2WMHA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 in complex with the h- disaccharide blood group antigen.
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
555
structure length
553
Chain Sequence
b'VQMRTTINNESPLLLSPLYGNDNGNGLWWGNTLKGAWEAIPEDVKPYAAIELHPAKVCKPTSCIPRDTKELREWYVKMLEEAQSLNIPVFLVIMSAGERNTVPPEWLDEQFQKYSVLKGVLNIENYWIYNNQLAPHSAKYLEVCAKYGAHFIWHDHEKWFWETIMNDPTFFEASQKYHKNLVLATKNTPIRDDAGTDSIVSGFWLSGLCDNWGSSTDTWKWWEKHYTNTFETGRARDMRSYASEPESMIAMEMMNVYTGGGTVYNFECAAYTFMTNDVPTPAFTKGIIPFFRHAIQNPAPSKEEVVNRTKAVFWNGEGRISSLNGFYQGLYSNDETMPLYNNGRYHILPVIHEKIDKEKISSIFPNAKILTKNSEELSSKVNYLNSLYPKLYEGDGYAQRVGNSWYIYNSNANINKNQQVMLPMYTNNTKSLSLDLTPHTYAVVKENPNNLHILLNNYRTDKTAMWALSGNFDASKSWKKEELELANWISKNYSINPVDNDFRTTTLTLKGHHKPQINISGDKNHYTYTENWDENTHVYTITVNHNGMVEMSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FUCOLECTIN-RELATED PROTEIN
molecule tags Hydrolase
source organism Streptococcus pneumoniae
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
total genus 203
structure length 553
sequence length 555
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08306 Glyco_hydro_98M Glycosyl hydrolase family 98
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmhA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmhA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmhA02
2Z1KA 1E6PA 4MNJA 1G9HA 4AD2A 2WVSA 2Z1SA 2JEPA 4V28A 1V02E 2WZEA 1E6RA 1W3YA 1DWGM 1AMYA 4AC1X 3BAKA 4NRRA 1C7TA 1HJQA 1VFMA 1QBBA 3GXMA 1H2JA 1CENA 1OJPA 1KXQA 1DEDA 3WF4A 1LWHA 3EDFA 4AZGA 4IM4A 3ARYA 2PI6A 4DM2A 4CU6A 3VD9A 5I79A 1G1YA 4NF7A 3THDA 2D22A 4CU8A 2YDSA 1W32A 1TA3A 3KL0A 1CXHA 1GOMA 4MB5A 4PMUA 3UR8A 2VR5A 3AMDA 1H4PA 3AXHA 1J12A 3GXDA 2V3GA 4OOUA 2WCOA 4M56A 2BY0A 2G4FA 2YL6A 1M53A 1E4LA 2O92A 8CGTA 4RE4A 5IHRA 3CZGA 4W87A 1LOHA 1ODUA 2FH8A 5BXRA 1QHOA 3B8SA 3W28A 1LJYA 1CGYA 3OLGA 1PX8A 2E4TA 3NDZA 1PIFA 1LG2A 2WBKA 3BAJA 2BVDA 3POCA 5TD4A 4CCDA 4TOQA 3AIRA 2FGLA 3MMWA 1SMAA 3K1DA 3VIJA 1E5NA 3BSGA 3M6DA 3BLPX 5IDIA 1KFWA 4J28A 3W38A 2X0YA 3SEPA 2WWCA 1H09A 2EPMX 3D3AA 1V6UA 1X1IA 5C70A 2WCGA 5FD0A 4ATDA 1CIUA 2BY1A 1ISYA 2DPEA 4AEFA 1NP2A 3HN3A 5CGMA 3N18A 1W2VA 3WUBA 3EYPA 3TP4A 3ECQA 2VI0A 1FFRA 3HMCA 4YN5A 2BXZA 1DHKA 1EQCA 1QI4A 2XSAA 3OB8A 1N7OA 2BRVX 3VX0A 1BGAA 2XWDA 3AJ7A 4CCEA 2D0HA 1K9DA 1WNOA 1FH8A 4LXFA 1OGBA 4N0RA 3WSUA 1OB0A 2UY2A 2VMFA 2OWXA 1DP0A 3ZSSA 4A3YA 4AZ6A 1JZ8A 2QV4A 3SCTA 4TVDA 1J0NA 4Z2IA 1CXIA 4JHOA 3MS8A 5ABFA 3W82A 5E70A 1J11A 1E73M 1KGWA 3L4VA 1C7SA 2V3FA 2QF8A 4D6JA 1X6NA 3CZJA 3PZUA 1W3LA 4UQBA 1QHZA 1D7FA 1XSIA 4GI8A 4HMCA 4JIEA 2WXDM 3WQ8A 4PTMA 1N7NA 1R8LA 3CLWA 3WF1A 4EANA 1MW2A 1E1FA 2EQDA 1US2A 2WMIA 1NM9A 3WENA 2EO7A 1V0NA 1WCGA 1CGVA 2DIEA 1C3FA 3AMGA 3GXIA 4HA3A 2WLZA 3MMUA 3W27A 4HOWA 4CKQA 5A6SA 1XCWA 2A3AA 1B3YA 1V02A 1GVYA 4D6HA 1HKMA 1CECA 4R27A 3WFZA 1N7RA 2GJPA 1Q6CA 1LL6A 2XVGA 2C7FA 4DWSB 2XJ7A 4W84A 4W7UA 4HPGA 5BXPA 1HL9A 5AC4A 2W4XA 5ABGA 3AFBA 1UWSA 4JFWA 4MB1A 1BFNA 1G01A 5JBFA 1BGGA 2QPUA 4H7VA 1QW8A 3WDQA 3SURA 2J62A 4Z2KA 3SCNA 5A6BA 2J78A 1XH0A 2IXUA 4PCTA 4GO9A 4CU7A 1GQKA 1QPKA 3KWXA 4D1IA 2XIIA 4UZUA 3K8LA 2PWEA 4ACZA 4W8LA 5D8WA 4HU8A 1W3KA 4X0VA 2CERA 2YJQA 5A1AA 4JKLA 3MSDA 1JAKA 3PZIA 3VIGA 1EDGA 3VX1A 1UD2A 4EKJA 1JZ3A 2D20A 3L2MA 2WVVB 5IFTA 2WYSA 4GZIA 3NDYA 3QOMA 1HT6A 3FW6A 3WH6A 3AHZA 4UFJA 1PX3A 3A4XA 2E9MA 2YOCA 1R7AA 3WH5A 5C8BB 1WPCA 5GQBA 5CLTA 1KCLA 2QLYA 7CGTA 4LYQA 4WKAA 3ARRA 2OWWA 4GZJA 1MW0A 3VGBA 5FCZA 4IUGA 4ZENA 2WMKA 3I3DA 1RWHA 2VL4A 5HPCA 3ALGA 3AROA 3SCPA 1PX4A 5I2UA 3ARPA 3MUZ1 2GDUA 5JBDA 1V3MA 2J77A 4E8CA 1RWFA 1H11A 3U5YA 2WMGA 2D2OA 3VGGA 3CZKA 2XUCA 3OLDA 1YHTA 3QHOA 3AS0A 3ARXA 1QNOA 2WSKA 3NUKA 1EOMA 4GKLA 1GJWA 4H2CA 1XRVA 1BYAA 4FF5A 3AIEA 1R85A 4GINA 2VZTA 5BWFA 1JAEA 1Q6DA 2OWCA 1KBBA 1GW1A 4Z2LA 2GFTA 1M03A 5A6BD 1I1WA 1LXKA 1B3ZA 1QBAA 5A6JA 1UOKA 1KXVA 1ZBCA 2C0HA 2JEQA 1ECEA 2VX5A 4UZSA 3RJXA 3NIYA 3WEMA 1JYWA 1KCKA 1V6YA 4HA1A 1CYGA 3CBWA 3WUFA 4TUFA 1VRXA 3OGRA 1HJUA 1V0MA 4HU0A 4J3TA 3SIMA 1OJMA 4LQ1A 4OUEA 5E6YA 2UY3A 1V3KA 3VD7A 1WDSA 4AWEA 4GXPA 4EE9A 1HJVA 1UR4A 2DSZA 1XC6A 5I23A 3ZR5A 5M17A 3ZSTA 4AZ5A 1OGGA 1N7PA 4CN4A 3SUTA 3W0KA 4AZHA 3DECA 5C71A 4HP5A 1NOFA 3F5LA 3PN8A 1JD9A 3MKKA 4MAVA 2VR4A 2F61A 4OIFA 1ITCA 5CSUA 1J9YA 5I5RA 4B9YA 1WKYA 3GTNA 5BYWA 4CVWA 5A2BA 4PMVA 3WEOA 2ZUMA 4PUEA 4QLKA 1CXKA 1UKTA 2AMGA 5AYIA 3OBAA 5ABFB 3ZJ6A 1EDQA 4FLSA 4BA0A 4S3KA 2XG9A 1B3VA 4KRTA 3WH7A 1LF1A 2CITA 3L4WA 4A3HA 4X9YA 2ZUVA 1H49A 3B9DA 3A6OA 2YL8A 4RE3A 3AHVA 5CSYA 1Q6GA 2QMJA 2UY4A 3ARSA 4CD4A 2VJXA 3BMWA 2J75A 1I8QA 4ZXOA 3AYSA 2Y8KA 1ODZA 2J7HA 3N11A 1KGXA 4PMQA 4MNMA 1MYRA 2ZXAA 3RILA 1VF8A 2GSJA 3OZOA 4U3CA 2QPSA 2CPUA 3ZO9A 1QNSA 1CLXA 1OT1A 2XYLA 4YHGA 1E6NA 1W2PA 2WVVA 1V3JA 3CUJA 1VEOA 5EFFA 3II1A 3AHTA 4AZIA 2CXGA 4QLJA 3VMPA 3S2CA 1M04A 1ESWA 1TVNA 1B1YA 1NWSA 1NWTA 5E09A 2FDMA 4PYSA 3M46A 1WDPA 3PZTA 3RCNA 1DWJM 3WQVA 1EGUA 3WNOA 3WNKA 1CNVA 1FFQA 3SUVA 1XD0A 2OYMA 3W37A 2XIBA 4HMDA 1A3HA 2WHKA 4W5UA 4UQAA 4CD6A 4UFIA 1E43A 2BXYA 4PMOA 2XM2A 1PIGA 4TVUA 5I78A 1VENA 2ZX6A 3WL1A 4H41A 3AXXA 1V03A 2VZSA 5GNYA 3QHNA 5CPSA 