2WMKA

Crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae sp3-bs71 (sp3gh98) in complex with the a-lewisy pentasaccharide blood group antigen.
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
582
structure length
572
Chain Sequence
VDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTANYWIWANDIENKAADYLKVSAKNGGYFIWAEQNNGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Differential Recognition and Hydrolysis of Host Carbohydrate-Antigens by Streptococcus Pneumoniae Family 98 Glycoside Hydrolases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 216
structure length 572
sequence length 582
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 2wmkA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wmkA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 2wmkA02
5FIPA 5AYIA 3PZMA 1BPLB 3EMZA 5KZ6A 3MU7A 1R7OA 3WDRA 3JUGA 2XSBA 1EO7A 3G6LA 3WNKA 5GPRA 2WSKA 4V27A 4URIA 2E8ZA 1J01A 3N11A 3MKKA 4S3KA 1ZL1A 3ZMRA 4PMXA 2BY0A 4Z2JA 1OD0A 4WSJA 2XTKA 1VEOA 1ZBKA 1XYFA 2F8QA 1MXDA 3BAKA 1KWGA 4FF5A 1GQIA 4CU8A 3NYDA 3ARUA 1W32A 1F9GA 1GQLA 3G6MA 3ARSA 4J3UA 1PX4A 2XVNA 3WBAA 4LGXA 4PCSA 4PMOA 5ECUA 3U5UA 1RWFA 4QLKA 1JAEA 1UD6A 4HPHA 1MW1A 3CLWA 3VD7A 4M24A 4HOXA 3ZR5A 1PZ3A 2E40A 3CZJA 5HOSA 3ZT5A 3AIWA 3WDPP 2YBTA 1GW1A 4M82A 1R87A 3ECQA 1HMUA 1EDGA 3VVGA 1QI4A 2OSWA 1DWJM 2GJXA 5HXMA 3FAXA 4LYPA 1J0KA 1SMAA 1NWRA 3CHEA 4GPNA 5D9PA 1C92A 4WLCA 1FOBA 4K68A 2G3JA 2CBVA 2VVNA 1OINA 2DDXA 4A4AA 4GI6A 4M80A 3SUVA 1BQCA 4W89A 3IANA 3CBWA 3VGGA 1H1NA 4H8VA 4ML4A 3DYOA 3PZQA 4UQEA 2OYKA 1AQ0A 1BVZA 3EBVA 3VX1A 5I78A 3GZAA 4OKDA 2VL4A 4HMCA 5E09A 3SCOA 2WVVB 2G8ZA 1FHLA 2VX5A 4HU0A 1V3HA 2WB5A 1V6UA 3VGBA 3WDIA 1CXIA 2Y8VA 5DMYA 1I1XA 3W37A 4X0NA 2J7EA 2YOCA 1MWOA 4GIAA 1WE5A 3EDEA 2X0HA 5DO8A 1HM2A 1ISZA 1LL4A 1H41A 3RMEA 5BXRA 1H2JA 3MUIA 3KL0A 5D9OA 2YA0A 2ESCA 2C0HA 2V38A 3DECA 1JXJA 2DIEA 2YBUA 4AZBA 1J0MA 2CYGA 1O6IA 5DT7A 5JBFA 1P6WA 4OUEA 1VAHA 3VD9A 1N7PA 1EOMA 1Z32X 2F2HA 2QMKA 4W7WA 3SCWA 2W91A 2Y2WA 1I75A 2FHBA 4CN1A 1BG4A 1C7SA 2WHJA 1RWAA 3AZTA 1E0WA 6CGTA 3PZ9A 4UFKA 3VINA 2XFFA 1VEPA 4WK9A 3RPMA 5DF0A 1UQYA 3PZUA 2DQXA 4JKMA 3VMPA 1B0IA 1KR0A 1M7XA 4U31A 4DWSA 1VF8A 1OGBA 5IHRA 3DC0A 1W9DM 1PX8A 5ABHA 1V6VA 3IK2A 