A 4S2CA 4LUSB 2GFTA 4QX4A 2OYKA 4WIWA 5EBAA 4QDWA 1UOZA 2ZZ2A 4GBUA 4L9ZA 1W3IA 3NL2A 5H91A 1Z7AA 1CGYA 4UFHA 1REQB 3EMZA 1CGWA 1MQQA 2VGFA 4I7UA 2PODA 2PWVA 3WNMA 4FZIA 3AROA 2NUXA 2XVGA 3WSUA 4JCMA 3ARRA 4LT9A 4D6FA 4R34A 3LI1A 4B91A 1XBXA 1NEYA 4NNAA 1OCNA 4O4WA 3DFHA 4C6PA 4EF8A 1TX2A 3LHZA 2V38A 3PZ9A 2CZVA 5KINA 1BSLA 3COTA 3QR1A 3A9BA 1N7QA 5IOBA 4JEQA 2NUWA 4YYCA 3U3HA 1CX9A 1X96A 3NZ1A 2ACSA 3TYZA 1AD1A 1ZJHA 2FTWA 3PSWA 1HX0A 1O4UA 4L4LA 4XQ6A 2GVEA 4H41A 1CB8A 1XIGA 2ZQ0A 1B90A 3UZYA 1PBGA 5D37A 1NWRA 4TMBA 1ZCCA 3FGCB 4H8NA 4U5KA 1EPVA 2DIJA 2OYLA 5TAOA 3DENA 1MO0A 2PDFA 5AHFA 1JCXA 1NARA 1ZCOA 4ZOBA 7CGTA 2MNRA 4HZ7A 4BQ2A 4UTTC 3WDQA 2D23A 2DT0A 3ATZA 3WEMA 2GOUA 1CIUA 1E6RA 3GNXA 5I3GA 2PWDA 1TJ2A 4DJFD 3GVVA 4PYSA 1WA3A 5JQ9A 5F1VA 2BBFA 3LBMA 1BTCA 3PN8A 1X97A 2DUZA 2ZKMX 3LNPA 4BWLA 4JIHA 4LYKA 2HCVA 3GAYA 1CLVA 3C2FA 1TX0A 3EXSA 3BOLA 4UOJA 3CLWA 4ZQPA 2ZICA 1SO3A 3NZPA 1CBGA 1P0DA 1VYRA 2XIOA 3AIQA 2J74A 3PR2A 2FFCA 4J9JA 3KOZA 3LPGA 3E2QA 4EXQA 4O1BA 4JQ4A 1NSJA 5C7VA 1MSSA 2QJNA 1N7NA 2C91A 2GQ8A 4AWUA 3ARSA 3KP1A 3QM3A 3KHJA 1OM0A 7ENLA 5E9AA 1JEZA 1H7RA 4E8GA 1TMHA 3LCFA 1LUCB 1I0DA 2YCLA 3QXBA 5F4XA 2E8YA 3VINA 4DELA 1LXKA 1V7YA 3IRSA 4AD4A 1CENA 3AJ7A 3H2FA 2E5DA 1ISYA 4NVTA 3RX4A 1T7LA 4PTWA 1EPXA 1RW9A 4QDPA 4S38A 2QCLA 2BXZA 1J0KA 2PC8A 4NAEA 3HMCA 3L67A 5I78A 1K6WA 1BKHA 4GX9A 2VD9A 1JZ5A 3UD1A 3MVIA 4RR4A 1V79A 2RHGA 4GJ1A 1GVSA 2VC5A 2EPMX 2WMGA 1TV3A 1OINA 3AIWA 1LT8A 3AHZA 4HA4A 4FX7A 4I3GA 5ABHA 3CPGA 4OZOA 3MSYA 1TWIA 3WIJA 1JVNA 4WSJA 1H51A 3T1GA 3EXTA 1ZTVA 4LCRA 3TYCA 3VI2A 5FJJA 1ZBWA 5GJMA 4CD4A 4QG6A 2DDXA 2DVUA 5D8WA 3EDEA 1WUEA 4LAOA 1GUVA 1M1BA 3QR3A 1XLLA 3MUIA 4AVFA 5FSDC 4J35A 4MY1A 5XIMA 4Q8TA 1U33A 5D2TA 4MJMA 4HU4A 3AISA 2IUZA 1HNYA 4ZQOA 3BAJA 3W00A 2VO5A 1UP2A 1UZHA 5F2IA 4KEZA 1ITQA 2PRMA 3I3DA 2OZTA 3HG5A 3LX9A 4CEXC 4JIQA 1F4AA 1SM9A 1OIMA 1UASA 4Q8NA 1KBIA 1RP9A 1JDEA 3EX3A 4M82A 5E6YA 1BWLA 1DXEA 5U7SA 3L4YA 1TJPA 3T0DA 3BJSA 1G94A 2QJJA 4X63A 2POZA 2INZA 3AU2A 3VX1A 4QLKA 2V69A 2QDHA 1QRQA 3EX6A 4AIUA 4DM1A 1H4PA 4JTAA 3AU6A 2QS8A 1EO7A 2BX7A 3BQ6A 3BANA 4KQNA 4UWMA 2PD9A 1X7IA 3V5CA 3ABRA 1MRAA 4OBSA 2O0TA 4LSBA 3U2EA 3TAOA 4RPPA 4OWGA 1V77A 3KCOA 4NX5A 4AEOA 3VA8A 3TLLA 4TX9A 1PXGA 3DX5A 4W7VA 4C6OA 5A6TC 1SR0A 2WNQA 1S3HA 2VT0A 4NJIA 3MB9A 4D8AA 1GHSA 1FRBA 2YL6A 4QE4A 3T78A 1E6ZA 4O52A 1I2QA 2BY3A 3S1UA 2WSRA 1HJWA 3I6RA 4QLLA 3W7HA 1AJZA 4HYWA 4DVOA 1KCKA 