2WW5A 2X09A 4GO8A 3O9NA 1Q6EA 2E8ZA 5ABEA 4P8UA 2BHUA 4B9ZA 4HZ8A 1E3ZA 1Q6FA 2J7GA 3AIVA 2E22A 4AISA 3L4ZA 5M3WA 1HX0A 1DTUA 1JXKA 1ZS2A 1GORA 4K68A 1PZ2A 2O9RA 2CKRA 4FLQA 4WLCA 1P6WA 5EMYA 3GNPA 3RO8A 3WMCA 3B9EA 1E3XA 1UG6A 2YL9A 2ZIDA 4TVCA 4N42A 1KXHA 1OIMA 3W24A 3VDBA 3ZM8A 1KXTA 3K46A 1OCQA 4D1JA 4B3LA 4PMNA 1UR1A 2OSYA 1ISVA 4U33A 3VPLA 1J0ZA 1JF6A 1FH9A 2NT1A 4PTXA 1M01A 1V08A 2YIHA 3VMOA 4J3VA 3T0BA 3ZR6A 1XYZA 1IZKA 3W81A 2GK1B 3W29A 2YLAA 4PTVA 1HVXA 1R7OA 1HN1A 2GUYA 4P7OA 3VGEA 4JFTA 4P7QA 1XSKA 2DT0A 1CWYA 2CHOA 3RPMA 1I1XA 1EO7A 3OLIA 1HNYA 2ESCA 1J0YA 1KBKA 1V6XA 1SMDA 3IANA 4Q7NA 1E55A 3CH9A 2RGLA 1OJOA 1NARA 3BAXA 1TE1A 1JZ7A 4PN2A 4CGTA 2BS9A 4UQ9A 2V3EA 4HTYA 5D9PA 2V38A 1RH9A 1ISZA 5GPRA 3PTQA 4PMYA 3CIVA 4MTVA 2XVKA 1DWIM 1E0WA 3FNDA 1GCYA 1EGZA 3DYPA 1GQJA 4PUDA 4UOJA 3KL5A 5DFAA 2J8FA 3N15A 4AMCA 4UQEA 4LGXA 4H8HA 2CYGA 1VFOA 1ZJAA 2Y5EA 3T2QA 3QOKA 1EIBA 1M7XA 3FAXA 1OD0A 1ZJBA 2W63A 3RM4A 5CG0A 2EBNA 1NP0A 5I6SA 3WF3A 1U2YA 4V27A 3AIQA 2J7FA 2JALA 4TTUA 3FHQA 3VIHA 1QNQA 1KWKA 2WHMA 3AOFA 1SYTA 4E4PA 4AZBA 1WZLA 4P7NA 2W91A 4KH2A 5M03A 1CDGA 1GUVA 2D0FA 3VGHA 2BHYA 2GK1A 2VVSA 3L4YA 3DYMA 1GNXA 4WKFA 1GOOA 2BNJA 2JF6A 5GNXA 4BF7A 1PBGA 3BCDA 2CBVA 3AICA 4U5KA 4W86A 3GH7A 3BC9A 3VIFA 3VIOA 1J0HA 1J10A 4ZXLA 3AS1A 8A3HA 4H8VA 2ZX9A 1UKSA 3ARUA 2BVTA 1Z32X 2VURA 1UR2A 2J25A 3MV11 3OG2A 4OOZA 3OZPA 3WD3A 1MW1A 3JUGA 4BQ5A 3PTMA 1E4NA 4UFMA 1OINA 1J0JA 2WMJA 2MANA 4CN1A 3PZOA 4AIOA 1Q4NX 1VFUA 4XUYA 5LA0A 1WAWA 4CD5A 1GOWA 4B16A 3AIBA 2D1ZA 1UUQA 1NH6A 4AD3A 1W3HA 2YA1A 2PBGA 2UY5A 3BGAA 1HN0A 2E0PA 5DF0A 2JFEX 1VAHA 5CQ1A 3VIKA 2XVPA 5A6LA 2OLHA 1BAGA 2XFYA 3WNNA 5I24A 3OIHA 7A3HA 5FL1A 1O7AA 1H41A 4FMVA 1BG9A 2WKLA 4GI9A 4AD5A 3BAIA 1XH1A 3VMNA 2WMIB 9CGTA 4CVUA 2C8NA 5AC5A 4AZCA 1ZB5A 5E0CA 5HPOA 1C8QA 2VZVA 4W93A 2WKGA 4U3AA 2O9PA 1UR0A 1B0IA 1E72M 1CXLA 1N7QA 2WMHA 4FLOA 1X6LA 4AD1A 4X0NA 1QNRA 4PEEA 3FXYA 3BCFA 4E8DA 3MUAA 2DH2A 3MMDA 1PAMA 4RL3A 1BYBA 2NW0A 3BSHA 3MANA 2IXVA 1BSIA 2VOTA 4GZEA 3BAWA 2E9LA 3MO4A 3AS3A 2BY2A 5D9MA 2EPKX 1YQ2A 1W9PA 3TONA 3WMSA 4D6CA 1PJ9A 2GJXB 3WDIA 5CJ5A 2F8QA 3U57A 4QAWA 3AZSA 3W6LA 3U7VA 2VZUA 5DO8A 3CGTA 1EH9A 4AIUA 4WIWA 4GQRA 1JG9A 3VD5A 1BHGA 3CHFA 4AZCB 4TX8A 3EDKA 4MAZA 4AD0A 2G3JA 2YL5A 5CXPA 5BRQA 1JYNA 1RW9A 1PZ3A 1BYDA 1QI5A 3N13A 1E6SM 7TAAA 3GXFA 3AMKA 1FHDA 1PEZA 1C8XA 2VX6A 3A4WA 3GYCA 1SFSA 4W7WA 3W25A 5A8OA 1HIZA 5E9AA 1I75A 3IK2A 3FAWA 2G3MA 2CBIA 4AYSA 3GM8A 1B2YA 1L0PA 4J7RA 4CUCA 4AY1A 2ZOXA 1NWUA 1UD3A 3WQWA 1CBGA 5LA1A 4P8VA 2G41A 3SCRA 2VX4A 4IPNB 3VNYA 4QLLA 4H04A 2CNCA 4QP0A 4UQDA 1CPUA 1K6AA 1UKQA 3W26A 2GJRA 5I3DA 1WO2A 3AMLA 1HP5A 4NSBA 1GOQA 4IISA 2DSUA 1XCXA 3MUY1 1KWGA 5A6MA 3W4RA 3WN6A 1VIWA 1W9UA 2HVMA 1K9EA 4J3UA 2CBJA 2XVNA 3EDJA 1EA9C 3LPOA 4CD8A 5CPTA 3OA5A 1H0IA 4UFLA 1F4AA 3NSMA 2VVNA 1WZMA 4RE2A 3WD2A 4A4AA 5A8MA 1IT0A 4WSKA 1GPFA 2WMFA 1TZ7A 1HJWA 3F5JA 4JHZA 3GBDA 4Z2JA 2ZWYA 4BCEA 1EXPA 3CTTA 4QCFA 1VBUA 3AMCA 2VT0A 3CUGA 4M24A 3S6TA 6TAAA 4UOZA 3CHCA 2DH3A 1QI2A 2EXOA 3WDRA 4PSPA 3PZMA 4ZEPA 2Q1FA 4Z2HA 3HU7A 3OLEA 1S46A 1K9TA 3WDPP 4D6IA 1HP4A 5ECUA 1CGXA 1QHPA 3RJYA 1JZ2A 3VVGA 3SCUA 5A69A 2G8ZA 2UWFA 1OGSA 1G5AA 2EEXA 3MV01 1CLVA 1QI0A 5M5DA 3LPFA 3O6AA 1X1JA 1HKJA 1UR8A 2OSXA 1JIBA 5JIPA 1GOIA 1HMUA 1LL7A 3A47A 4YPJA 3WNMA 1JL8A 2WVUA 2CETA 4JKKA 4P7RA 2YA2A 3TTOA 1BYCA 2ZUSA 2WAGA 3WEZA 2ZX8A 4NI3A 3IJ9A 3IJ7A 5DT5A 1SR0A 2J7EA 4BQ4A 3AIUA 2CESA 2DQXA 3ALFA 4DUWA 3TTSA 3ZT6A 4UNIA 3DC0A 3MSGA 4MJ4A 3UESA 1UH2A 1UYQA 4XV0A 4W85A 1FHLA 2X2YA 4UFKA 4H8UA 4BS0A 3NCOA 3T0AA 3CZLA 2VCBA 1VBRA 5D8ZA 1E71M 1W91A 4F8XA 2WCSA 1V3LA 2YLLA 2IUZA 1UKPA 4JCMA 5BROA 4L4PA 4HOXA 3PTKA 5JBEA 1GQIA 4PCSA 4QFUA 5FIPA 3VIMA 2ZUTA 3AZTA 2VQTA 1UWRA 3SUUA 1UD4A 3WD1A 1H0GA 1NOWA 2ZXQA 4U2ZA 4URIA 2A3CA 2WWDA 1TR1A 4ZFMA 1E6XM 3GNRA 1H5VA 2PBOA 4JFSA 3WH8A 1VJZA 3ZT5A 3K8KA 1AVAA 4UQCA 4AIEA 4KMQA 1D3CA 3K4AA 1LXMA 5IHSA 4M8UA 2B31A 3THCA 4PMXA 1E40A 5IFPA 4AXNA 4B3KA 4NRSA 2XGIA 2WC4A 4HOZA 3VTRA 4JAWA 2EJ1A 1HKIA 3ZIZA 2JF7A 3QGVA 4XX6A 4LPCA 1G94A 2XTKA 3N9KA 1CXEA 1C93A 1EOKA 1E56A 5EBAA 4W5ZA 2WZIA 3WQ4A 2PC8A 1EO5A 4XZWA 3AXIA 1E15A 3PZQA 3QR3A 4KGLA 2YBTA 4AD4A 5HOSA 2E40A 2JIWA 2FGZA 4W7VA 4GI6A 3I3EA 4D72A 3N1AA 5IXEA 2JIEA 3T08A 3VILA 4DUVA 3TA9A 3VGDA 1CEOA 2XFRA 2YA0A 4AEEA 1UHVA 1LG1A 1ZU8A 3K8MA 2DGAA 2WSPA 1UZ1A 2XSBA 4LYPA 1JZ4A 1MQRA 1V3HA 1MWOA 3T09A 1JFXA 1EQPA 4F66A 2ZUUA 4HMEA 2Y24A 4OBRA 3E1F1 3DYOA 1V0KA 3BAYA 1E4MM 5A8QA 3UR7A 1B90A 2PWGA 5E0FA 1OJNA 1XH2A 1W3JA 3CMJA 2RGMA 3UETA 1MFUA 1JFHA 4W89A 1W1TA 1UWQA 1NQ6A 5FL0A 3PZGA 4LYRA 3CZ8A 1BLIA 1W9XA 1BTCA 1JDDA 1W1PA 1WZAA 2NSXA 5E6ZA 3QHMA 3ARZA 2VCCA 2W92A 4PBGA 1MXDA 2J7DA 2FHCA 1BF2A 3U5UA 4MJ2A 1RPKA 3EMCA 3T2PA 3VNZA 2EPOA 1WDRA 3LPPA 2A3BA 4HZ7A 3UCQA 3DHUA 3MU7A 3RMEA 5AY7A 2WHJA 4ACYA 3WKZA 1HL8A 3W6MA 1UH3A 1B9ZA 3M07A 2J4GA 3F4VA 3WH9A 1UD5A 2YKKA 3M7SA 4C7FA 2CKSA 2WHLA 1V6WA 1DWFM 2XWEA 2VC9A 1E70M 5A6KA 3AHYA 5LA2A 3WDJA 1JDAA 3G6MA 3CUFA 2Q8XA 3FY1A 1UQZA 6A3HA 1AQHA 5AYBA 1UWUA 4MADA 3BLKA 3I3BA 1F9GA 1TG7A 1HJSA 4GPNA 4JCLA 3SCWA 2VRJA 3ZJKA 