1EQCA 1K9TA 4HOWA 3F5KA 1CXLA 1Q6CA 4AZHA 3UEQA 1QBAA 3PZNA 5D9MA 4CCDA 1W3HA 2WW5A 1E4NA 2ZUTA 4J3WA 5CQ1A 3BXWA 2E9BA 3BMVA 3GXIA 1H11A 2D24A 2WMIB 3WIJA 4H7VA 1Q6FA 2CITA 1VFOA 2ZOXA 4W7VA 3WQVA 3N12A 1E6SM 2WMGA 1KFWA 3SURA 3CTTA 1TVNA 3FHQA 1C8XA 1WP6A 2C8NA 3HU7A 5JBEA 6A3HA 3BAIA 1M03A 5CPQA 3UG3A 2CEQA 5EFFA 1KCKA 5CPSA 1CYGA 4PUDA 4BS0A 4UR9A 2NT0A 2BXZA 1JZ6A 1UR8A 3PHAA 3TTSA 4M8UA 1C3FA 2V3GA 2JEQA 2ZX9A 3ZT6A 1QPKA 1UKOA 2J7CA 1ISVA 4AYSA 1F1SA 1BF2A 1C90A 1HP5A 5IHSA 4UFMA 3VIHA 2DT0A 3OGRA 4EANA 2BY2A 4CU7A 1BFNA 5E6YA 4ACYA 3E1F1 1JXKA 4TX6A 1ZB5A 4M1RA 1NOWA 2JALA 3SEPA 4A3HA 4D6CA 1XD1A 2D22A 2ZX6A 5IFPA 4CD6A 7CGTA 5BXTA 2Z1SA 3PZOA 1W91A 1WAWA 2BNJA 2GK1A 3CUJA 4GO8A 1VEMA 4CCCA 4JFWA 4P8XA 2DT3A 2DT1A 4ACZA 5A6KA 3VILA 4QLLA 4FK9A 2J7HA 3K8KA 1IZKA 1GVYA 3CUFA 1B31A 4GZJA 1VIWA 1FP8A 2ZXQA 2WZEA 1JNEA 3NIYA 4GZIA 3LMYA 1QBBA 4JFUA 1GOKA 2ZWZA 5HNNA 2EPKX 1HF6A 1YHTA 1EHNA 2D1ZA 3RM4A 4U33A 2JEPA 4DUVA 3BAXA 1HX0A 1HIZA 2WDAA 4NRRA 4P7RA 4F9DA 3UCQA 4RE3A 2DEPA 2V3EA 3ZT7A 4QCEA 2GDUA 1JZ7A 4J3XA 3BCFA 2FH6A 3T08A 3MANA 3SCRA 5FL1A 2W67A 1HJUA 4W8BA 2DIJA 4TVCA 3OLIA 3CHDA 3FXYA 1WDQA 3WF4A 3VIIA 5IFTA 2V3DA 1MQPA 1UWSA 1KXHA 1D2KA 3F5LA 1JYXA 1ZU8A 1OGGA 3NSNA 1HN1A 2BVDA 1HJVA 2PBGA 2WHMA 2E9MA 2X8RA 2CKSA 3SUSA 2V5DA 1E1EA 4M56A 2VZTA 3KEHA 3W4RA 1J9YA 4AZCB 1G0CA 2XFRA 2PF0A 3MUAA 1OJNA 2XWDA 2CESA 2W92A 4JFTA 3PZVA 3RCNA 4J7RA 1BTCA 5C70A 1U2YA 2VRJA 4AD2A 4P8WA 1AQHA 5JUVA 1VJSA 2WVUA 4JL2A 1B90A 4ZXOA 1J0HA 2XIIA 3FW6A 4Q22A 1JDAA 2PWFA 3QHNA 5A95A 4CGTA 1TA3A 2UY5A 1Q6DA 4DM2A 5LA1A 1C7TA 4PMDA 1BYAA 5CLWA 4KGJA 2VCAA 1CDGA 3CZ8A 4CD4A 3L4VA 1XH2A 1CPUA 3L2LA 4MDPA 1H5VA 3CZKA 3CMJA 1UZ1A 4CN6A 1VFFA 3CPUA 2NW0A 3OZOA 2EPMX 4PMNA 2YL9A 2VRQA 4JFVA 4W8AA 3W81A 1HP4A 2PB1A 2DT2A 1NP0A 4AZIA 1EIBA 3OZPA 2WVTA 3AIBA 5AC5A 1XV8A 1CGWA 3THDA 3FAWA 4RE2A 3WQ8A 2E22A 2ZUSA 3WDHA 4NSBA 2YLAA 2VX4A 1US2A 3B9DA 1NARA 1V6WA 2CETA 1LQ0A 1NM9A 4JCMA 3PTQA 4TVUA 4HU8A 1QNOA 1E1FA 7TAAA 4ATWA 4UQDA 1SR0A 1E0XA 2F61A 2J7BA 3ZM8A 1B3ZA 7A3HA 3M6DA 4AZ6A 3TTQA 3BLPX 3LPFA 4OOUA 1LWJA 2ZIDA 4P8UA 1LG2A 4IISA 1XH1A 4GQRA 3WKZA 4PTWA 1UZ4A 1WKYA 2QPUA 3AS1A 3CHCA 3WQ6A 3WEOA 1GQJA 4IM4A 3MSDA 1KGWA 4MB1A 4PYSA 3EMCA 3L4UA 4WJXA 2FGLA 