5C0QA 2EF9A 4V28A 1EUNA 4LANA 4RDVA 4MPKA 5FACA 4GIRA 3FHAA 2Z0IA 3ONCA 1XUUA 4L4PA 1FWHC 3UR8A 4UTKA 3OLGA 3TQPA 3N25A 1G4EA 2ATMA 9RUBA 4FALA 2HPMA 4GGHA 2PRHA 1EGMA 3CEUA 2J47A 3KFTA 1XLDA 1W3TA 3SY1A 4AMCA 5IFTA 1WKEA 1GOIA 2VELA 1G4TA 2HPIA 4ZXOA 3H2NA 4UOZA 1Q6DA 3GDBA 4QS6A 1S2VA 3WDJA 1YQ2A 2YIHA 2QAPA 2GVJA 4D6GA 1SUXA 3AQUA 3WJSA 4HJWA 1JCNA 5K9CA 4MB1A 3L4ZA 4Y9PA 6CGTA 4DWSC 2G50A 3TW6A 2DVXA 4NJKA 3NG3A 3UW6A 1MUMA 3P93A 4PTDA 4ZTYA 2Y8KA 3C52A 1XLFA 2R91A 2FHFA 1A5CA 1ZUAX 3THUA 3WJYA 2VFDA 3WUEA 1BF2A 4WSKA 3BMVA 1VFMA 4K1GA 4N02A 1PX8A 4TTUA 3SUVA 1H7OA 2PTXA 1KM5A 1S2WA 3HBLA 3NQ8A 5HPCA 1KFLA 1WDRA 3BZJA 1WYIA 4DJDC 3WH6A 3KHDA 4HMDA 2E1WA 1Q8AA 2VR2A 1Z41A 3WDPP 3QQWA 4AEFA 1XRVA 3MHUA 2YL9A 4FF7A 3S2MA 1GVRA 1EBGA 1CZ1A 5BOEA 3UG5A 2FZNA 1TUXA 4PL2A 4MYXA 2CITA 3H24A 5GVJA 2WKJA 1XPGA 4Z1CA 3SCSA 3CUJA 1UQZA 1GEQA 4LVAA 3I4EA 1JZ2A 1CYGA 5A69A 3OG2A 4Q6JA 1K1DA 2V5KA 1NWUA 4KRZA 1M7XA 1KXQA 3GLCA 1VYPX 1X6LA 3ISIX 1HFBA 3SUTA 4HD5A 1WXJA 1SYTA 5GNZA 1TV8A 5GJPA 1X6UA 2AAAA 4B5WA 4LEFA 3WF4A 3CIWA 3IARA 1N7OA 1WE5A 3CS2A 1BRLB 3HF3A 5IDIA 1A0EA 4WEVX 5M03A 4FXJA 4Q6XA 3L2IA 3S1WA 3GG0A 5C9UA 2ZIDA 2I1OA 4LYRA 9CGTA 1F6KA 2BRVX 4YTQA 3I6EA 3FA5A 2XZ7A 4IICA 1TMQA 2YCEA 3O2LA 5FJIA 1QNQA 3NVTA 3NJ3A 4FB7A 5DY2A 4HZ6A 4HNTA 4RZ6A 5FJOA 3SGUA 1SGJA 1N82A 4UQDA 3WBXA 1PTDA 3BE7A 2GSJA 1L6YA 4GVIA 4NZFA 1PHWA 3SN4A 1EJ7L 2DPEA 3OGVA 2ODOA 1RH9A 3QGKC 3QC3A 1DQWA 3O6DA 1W91A 1LWJA 3S6TA 2V63A 3V5FA 2VFHA 2XIMA 4IMFA 1RWFA 1R3TA 1JD9A 3T42A 2HNEA 3CTTA 4AZ7A 4B2DD 1HN0A 1QHZA 3N2TA 3IWPA 2V5CA 3GXIA 4PCFA 4FOJA 3S5OA 4DHGA 1DJYA 3K1DA 3RPTA 5KITA 3ATYA 3W1XA 4CQBA 1Q7QA 4Q7BA 1ZBVA 2VX4A 2OLSA 2DUXA 2NX3A 2PDCA 3K30A 3LCLA 2EG6A 3A5FA 4JTQA 5AOUA 3W2KA 3CNYA 3EOUA 4NJGA 1X6NA 2OR2A 3PC0A 3BLLA 3SRFA 1K8CA 3MW7A 4H4IA 1Z42A 5DT5A 3LA4A 3IJQA 1JDAA 3QV6A 1NIUA 4I7VA 1LBFA 2YBTA 3GTNA 3AWNA 1DOSA 3OTRA 3B0YA 3PPFA 3VGEA 1X7FA 4QEEA 3JU2A 1G01A 4L6DA 5GPRA 4PCTA 1EUAA 2YA2A 1LQAA 2SFPA 1UR3M 3HM7A 2PDXA 4QP0A 4XD3A 1LM1A 1N7PA 3DDMA 1EJXC 2UY2A 1ITUA 3NYDA 2F6XA 3LM3A 3LTSA 4P7RA 2V2DA 7PTDA 3ENLA 1NP2A 2PDQA 4PEEA 1L6GA 5BU9A 2D1ZA 3IJ7A 1F8IA 1TCMA 4GNVA 2VCAA 2IKJA 2Y6ZA 3FNDA 1KQYA 1S2UA 4WKFA 1GJPA 5U4NA 3E12A 1EOKA 2OLHA 1K77A 4Q8PA 2ZRYA 4IWWA 3GVWA 2P53A 4A2SA 4J1OA 1MQPA 4AY7A 2ADAA 2PDYA 3NQGA 3MA8A 4NXSA 2DZBA 4PSRA 3WQEA 5AZ1A 4WXYA 4DZAA 4W7WA 4PTXA 4B15A 5K9DA 1AL7A 3LN3A 3ZVHB 1RD5A 4NAFA 4JTFA 1GYLA 