1LL4A 4M82A 1XHGA 3ZT7A 1VEMA 2VZOA 2X0HA 4F79A 3AI0A 4R5EA 1JD7A 3PZVA 5FKYA 2Y4SA 2XFFA 2W62A 1MQPA 2EPNA 4DWSA 3VIPA 3WIJA 3DHPA 3VOCA 3KL3A 2BVYA 3BXWA 1Y7VA 1KQYA 1TVPA 4WJXA 4J3WA 3WF0A 3SUSA 2PWDA 1A47A 3WF2A 1AQMA 1O6IA 2XVLA 3G6LA 2DSWA 3AIWA 4WK9A 3ZJ7A 3SUWA 2DSVA 3PZNA 5A94A 3T0DA 2BFGA 1GQLA 1F1SA 3VM5A 3SCVA 3WDHA 1OIFA 1V0LA 4TX6A 3WL0A 1XSJA 2OYLA 3ARWA 3UEQA 3VD4A 1B3XA 2WZHA 1E5JA 5EFDA 1NWRA 1CXFA 1WDQA 2J79A 2VTFA 3UG3A 4AZ7A 3BMVA 1C82A 3TTQA 3SCOA 3APGA 2EPLX 1BG4A 3VDHA 1MXGA 4EAMA 3UERA 5KEZA 3WNPA 2VX7A 3A4AA 2W61A 5D9NA 1WP6A 5KZ6A 3IJ8A 3CUHA 4IPLA 3RDKA 2W5FA 4JFVA 1RP8A 1B3WA 1WE5A 1CGUA 1PPIA 3AZRA 2ZICA 3L4XA 3AYRA 4JFUA 1UD6A 2A3EA 3AISA 1ZL1A 4MNLA 1GONA 1GVIA 2GVYA 5ABHA 4E2OA 1RD6A 1CGWA 2WC3A 2PWHA 3VKKA 2BY3A 1RWGA 2G3NA 1BPLB 2YDRA 4ZE5A 2ZX7A 3VM7A 5A8PA 2QHAA 3KEHA 1JXJA 4MNKA 1E6QM 4CCCA 1UKOA 1HVQA 3NSNA 1NOUA 1MW3A 5D4YA 3POHA 1UWIA 2ZXBA 1V6VA 4U2YA 5A3HA 2XPKA 2DSKA 1EHAA 1TCMA 3WD0A 1B31A 5F7UA 1JDCA 2X1IA 1OM0A 5HNNA 2JE8A 2WANA 1E1EA 3N17A 2E8YA 4M29A 1VEPA 4MB3A 3PBGA 4CN6A 3VDAA 1OSEA 3RM8A 1KQZA 3L4UA 4WKHA 2DT2A 1J0KA 2VQUA 1JNEA 1HJXA 3OGSA 4NZCA 4OBSA 3PHAA 2J47A 3F5KA 1G0CA 2HISA 2GJXA 2OYKA 4C7GA 2W66A 5GNZA 4J27A 1W1VA 3AHXA 4XZBA 1WB0A 5BCAA 1N82A 3ARTA 2TAAA 4WF7A 1US3A 1GJUA 3ZJ8A 4JZ5A 1CGTA 4V2XA 3OGVA 1JI1A 1L8NA 1UZ4A 5A2CA 1ZBVA 6CGTA 5A8NA 1JZ5A 3ARQA 1J18A 3WQ6A 2OSWA 2F2HA 3VU2A 1E0XA 4F9DA 2XHYA 1HMWA 5A6AA 2D0GA 3HJEA 3RIKA 4JL1A 3T2OA 4DWSC 2WDAA 2D23A 4KRUA 1UR9A 1C90A 4ATLA 1H3GA 2WC7A 1KR1A 4PRWA 1GHSA 2ZE0A 3EDEA 3O2LA 4P8XA 1J0IA 3CHEA 4P7LA 5JUVA 1EDTA 5CPQA 4XB3A 4MDPA 2CIPA 4MB4A 1TUXA 3RM9A 1V3IA 4F9JA 1C92A 1QW9A 2GDVA 1FH7A 2X03A 2D3LA 4BQ3A 3L4TA 2CBUA 2VRQA 2O9TA 4FK9A 2VO5A 3UG4A 3ZQ9A 5I77A 4EK7A 3WFLA 5DMYA 5A2AA 4UR9A 2J7BA 4PMDA 5EB8A 4ZE4A 4LX4A 2WNWA 2ZXDA 1CTNA 3GNOA 1OD8A 2V3DA 1DWHM 3ZMRA 4P8WA 2PB1A 1X1HA 3EMZA 4QDMA 3GH4A 1UQYA 2WBGA 5HXMA 1FOBA 3WUEA 1DWAM 3WELA 5BRPA 1B30A 1ZBKA 3KZSA 1KB3A 1VJSA 4JKMA 1JYVA 1XGZA 5BXTA 1E4IA 2DDXA 4JL2A 2BRPA 4J3XA 3VUPA 3AQUA 1H1NA 2ZWZA 1VFFA 1MFVA 3N12A 3EBVA 3J7HA 3FHAA 5CZKA 3CHDA 1RWAA 2O9OA 2G3IA 5HBFA 2CEQA 2YDQA 3B9AA 2NT0A 2DIJA 3VDCA 4M81A 4U31A 4W8AA 3BH4A 4Q22A 3PZ9A 4KWUA 3N04A 4ACZB 4FLRA 1ITXA 1BQCA 3SCQA 3K4DA 3GH5A 3TOPA 2Y2WA 2J7CA 4S3JA 1QI3A 2AOSA 1MQQA 1FA2A 1LWJA 4KGJA 1KR0A 1VB9A 3ZOAA 2V5CA 1JGIA 2DEPA 4Z2GA 3LMYA 2D24A 3WMBA 4UFHA 2AAAA 1E0VA 4YHEA 1HKKA 1UA7A 1OWQA 5BXSA 3CUIA 2W67A 3AS2A 2E9BA 3CPUA 1WZKA 1K9FA 2WB5A 5DEZA 2BV9A 1QVBA 2FH6A 3EMQA 1XD1A 4L4OA 1R86A 3U7BA 1JF5A 4HZ6A 1C91A 2X05A 1UD8A 2D3NA 4M80A 1LQ0A 3MUIA 3L2LA 4HPHA 1IZJA 3A3HA 2A3HA 1QNPA 4DUXA 2Y8VA 3VO0A 3WD4A 2XGBA 4D6EA 2E24A 1W9VA 4W8BA 5D9OA 1XV8A 4Y7EA 4U5IA 2V5DA 1C8YA 4MDOA 1OT2A 2PF0A 4DM1A 3KE0A 3VINA 1JI2A 3SCSA 4J3SA 1U30A 2WPGA 1D2KA 1R87A 3WNLA 4WSJA 5HDRA 1CZ1A 1UA3A 4GQQA 3WBEA 4GIAA 3IAPA 3UG5A 2BHZA 1W9BM 3ARVA 2J74A 1BVNP 1KGUA 1RWCA 4PSRA 3D5HA 4QCEA 3GDBA 1QOXA 4D6GA 2ZUWA 3TTYA 2VRKA 5LYRA 2FHBA 1HM2A 5I0DA 1XYFA 1HXJA 4D6FA 3CZEA 3NJ3A 1JNDA 3EDDA 3CO4A 2J8GA 1J01A 1F4HA 3NYDA 1E9LA 2WLYA 4C7DA 2VUYA 1RP9A 1CB8A 4W88A 3FN9A 2WK2A 3W53A 1ISXA 3GBEA 4ML4A 4TTGA 1TMQA 4B15A 3WQ5A 5CLWA 1AQ0A 1ZBWA 1E6ZA 3WUGA 1W1YA 2WCAA 1JYXA 2FHFA 4M1RA 1EHNA 4AW7A 1MVYA 5A95A 2VNCA 4UTFA 4DWSD 1LLOA 1UH4A 3CMGA 4UCFA 4BZYA 5CGTA 1JZ6A 4PMRA 1U33A 3VIIA 3WBAA 3NSXA 1IV8A 2CHNA 1UWTA 2X8RA 3IAQA 3WY1A 5JIWA 1GHRA 3VGFA 2ZUNA 2E3ZA 2PWFA 4CD7A 1X1NA 2DT3A 4UOQA 1GZJA 2QMKA 2ZX5A 4HA4A 1J0MA 4BQ2A 2YBUA 5FOOA 2BRWA 4OJYA 1HM3A 2CCRA 4OZOA 4OKDA 3LPGA 3VD3A 2XM1A 1BVZA 1GOKA 4D71A 2VCAA 4MPKA 2DT1A 2WVTA 3GZAA 1W9DM 5DT7A 2WM0A 4PMZA 1HF6A 1FP9A 4PTWA 1OBAA 1TFVA 4ATWA 4TXEA 4D6DA 1FP8A 1TA3B 1ISWA
chains in the Genus database with same CATH superfamily
2PDUA 1G9HA 2E5DA 4AD2A 1PV8A 3QSRA 2Z1SA 1OF6A 5BWAA 2PDWA 1S3TC 1IEXA 1F76A 1OJPA 3BICA 3VNKA 4ALDA 2PI6A 4CU6A 3VD9A 5I79A 3W87A 2D22A 2PFHA 3W02A 3LCLA 3T42A 5FJTA 1QPOA 1I4NA 2PWVA 1L6WA 2B81A 3DOPA 1H4PA 3AXHA 1J12A 4M56A 2G4FA 3R11A 3FYOA 3A4JA 8CGTA 2ODOA 5BMWA 4Q4SA 4N9CA 2PTWA 2WOQA 2Y7EA 1LOHA 1ODUA 1TSIA 4LTSA 3VKJA 1SSDA 3W28A 3OLGA 1PX8A 1U83A 2PLCA 3CAQA 1PIFA 5IBXA 2GQ8A 4M19A 3BAJA 2BVDA 4PMJA 1HO4A 5BMXA 2A85A 1W17A 5JXQA 3BLPX 5IDIA 3MBDA 2X0YA 3MHGA 1H50A 3KRUA 1JQVA 3D3AA 1X1IA 3GFYA 4JIRA 3THQA 4ADTA 4C6LA 2DQWA 3UCDA 1CIUA 4CQ8A 3BJSA 1I2RA 4O1DA 1JRBA 5HULA 3WLPA 3XISA 3HN3A 3N18A 3WUBA 4D9PA 3E2RA 1ADOA 1A5LC 4WDUA 1IWPA 5LIXX 1EQCA 3QC0A 3F7JA 2PU1A 2BRVX 3RHGA 3VX0A 3AJ7A 3LXCA 4CCEA 2D0HA 2INZA 1K9DA 4QEEA 1OGBA 3CIXA 1F61A 3WSUA 4S23A 3ITXA 2VMFA 2AL1A 1B4KA 1M7PA 2QV4A 1YXDA 4QHRA 3BL3A 4LUIA 4Z2IA 3MS8A 3W82A 2GSHA 5E70A 3IRDA 4FNSA 2YZ5A 1FCQA 2PP1A 3GRIA 4QITA 5DY2A 5CJNA 1C7SA 2QF8A 4NU7A 4D6JA 5CEWA 1QHZA 3W01A 1FRBA 1R9ZA 3U9IA 2O56A 1BRLB 3WQ8A 3F2DA 4PTMA 1N7NA 3FEQA 1E1FA 2EQDA 1US2A 2GGJA 2WMIA 4WJ8A 3WENA 2EO7A 3JRKA 1WAUA 3AMGA 2OEMA 3CNYA 4RCXA 3MMUA 5BU9A 2HZGA 4RNIA 1V02A 1GVYA 1R47A 3GX9A 3WFZA 2Z4GA 2XVGA 1UIOA 4FOUA 4XISA 4C6PA 3M9YA 1FWTA 1ZSXA 3F4DA 5AC4A 2W4XA 1O4UA 3GDMA 3B8DA 2IKHA 1BGGA 4H7VA 3N34A 