2Y24A 3QOMA 2DPEA 4HMDA 4BZYA 1WO2A 1J0ZA 4B3LA 2CXGA 4JZ5A 4AEEA 4UQCA 3RDKA 4EE9A 1J0IA 3GNOA 3AISA 1NP2A 2WXDM 4L4OA 2ZXBA 3O9NA 2GVYA 1GHSA 3AYSA 3LPGA 3ARPA 2ZX7A 4FLSA 5CG0A 1JDCA 1FA2A 3W27A 3ARVA 5CLTA 5DEZA 3VIGA 5LYRA 1FFRA 5IDIA 2EJ1A 1E40A 1LL7A 1UR1A 4XUYA 1KR1A 1J12A 4F79A 1ODUA 1QI5A 3VGEA 1GHRA 2D3LA 3FNDA 5BCAA 1JZ8A 4AIEA 3VDBA 3A6OA 1WDPA 2XPKA 2D23A 3WH9A 4UZUA 4F8XA 8CGTA 2WSPA 3ARQA 2ZXAA 2J75A 1FH7A 3ZIZA 4W84A 1CWYA 4Z2LA 2Z1KA 1SYTA 3WMSA 5CXPA 4AC1X 1C93A 1OJPA 1X1JA 4DWSC 2MANA 1CTNA 4GI8A 4RL3A 4D1IA 1EDQA 3NSXA 1WZMA 3VNYA 4UQ9A 1V08A 2W5FA 1N7QA 3PZTA 1E71M 2GJPA 4H41A 1F4HA 4J3SA 5GNZA 4PMRA 1TMQA 5ABFA 1CLVA 2ZX8A 3O2LA 3TOPA 4KWUA 4F66A 3K1DA 1MFVA 2VJXA 3UERA 3UETA 2GSJA 3GBEA 1X1HA 2XIBA 4AZ7A 5GQBA 1PIGA 1UWUA 1LXKA 1FP9A 1CGTA 1C82A 3T2QA 1E6QM 2J25A 3ZJ8A 4N0RA 1GNXA 4LYQA 1JNDA 2VZUA 4WF7A 5E0FA 2J7GA 2EPLX 2YDQA 4UZSA 4Z2HA 1H49A 3QHOA 2X2YA 1RP9A 3GNPA 3T0BA 2J74A 1TFVA 3GXFA 5A94A 3W24A 4HA1A 5D9NA 3W53A 1L0PA 3WDQA 4PMYA 2GJXB 3MMDA 5A6BD 1UWQA 3OG2A 4B9ZA 5D8ZA 1ISWA 4EKJA 3EDFA 1HKJA 1CENA 2BS9A 4B3KA 1DEDA 2O9PA 5HBFA 4FLQA 4W85A 4IPNB 1UWRA 1JYWA 2BY1A 1D7FA 1JI1A 5A69A 3WUGA 8A3HA 2VRKA 1B1YA 1VBRA 5D8WA 1OWQA 1G1YA 3ZOAA 1KGXA 1CLXA 3ZSTA 4CU6A 2E4TA 2VQTA 2WMJA 4U2YA 5D4YA 3L4YA 3WL1A 4BQ3A 1V0NA 3B9AA 4U2ZA 2A3EA 3S2CA 3N15A 4EK7A 3ALFA 1EHAA 2CERA 3VOCA 5CZKA 4GQQA 2CCRA 2NSXA 3AYRA 4BF7A 1VFMA 2G3IA 1W1PA 1OM0A 3CUHA 2OYLA 4ZE5A 1VRXA 1W1VA 4J3VA 4PTXA 3ZJ7A 4E2OA 2W4XA 2A3HA 5JIWA 1KXVA 1QW8A 1V0MA 4PSRA 1XCXA 2W63A 4HP5A 3RJYA 4XZBA 1UWTA 1H0GA 4D71A 3TTOA 4UTFA 2ZXDA 3APGA 3GBDA 1Q6GA 2V3FA 4HZ6A 4AIOA 1M01A 1N7OA 2XYLA 3NJ3A 3N13A 1V3MA 1HVQA 1OBAA 3SCQA 5I5RA 2ZE0A 1JD9A 3AHTA 2DSVA 2WVSA 1V02E 3TTYA 4HPGA 1HNYA 4LPCA 3UG4A 1NQ6A 3NSMA 3WH7A 1ITCA 3AIQA 1MW0A 1ZS2A 2VUYA 4DUXA 4PN2A 2WCGA 2WHLA 4MB4A 5A8PA 3EDKA 3MMUA 1ISYA 1EH9A 2OLHA 2WANA 2D0HA 2IXVA 1ESWA 4XV0A 1DWGM 4DWSB 1GZJA 5DFAA 3QHMA 3T2PA 2WLZA 3W6MA 1B9ZA 3IJ8A 3AXHA 1UOKA 2BRPA 2YL8A 1JI2A 5JIPA 1E9LA 1SFSA 2YKKA 1KBBA 4OJYA 4F9JA 2WCOA 2IUZA 3N18A 1CB8A 2BRVX 2CBUA 1KB3A 4UOQA 4JFSA 3WQWA 1EO5A 5A6MA 5A6LA 3WY1A 1CBGA 1J18A 3BAYA 1UH2A 1WZLA 3WQ5A 2PWHA 3TONA 1QHPA 3ARTA 3KZSA 3EYPA 1UR9A 2VOTA 1UG6A 1A47A 2PWEA 