3UR5A 2CZDA 3CMFA 3GS6A 1KKRA 3QJAA 1FP8A 2F2KA 2E6YA 2PZ0A 2PGEA 1UW9A 5AN7A 1ICPA 2CXGA 3AYTA 3LXBA 2ZUNA 4F3HA 5HXMA 3P80A 4BKNA 4GIAA 4NQ1A 4F2TA 8XIMA 4Q4SA 1BXCA 4AHOA 5A6MA 1JI1A 2JEQA 3BL3A 4D6JA 4K8EA 1VB9A 5B7YA 1ADSA 2OZ3A 3EX2A 1TPDA 1QW7A 3L5MA 4NL1A 3AMGA 1JCJA 1D8CA 3D47A 3N2BA 3F59A 1CGTA 3TJLA 3M5ZA 5LZLA 2PA6A 2DGAA 4DXKA 2GDVA 4WQ6A 1MW2A 4GVFA 1RWCA 1VR6A 5A6BA 3U0HA 4AWTA 2VL4A 2ZC1A 1GOOA 2NLIA 1X39A 3PF3A 1S2TA 4ACZA 3BUVA 5A2AA 4XAFA 1B9BA 3PANA 3SEPA 1AODA 1IYXA 1MUCA 3GR8A 5E0CA 5A3HA 1DJGA 4MHBA 1XLJA 3LHVA 4UNKA 3NWRA 3V18A 1NH6A 4NIRA 4JY9A 3ABOA 2E8ZA 1T40A 1POKA 2EJAA 3AAMA 4LY4A 2EPKX 3PWIA 4DO6A 2Y7GA 4HP5A 4CU8A 1BKSA 4JTTA 2QLYA 1IEXA 5HMEA 4EWJA 3L21A 3AXKA 1HKJA 2PUZA 2BVYA 3MQTA 3FEMA 4WKAA 2OO6A 3BSHA 4WGHA 4H00A 4DJED 4JHOA 3GHTA 3QV9A 3CAWA 1IWAA 2PU1A 3RNDA 5BRBA 1LL7A 5CEWA 3OIXA 3TK7A 3M6YA 4LV4A 3W7NA 4S39A 2H90A 1EWEA 2XN1A 1UYQA 3ZWSA 3IACA 2V2HA 5CGTA 5KEZA 1EF2A 2RJHA 4PRWA 1QWGA 3SFKA 3GFZA 2C14A 3W86A 1BYCA 3BW3A 4CQ9A 5HNUA 4B3KA 1ADDA 1Z8AA 1FDJA 2ZUUA 4PUMA 2EAWA 4TVUA 3W1QA 1V08A 3DBNA 3K8MA 4JFVA 1FFQA 1D7KA 4JNZA 2PSNA 5TIMA 3GU1A 1UR0A 2NVAA 3G8EA 4UR7A 4R9XA 1YYAA 3W24A 3S9YA 5BXRA 3O63A 4LS2A 1FCUA 5C54A 1KBLA 1JJKA 4J3SA 4R53A 3WK0A 2YFNA 2CWNA 2Y85A 2FVMA 4RNHA 4QJ1A 1V0LA 5KZ6A 3PBVA 2XVLA 3A3XA 2XSAA 3WELA 2QGYA 1F6YA 5CZ0A 3GRIA 3HGSA 2ZUVA 1DHPA 4GRSA 3SCPA 1AFSA 1PIIA 2J8TA 1ZSXA 1W5MA 3KDOA 1GWJA 4E5TA 1B3OA 4NUWA 1ZENA 3S2CA 4MNKA 3SADA 2IPJA 4QE5A 2ISWA 4NSBA 1W9BM 1CXFA 4UTIA 1JQVA 2X41A 1K4HA 3F1QA 3VDAA 4MZ8A 2TODA 3L4UA 4LYQA 3T08A 3RX3A 3S4TA 3K4DA 4W5UA 1OFDA 1FCBA 4GO8A 4QAIA 2C7FA 2CYGA 2ZA2A 4REQB 3H2CA 4EACA 3NCOA 3CLMA 3MDWA 3ARWA 1F9GA 4EK7A 1Z89A 1R38A 4JZ5A 2ZZ4A 4F0HA 4Q4OA 1RWAA 4J3ZA 1Z69A 1I8JA 1K8XA 3UVAA 3POHA 3EWZA 1MQRA 5FF7A 5I0DA 4YYFA 1H5VA 1PDYA 5HDRA 2A6LA 5HNTA 1ODUA 3CQKA 5EU9A 4XD5A 4QNWA 3KVMA 4W93A 5LXEA 3LZ5A 2O4MA 1DIEA 4UMBA 3HQOA 4WDWA 5KETA 4HQVA 1CLKA 4C7DA 2Z1SA 3RLVA 1OJXA 2E7FA 3BJFA 1LRTA 4TQTA 4GHRA 4S3EA 4W8AA 3A23A 3Q4DA 3T9PA 4RV8A 4XIMA 4P5UA 4R5EA 1LP6A 1C82A 2GYIA 3O0KA 3ELFA 4Z2GA 2J9ZA 3K13A 2WMIA 4WRHA 4Q22A 4ZMGA 1S2CA 1JQXA 1F3XA 3IJ8A 2HEJA 3RCMA 2WHMA 1J0ZA 4L80A 4MYAA 3M6DA 4Y2WA 3TQ0A 2Z6IA 3MSRA 5FF0A 3SCVA 2XDFA 2P8CA 4TX8A 1DP0A 3PFRA 2ICSA 3STGA 1OYAA 4UBPC 1QO5A 5AHMA 3O7UA 4W88A 4K8HA 4QJ4B 4F48A 1EFZA 2D2GA 5CG0A 1J79A 2WNZA 5BNKA 3CAKA 4QSHA 1S5NA 1FWNA 3AS2A 3KBSA 5DFAA 1ECQA 3NDYA 5KZEA 