2BMBA 5E1QA 1S5MA 2J62A 2Y70A 3G1HA 4Z2KA 2C13A 2VGFA 3G0SA 1KTBA 4Z1CA 2J78A 3SCNA 2DZAA 1TV3A 3D6NA 3DBNA 2XIIA 3A22A 3K8LA 4W8LA 4IIFA 1PHWA 1W3KA 4REQB 4PBEA 4JKLA 1SZNA 3MSDA 1JAKA 3VIGA 3W85A 3VX1A 4EKJA 4A35A 1IZCA 3LQGA 1IT7A 3QC3A 1QTWA 4GZIA 4DELA 3NDYA 1HT6A 1TYGA 3FW6A 4I7UA 3CASA 3WH6A 3AHZA 3N4FA 4DRSA 1PX3A 2E9MA 1S2CA 3B05A 5E93A 2X40A 5CLTA 3B0XA 1AW2A 1ONXA 3G3MA 3MZNA 3SADA 3JS3A 2HE8A 3ARRA 3I4EA 1RJPA 3LN3A 4WGHA 3PUEA 4ZENA 2RDXA 3I3DA 1V79A 4ROPA 2OPJA 3GG0A 1R3RA 1RXOB 2J77A 4FIQA 4GX9A 1H11A 3VYLA 3U5YA 2WMGA 3QTGA 1VS1A 3STFA 3PSWA 1X1ZA 3CZKA 2XUCA 3P61A 3MHFA 3QHOA 4G5DA 5T9BG 2WSKA 4GKLA 1XLJA 4EXAA 2VZTA 2R1PA 5HJLA 1FWIC 2DVXA 3AAMA 5BU6A 3B0YA 1Q6DA 2PWUA 3CV1A 4PUJA 3KBMA 1TCDA 2GFTA 5A6BD 2V5BA 3MVIA 1K77A 4O1FA 4I90A 1KXVA 2O0TA 3ITYA 1OYCA 1JYWA 3UQNA 4G6CA 4J5NA 1CYGA 3AC0A 1M7JA 1OFDA 1VCFA 3SIMA 1P5BA 1OJMA 2ZVRA 4GX8A 1DIEA 3HGSA 1SZGA 1V3KA 2Q3OA 4QEHA 1HGYA 1SSGA 3RR1A 5I23A 4EPKA 2RHGA 2R6OA 3ZSTA 4AZ5A 4ZR8A 1P0NA 4S3DA 4ZOAA 3K4WA 7TIMA 3A5VA 3F5LA 1JD9A 3MKKA 2VR4A 2F61A 3IWPA 4GIYA 4F2TA 1J9YA 1OFEA 5I5RA 5FAGA 4UTWA 5BYWA 5AHFA 3OP2A 2VGIA 4XAZA 3GVRA 1LUCA 2B7PA 2V67A 3G1VA 2VFDA 2Z1BA 4NX5A 1ZUAX 1TV8A 2A7PA 1EBGA 2HEJA 3QYSA 4PEKA 4UIOA 4H19A 3IVUA 2XG9A 3H2FA 4XG1A 4HHLA 1B3VA 2GJNA 4GQ0A 1SJDA 3PM6A 3L4WA 1S39A 4ML9A 3RITA 4JQ2A 2ZUVA 1H49A 1ONRA 2YL8A 3A6OA 5DY3A 4JTSA 4RE3A 2QCHA 2W3ZA 5CSYA 2AGKA 2VUNA 4PRRA 3V1HA 4HHMA 1Q4WA 5H6HA 1N8IA 3AYSA 2EKCA 1IXNA 4O0KA 5EMKA 3IIXA 4J1OA 4MNMA 5F2MA 3RILA 3TIMA 3L67A 3WQGA 1DE6A 3CUZA 4IP7A 4JEJA 1OT1A 5DMMA 2PCQA 1M68A 4YHGA 4DN1A 1JDFA 5DXYA 3N9SA 1W2PA 3KTSA 3SFKA 2LLEA 1V3JA 1VEOA 5EFFA 4GYJA 3AHTA 3S2CA 1YTKA 2ISWA 1HZYA 1TTPA 3CJPA 1TVNA 1NWTA 1PWLA 2D69A 3HQNA 5J5RA 2EKGA 3M46A 3EKLA 3RCNA 4IQJA 1UB3A 2IQTA 1AD1A 3WQVA 4DZAA 2JKEA 4QSHA 1M5WA 3WNKA 2WJFA 1CNVA 3W37A 5E0KA 1M9HA 1TPC1 3XINA 1UZHA 1TWZA 4UQAA 1QK2A 4JHMA 1PIGA 1VENA 3UWUA 3AXXA 1BQGA 3GIQA 3MC5A 4KCVA 3QTPA 3NL5A 1SGJA 3LA4A 3SN0A 3AUJA 2QAFA 4J3ZA 2WW5A 5BZAA 4DNHA 1RA5A 6REQB 2C1HA 2KAUC 2PE4A 1EP1A 2BHUA 3VABA 4B9ZA 5LGZA 4H8NA 2IPJA 1W3IA 2E22A 2J13A 5M3WA 1ZS2A 1WOBA 4LAMA 2O9RA 2GVLA 3M0ZA 2RKXA 4GNVA 3P80A 3WMCA 1YNQA 4WDWA 5T91A 3QGAC 2ZIDA 3S1GA 4TVCA 1KXHA 1OIMA 3VDBA 3RCYA 3ZM8A 2F6UA 1OCQA 2WKJA 5TF0A 4XZIA 3GUWA 4PMNA 1ISVA 1KLYA 1IHIA 5FJJA 3QRHA 1M01A 1ZCCA 2PAJA 4MLJA 3ZR6A 2GK1B 5CC6A 1A0EA 3LG3A 5H8MA 3TW7A 3R12A 3UPWA 3BE7A 4MZYA 2ESCA 4HU3A 3A24A 4LNYA 1F05A 3IVTA 3URNA 3IJIA 2WNNA 3R6IA 2O7QA 2TSYA 1ADSA 3BAXA 5PTDA 4PN2A 2P1FA 2V3EA 2FZ9A 3CPGA 5D9PA 4F2UA 2V38A 2E1DA 4PMYA 1V7AA 3CIVA 3P5ZA 4RK8A 1K8ZA 3LNMA 2WM1A 4UOJA 3LLXA 4O0ZA 4JGDA 4GVFA 4AMCA 3FKKA 4LGXA 4H8HA 5LGXA 3SIZA 2Y5EA 1Z8AA 3T2QA 4G56A 1M7XA 3FAXA 1Z42A 3AWOA 4QAIA 2PEVA 1OD0A 1VC4A 1NP0A 4R88A 4S3FA 1LQ2A 3W76A 4B5TA 3LYEA 3L2IA 3OBEA 3FHQA 1LOSA 1G7UA 2PDLA 4HJWA 1KWKA 3AOFA 1W1A1 1Y0EA 4LANA 4HHHA 4AZBA 1WZLA 2W91A 1HKWA 2GK1A 2VVSA 4GH1A 4DVOA 3GDLA 4LVDA 1POJA 3F59A 3S5OA 4H2HA 1GNXA 4YTSA 1M3UA 4IFKA 1XUUA 4ZB2A 2Q6ZA 3TQ0A 3RK8A 2E09A 2CBVA 1KBJA 2ACSA 3EB3A 3H2MA 4HVXA 8A3HA 1M7OA 1FWNA 3QQWA 3LS9A 3L5LA 3N19B 3E5PA 3CUXA 1KM6A 3LHVA 4WJEA 4YVXA 4MFDA 4NIRA 1TV7A 2ABAA 2RDTA 1B9BA 2WSRA 4NNBA 4XAGA 2G50A 5XIAA 3LSCA 2HQAA 2E6DA 1OINA 4HCDA 5D2WA 4AIOA 5C55A 2D2HA 6TIMA 5LNRA 2PC4A 1NJJA 3S4TA 4HNLA 4XAYA 1WAWA 1GOWA 1Z7AA 4B16A 1GTHA 4I6VA 3W22A 1RVGA 1XXXA 6REQA 4AD3A 5T9CE 3BGAA 3O06A 3SO7A 1HN0A 5DF0A 4XZNX 5JMUA 1T99A 1SM9A 3VIKA 5A6LA 3W7JA 1B54A 1R3SA 4AD5A 1H41A 4FMVA 5FJUA 4MG4A 4DLOA 3VMNA 2C8NA 4PTDA 5FJPA 1C8QA 3NFUA 1B0IA 4X9SA 3TXVA 4JIQA 1PDZA 4X0NA 3IUHA 4PEEA 1MEWA 3LXAA 3FXYA 2NX3A 3G1XA 4UXDA 3W7IA 4E8DA 2J88A 4NAEB 3MUAA 4X60A 5DRCA 3CC1A 2NW0A 3BSHA 3QH2A 3MANA 2IXVA 3M0LA 3AS3A 3GE7A 5D9MA 3F2BA 2EPKX 2GJXB 1RJRA 5CJ5A 3UWZA 4JQ4A 3U7VA 3NO5A 3M1ZA 4DI8A 1EH9A 2WJEA 4NI8A 5CGQA 4HCHA 4MAZA 4AD0A 3VNLA 3P74A 5CXPA 5BRQA 1PZ3A 1BYDA 1P48A 3N13A 5HAOA 3GXFA 5BNKA 1LOLA 5I02A 4QNWA 1FUYA 1ZP3A 4W7WA 3O15A 5A8OA 1HIZA 1I75A 3ENLA 4H6KA 2Z26A 3FK4A 3FAWA 5K3VA 4C6IA 3E2SA 2G3MA 1M6JA 4WHBA 4AYSA 1L0PA 4UTIA 1FWRA 4YTUA 5KZMA 2CLOA 3M0VA 4ZBCA 3QBUA 1FKWA 3PANA 3PUDA 4QM1A 5G2IA 2A0NA 5FJOA 1ZCOA 3VNYA 2FMNA 2CNCA 4N6EA 1K6AA 5HUPA 3NOYA 1UKQA 2PDHA 3TJLA 4XD5A 3WYZA 4O0QA 4IISA 4YU1A 1GOQA 3OQEA 1AQFA 2DSUA 2DZVA 3MUY1 2WJDA 1TWDA 4J40A 4LUJA 2F2KA 3AALA 4Y9MA 2HVMA 1K9EA 3ES8A 1R0MA 2WSQA 2Y5SA 2Y8UA 4UFLA 3H2CA 3RLVA 3OVRA 3URBA 5C0QA 2VVNA 1IT0A 1JCLA 4WSKA 4IPIA 2PTYA 1A5KC 1TZ7A 3GUGA 5DXXA 3GBDA 1Q6LA 3UXLA 3QGKC 2VT0A 1YPIA 4HA0A 2R14A 3BW4A 4UOZA 2IS7A 1XKYA 3CAWA 3KW3A 2EXOA 3LQLA 1AFSA 3HU7A 1XIBA 4AG0A 3UWEA 5ECUA 1CGXA 3RJYA 5A5WA 2RUSA 4US5D 4FNQA 3H4GA 3V4BA 1B57A 1OGSA 4B4HA 2EEXA 3BSMA 1MO0A 3PB0A 4EF9A 3O6AA 4AX6A 1F5ZA 1HKJA 1UR8A 3ABZA 3QMRA 3DFNA 1GOIA 1X7IA 1IE7C 1LL7A 3UJRA 3A47A 1GGOA 3W1RA 5D2TA 4YPJA 4JTEA 2YA2A 1BYCA 2WAGA 2X7VA 5MKGB 4FAMA 3QZAA 4E2DA 3CIWA 4MJ4A 1UH2A 1UYQA 3DFOA 3EXRA 4KWSA 4NYUA 4NZJA 4UCGA 5AVHA 2BODX 4HYRA 4FNTA 4HYWA 3FKRA 4WGXA 3GD6A 1VKFA 3T0AA 2CW6A 2GJLA 1VBRA 4XTIA 1E71M 2WCSA 5DMNA 1SR9A 