4U3AA 2ZX5A 5A2AA 2VR5A 2EBNA 1PX3A 4C7DA 2PWDA 1GOIA 3ZJKA 1UYQA 4JAWA 1ODZA 4W5ZA 3CIVA 1QNSA 1DHKA 5EMYA 4TTUA 1R8LA 2QV4A 2PBOA 1SMDA 3WD1A 5M17A 1N7RA 1TR1A 5CGTA 1HJSA 2HVMA 4TVDA 3ZJ6A 1E3ZA 5GNXA 2FHFA 3MV01 4NZCA 3MMWA 4PUEA 2J8GA 2E0PA 3OIHA 2ZUVA 1CZ1A 3DYMA 5A8MA 3NDYA 4QLJA 1UWIA 1JIBA 1FFQA 4CUCA 1XYZA 2VZOA 4FLRA 2QHAA 1OJMA 5CSYA 1LXMA 5BRQA 4UQAA 1H3GA 2GK1B 1U30A 2BRWA 1W9BM 2XFYA 3BC9A 3UESA 4W87A 2JIWA 3DHPA 1E6XM 4ACZB 3GNRA 1XGZA 3PZGA 4P8VA 2ZUNA 2G41A 3M7SA 2JFEX 4BQ4A 2D20A 2TAAA 3N9KA 4MB3A 5GNYA 1QHZA 3AMDA 3AXIA 2DH3A 3GH5A 5DT5A 3U7VA 4S3JA 5AY7A 1QI0A 4LX4A 1E55A 1GOWA 3WNPA 2ZUMA 3ZR6A 4N42A 1DWAM 4MPKA 3EDDA 1H4PA 3NCOA 2X05A 3GM8A 2BV9A 1N82A 5EB8A 1AVAA 1KGUA 1WDRA 3OA5A 3IJ7A 1HL8A 3QGVA 4XX6A 4PMVA 1R85A 1JDDA 5LA0A 2CHOA 1UKPA 5TD4A 3ALGA 1RH9A 4P7LA 5M03A 1XSJA 1R86A 3UR7A 4NF7A 3I3EA 2J62A 1HKMA 3W0KA 2WKGA 4MB5A 3OLDA 4QP0A 1PPIA 1RP8A 1XRVA 2J79A 1O7AA 2Y4SA 3AIRA 1OIFA 5FD0A 2E8YA 4KH2A 2OYMA 4ATDA 1JG9A 3IJ9A 2A3BA 1FH8A 1QOXA 3TP4A 3BLKA 1QNPA 3W29A 1NOFA 1WDSA 2VX7A 3VM5A 4Q7NA 3AS3A 1GJUA 2GUYA 3U7BA 1TVPA 4W8LA 4D6DA 3AHYA 1V0LA 4DUWA 3WDJA 1WPCA 3VD4A 5ABEA 1IT0A 2VQUA 3A4AA 5HPCA 3WF2A 4QDMA 1TZ7A 4JHOA 4QAWA 4W86A 1E4MM 1NWTA 1VJZA 2J7FA 3SCSA 4BCEA 2WWCA 3AHXA 1BYDA 3AXXA 4TX8A 4E8DA 5CGMA 1NOUA 1UD8A 5I3DA 1GOOA 4D6EA 5EFDA 1CXFA 1JZ5A 3SCUA 4CD7A 3WQ4A 1E72M 1TA3B 3MSGA 2A3AA 4OOZA 3VIKA 2D2OA 2WC7A 3A4XA 2BHZA 3WN6A 1KQZA 1UD4A 3UG5A 3GXMA 2AOSA 4YHEA 4W88A 1VBUA 1XCWA 3KWXA 3WH8A 3SCVA 4U5IA 9CGTA 1BGGA 1E73M 1LF1A 1CGXA 1UD5A 1VB9A 2BVYA 4WKAA 2VO5A 3ARWA 1HVXA 1WB0A 4MAVA 1OSEA 4U3CA 1GONA 4BQ2A 1K9DA 4CD8A 3THCA 1W3JA 2CPUA 2VC9A 1UKQA 3GTNA 3BSGA 4AD3A 3OBAA 4WSKA 4AWEA 4HOZA 1UA3A 3UR8A 2XHYA 3SUTA 3BCDA 4PCTA 3GDBA 1B3VA 1MW3A 1I8QA 1NH6A 2W66A 4AY1A 1JFXA 1BVNP 4HA3A 3WBEA 3LPPA 1ECEA 4D6IA 3VD5A 5BRPA 2WHKA 5HDRA 2YDRA 4JL1A 5FCZA 1LJYA 2FH8A 3AHZA 4QFUA 3ARRA 3POCA 3KL5A 3BMWA 1C8YA 3PBGA 1MW2A 2AMGA 5A1AA 1RWCA 1BSIA 2WCAA 2WYSA 1QNRA 1PAMA 4JIEA 2DSWA 3VDHA 3BAJA 1F4AA 4ZENA 1Q6EA 4AMCA 3CHFA 1DWIM 1PJ9A 3HN3A 3WUFA 2DH2A 3W25A 1MQQA 2YA2A 4PRWA 3VIFA 3WNOA 2VI0A 5FL0A 3BAWA 3ZSSA 3PTKA 2UY2A 1WZKA 2XGBA 1D3CA 4MJ2A 2B31A 3WMBA 4B16A 3VTRA 4J27A 1CGVA 2DSZA 3WEMA 1RWGA 4PTVA 