1OF8A 3EAUA 4Q33A 4JBRA 3DI1A 3F5JA 2PWUA 3WQ5A 4C6BA 2AGTA 2PTWA 4UTUA 3N6QA 1BYAA 3OVPA 1EJUC 4XTDA 2INEA 5DO8A 1A0DA 3VGDA 3G1SA 3IS4A 4MWAE 1B3XA 1E6NA 5HMDA 1IT8A 3CWNA 3AWOA 1P0NA 3FOKA 1KM2A 2OODA 5A94A 4C6CA 4FA3A 1H0IA 2REQB 4IMAA 1P1MA 4B3ZA 3M41A 1B3YA 5ABFB 2ZXBA 3VIGA 1UA3A 2FZMA 3VIJA 4CNPA 3N34A 2V3EA 3VFCA 2GL5A 2DP3A 4JN7A 4TMCA 1VFFA 1FDYA 2OOFA 3M44A 5CZJA 5EB8A 1EGUA 3LGEA 1SPQA 2C8NA 2BASA 2VGBA 5D03A 1XHGA 3OOQA 4UIOA 1IV8A 4RW3A 4YLWA 1PZ1A 2G3MA 4PCSA 4UFMA 2X1UA 3HPZA 3EWXA 3B3DA 5AHIA 3A4AA 4GJIA 4GINA 3APTA 7ODCA 4JTRA 1IF2A 3W7OA 3NGFA 7REQA 1RK5A 5I3HA 5FJUA 2QVHA 3BGGA 2NX1A 1Z32X 2YBVA 3GC5A 4WR3A 4C7FA 4GYPA 4V2XA 1UMLA 1A5OC 3NPWA 1R86A 4WY0B 2Y7FA 1E15A 2JGQA 3I65A 2CETA 4GMEA 5D9OA 3W0KA 1FP9A 4Z08A 3EEZA 4Q7IA 2E09A 4LJ3A 3BGJA 4L1GA 3UG3A 1H5YA 1XIHA 2Z1VA 1GORA 3R8GA 5LIKX 4DUVA 5G1TA 2PDNA 4ASTA 1KCXA 5A8OA 4GQQA 2PDUA 2UWFA 1X1OA 1E4NA 1MZRA 1OYBA 2QUMA 1SO4A 4JFSA 3UBPC 3VGGA 3RO8A 5I23A 3N2XA 3ITLA 1J10A 4GKTA 1A4MA 4UXDA 1Q7ZA 3PFMA 4D6HA 4HU0A 3NDZA 2AQOA 3IV8A 4BF7A 1ESWA 2ZVRA 4NZCA 3FXYA 5EL1A 3CC1A 2WZEA 1TA3B 4KFNA 3A4JA 2YB4A 1PB0A 2Q6ZA 3INPA 3LV5A 3BVJA 4GH1A 2ZUMA 3RJYA 1J2WA 4C6DA 5G1MA 3B9NA 4QCEA 2PTDA 3CZKA 4H6EA 2JIEA 4JEJA 4A05A 1FH9A 1JCTA 1F74A 1M01A 1QATA 4KESA 5LIWX 3U2ZA 3G22A 4ZOEA 3BGAA 4LUYA 3TA9A 2O9OA 4F2UA 3FAWA 4PMZA 1K02A 3P8JA 2NWRA 2FPTA 1F1SA 1EA0A 1DBTA 3AHVA 2FFIA 2PCQA 1Q8JA 3LUTA 4PA8A 1UOKA 2PZNA 3R2GA 2ZUTA 4F79A 4ZENA 4BA0A 1U2YA 1CGXA 3N18A 4UR9A 3H54A 4HVXA 3B9DA 5IRPA 3KWSA 3GDMA 1MDLA 2HE8A 3QEZA 3CIXA 3CIVA 3UWUA 3CU2A 3GB6A 2A7RA 4D72A 3GTHA 1KXHA 4X2RA 3VC5A 2MANA 4TO8A 4Q4QA 3CAVA 4RZ4A 3N2OA 1XIMA 2TPSA 5EMUA 4ERIA 4FLQA 1XC4A 2VMFA 3R11A 3U4FA 1W6TA 3GC4A 2Z4GA 3IT6B 3CJPA 4MF4A 3KP0A 1IXOA 4LS1A 3CHCA 1GZGA 2ZZ7A 2F6UA 5HQEA 2YPIA 4I9TA 3URNA 3NPXA 1HKVA 1DJWA 2CLKA 5JU6A 2DSUA 2NT0A 1CXIA 3IV3A 1W5QA 1Q6FA 2QCGA 2W5FA 1DJNA 1GOWA 3NZRA 3SRHA 3E2SA 4XBKA 4DUWA 5AKQA 4AY8A 2BG5A 3QY7A 4DBDA 2FQIA 3KVJA 1EZ2A 4L65A 1XI3A 5A8QA 4PBFA 4GGBA 4XB3A 4JN6A 1QO2A 2QCDB 3CV2A 2ONEA 4UQCA 1JF6A 3VM5A 5HJXA 3M7WA 2RDTA 1AL8A 3VNYA 2F84A 3V3WA 5DMYA 3DZ1A 2WVVB 3T0TA 5I03A 2WNNA 2ZXAA 4BJHA 1M6JA 3L4TA 1RP8A 3NQDA 1I4NA 5AVNA 5A5WA 3GBDA 4KFOA 2FYMA 1DV7A 1TFVA 1V5XA 3SECA 1KRCC 2QAFA 1LCOA 2X16A 2ZA1A 1IEVA 3WH5A 3EKGA 1OK4A 4GD0A 2A3EA 1WZMA 3TAKA 2AL2A 1NOUA 3CXOA 1B3ZA 3H23A 2OTDA 1XQKA 3BURA 5B80A 1VBRA 1XSIA 1OD8A 3CBWA 3IGHX 3OVQA 4HU8A 