1UKPA 1KCXA 3V16A 1L6GA 4PL1A 3K13A 1X39A 3IRSA 3ERPA 4F2BA 4QFUA 3CB3A 1GEQA 1SW0A 2VXNA 3JZEA 4IICA 3HGOA 4N02A 3O0KA 1XL9A 1TR1A 3P62A 4L6OA 2QCMA 1DXEA 2PBOA 3IIPA 2QJIA 3WH8A 1KRBC 1VJZA 4LUSA 4WY0A 1KM3A 1AVAA 5K9CA 1S38A 4D2JA 3K4AA 3B03A 1LXMA 1EUNA 3PAOA 5IHSA 2OO0A 3THCA 1B5TA 4PMXA 3HMJG 1KFCA 5IFPA 2FTYA 3ZFHA 4EXQA 1PCKA 4NRSA 4WDTA 3TDFA 1YRRA 4FNPA 4UTKA 3CMFA 4IMEA 2EJ1A 3ZIZA 4MOZA 5FEZA 2VZKB 1OYAA 4ZTYA 1G94A 3N9KA 1CXEA 1E56A 2FJKA 1P0DA 4B5SA 3UJFA 1J96A 2HROA 2Z28A 4HJFA 4M6UA 2H8XA 4DO6A 2YBTA 3MQTA 4AD4A 4RE0A 2X1UA 5HOSA 2OEJA 4W7VA 4GI6A 3CQ0A 2NQHA 3R5EA 3VILA 4B2DD 4BF9A 3IV8A 4FALA 2YSWA 5TBOA 4NYYA 1LG1A 1ZU8A 4GYFA 2Z6JA 4LYPA 5J8LA 1E0UA 1MWOA 3ZWTA 4YXGA 2ZUUA 4DAIA 3KFTA 3E1F1 3EB2A 4LV9A 3MJMA 3BAYA 5A8QA 4ZGYA 4UTUA 5E0FA 3CMJA 1QDSA 1JFHA 4W89A 1W1TA 3B9OA 1UWQA 3W86A 5FL0A 3W71A 3UW6A 1JR1A 3VOIA 1VQTA 3L12A 4GC4A 3V0UA 4B5XA 4Z1BA 4YLWA 3TSBA 2Q8ZA 1WZAA 2NSXA 3QHMA 3GB6A 3ARZA 2Y1HA 3RXZA 1XDLA 1MXDA 4IP5A 4ERGA 3UF9A 2FHCA 5KSWA 3KOYA 4Q8MA 3NQFA 4MJ2A 4C6QA 1AH0A 1WDRA 4POCA 3HB9A 4HU4A 4L56A 4HZ7A 1X96A 1U22A 3WCZA 3TZNA 4ACYA 2CXEA 3U2CA 1O1ZA 1UMLA 2J4GA 5T26A 4F40A 2CKSA 3QQ1A 1U5JA 3ANYA 5F2LA 1YE6A 1UMYA 3W23A 3HTWA 4XO7A 1DQXA 3VA8A 2PCEA 5A6KA 3AHYA 5LA2A 1JPIA 3WDJA 3CUFA 1XLBA 1TG7A 3VNMA 4IP4A 1WXJA 2OX4A 3G1RA 1C29A 3LX9A 1Q6RA 1L2QA 3GZ3A 2Y4SA 2HVNA 5DLCA 3R10A 2EPNA 4QS5A 4DF1A 4MIMA 1E1CB 1E1CA 4WJXA 3PBMA 2PWDA 1AQMA 2DSWA 3AIWA 3IJQA 1DVJA 4FF7A 1F1SA 5BW6A 4HK7A 3WBWA 2Z00A 4AMAA 4HNOA 1BVWA 1XSJA 4X2RA 3S5NA 3SFWA 1XYLA 3ARWA 3UEQA 2VEPA 1B3XA 1CXFA 1DJYA 1Y5XA 4KCWA 1OC5A 4CQAA 3SCOA 1KKRA 4DJDA 3VDHA 3W00A 5CPLA 2Z25A 2DZUA 3UERA 3VE9A 3A4AA 4XO6A 1WA3A 5H8PA 4B90A 1ITQA 1WP6A 5KZ6A 2H3DA 3NPVA 3NQEA 3VC6A 4IPLA 2W5FA 4JFVA 4ZOEA 2Z2UA 3UZYA 3FDGA 1CGUA 1PPIA 4LCQA 2ZICA 2XGZA 3KRBA 3H12A 3G1YA 4JFUA 3AISA 2KZHA 3GW3A 1GONA 4YJ5A 4Z0SA 4XBKA 3EX4A 4INFA 4MFEA 3PBVA 1BPLB 4ZE5A 4FNUA 2V69A 2QHAA 3AWNA 5CG7A 3DEQA 4CCCA 5KITA 2DUXA 2XIJA 4GRSA 2RJGA 3QY7A 3TCSA 1V6VA 1PVNA 1TCMA 3OYZA 2G37A 5EA9A 3E96A 1JDCA 1OM0A 5TQLA 2OKTA 4JQ3A 2JE8A 3ZLGA 2WANA 1E1EA 4MKNA 3ZZ1A 2E8YA 2FIQA 1FY6A 1RLDA 3RM8A 3TK7A 3EX3A 3SRKA 5CZJA 1G4SA 3Q58A 1JNEA 1XFCA 3CYVA 2J47A 5FF3A 2HISA 4IJCA 2GJXA 2QPXA 3TNOA 2W66A 1JEZA 3KRZA 3BLIA 1DJHA 3AHXA 5BCAA 3OZMA 3SGGA 2GL5A 1TB3A 4HNNA 1A49A 2I5GA 1US3A 1VLIA 2CZ5A 1L8NA 1YADA 2E67A 3WLLA 4ZFCA 1JZ5A 2F84A 4JX4A 3A64A 2OSWA 2F2HA 2I16A 3U48A 4C6MA 3EX1A 2H8ZA 4F9DA 1OFOA 4RPPA 1HMWA 3NEHA 3PBYA 4JL1A 1JUBA 4DWSC 2WQDA 4JBRA 1C90A 2YX0A 3KS6A 1UC4A 2ZE0A 1UP2A 3O2LA 3NQDA 4P7LA 5JUVA 4GABA 1EDTA 4MB4A 3WK2A 2OKOA 1C92A 2D3LA 5F4XA 2VRQA 4FNRA 4FK9A 4QISA 2VO5A 3PR2A 2E25A 4GC3A 2H9AA 4A05A 1DIKA 5DMYA 5A2AA 2DZWA 1TTIA 4ZE4A 3R8GA 3PPFA 2QJGA 2YR1A 3OVPA 2WNWA 4JX5A 3G0UA 3GNOA 2V3DA 1DWHM 4GOAA 1QO2A 1UQYA 3NQ8A 1DWAM 2ANUA 2J8TA 4RLIA 1B30A 1DHPA 2HE5A 1KB3A 1OADA 4M6PA 4WY0F 1JYVA 5BXTA 3DFPA 2HXTA 4JL2A 2NLIA 3AQUA 4LY8A 1H1NA 1KM1A 2X30A 2ZWZA 3L23A 3PUGA 4GY0A 5HJYA 5CZKA 3FHAA 3CHDA 3PC0A 1GYNA 2YDQA 7XIMA 2QUUA 2DIJA 4HK6A 1W6TA 4M81A 3PWIA 3GTFA 4W8AA 3UJ2A 4PCNA 4QSFA 4Q22A 3W1QA 3N04A 3G2GA 1SO3A 3OO2A 1ITXA 3BG5A 3GH5A 2J7CA 1TELA 4XD6A 2RAGA 4Z2GA 2D24A 4UFHA 2P0IA 4GA8A 2W67A 1DIDA 1YNPA 5C9UA 1A0DA 2G4JA 3MB9A 4WOQA 1DJXA 1WZKA 5DEZA 2ZRWA 2FTWA 4YVPA 4Q8OA 5G5IA 4FI4A 3EMQA 2ZZ4A 1V77A 3U7BA 4HZ6A 4CCZA 1Q65A 1XPGA 4RXGA 1H7NA 5K9XA 2R1MA 3L2LA 3LI1A 1Q2SA 3A3HA 3E0FA 4DUXA 3SECA 1AMKA 2XZ9A 3DKLA 2A6NA 3EKGA 1W9VA 1XV8A 1K4GA 4JYEA 5FESA 4S2BA 1JI2A 2DW6A 1U30A 1D2KA 3UVIA 5AHIA 4GQQA 1TIMA 3OHIA 4I8DA 4Q8PA 4ICNA 1KGUA 1RWCA 3OPSA 4HPXA 4RR4A 1RAKA 4I7WA 5GJPA 2VRKA 3CXOA 4IX2A 1XYFA 1HXJA 4CNSA 4O52A 1TTJA 3GQYA 1JNDA 3BCJA 3CO4A 1J01A 1F4HA 2YW3A 2B7OA 4PUMA 3WLRA 1M1BA 3NYDA 2WLYA 1RP9A 3HF3A 5LHEA 1EB3A 1CB8A 4W88A 4IL2A 1GKQA 1NF0A 3U2EA 2QGYA 3DENA 4C1NA 3GBEA 5CLWA 3EXSA 1E6ZA 3WUGA 2WCAA 2QVHA 1W0MA 2R9RA 3M0HA 3TH6A 2GDQA 2UV8G 3VKBA 1MVYA 3LCGA 4HPNA 7PTDA 1YE4A 1FWCC 4JDYA 4I5XA 2HNEA 3P84A 1ICPA 4RJEA 1EP3A 2TMDA 3CH0A 1SPQA 1VYPX 3WY1A 2ZUNA 1RJQA 3O07A 4UOQA 4JTAA 2PDJA 4HA4A 2BRWA 3LSBA 1L6YA 2CCRA 3HQOA 4N7QA 3LPGA 3DGBA 1YNYA 1TV5A 2Y7DA 3QJAA 3MPGA 4D71A 2VCAA 3T81A 3FIGA 4MPKA 4MKVA 5AC7A 2WVTA 2WM0A 1W5NA 1TWSA 1O5XA 4WXZA 5AVNA 1OBAA 4MWAA 4D6DA 4LW7A 3VNIA 3M0YA 1I45A 3NVTA 4I9MA 4A8NA 3DFHA 3ITVA 4L61A 2C91A 1W1B1 4LB4A 2ZDRA 1A5SA 1OK4A 1V02E 3UWYA 3BAKA 1P1XA 1CENA 3GDTA 1KXQA 1DEDA 1BWKA 1Q63A 3EDFA 4KEZA 4AZGA 2PLJA 4QJ5B 4I5RA 4DM2A 5I3GA 5F4WA 1G1YA 4NF7A 3THDA 1W1IE 2ADAA 5I7GA 2VZKD 3DC8A 4MB5A 3HPFA 2ICSA 3C61A 1O5KA 3KVJA 2FPYA 4OOUA 2YB4A 2YL6A 1TMHA 2O92A 3KWSA 4XAFA 5IHRA 4W87A 5BXRA 1C8VA 2E4TA 3W1TA 6PTDA 3GU9A 1W31A 3QYQA 4WX2A 4MM1A 5TD4A 2X1TA 3AIRA 2FGLA 4AAJA 3VIJA 1E5NA 3H2EA 4O53A 3M6DA 1GWJA 3WLTA 2EG8A 4J28A 2WWCA 1H09A 1XLHA 2VD9A 2PGWA 5L6UA 5FD0A 1I6NA 1PCWA 4I7VA 2Z0IA 2DUZA 1FWBC 3BVJA 4LC8A 1ISYA 4DZIA 4AEFA 1MDLA 1NP2A 5CGMA 1XICA 3TP4A 1X98A 2VI0A 4ZQNA 4OT7A 1FFRA 3HMCA 1UR3M 4MWAD 2BXZA 4HMNA 3RRAA 1N7OA 4L9XA 4XZLX 1BGAA 3EWUA 2XWDA 5G1TA 1XLKA 4QGCA 3EGJA 1TJ1A 4DYKA 