3L2MA 1W2VA 4KGLA 2VCCA 1E43A 5A8QA 4H8HA 1OGSA 4D6FA 1BGAA 1LWHA 3L4XA 1PBGA 4C7FA 3WMCA 1V0KA 1CXEA 3L4WA 1OIMA 1X1NA 3AS2A 3BGAA 1M04A 2Q8XA 3GH4A 3CZEA 3CUIA 4KMQA 4GXPA 4UOZA 2PWGA 1KQYA 1WNOA 3AFBA 5BXSA 2Y8KA 2QLYA 4IUGA 2CBIA 4GINA 2JIEA 1OT2A 3VMOA 3AZSA 1QW9A 1BHGA 1RW9A 3D3AA 4NI3A 1WZAA 3WSUA 3WD3A 4MDOA 1W1TA 1PIFA 3K8MA 1UUQA 2YIHA 5E6ZA 1CGUA 2JF7A 3VIJA 1V3JA 1OCQA 3SCTA 1KCLA 2PC8A 2X1IA 3T0AA 2WKLA 2G4FA 2YLLA 2XWEA 2UWFA 4PMUA 3AZRA 1AMYA 1CXKA 3CZLA 4D6GA 5ABFB 1BYBA 2CHNA 1HJXA 1K9EA 1Q4NX 2EPOA 4H04A 3K4DA 2NT1A 3VDAA 5A2CA 2JF6A 4U5KA 4E4PA 3BSHA 2XGIA 2OWWA 3WUEA 3AMLA 1EOKA 5EBAA 1B3WA 2O9TA 1ITXA 3WUBA 2QPSA 4OBRA 3AJ7A 1BG9A 1EA9C 3PZIA 4D72A 1UR4A 3CUGA 1HXJA 2QMJA 2VTFA 5A8NA 1B3XA 1EXPA 4LQ1A 2E3ZA 3K4AA 1CGYA 1W3LA 3AIEA 5BROA 2VNCA 4XZWA 3BH4A 1RWHA 3AQUA 3GYCA 3OLGA 1U33A 3O6AA 3VM7A 3U5YA 1L8NA 1V6XA 1V3KA 4B9YA 5E0CA 4ZE4A 2WCSA 4AIUA 2XG9A 4PMZA 3POHA 1G01A 1MYRA 2WVVA 4HZ7A 2RGLA 1QI2A 3AOFA 1OD8A 2DGAA 1E6RA 4M81A 3MO4A 3T0DA 4ZXLA 1V02A 1E0VA 1QHOA 3AMGA 2YL6A 3RJXA 3WEZA 2OSYA 3QR3A 4UQBA 5FOOA 1B30A 5CJ5A 2A3CA 1VFUA 4MNKA 5AYBA 5I6SA 4BA0A 3AHVA 1OT1A 5A6BA 4DWSD 4NRSA 4WKFA 1X1IA 1E5JA 5HPOA 2FGZA 2WNWA 1UR2A 4D6HA 2UY4A 1CIUA 4X9YA 2VURA 3DHUA 3T2OA 1N7NA 3KL3A 3A47A 1W9VA 2RGMA 3MS8A 1J10A 1S46A 1W3YA 1JL8A 1OB0A 1HJQA 5I24A 1G94A 2VT0A 2J77A 1ZBWA 2E9LA 1HT6A 3FHAA 4AD0A 5M5DA 1XH0A 3M46A 1W9PA 3WNNA 1TUXA 1UA7A 2HISA 2XM1A 3I3DA 4R27A 2BY3A 1FH9A 3KE0A 2AAAA 5CPTA 1US3A 1J0YA 1UKSA 4M29A 4BQ5A 1XSIA 1A3HA 2DSUA 3W38A 2XM2A 1UH4A 4YN5A 3LPOA 3N1AA 2WC3A 3GXDA 5IXEA 4R5EA 5E9AA 3WD0A 1J11A 4UFLA 2VR4A 2WMIA 2EPNA 1GQKA 3II1A 4L4PA 4Y7EA 2WMHA 3M07A 5A3HA 1TCMA 2VZVA 1AQMA 2XVGA 1WCGA 3ARZA 3AMKA 1JGIA 3FY1A 2D0GA 1KWKA 1PEZA 4TTGA 4GO9A 4HZ8A 2EO7A 1EGZA 1GVIA 3OLEA 4KRUA 1MXGA 1GCYA 2XVPA 1CNVA 5A6AA 3L4TA 3VD3A 4W5UA 2ZWYA 1W3KA 4OZOA 4RE4A 4MADA 1DTUA 5ABGA 1JZ2A 3OB8A 2WC4A 4ATLA 1E4LA 1E6NA 3D5HA 1EQPA 4KRTA 3TA9A 3OGSA 1EDTA 3A3HA 4ZEPA 3N04A 3IAPA 2CNCA 2Q1FA 1UH3A 3SUWA 4TUFA 1TE1A 3EMQA 5AC4A 3K46A 1JYNA 1PZ2A 3WF0A 3SUUA 1W9UA 1V3IA 1HM3A 4AD4A 1NWSA 4LYRA 1BAGA 1GJWA 4H8UA 1ZJBA 1G5AA 3EDJA 1DWHM 2BFGA 3WD2A 1JF5A 4JKKA 4PEEA 2W62A 1E3XA 4MAZA 1X6NA 2FDMA 1GPFA 3ARXA 1UR0A 3ZQ9A 