1YBQA 3OLDA 3N4AA 3TUUA 1H7XA 3V5OA 2R14A 1EX5A 5KSWA 3TC3A 1KFJA 4GUHA 3VNMA 1CXEA 3KBWA 2EQDA 3TFXA 1E0VA 4LS0A 2D0HA 1KO0A 5BMXA 1V6YA 3UZWA 4NZ1A 2PF0A 2V9DA 3VIFA 2D2OA 4DF0A 4PN2A 4Z2JA 4TU1A 1VKFA 2X03A 1ZJBA 2AL1A 3TSDA 1H1NA 3DXIA 1R2RA 4PMVA 1WDSA 3GNOA 1IZKA 1KRMA 4UTFA 1H50A 4MB4A 1EA9C 3U7VA 3PUEA 1AJ0A 4JFTA 3MDUA 4JKLA 1TVLA 4I9AA 1K9EA 4O11A 2Y5JA 5D9NA 4U3AA 4ATDA 1VFUA 3GR4A 1RY8A 1Q6OA 3L2MA 3UWEA 2WBKA 4ZCWA 1S38A 5JBDA 4GOAA 3N3TA 1KTBA 5A6KA 1RXOB 1BVNP 3IK4A 4WJEA 1A3XA 3O6YX 2OG9A 1Z44A 2CPUA 1I2RA 1KV8A 4Z2HA 3ZOAA 4GUFA 4HNVA 4XO6A 2X8RA 4ADTA 1F73A 3SR7A 1BD0A 1FWCC 4BI6A 5E9XA 2C13A 3OYXA 3BW4A 4IMDA 3GH4A 4JFUA 4LUTA 2OEKA 2WZHA 4MAZA 1XG4A 3HG2A 3BV7A 3IGUA 4JICA 2OWCA 3R5EA 2LLEA 1CTNA 2E6DA 2VHLA 4WF7A 1LOQA 3G24A 3AYSA 1OJPA 3R10A 3CL8A 6XIMA 1VD6A 3F2DA 1A53A 1XLCA 4S1FA 1VCVA 3REQB 2MUCA 1PZ0A 1AMYA 2IQDA 4JNMA 4QCFA 3IUDA 3GNPA 1KBBA 3WH9A 3VNLA 3UA3A 2FLIA 4UQBA 1DE6A 1W1ZA 3PZQA 5CQ1A 1TWWA 5K4XA 5D9MA 4ZSTA 3B0PA 1L6WA 4F0LA 3IJ9A 1V6WA 2G3NA 3WNOA 1JZ7A 4Y7EA 5SWUA 4F66A 4M3PA 3BLEA 3EA2A 4XISA 3UP8A 3UNDA 1UB3A 3HG3A 3GYCA 3UJSA 3S9IA 5CSSA 1XBYA 2HMCA 1XCFA 1ZALA 4AH7A 3WMCA 1X1NA 1FQ0A 3RJXA 1B30A 1XSKA 4C60A 3BLIA 3OGSA 4HNCA 3OW1A 2ZZ6A 1DIDA 3AYVA 1K7EA 3G1YA 4ZQMA 4TV5A 5EFDA 2Z26A 3UT0A 2JGYA 3TEVA 2IXVA 4OBRA 3LMYA 1GJWA 4IX2A 4US5D 1UWSA 5D30A 2VCBA 1C93A 1EBHA 2PRLA 2WCOA 1F9CA 2A3BA 3VOFA 2Z6JA 4FMVA 1LF1A 2BVTA 1FWRA 2QUNA 2BZNA 5CJMA 2ZE3A 4DO4A 4AZGA 4JKMA 3B97A 1KM3A 3STFA 4IIEA 4Z1AA 3W83A 1EQPA 3KCJA 2TYSA 1QK0A 1VJZA 1TELA 2W9MA 3BSMA 4HCDA 5DT7A 3W9ZA 2VFIA 1XISA 4RZ5A 5FAJA 3WBYA 5BOOA 1VPXA 3QQ0A 1QMLA 3AS3A 4P2VA 1YPIA 5F2GA 5AYBA 2D2JA 3CHDA 5REQA 4IIGA 2EKGA 4MOZA 2EEXA 1LRNA 3RLUA 1JGMA 1FXQA 1Y7VA 3N3MA 1JXKA 5HR6A 4JTJA 3C2VA 4ATLA 3SBFA 3W1MA 5AYXA 3BCJA 1TO3A 1D3HA 2CEQA 1RJPA 1VH7A 5FF3A 3WJWA 1RA5A 3HMJG 2HVNA 2XM1A 1W3JA 2FH6A 2HZGA 2Z1XA 5AVHA 3GNDA 1W54A 1YEYA 1TTIA 1JFXA 1JYVA 3I10A 4B90A 2CLLA 2O56A 1H2JA 1I2OA 2ZTJA 4IJBA 2FZ8A 1UA7A 2HDJA 3WD3A 3WQPA 3QYSA 4J5NA 2YA1A 3LXCA 4J2MA 4RW5A 1KM0A 3LG3A 2DZUA 1J5TA 5A2BA 4A4AA 3O9NA 3WLQA 3PZTA 1NDVA 3S47A 2GGHA 2GWNA 2X0YA 1MNZA 1OX4A 1XFCA 1UIPA 1BYBA 3NIYA 1IEWA 1TPH1 1M53A 3DC0A 1AZ1A 2QF7A 4DLMA 3VIKA 4LF2A 4XVDA 3ZLFA 3MMWA 4IGNA 4KPLA 1HM2A 1BVZA 3IGSA 2FDSA 1QPOA 5HWNA 1VBHA 4MM1A 3SM0A 1IIGA 2VEKA 4UNLA 3W01A 1B3WA 4IP4A 3OLIA 4XD4A 4IL2A 1UH2A 5CKSA 4LUSA 2XUCA 3LLXA 1G4PA 1V02E 4Y90A 5AC6A 