1OB0A 5TIMA 5LZLA 2UY2A 1J6PA 2FGBA 1OC6A 4A3YA 3ZSSA 3P8IA 3W75A 3SCTA 4XWUA 5M1TA 1WUFA 4HSNA 4JHOA 4OTKA 3PJWA 3UU0A 1J11A 3QR8A 1S5VA 1DBTA 4V1XA 1KGWA 3LGGA 5HINA 1X6NA 1W3LA 5HATA 7ENLA 3O6CA 4JY9A 1ZZMA 1D7FA 2IMRA 4D8LA 2ZFAA 3KDNA 4HMCA 2NVAA 3W07A 1I2PA 4Y9PA 3HG4A 1R8LA 1A5BA 3F4WA 4HNCA 5AHNA 2XIQA 2ABBA 4Q4QA 1K7EA 3B40A 3LZ3A 3W83A 4HIBA 2CC0A 1V0NA 1WCGA 1CGVA 2XINA 3OODA 1DQUA 1YPXA 5A6SA 2PDNA 5G1MA 1LBLA 4D6HA 1PUDA 1UBPC 2C18A 3ITLA 1N7RA 2GJPA 1Q6CA 3O05A 4FXJA 1SW3A 2C7FA 4DWSB 1HUVA 3NQBA 3B8TA 3T40A 3TR2A 1XLGA 5BXPA 4YCPA 2P5NA 3M64A 1VPYA 3R58A 4JFWA 3WMLA 1BXNA 4MB1A 1BFNA 4H4IA 1HKVA 2QPUA 3WDQA 1CLKA 4A3QA 5AHMA 2FPVA 3W2LA 1XH0A 3NA8A 4L6HA 4CU7A 1QPKA 2XN2A 4D1IA 3MYPA 2VDGA 4UZUA 2PWEA 4EWND 3DXIA 4X0VA 4PFHA 2CERA 3EOUA 2TYSA 3PZIA 1W56A 3EWCA 4ZZ9A 1YBQA 4PULA 5AYXA 3O6YX 4Q8NA 5IFTA 2PDIA 2YYUA 4I3GA 3LERA 1OCBA 2FDSA 2VFIA 3I4KA 5LIUX 1LCOA 3E3HA 5GQBA 1N2VA 2G97A 3H6OA 1KKOA 4ZQCA 2OWWA 5I3FA 4NXSA 4IUGA 2WMKA 4Q33A 4JDBA 3ALGA 1RQBA 3AROA 3MSRA 3SCPA 1OX4A 3ARPA 2GDUA 5JBDA 1F6YA 1V3MA 1LYXA 1RWFA 3DG7A 1J5SA 3EZ4A 3VGGA 3OLDA 3LHYA 3IARA 2NX9A 1QNOA 1EOMA 8XIMA 4EF8A 4LB3A 2Z1WA 1XRVA 3AIEA 1EJVC 4ADUA 4GINA 5FJRA 5AB3A 4LF2A 4IGMA 2RDUA 5BWFA 2OWCA 1KBBA 4O8AA 4Q6JA 4Z2LA 1M03A 2A6LA 3HPSA 1JQXA 1EF2A 1I1WA 5CPMA 2WNZA 1QBAA 3EA2A 1TV4A 5A6JA 1ZBCA 3ITGA 4GNKB 4W9TA 1ECEA 4ENLA 4UZSA 3NIYA 3QEZA 3W2MA 2I9UA 4HA1A 3WUFA 1VRXA 3V3WA 4BHYA 5EPDA 1FVPA 4AVFA 5E6YA 1G6CA 2UY3A 4IG2B 1WDSA 1EYWA 3I6TA 1UR4A 5M17A 3NDOA 3NQVA 2PPGA 1N7KA 1KRCC 3W1UA 3UP8A 1FWSA 1V7YA 5I06A 1ZHAA 1K4HA 1NQKA 3ABQA 5MF5A 4AZHA 4L9ZA 2P3EA 3EOOA 4HP5A 4MAVA 1ITCA 4LNCA 1F74A 4DF2A 1K6WA 3GTNA 3PBWA 4CVWA 5A2BA 3NL6A 3ZS4A 3WEOA 4IMGA 4PUEA 3M4HA 4H83A 5I3HA 4DJDC 3OBAA 2BBFA 4FLSA 2QKFA 4S3KA 5EMJA 3WJZA 1AUSL 2QIWA 3LM7A 5HR6A 2WQPA 4OECA 2Q3RA 4DJED 3R43A 3WG6A 3BGGA 3KVLA 2EF9A 4YWIA 2VJXA 2J75A 3BOFA 4ZXOA 2Y8KA 4LT9A 1PKYA 1YPFA 2AGTA 1UUOA 1KGXA 4M51A 1OC7A 1MYRA 1EJSC 3ID7A 5K4ZA 3TMQA 3PUOA 4DBEA 3ZO9A 1DJZA 4V33A 3LB0A 1G67A 1TJ2A 2WVVA 4JPGA 3CUJA 4K38A 5BRBA 2FB3A 1UJQA 1NWSA 5E09A 2GUUA 3C86A 2FDMA 3PNUA 1GQNA 1EGUA 4WY0B 1NDWA 2GGGA 4TQTA 1A3HA 2WHKA 4W5UA 4NZ3A 1XLEA 5IM51 2ZRZA 3DU0A 1XLLA 4Q4MA 2UBPC 4UFIA 3FA5A 2VR2A 3RO6A 4ZQPA 4S3GA 3T05A 4TVUA 5I78A 1S5NA 5FF2A 4N4PA 3GTIA 1GVOA 1QO5A 1W5OA 2Q09A 2C79A 4GO8A 2HPIA 5L9FA 1YIXA 3O9NA 3MA8A 3FA4A 4NHVA 1E3ZA 1P6CA 4NL1A 3T4CA 3UT0A 4LS1A 3TJXA 3C6CA 4EPBC 2ZC1A 2HWGA 1HX0A 1DTUA 5G4WA 1JXKA 1TQJA 4K68A 1PZ2A 2HMCA 3LOTA 3R25A 3BLDA 3C0SA 4DO7A 2PDXA 2GOKA 3RO8A 3GTXA 1EC8A 3B9EA 2Q71A 1PHQA 1TR9A 3H70A 1UG6A 1KLZA 1QXLA 2YL9A 4N42A 3W24A 2QJHA 3KBWA 4Q6XA 1KXTA 3K46A 3LM3A 3GK0A 2VFFA 3GG1A 1KO0A 5DCDA 1SZFA 3H8AA 2NT1A 1V08A 1YEYA 2PF8A 3G1SA 4JX6A 2YLAA 1EPXA 1A50A 4PTVA 1R7OA 3L5AA 3VGEA 4C6NA 4P7QA 5AYZA 1ZY9A 4NAFB 2CHOA 1G4PA 4C1NB 3E74A 5KETA 2RGLA 1OJOA 3TE9A 1SZEA 1TE1A 3S6OA 4FXRA 4UQ9A 5FAJA 1RH9A 1OHLA 2C1GA 1MNSA 1PL9A 4MTVA 2XVKA 3N2MA 1GCYA 1GQJA 4PUDA 3TFCA 3N15A 1MEHA 4UQEA 4DWDA 2PDMA 1UP0A 1VFOA 1BD0A 1ZJAA 2J6XA 3C52A 3QOKA 1EIBA 4H6EA 4DYEA 3V75A 2OGYA 2YXXA 3A5FA 1ZJBA 5CG0A 2W9MA 4XSMA 1K03A 4ROQA 4Y96A 4IJRA 4IL0A 4TTUA 1XG3A 1XWYA 3LXBA 4K6AA 3AO0A 1CW2A 1JUKA 3PY2A 5M03A 1GUVA 3VGHA 2BHYA 4Z42C 3S2JA 3L4YA 3DFYA 4FOJA 4WKFA 1NIUA 4FHAA 5GNXA 3REQB 3ES7A 2R24A 3BCDA 3AICA 4KPLA 4O1AA 3W7NA 4U5KA 9XIAA 3BC9A 3KOFA 2P10A 4ZXLA 3AS1A 4F0SA 4H8VA 3H2OA 2XN0A 1TPWA 1W3TA 2OU4A 2BVTA 3ANUA 4PE8A 4IMCA 2HBXA 1UR2A 1PO9A 3OG2A 3MP5A 4R7JA 4OOZA 4PUWA 5E9XA 1M41A 1MW1A 4BQ5A 3PTMA 3STPA 1E4NA 1S1RA 5DELA 2MANA 3PZOA 1DJIA 4XUYA 4M6VA 1IIGA 1J6OA 1O1HA 1OZQA 5F1VA 4CD5A 3AIBA 2D1ZA 2PA6A 3IGXA 1UUQA 2XN1A 4H9MA 3C2EA 1W3HA 3GKAA 2C6QA 2PBGA 3TOYA 2E0PA 4IF2A 1XBXA 2JFEX 5CQ1A 2XVPA 1FXQA 2QUNA 2OLHA 4QJ1A 3DDMA 4JQ1A 5I24A 3E0VA 4KETA 3ZVHB 5FSEC 3IVSA 4GI9A 4KWVA 4DJFC 1XH1A 3H2AA 5HQLA 1ZB5A 2VZVA 5G4EA 2VEIA 4LBUA 2WKGA 3VFCA 4DBWA 1A3XA 2P8CA 3ZLHA 3PG9A 4FLOA 1QNRA 2UZ9A 3M0KA 3GDRA 1K3UA 2DH2A 4UC5A 1JJKA 2QJJA 4IQEA 1BYBA 3MMTA 3S3GA 1TX0A 4MPQA 3BAWA 3IJLA 4LAKA 3MO4A 3PPHA 4GKTA 3BURA 3VAVA 1GVSA 5AZ1A 4E3TA 3FFSA 3W6LA 2VZUA 5DO8A 3CGTA 1XRTA 4AIUA 1XIMA 4MY9A 4LVFA 4Q7BA 3N2XA 4NVTA 1MUWA 1A5AA 3BMXA 1E6SM 3JVAA 4MSSA 7TAAA 1UP3A 2YGYA 1FHDA 1FCUA 4XSLA 4UTTA 1NAL1 2ALDA 4DLFA 1SFSA 4O16A 4EAYA 3IK2A 5D2XA 1SFTA 2CBIA 1JCNA 3SY1A 1XF0A 1L6FA 1IYXA 1NSJA 3UY7A 1GG1A 1NWUA 2BLEA 4J4KA 1TTQA 4O17A 2P88A 5LA1A 3SCRA 1XBYA 3KOXA 1XBZA 4QP0A 4UQDA 4ZL1A 3CAKA 3W26A 5I3DA 4NSBA 4H7CA 3TYBA 1AL7A 2OFJA 3LD5A 3UCCA 3MYOA 3AJXA 3W4RA 4JTKA 2Y61A 3ANVA 2VWSA 1JCMP 3PJXA 3NSMA 4RE2A 3SY8A 3EWWA 2XH7A 4QG6A 1XKJA 3N9RA 4A4AA 3DI0A 4J2PA 3ZXWA 1KFJA 3L0KA 3F5JA 3B06A 3RN6A 4Z2JA 3INPA 3RF9A 1NVMA 4BCEA 3ABOA 3QV6A 2IQDA 3WLIA 4QCFA 1VBUA 3AMCA 2JGQA 2QCGA 2ALRA 1SO6A 3BLEA 3QKEA 3CHCA 3UGVA 1U5HA 1QOQA 3RPDA 4PSPA 5C2XA 4ZEPA 4UTTC 1VBHA 1RK5A 3V36A 1S46A 1IIHA 4JNMA 2DW7A 1HP4A 1Q2RA 1Q8AA 3DHDA 4C6EA 1JZ2A 2AL2A 4UBPC 2C1IA 4IZGA 1NFGA 1B4EA 1DXFA 3KBTC 1K1DA 1YYAA 2OSXA 1JIBA 2VDHA 5LKYA 2FLIA 3BUVA 2WVUA 2CETA 3KS5A 4JKKA 3SBFA 3B0PA 