4MNLA 3VGFA 4QCFA 4WIWA 5LA2A 3VIPA 4X0VA 1X6LA 2JE8A 3VIOA 2EQDA 3VX0A 2EEXA 3HJEA 3VGDA 1H0IA 3I3BA 3SCNA 3AIVA 1MVYA 2X09A 3CZGA 2QF8A 3NUKA 3PTMA 4Z2KA 2BHYA 1C91A 3CH9A 1DP0A 1RD6A 1BYCA 5C71A 1IZJA 3RIKA 4H2CA 2D0FA 1E70M 2DSKA 3AMCA 3AI0A 1EGUA 3RM8A 2WMKA 4V2XA 3F4VA 4HA4A 5BYWA 1J0JA 4AZ5A 1HL9A 2OWXA 4AXNA 1J0NA 4P7NA 4MJ4A 2VX6A 1K9FA 3ZO9A 3VPLA 3WH6A 4Z2IA 2WK2A 1CEOA 4CKQA 2YJQA 3SCPA 4P7OA 1GUVA 3CMGA 5KEZA 3MUY1 1FHDA 2BXYA 2CKRA 4CD5A 3CO4A 1HKIA 4J3TA 3AIUA 2WWDA 5C8BB 3VDCA 1ZBCA 2XVLA 3WFZA 5E70A 5CSUA 4YHGA 4FMVA 4PSPA 1Y7VA 3WD4A 3K8LA 4D1JA 3WENA 1MFUA 1W1YA 2PI6A 1E15A 4MNMA 4GI9A 2WMFA 2D3NA 1E56A 1E6ZA 2UY3A 3QOKA 4E8CA 3NDZA 1UD2A 1DWFM 1HJWA 2WPGA 2J47A 1M53A 1UD3A 4HTYA 4AZCA 4MTVA 2GDVA 2O92A 5I77A 4AD5A 2ZUWA 2C7FA 1JYVA 3ARYA 3VMNA 1B3YA 3MUZ1 2ZUUA 4DM1A 2YDSA 1KXTA 4CCEA 2WBKA 3L4ZA 1BLIA 3GH7A 4A3YA 1XHGA 3AROA 4IPLA 1KXQA 3S6TA 3W28A 1ZJAA 5BXPA 2J4GA 4EAMA 3W6LA 2J8FA 4GKLA 4Z2GA 1YQ2A 3WF1A 4HMEA 1QI3A 3F5JA 4UOJA 3FN9A 2GJRA 2WM0A 2WAGA 3J7HA 4OBSA 5FKYA 3WNMA 1OJOA 3PN8A 2ZICA 1JZ4A 1JAKA 1GORA 4GZEA 4J28A 5I2UA 2J78A 3RILA 2WZHA 5JBDA 1LOHA 3WH5A 1G9HA 5A6SA 1ZBVA 1ISXA 2IXUA 4D6JA 4W7UA 4AEFA 2V5CA 2Y5EA 3HMCA 4ZFMA 3W26A 3VGHA 1GOMA 1RPKA 1CECA 4UFHA 2XJ7A 4AW7A 1JFHA 1XD0A 2O9RA 5A2BA 4UFJA 3W82A 3WF3A 2G3MA 2X03A 4CN4A 4TXEA 1LLOA 2J7DA 4C7GA 3AS0A 3VNZA 4FLOA 3CGTA 3VKKA 1HMWA 2WZIA 1E4IA 2VCBA 2W61A 4V28A 4UCFA 1JF6A 4B15A 4W93A 4CVUA 1UQZA 1VENA 1JD7A 2WLYA 4PTMA 1TG7A 1W9XA 5A6JA 1CXHA 4TOQA 5I0DA 5BWFA 2YA1A 2CBJA 2EXOA 3WL0A 1R7AA 1XC6A 1H09A 1HKKA 2WBGA 3U57A 2G3NA 4OIFA 2BHUA 2VVSA 4JKLA 3RM9A 3SIMA 1LL6A 1QVBA 1MQRA 1V6YA 1QNQA 4AZGA 4PMQA 3VUPA 4XB3A 4WKHA 2OWCA 4P7QA 1K6AA 1KBKA 3VO0A 1W2PA 2XUCA 1V3LA 1XSKA 4JCLA 3T09A 1E5NA 4UFIA 3B9EA 3VIMA 3RO8A 3WFLA 4JHZA 2CIPA 3VU2A 1B2YA 2BVTA 2XVKA 3DYPA 1C8QA 1UKTA 5I23A 3AICA 3MV11 3B8SA 3N17A 4PBGA 1JZ3A 1HN0A 4UNIA 3WELA 1I1WA 2YL5A 5M3WA 4LXFA 2X0YA 1E6PA 3A4WA 4AISA 2E24A 2O9OA 5F7UA 3WNLA 2GFTA 6TAAA 4MNJA 5I79A 3IAQA 2FHCA 4AD1A 3OGVA 1UHVA 2XSAA 1GOQA 4YPJA 4CVWA 2VMFA 1IV8A 2OSXA 2VZSA 1V03A 1LG1A 1NWUA 5A8OA
chains in the Genus database with same CATH superfamily