3ABZA 3DN5A 1NFPA 2P5NA 4LU0A 4ADSA 4D1JA 1REQA 4UTJA 3MMUA 4JYDA 3VKBA 1YTDA 4LXFA 3FA4A 1LOLA 3P2VA 1E6XM 4LBSA 3DECA 3O06A 1OFBA 4GA8A 1HKIA 2RUSA 4K6AA 5DLCA 1IR2A 2XVPA 4RK8A 3M0MA 4KBXA 3VNJA 4LCQA 3W1TA 3ZO9A 1R85A 2DIKA 2HV5A 3VX0A 3BPWA 3MSGA 3PPCA 2DQXA 2WMFA 2BVDA 2G96A 1GW1A 4FAMA 1RWGA 4RE2A 2CESA 4N6EA 1TE6A 4V1XA 1ZJAA 4AZBA 4IIDA 3RMEA 2F2HA 3UWVA 1UD5A 5AHLA 4LAMA 3O07A 1MNSA 1V02A 1XICA 1R3SA 2V82A 3DKJA 3V0UA 4O0ZA 1XGZA 3ERPA 3JR2A 4ZODA 5AHNA 4AU0A 1EGVA 2ZYFA 4M6UA 4HU3A 4F8XA 1E1FA 3VUSA 2GVGA 4FNPA 4IIHA 3UETA 3LCIA 1SZFA 2FZDA 3KRSA 3WL1A 2E68A 1QHOA 1TIMA 3I3EA 3PULA 1UBSA 4EPKA 1OF6A 4MNMA 5A6LA 1E0TA 4GYPC 4JS3A 1U5JA 4IQEA 4A3RA 4G5DA 4AF0B 1EJWC 1UWAA 2VGIA 5FL1A 3T7VA 3P5ZA 1PKMA 3WNKA 1O1HA 3F03K 3E1F1 3TTEA 4FR1A 1PKLA 2YXGA 4WDTA 5JIPA 1P6BA 4Q8VA 2E25A 3OG3A 4F0KA 2DQWA 3TOPA 4JXCA 3GNRA 1E4LA 3QMRA 4Q8WA 2BXYA 2VOTA 5LNSA 3OODA 3E74A 5FD0A 1XX1A 1CLXA 2XGZA 2ACUA 2VKZG 2J77A 4A22A 1SW3A 4IX0A 1ZGDA 4H7VA 4MDPA 4ORMA 1ZS2A 3M0ZA 1NVMA 1XCXA 4XO7A 1JCYA 3GNNA 2V5LA 4Z2IA 3M5VA 4O1EA 2VZTA 1XF0A 4Q8QA 4OU1A 4Z1DA 3TV8A 3TZFA 4G2DA 3PAOA 1MEWA 1JZ4A 1H3GA 3W74A 2HBXA 2Q02A 3FDKA 1OCBA 3N73A 3LMZA 4LOCA 2VOMA 5C9ZA 3QR8A 1ELSA 1PX3A 1LUCA 3H70A 4TXEA 1IXQA 4XZWA 3WX7A 1C29A 1JRCA 2A5HA 4RV3A 3QV8A 1E55A 2NVCA 4EPEC 3LRMA 3PPHA 1H62A 4MKSA 3GUGA 2P0OA 3SSJA 1K8YA 4FX6M 2GQAA 4IP5A 3ZJKA 3PG9A 3R6IA 2A3CA 1Z3NA 3CQJA 4IJCA 3CH9A 1WBJA 5LNVA 2DY3A 4UB9A 3PWAA 1A5UA 1JNEA 1D9EA 2GUYA 3ZT5A 5GNXA 1CGVA 1T8XA 3ZR5A 3GVRA 2GSEA 3H7RA 1RVKA 1S5WA 2YCJA 5EFFA 3LSBA 4DPQA 2QV5A 3CO8A 3CYJA 3G6LA 5T26A 2PWHA 2C15A 3UERA 3S1XA 3C2RA 1Y5WA 1UBPC 1TG7A 2Z7KA 2A2IA 1LORA 4UFKA 4L9XA 3W27A 3PHAA 2Q3OA 2EHHA 5TD4A 1THFD 3R0KA 4CCEA 2CLMA 1RBAA 3STEA 4FR6A 1GCYA 1KWKA 2PS2A 1XLMA 3B05A 3ZLGA 3IJIA 3WBEA 2CLHA 3CTLA 3NZQA 4CCCA 3BO9A 1KBKA 1XLAA 1US2A 4BQ5A 4C6IA 3QZ6A 4YWSA 1BXNA 4KRUA 3NSXA 2Y24A 4B16A 4IFKB 2PGWA 3KBMA 1XG3A 1DVJA 1ME9A 1B5TA 1GG1A 4JTLA 2BMBA 1FWDC 3CO4A 1V0NA 3H2OA 3ORWA 1UC4A 4XUGA 3ITGA 3G5EA 4Q4MA 4JTEA 4CU7A 3GVGA 5D2WA 3GFYA 1QT1A 4IZGA 4D71A 4W4QA 3MPGA 4S3BA 1F7BA 1LQ0A 1OGGA 4RPQA 5CGMA 3DI0A 3BG3A 2WW5A 4IG2B 2E40A 3C0SA 1GGOA 4GZIA 2RH9A 3VKCA 4E4PA 3GX9A 3HGOA 3G77A 3M16A 4MZYA 1V3KA 3AS0A 4IFRA 1ZB5A 1SZEA 2QDEA 4JX6A 2H9AB 2BY2A 4W85A 5K7JA 3RIKA 1KXTA 1GG0A 4PB4A 4PMYA 2BFGA 2IPGA 5LIUX 1JCLA 2Y61A 5I3JA 5H2ZA 3GO2A 2L5HA 1LG2A 2RDWA 2E77A 4J3UA 4ILSA 4C6QA 1YPXA 4ALDA 