2ZUSA 1HW6A 2ZX8A 3IJ7A 5DT5A 2J7EA 4IMAA 4ES4A 2NV1A 2V63A 3TTSA 2BG5A 2P8BA 3UESA 2GQ9A 4BI5A 1KA9F 4XV0A 4HN4A 3FJLA 4LALA 4QE1A 2PDCA 2YZRA 3YPIA 4H8UA 3N6QA 3WK0A 4BS0A 1FWFC 1S5WA 3W1NA 1EZWA 3CHVA 1D9EA 8XIAA 9XIMA 5EYWA 3QFEA 1VR6A 4JEQA 3WLQA 1O5QA 1EWEA 1YXYA 3VIMA 4BWLA 2ZUTA 2VQTA 2YEPB 1UWRA 4ZQOA 1H0GA 1NOWA 2ZXQA 3T6CA 2FYMA 4URIA 1FWWA 4L65A 4TU1A 3FOKA 4ZFMA 3CQIA 1BWVA 3GNRA 1H5VA 2BX7A 1R9XA 3VCCA 3EX2A 4QE5A 1POKA 4O1BA 3G3DA 5B7ZA 2IKIA 3A12A 3S6DA 4GGBA 4UQCA 3FJ4A 1D3CA 1TRIA 2Z29A 5AC8A 4HPJA 1AJ0A 4K39A 3O1NA 3DN5A 2QDGA 2JBMA 2B31A 1E40A 4JYFA 1UROA 2XGIA 2WC4A 4HOZA 3VTRA 3C3UA 4JAWA 4DBUA 3C2YA 1HKIA 4Q8TA 2JF7A 2HS8A 4LPCA 3PTDA 2XTKA 2EG6A 4GCXA 2GQ3A 3NGFA 1REQB 2H3BA 4WSHA 3PZQA 4KGLA 3WLOA 1LRQA 2JIWA 1JCJA 4WR3A 1A4LA 3N1AA 2BB0A 2IW0A 3T08A 1QT1A 4DUVA 3TA9A 3VGDA 5F1UA 4JTJA 3IK4A 2ZYFA 4RZ6A 2DGAA 2OOFA 4GYPA 1JZ4A 2RFGA 3H4XA 4JTFA 1MQRA 5DX7A 4GGHA 1RCXB 5DMLA 1JFXA 1EQPA 4F66A 4HZMA 3H53A 4Q4OA 2J27A 4LAUA 4OBRA 3L0GA 1XLDA 3W2UA 3B0VC 2PWGA 4RDWA 1OJNA 1XH2A 3GVQA 4OQVA 1IWBA 1UUMA 3MVTA 4PR4A 5FF7A 4RUBA 4K8GA 3G1FA 1BLIA 1EYEA 4E38A 3W7HA 5H1WA 1W1PA 5HJXA 4KIRA 5E6ZA 3R2GA 3UVAA 3GWQA 3FJNA 1WBHA 4ORIA 3KP1A 2W92A 1X1OA 4PBGA 1Q6QA 3GHUA 2J7DA 4OWGA 1BF2A 1FBAA 1RHCA 3EMCA 4ZCWA 2PTDA 3GHTA 2A3BA 1QPRA 4HTBA 2G3FA 3WKZA 3UBPC 1GPWA 2X1RA 2HPMA 3F4VA 3W1LA 4C7FA 1T5AA 1HG3A 2WHLA 1V6WA 2XWEA 2VC9A 1E70M 4EP8C 1T7LA 3MCNA 4I6KA 1JDAA 4LUSB 1F6PA 3D47A 3FY1A 1ZAIA 2PDFA 1NFPA 4FSAA 3CWOX 3LBMA 1AQHA 3KLKA 4GIRA 1I0DA 1MDRA 1K8YA 5EMLA 3GFZA 4UTHA 1L9WA 3WK1A 3KCLA 4YTTA 1XHGA 1HGWA 1VEMA 2VZOA 1I0BA 4C6JA 3CO8A 4L4MA 3P3BA 4KEVA 4D8AA 3N3TA 4NJGA 3FEMA 5BOEA 1UWAA 4ZA0A 3VIPA 1MZHA 1PZ0A 3KL3A 3FLUA 1Y7VA 2EJAA 1KQYA 1TVPA 5C54A 4QBXA 4J3WA 3LGEA 4GWEA 3SUWA 3T0DA 1ML1A 4G1NA 1GQLA 1RUSA 3V35A 3MY9A 1ADDA 1TMLA 1V8EA 1OIFA 1ZJHA 1V0LA 3SRFA 4FZIA 4LS2A 2Z1VA 1DOSA 1FX6A 1BXBA 4B5VA 3DAQA 3VD4A 1SO4A 1IWAA 4AEOA 3RX3A 1Q45A 3LCXA 2XU2A 2J79A 4AZ7A 2I57A 4A3UA 1XIEA 3APGA 2DVUA 1BG4A 5FF4A 2OGJA 3FV9A 5D04C 3TTEA 4B5WA 5J5DA 4IOTA 2AQVA 4ONVA 1VFSA 3IJ8A 3RDKA 4TO8A 4HK5A 1ME7A 4Z0JA 2KXSA 3AZRA 3AYRA 4FX6M 4CNOA 4M1BA 2A3EA 1YW1A 1ZL1A 4DPPA 3L9CA 4LRSA 4O57A 3LRMA 2GVYA 2WC3A 3IPWA 2ZX7A 1SZRA 4YYCA 5MKGA 4QQUA 3KEHA 3C2RA 5D30A 1E6QM 3NQGA 1X6UA 4LOCA 1HVQA 4GFIA 3NSNA 2QUMA 3QQ0A 4O28A 5D4YA 2G95A 3TLQA 3POHA 2V82A 4U2YA 2XPKA 1I2QA 2DSKA 3WJWA 3TR9A 2V68A 3W88A 3P14A 1LUCB 3N17A 3NZQA 4PB4A 1R2RA 5B80A 3LCHA 1MRQA 4EIVA 4JTRA 1J0KA 3GHRA 3W7MA 4NZCA 1ZPTA 1TO3A 3STCA 3V5FA 2SFPA 3BWWA 4JTGA 1LM1A 2Y7GA 1PTDA 4ZB5A 4FIRA 2TAAA 4DF0A 1GJUA 5CAKA 4XAPA 3R8HA 3TX9A 4IUOA 4V2XA 2P50A 3OGVA 1JI1A 5A2CA 1KBLA 4QR6A 2ZZ1A 4K1GA 5A8NA 4NAFA 3GC4A 3WQ6A 3RU8X 1TX2A 5LIKX 4O11A 3DG3A 2ZDSA 4OFCA 1E0XA 3HBLA 3PF3A 2XHYA 2PGFA 3HJEA 2E6YA 2F38A 1ZQ5A 4ATLA 1H3GA 2WC7A 5D09A 4US5A 1KR1A 4PRWA 3UWWA 4DIAA 3CHEA 3Q45A 5CPQA 4XB3A 1TUXA 1V3IA 2GDVA 1QW9A 3L4TA 2O9TA 3NQ2A 3UG4A 2BOFX 2QAPA 3O16A 4NY2A 3ZQ9A 4PB5A 1XM3A 2OCZA 3V0TA 1SU5A 1JULA 2QDEA 2ZXDA 3FS2A 1OD8A 4GVIA 1W37A 4P8WA 2B4GA 1X1HA 1IF2A 3EMZA 2OT1A 1RSCA 3CL7A 5HXMA 3WUEA 2C71A 4RDYA 1E9ZB 5BRPA 1GYMA 5BOFA 1EPVA 4JKMA 4FPSA 4J3XA 3VUPA 1PIIA 1VFFA 4Y9OA 1K70A 3N12A 1N8FA 3EBVA 5BOOA 2V81A 3KTCA 4C1LA 2O9OA 2CWXA 3BOXA 3ME3A 4FX7A 1XG4A 4O10A 1P43A 3LK6A 1R6WA 4U31A 2QF7A 3FGCA 4FXFA 1C9DA 2D2JA 1BQCA 3K4DA 4YS1A 2BGQA 2Z1XA 4O12A 2Y2WA 4S3JA 1QI3A 2AOSA 1LWJA 3LHZA 1KR0A 2ACQA 2ASHA 2DEPA 2V5CA 4C5YA 3H55A 3LMYA 4IGHA 1E0VA 1UA7A 4YTQA 2A79A 1H62A 3AS2A 3BTNA 4KQNA 5B7YA 1MEIA 2E9BA 4UWMA 4F0LA 2WB5A 2CLHA 4DUOA 4NJJA 1QVBA 1R86A 4LV4A 1JF5A 1AZ1A 4XUGA 1UD8A 4FOKA 3MUIA 2AQOA 2VEMA 3IGSA 2FKPA 4IX0A 1KV8A 4HPHA 4Q8WA 3HV9A 1TPFA 5DCBA 1TPUA 4OVXA 2NWRA 4REQA 3CU2A 3DUGA 2E24A 3LHWA 3KTXA 4R85A 3T4WA 5D33A 4U5IA 1C8YA 4GLEA 1O60A 1EA0A 3F4NA 2PF0A 3ABRA 2F6KA 4L9YA 2CU0A 4NG3A 5HDRA 3P60A 4KS0A 4A8LA 4MJMA 2BHZA 2CFFA 2ZKMX 1BVNP 3ZR4A 3RG6A 4X2PA 4UMBA 3O3RA 3OOQA 4F3HA 3WZ0E 2WSYA 5I0DA 3NG3A 4AHPA 3IV3A 4R53A 1LT8A 3NJ3A 3B04A 4NKCA 4HHPA 2G5WA 4C7DA 1EL3A 1OFQA 4BK9A 4WOZA 1I2NA 2WK2A 4GQBA 1DORA 1QU4A 1ALDA 4S1FA 4PUKA 2V6AA 5EY5A 3T7VA 4PGLA 1ZBWA 4R9XA 3QXBA 1W1YA 1JYXA 2Z2AA 3BQ5A 2FHFA 1IXOA 4RZ5A 1EHNA 5GJNA 1ENUA 5A95A 2VNCA 2Z7KA 3CEPA 1FTXA 4UTFA 1LLOA 3CMGA 4PFMA 5DBUA 2Y85A 4PMRA 3WBAA 3QMTA 5CZTA 2OQHA 3NSXA 1IV8A 3DFTA 1QFEA 2CHNA 2IQ0A 2X8RA 4E3VA 2DIKA 5JIWA 2E3ZA 1W5QA 1X1NA 3HO8A 3OG3A 3IT6B 2ZX5A 4TV5A 2YBUA 5FOOA 3A9BA 1EXBA 1VYRA 3EEGA 3H26A 4GUJA 3VD3A 1US0A 2VDIA 2XM1A 1BVZA 1QASA 1RLCL 2HDJA 2QR6A 2Y88A 3BARA 4NX0A 2DT1A 3GZAA 4Q4PA 5JU6A 3IIZA 1FP9A 3TN3A 4PTWA 5CSSA 4H1ZA 1SFJA 4TXEA 3TYCA 1QI0A 3UZ5A 2Z1KA 1RV8A 4MKSA 4L80A 3VUSA 4MNJA 3W9ZA 3G24A 3SM0A 4B5UA 4YMZA 1IGSA 2VC5A 1TIWA 4FO4A 3EOLA 3MW7A 1W3YA 1N8WA 1DWGM 4AC1X 1EJXC 4NRRA 1VFMA 1QBBA 3GXMA 1H2JA 4GJ1A 4NP7A 2NQJA 4CQ9A 3DZ1A 4IM4A 2PTZA 3ARYA 3GIPA 1R9YA 3GR7A 2DJXA 1KNWA 1VFHA 2ZTJA 4CU8A 3RGTA 3KL0A 1AD4A 4PMUA 3UR8A 3GXDA 2V3GA 1W3NA 1AA1B 1OX6A 1JCXA 4HCLA 4QG9A 2V2CA 4IIGA 3MO7A 1UW9A 3TQPA 3I7RA 3CZGA 2E1WA 1F3XA 1P0BA 1QHOA 3B8SA 