5AYIA 3WLMA 5FJRA 4GX8A 3LMZA 4JTKA 3EMZA 4BI5A 1J93A 4JOMA 4IXXA 3E0VA 4XZLX 3KRUA 1EEPA 4V27A 3CT7A 3GG7A 4URIA 5I03A 1CT5A 3MKKA 4R85A 1SFJA 2FPTA 2Y0FA 2Q3RA 4Z2JA 4WSJA 3A64A 5H6HA 1KA9F 1ZBKA 1XYFA 1MXDA 3BAKA 4FF5A 1GQIA 1RAKA 4C6DA 1UPMB 1W32A 1F9GA 2HPIA 2QGYA 4BR1A 1W37A 3M0JA 4JTTA 1OFRA 4E38A 5D2XA 4HPHA 1MW1A 3CLWA 4DELA 1REQA 3ZR5A 1PZ3A 4F4RA 4CNOA 3CZJA 5E1QA 4GYKA 1J79A 3QKZA 3B0UX 4M82A 3ECQA 1AG1O 4ICNA 3VVGA 2OSWA 4AY8A 1DWJM 4LU0A 2PU0A 5REQA 3G1FA 3CHEA 3NZGA 2C19A 7REQB 4DO7A 4WLCA 2VVNA 1TMHA 1XLBA 4H01A 3VGGA 1R9YA 4L5ZA 4D8OA 3C86A 3PWGA 4AFYA 3M0MA 3ITTA 2I14A 3PZQA 1B9BA 4GNVA 4M7TA 3VNIA 2OYKA 3TJLA 1AQ0A 5I78A 2W6RA 3GZAA 4HMCA 5LIWX 2VX5A 1P4CA 3SY8A 4HSNA 1VCGA 4XSLA 3WDIA 3QLLA 3BARA 3PANA 1CXIA 3W37A 1QJWA 1JUBA 1R3YA 3P80A 1WE5A 1W3TA 1HM2A 4DY1A 1LL4A 5A6TC 3RMEA 4L6DA 2NQZA 4S39A 4ZSTA 4E3VA 4HTBA 4AWTA 2C0HA 1X1OA 4Y9OA 3KVLA 3DGRA 4LS2A 5C9RA 2YBUA 5FJPA 2B0MA 2ZTJA 5JBFA 1VAHA 3SIZA 4NAFA 4W7WA 1I75A 4WDUA 1C7SA 3LI1A 2HV5A 6CGTA 3R7MA 4GQ0A 4UFKA 2ZZ2A 3VINA 2G95A 4NAEB 2XFFA 2X1UA 3QBUA 3M5ZA 3IV3A 2QCMA 4XTDA 2OT1A 2W79A 3A21A 2XIJA 1LYXA 4JKMA 1B0IA 2YCIX 2PFHA 4DWSA 2PDNA 4M5PA 3F2DA 3R8HA 1PX8A 3DBPA 1V6VA 2I5GA 4Y9NA 1IXNA 3DFTA 1XWYA 4AZHA 3SGGA 4Y2WA 4LBUA 4CCDA 1DVJA 1W3HA 3GLCA 2WW5A 3GR7A 5LIYX 4YXGA 4J3WA 5HQLA 3BXWA 3BMVA 3GXIA 1UP3A 2D24A 4H7VA 2YCJA 3QC3A 4MWAA 2V9DA 3L0KA 1D3GA 1NTHA 2BBFA 2WJEA 2Q8LA 5I02A 3CTTA 1TVNA 3Q2DA 3FHQA 3NZPA 2BWGA 1KM2A 5JBEA 1D8WA 5JH1A 1W5QA 3BAIA 3W70A 3CYJA 3PWAA 3M6YA 3QMSA 1ONRA 1KCKA 4EXAA 1CYGA 4PUDA 2XINA 1M1BA 1S5TA 2NT0A 3UWWA 3NQAA 4PTDA 1A49A 3INPA 4GZ7A 1KM5A 4C6NA 1EA0A 1VBHA 1ONEA 1DV7A 4S3DA 2ZX9A 1QPKA 4AYSA 4IPIA 1C90A 4F0MA 3HQ1A 3OGRA 4EANA 4UMBA 2V2HA 5IDZA 3M0XA 4CU7A 4ZTYA 3E5BA 4BI6A 3E1F1 4V1XA 1ZB5A 1XPYA 2JALA 5CPLA 3EWZA 2D22A 1KD0A 4J40A 3ZYZA 2IS7A 2FKPA 5BXTA 3H26A 1NY1A 1O95A 1W91A 2BNJA 3VUSA 4M6QA 2GK1A 2R24A 3GAYA 3S47A 3LGEA 4JFWA 4XZHA 3R89A 4B5NA 2BXVA 3OVQA 1K1DA 4QLLA 3W7QA 3TE9A 2X2GA 1RK6A 1M68A 2GGGA 4IIBA 2ZXQA 5F2IA 1LOLA 3N29A 4GZIA 1GOKA 4LAOA 1EJ7L 1YW1A 3TN6A 3RM4A 4U33A 1ZGDA 3V5OA 1GVSA 2GSHA 4S2CA 5BOOA 2WDAA 3GXTA 4QCEA 1KBLA 1R5YA 5FL1A 2Q09A 2W67A 4W8BA 3CQ0A 5BW6A 2ANUA 4WY0B 2FVLA 3OLIA 3UZZA 4HCDA 3O1NA 3P67A 3WK2A 1M7OA 3TR2A 3S83A 2J9ZA 1F3EA 1MQPA 1D2KA 1TJ1A 