3QOMA 3FX4A 4IMEA 2CZ5A 3M0LA 1DWJM 2YL5A 4LGXA 1JCMP 4CN1A 5EA9A 1LXMA 4CKQA 4O14A 2BP1A 3O3RA 1I9CB 2DUAA 1QPKA 5DBTA 5C71A 3QPYA 1LL4A 4L1WA 3AS1A 4JPGA 1YDNA 3ARUA 1RJQA 1ICQA 1MXSA 5KZDA 3PTKA 4M51A 4F9JA 3RGTA 3AIBA 4J3XA 4DAFA 2PDWA 4HTYA 1R9ZA 1HJQA 4FIRA 4AMAA 2BB0A 2J79A 1FTXA 1XXXA 4DIAA 3B8IA 2PWGA 1M7OA 2ZFAA 4HSNA 3VZXA 4W84A 4IHCA 4O10A 3CUZA 1FDZA 1S3TC 4A3QA 1SW0A 1NFBA 5KTLA 4KCTA 2ZX5A 3SDOA 5G4EA 4B5TA 2BOGX 4AD2A 4JY8A 4G6CA 2QR6A 5HINA 2NSXA 1QFEA 2IXUA 1NJJA 4P8WA 3DHFA 2NQZA 2XG9A 3A3HA 1ZAJA 4K37A 4C6MA 1HP5A 4KIEA 4HSHA 4GO9A 1DORA 4MDOA 1F4HA 2OELA 1V6VA 4PMJA 4LX4A 1GQJA 1UPMB 3LNMA 1C8YA 1BGAA 4RX0A 2PBOA 3WFLA 4DZIA 1QNOA 2ZX9A 4DWSA 3WBWA 3GHUA 3L9CA 1EDTA 2QCEA 3QGVA 3VU2A 2PE4A 5E1QA 4LW7A 3S8HA 2PLJA 1W5NA 3FJLA 3U57A 4MY8A 3L0NA 4OECA 1YHTA 2I56A 3PJWA 3ZM8A 5H1WA 1SSDA 4PTVA 4DUOA 4U3CA 5HUPA 2B7QA 4PUEA 2QULA 1DJXA 1B2YA 1FHDA 3OJGA 4ICNA 3S5YA 2E24A 4DJDA 3K1GA 5AFDA 2YGYA 4AD1A 1MI3A 4CN4A 1XUZA 2VZVA 2PBGA 4E0CA 3WQVA 1H7NA 4E3VA 4JHMA 2YDSA 1PUDA 3V0SA 4OKDA 1CXLA 3HZ3A 3NNTA 2OQYA 3CUHA 3LCXA 3L4XA 1T5AA 1GQLA 3V16A 4ZO8A 2G8ZA 3E9AA 4KEUA 3RPDA 2A3HA 5K3VA 1XRSA 2QYGA 3L7RA 1EWDA 3L65A 2EPLX 1TPFA 4H8HA 1VHNA 3PP7A 1VENA 4KGLA 2GOKA 3UG4A 4PH6A 4MB5A 3OBAA 3V36A 3W7EA 4UQ9A 1XYFA 4XZHA 4Y8EA 4MKVA 1JZ8A 2WZMA 2F6KA 2YW4A 4N0RA 1HGYA 4XAPA 2YSWA 3G6MA 3LHWA 2A7PA 3KOXA 3ES7A 1YNPA 3PAJA 4ZQNA 5HMFA 2HS6A 2DH2A 3GZ3A 4HMNA 3DFPA 5BOFA 3T40A 2EG8A 2F38A 1OIFA 5K2ZA 2EPHA 3WFZA 3CM4A 4TR9A 1H7PA 1PL9A 1PHQA 3THDA 3O05A 4LFYA 4NILA 2VNCA 2CBJA 3BLDA 3RO6A 1CXKA 3AICA 4XZMX 3UXAA 1WOAA 3EWWA 3CV1A 2G3JA 1EL3A 2FHCA 2E5BA 1HKKA 2VEGA 4AC7C 3N29A 3CQ0A 4JL2A 3TSBA 1OSEA 2D3NA 3LBOA 4A6GA 5I77A 4JX4A 2C71A 1SZNA 2EXOA 4DJFC 3LHYA 3VNKA 1IXNA 2D24A 5JXQA 2H8XA 3GIQA 3I6TA 3UJEA 4LALA 3LI0A 3ANVA 1UUQA 2D3LA 3RMJA 4N6FA 3ZSSA 3WLIA 1FFRA 3BOXA 4Z1YA 4DLOA 2HROA 3CWHA 3FLUA 5CAKA 1VEOA 4FS9A 3A13A 2PDJA 1SO6A 2TRSA 3AIVA 1LDCA 3KBTC 1OEPA 5I3KA 4ZSUA 3AMKA 1RBLA 1J96A 1GOQA 2A1YA 1OGBA 4YXGA 4IGHA 3VOIA 3TW9A 3AHTA 1YXDA 3L5LA 1ZFJA 1EZWA 1DWHM 2E9MA 4EIVA 2EG7A 1XM3A 2KX9A 1GTHA 4KT2A 5J5RA 1OZQA 1QI4A 4GNJA 1SVDA 2NVDA 1E9LA 3A24A 4ML9A 4IM4A 4KWOA 1VLWA 4PB3A 5HNNA 4XZBA 4I6KA 4RJEA 1EP2A 4NI8A 3DH7A 4CQDA 4FK9A 1PZ3A 1UD6A 3VFLA 1W9VA 2RJGA 3NQBA 3T4WA 1WUFA 3NYZA 2GPTA 1M9HA 4NZJA 1YE4A 3CL7A 2VX5A 5A2CA 2G97A 2Y5EA 3MUZ1 5C55A 1M7PA 2PP3A 2BNJA 4GC4A 4QR6A 3ZVHA 1Q2RA 1Q45A 1V0KA 4ENLA 