2R82A 3W2KA 2YDAA 5C7HA 2CLEA 1P1MA 4ZO8A 3NDZA 4ICCX 1XLAA 1LG2A 3UZXA 3KBUC 2WBKA 1T96A 1WUEA 3IIVA 1H7WA 3WFAA 4KKXA 1WQ5A 3PB2A 1P7TB 5HMFA 5U4NA 1ME8A 2W27A 2BDQA 4K7YA 2FB2A 1V6UA 5C70A 3LRKA 1XQLA 3W72A 1JUEA 4M7SA 2GQAA 1FQ0A 1QJWA 2BY1A 4RPQA 2QCDA 2DPEA 4BWLC 2NQZA 4GZ7A 1O0SA 2X1SA 2OOGA 3NZRA 2OT0A 1DHKA 2XSAA 4G7EB 4UUIA 1XLIA 3S5SA 1UJPA 1H7PA 4N0RA 3TYEA 4LSBA 1JPHA 1PKNA 1DP0A 4AZ6A 2CZFA 1JZ8A 4G8TA 5LSMA 2I14A 4TVDA 5AFDA 1J0NA 3E38A 2VKZG 3APYA 1NELA 4JNZA 1IGWA 3THUA 4GK8A 5I3KA 3JW7A 2V3FA 1OX4B 1AJZA 4JICA 3PZUA 4UQBA 5K4XA 5EBUA 3VE7A 2WV8A 3ZLFA 3GXNA 4BY3A 2MNRA 1QK0A 1QCWA 3HG3A 2CWNA 5KMYA 3NO1A 5HUOA 3K30A 3HQ1A 3E49A 4EANA 1MW2A 1Z9AA 4RDVA 4A2SA 3NXLA 3QMSA 2J9XA 2VWTA 3P0WA 1NM9A 2ISVA 1ZAJA 3VKAA 1FDZA 1V5XA 4RNHA 2BGNE 3KBVA 1BKSA 5CKSA 4HA3A 2WLZA 2A7NA 1Z41A 3C0JA 4HOWA 4CKQA 1CX9A 1JPDX 2A3AA 4E8GA 1B3YA 4ERIA 1CECA 3M47A 2GVJA 4TMCA 5CAHA 2HCVA 1OG6A 4W84A 1S2UA 4L64A 4HPGA 1BF6A 4QXIA 5HNRA 2B0MA 1HL9A 3HGRA 3UXIA 3AFBA 3OEXA 3GR4A 4XZHA 2GPTA 4HB7A 1QR7A 1G01A 5JBFA 3M0XA 2E6AA 3SURA 2OELA 4XD4A 5A6BA 1XGEA 3TXZA 4PCTA 4B92A 1GQKA 2EHHA 3KWXA 1CB7B 3UXAA 4X22A 4ACZA 1GW9A 5D8WA 4HU8A 2I9EA 2CLPA 2F9RA 2Z24A 4AU0A 4DEFA 3UGRA 2FJUB 3AU2A 4N9EA 3NAVA 1F7BA 4M5PA 5RUBA 3S5ZA 3P2VA 1LLZA 2A3LA 3SGUA 5XIMA 1EDGA 1UD2A 1DKWA 1YMYA 1JZ3A 2D20A 3L2MA 4U10A 3E5BA 3QLLA 1THFD 2WYSA 1F2JA 3QN3A 3SZ8A 1MUMA 4K37A 3GNXA 3QOMA 3GU2A 3H4WA 4ZO6A 2YOCA 4C5ZA 1R7AA 3WH5A 5C8BB 1MRAA 3NGJA 2IKGA 2QLYA 1EEXA 2C15A 4LYQA 9RUBA 4GZJA 1MW0A 2PP0A 3VGBA 3F2CA 3BDKA 1RWHA 2VL4A 5HPCA 4YVVA 1XIDA 4AF0A 1PX4A 4LS0A 3EWYA 3EWXA 2D2OA 4A8RA 2ZVIA 1YHTA 1KFEA 1MUCA 3NUKA 4QQ3A 3NQ6A 1RALA 4H2CA 1BYAA 1R85A 4FS9A 3N14A 1EX1A 3VXGA 4E2VA 1JAEA 5DBTA 1GW1A 4ZODA 1LXKA 2VFHA 5D38A 4B91A 2C0HA 2JEQA 4H3DA 5CC7A 2AKMA 2D2GA 2VX5A 3RJXA 3WEMA 1V6YA 4OV9A 3CV6A 3S9ZA 3OGRA 4IFKB 1V0MA 1VRDA 1A3WA 4IHCA 3B97A 3HJZA 4LQ1A 1IEVA 4OUEA 3STGA 3CYJA 4MYXA 1PTAA 1VLWA 4AWEA 1XFBA 4GXPA 4EE9A 2EPHA 1ITUA 2QULA 1A5UA 1UPPA 1PDYA 1N7PA 4BEUA 3DCPA 4UNKA 4MWAB 3SUTA 3DECA 5C71A 1NOFA 1Z69A 3UJSA 2POZA 4B9YA 1WKYA 3MI6A 3KX6A 6ENLA 1MXSA 4IGSA 2PZ0A 2ZCGA 4N9DA 4IXHA 3P82A 5H2ZA 6XIAA 4RNFA 1IQ8A 4DNMA 4GYPC 1UOZA 3LLDA 3U4FA 5ABFB 4DI9A 1EDQA 3P6LA 3B9NA 3M5ZA 1XQKA 3MI2A 3WH7A 3HOJA 1LF1A 2PDYA 4NNAA 5DANA 1PWMA 2O55A 4W4QA 2PMQA 3B9DA 3SB0A 3AHVA 1Q6GA 4L7ZA 4AYGA 2Q8LA 3SJ3A 4CEUC 4CD4A 1KFBA 4IPJA 1G7VA 3W2NA 1VPQA 4KEMA 4G9PA 3N11A 5C9XA 2PRMA 4PMQA 2ZXAA 3GAYA 3OZOA 3ITTA 1XW8A 1QNSA 1CLXA 4DXXA 1L2UA 3NXFA 1GK8A 1ONWA 1E6NA 4V15A 4O15A 5CPNA 1V6TA 2RDWA 1RA0A 5FF0A 4LWWA 3NURA 5ECVA 3VDGA 2CXGA 4OE7A 4QLJA 1XS2A 3VMPA 4YYFA 1S5TA 3HG2A 1M04A 3CL8A 1ESWA 1TPH1 3A9IA 3GFXA 1B1YA 4R33A 4EPDC 4PYSA 2JKAA 3PZTA 4A21A 1DWJM 1JPMA 1FFQA 2FZMA 2OYMA 1DTNA 4Z1DA 2E77A 4RW5A 3O63A 3S9YA 3S9IA 2PSNA 3O8AA 3LGDA 3QF0A 2BOGX 3VCRA 4CD6A 2P76A 1VD6A 1E43A 3DI1A 4UR7A 4PMOA 3M43A 2NVCA 1GKRA 4NQ1A 3N3MA 4PA8A 3WL1A 4H41A 1V03A 2VZSA 3ELFA 2XISA 5GNYA 3KVMA 3QHNA 2OXNA 3UPMA 2X09A 5A8GA 4ZO9A 4IJBA 1TJPA 4IT1A 2J7GA 3AIVA 3R0KA 3L4ZA 1Q7ZA 2E5CA 3T78A 4AIBA 4IQDA 1RVKA 4WLCA 1P6WA 3GNPA 1N55A 1TRDA 4B4FA 1Q8JA 3S47A 4TR9A 1EBHA 1KD0A 1HO1A 5CPOA 1IEWA 4ZO7A 4ILSA 4H9YA 3GHSA 3CT2A 3VI2A 4IFOA 4B3LA 4FA3A 1UR1A 2OSYA 1TQXA 2P53A 1KTCA 3TC6A 3OVQA 3VPLA 3M5XA 3NQAA 4US6A 4WVXA 1FH9A 1RZMA 4PTXA 3VMOA 4J3VA 4A29A 1XYZA 3VNJA 2EG7A 1KC7A 3W81A 1TJRA 1HVXA 3BGJA 1HN1A 4P7OA 1XI3A 4JFTA 3FCPA 2DT0A 1CWYA 3RPMA 1I1XA 4Q8VA 1HNYA 1J0YA 2EGZA 3WLMA 4DXVA 1KBKA 3E2VA 2QCDB 1E55A 3CH9A 3NM3A 5DRIA 1JZ7A 1H61A 4AQLA 1TPEA 4CGTA 5AHLA 4HTYA 3PTQA 1DWIM 4ASTA 1E0WA 4C6OA 1EGVA 3FNDA 4QG8A 3DYPA 5EMMA 1Q5MA 1O95A 1UC5A 4O14A 3KL5A 4PBFA 4HSOA 3E2QA 4AY8A 2CYGA 3FX4A 3D3FA 4QIUA 1XPYA 2TRSA 4CQBA 2EBNA 2FVMA 3WF3A 4V27A 3AIQA 1D7KA 2J7FA 2JALA 5AYYA 3VIHA 1QNQA 2WHMA 3BO9A 4WUIA 2PDKA 4E4PA 2NVDA 1YX1A 4P7NA 4KH2A 4B2DA 3LTYA 2HV5A 1AK5A 1YDVA 3BW3A 3S1WA 3DYMA 3TYZA 1GOOA 1Q3NA 2JF6A 2FZNA 4BF7A 1PBGA 2VHLA 3O0FA 4W86A 5FEWA 3KP0A 1YDOA 1FXPA 4JD4A 1J0HA 1J10A 1XIJA 4OBTA 3QPZA 2ACUA 3MUCA 4GE8A 2ZX9A 1UKSA 3FSUA 1U1UA 1Z32X 5IRPA 3VZXA 2GSEA 3GW0A 3OZPA 2BZNA 2B7NA 2OVLA 4IGNA 3UYIA 4YNGA 2XDFA 4DXKA 1J0JA 3S1VA 4EX4A 3EXTA 1SUXA 1Q4NX 1VFUA 4PC8A 1QATA 2YFOA 2QJMA 2ZTKA 1X38A 3G5EA 1TUFA 1UIPA 5XINA 2YXOA 2CLIA 1F3TA 3C4UA 3MP4A 2XSXA 1NH6A 2OLAA 2WJZA 4L1XA 2UY5A 3NVDA 3AYTA 1Y5WA 1VAHA 1BAGA 1PS9A 5U7SA 1WV2A 7A3HA 5FEXA 3W7CA 2WKLA 3I7QA 4K8EA 9CGTA 2OODA 2W79A 2ZRYA 4DAFA 5HPOA 4W93A 4DO4A 3TC3A 1CXLA 3B8WA 4Y6GA 2QJNA 3BANA 2QT3A 3QR0A 4JIHA 2VGGA 1W5PA 3N2BA 3BCFA 4MMWA 1GVQA 3FYPA 2VOTA 5CCZA 3RLGA 1YQ2A 1W9PA 4D6CA 3H21A 3PJTA 3U57A 1KCZA 1R30A 3T07A 4QAWA 3UYCA 4Q8UA 4WIWA 5F2GA 4GQRA 1XJBA 2YCIX 2YB1A 3GVWA 3VD5A 1BHGA 1KBIA 4H9VA 2NV9A 1YDYA 1H1YA 1VIZA 4MVAA 4PRTA 1H7XA 1ICSA 3MI3A 1JYNA 3ABXA 1RW9A 3OBKA 4DJEC 3RX2A 2RH9A 4RV8A 4B3ZA 3ITCA 2L5HA 3N25A 3H23A 1J93A 3L5MA 1D8WA 3AYVA 4DY1A 1H51A 3W25A 5E9AA 3N4AA 1XLFA 3LV6A 4XZ9A 3QV8A 1Y5VA 1RK6A 1B2YA 4JTIA 4LU0A 4UTMA 3E12A 5FEPA 4CUCA 1DE5A 1BRLA 2QCNA 1XR2A 1UD3A 4P8VA 1WXYA 2VX4A 3HFTA 4IPNB</