3FXGA 3JUGA 3VUPA 1AH3A 3SY5A 1ZL1A 5IXEA 1M3UA 2D0FA 4UR8A 4IGMA 2CLOA 4W9TA 4PBGA 3MJYA 4CD6A 3A6OA 4H04A 3QGAC 5F4SA 3PNUA 3M5XA 2NV9A 3NQ2A 1O95A 3BV4A 3C3NA 4Q32A 1EC7A 4CUCA 3WQFA 3FY1A 4YCPA 2J7CA 3N2MA 1A80A 3C6CA 3THQA 2KXSA 1KFBA 1GONA 3S5ZA 1J0YA 1OC7A 3G2GA 4BS0A 1EJSC 3TYUA 1OQFA 3F5KA 4JTKA 1QPQA 2NV2A 2F8QA 3L68A 3R0UA 3GUWA 2RGMA 4MIMA 2GVYA 4S23A 2IPWA 1ENUA 1XYCA 5A1AA 2XGIA 1YE6A 3G0SA 4HA3A 1KGUA 2NV1A 3CB8A 5FESA 2Z1WA 4K7YA 4OE7A 4Z2LA 2WM1A 3ITCA 1VBUA 3PTDA 3JVAA 4INFA 2VX7A 4JTIA 4YTRA 4FO4A 1RZMA 1TREA 3R8RA 2I5QA 4PMUA 4DF1A 4XSLA 4HN4A 1C7TA 5LNWA 3M07A 2EGZA 3NQVA 3UQNA 1B57A 1TJRA 3GKFA 4LC6A 2EBNA 1RAKA 4KERA 2E9LA 3R4IA 1PE1A 3QSTA 4E38A 3W1LA 2J6VA 2VC9A 5CPNA 3GAKA 2Y8VA 1HJXA 1FWTA 1TPB1 1GYMA 1JPHA 2WCSA 2A85A 3WH7A 3Q37A 4JD4A 4IUGA 4XWUA 3DESA 5E70A 3EMQA 3SIZA 2OQLA 4UQEA 2OEJA 4YTSA 4A3UA 2QV4A 4NXKA 1Q3NA 1NOWA 5FJRA 2FVKA 1AW5A 3PJTA 4PRRA 1GTEA 3HPAA 3EWCA 3R7MA 2W91A 1E6QM 2PDMA 2QJGA 2QPXA 1YRRA 1GQIA 2QKFA 1NQ6A 1C8XA 1EIBA 1MFVA 3WLMA 4H01A 1ZHAA 3NEVA 4J2PA 5CPQA 1MWOA 2VGGA 4POCA 4O1CA 3KRBA 3AXXA 3M0VA 2X05A 2X1RA 2ZA3A 1W1VA 4KCUA 2Q1FA 3I7RA 1AH4A 3WQ8A 1V7AA 4HHPA 5JH2A 3RFAA 5M5DA 2A0NA 2CC0A 1KR1A 1LRQA 1QBBA 4IP7A 1T8QA 4DQWA 3PZMA 4IISA 1IWPA 4QNEA 5CG7A 4PUJA 2Q8ZA 5A6BD 1R0MA 4K2SA 3N04A 3WQ6A 4PUKA 5HQLA 4FNQA 3WDIA 8RUCA 1UUOA 2YEPF 1TTJA 2Y5SA 3JW7A 3RDKA 4B9YA 4FEZA 4IPPA 4FP1A 1K3UA 5HA7A 4HBKA 2X40A 2W92A 1GVOA 2J6XA 3GHSA 5C2CA 3DG7A 3HPFA 2X0HA 1UR2A 2HSAA 3OZOA 2FIQA 1RQBA 3ITTA 3KVLA 2FZ9A 4LAZA 4UNIA 1QASA 5FIPA 1JIBA 1ZNNA 1R2SA 1FH8A 4N2YA 4O16A 2AKZA 1F6PA 4O1DA 4XG1A 5HNRA 5H6HA 2VX6A 3NM3A 3E5BA 4R85A 1UKQA 1FWIC 2QEZA 3RAOA 1US3A 1P6CA 1UHVA 3T2OA 3Q2DA 4REQA 1DYSA 1A5MC 1GEHA 4HT3A 3LB0A 3VIHA 4BI5A 4GYJA 3ZJ6A 2E6AA 1NU5A 3WCZA 2RDXA 4FNTA 1PZ2A 4GH3A 1XYAA 4C1NB 2XH7A 2XSXA 3W81A 2Q01A 3P8IA 4LV9A 1FA2A 4YJ5A 3H7UA 5C9RA 1J0IA 4WHBA 1KR0A 1HJUA 3W23A 5FI8A 2VZOA 1WNOA 1XLIA 3UYIA 4GQ0A 4B4FA 3BAYA 3VM7A 2E3ZA 2ANUA 3LY0A 1XV8A 3L4WA 2ESCA 5DBUA 1QI2A 4ECLA 3B04A 2AOSA 1RQHA 3T81A 4AXKA 4GXMA 3WNLA 2QT3A 2J24A 2O7SA 4PL1A 5EPDA 1XKJA 3EX4A 3G8RA 1S5TA 1FWFC 1WAUA 1U5HA 3Q94A 1YIXA 5BXTA 2BV9A 1GKPA 6ENLA 2WV8A 4ZEPA 3MUAA 3WBAA 3NQ6A 1PO9A 1CCWB 1J5SA 3W70A 4PULA 2PCEA 1HMUA 1TRDA 3CUFA 4CCDA 1O66A 2GJLA 3UCCA 4M56A 2HE5A 3T0BA 4AD3A 2E6FA 1UP3A 5CLTA 4BR1A 2OT0A 3SCTA 1VFLA 1JZ6A 1EC8A 3OP2A 3KLKA 1KCZA 2FJUB 4GZJA 4I8DA 4XKYB 1KLYA 3VZYA 3WZ0E