3LUTA 1OGGA 1XIDA 5A5WA 5BU6A 4O1EA 2X8RA 2CKSA 3SUSA 1E1EA 2OFJA 3W4RA 2GOUA 1KNWA 3O07A 5I3JA 3WLQA 3MUAA 4HYWA 4HVXA 3CYVA 4RDVA 2ZA2A 3PZVA 4NASA 4J7RA 1BTCA 3E38A 1U2YA 2VRJA 3CEUA 5LXXA 3LZ5A 3S0CA 2P50A 3FW6A 4FXRA 4Q22A 4QJ4B 3QHNA 5DMNA 3LB0A 5A95A 1MSSA 1TA3A 2REQA 2I16A 2UY5A 1QOPA 1TWSA 1PSCA 4LBRA 3FS2A 3S2JA 1FWNA 5CLWA 4KGJA 1CDGA 4C65A 4GNJA 1L6SA 2F84A 1H5VA 3CMJA 1CCWB 4LB4A 1WYIA 1VFFA 2PWUA 3K2GA 4IL2A 4YTQA 1SZRA 1U22A 4IIEA 4NIRA 1FDZA 3OZPA 2XN2A 1XV8A 1I60A 2WSQA 1XBYA 3FAWA 3S9IA 4RE2A 1YE6A 5KITA 5AFDA 3B9DA 1A5KC 2Y7DA 2CETA 1LQ0A 1EFZA 4O4VA 3PVFA 1K6WA 3D0CA 1QNOA 3G1RA 3LTYA 1W5OA 1XLFA 2OMAA 3RPTA 1Z41A 1B3ZA 4ZOCA 7A3HA 1Z89A 4AZ6A 2EGZA 4OV4A 2J6VA 3GXNA 2ZIDA 4FOUA 4RCXA 1Y5VA 4GQRA 3WKZA 5KINA 5AYYA 1EBHA 3HQOA 4QDPA 4DI9A 4H1ZA 3AS1A 1E0UA 1VBGA 2PLKA 3EMCA 5AHIA 3L4UA 1C8VA 3BLIA 5LKYA 2VEFA 4HJFA 1KW1A 2DPEA 4HMDA 3H2NA 4KEMA 3V16A 5GJMA 4EE9A 1J0IA 4ONVA 3BANA 3DH7A 2GVYA 3AYSA 4WSHA 4ERGA 4C91A 1I0BA 1FA2A 1XW8A 3ARVA 5CLTA 5DEZA 4OTKA 4WD0A 4G1KA 5IDIA 5AECA 1E40A 1Y5WA 1DORA 2F6UA 2HWGA 1QPRA 1UR1A 1KR1A 1J12A 1TZZA 3N6JA 2R8WA 4RXFA 1X8CA 4X9SA 1UWAA 1VS1A 4PB3A 3NQ8A 1XKJA 2V2CA 5CZTA 3PPFA 1QTWA 1I2NA 3FJ4A 2X0SA 2QAFA 4YU1A 3PUEA 4Z2LA 2QF7A 2Z1KA 1F61A 5AN7A 1CTNA 1ALDA 2HROA 4GMEA 4R3UA 4FX6M 4RL3A 4HA0A 1T41A 9RUBA 2YZRA 2ZDRA 1TE6A 2GJPA 4H41A 1F4HA 3IIXA 4F66A 4MMWA 2VJXA 4G7FA 4Y90A 3UERA 1JQVA 3S2NA 3V1PA 3GVQA 3G0XA 3GBEA 1YPFA 4ADUA 1S38A 3HA1A 3UXLA 5GQBA 3PG8A 5EPDA 1PIGA 1LXKA 1FP9A 1C82A 4N0RA 4ZFCA 3O7UA 4Q7IA 4H8NA 3KBTC 3VOGA 1LORA 4HQVA 1JGMA 5E0FA 1ADDA 1Q8AA 1R2SA 5M2FX 4AHPA 1REQB 4Z2HA 2E28A 1H49A 2NX1A 3UD6A 3VOIA 2VD9A 1RP9A 2QR6A 3T0BA 3TQ0A 2C71A 4IT1A 4HA1A 5D9NA 4A8RA 3UNTA 1UWQA 3WJYA 4LS0A 3EB4A 5D8ZA 5REQB 1CENA 1HKJA 4C6CA 3E74A 2AKZA 1JYWA 4GGHA 3KBMA 3WBXA 1Y65A 4GIEA 1KM3A 1TX2A 2PC4A 2VRKA 3LRKA 1VBRA 1SO4A 1SZEA 3GX9A 3SFKA 1G1YA 1F5ZA 3VOFA 1SSGA 4C6OA 2VQTA 3A24A 6PTDA 1P6CA 3B9AA 2A3EA 3N15A 3ALFA 3OYXA 3DG3A 3R13A 4GQQA 2CCRA 3R0DA 2NSXA 4BF7A 1O5KA 2FVKA 3CUHA 2NV2A 3TYBA 3QR8A 3QSTA 4Y6GA 5T26A 4E2OA 1N8WA 3IRSA 4HP5A 3NFUA 3P0XA 3LDVA 4C6FA 4Z1BA 1OZMA 4UTFA 3OBKA 3F7JA 1ZSXA 1PE1A 3PSVA 3C2VA 4B3ZA 4HZ6A 2XYLA 1N7OA 3NJ3A 1V3MA 1AODA 4NAFB 1C29A 2DSVA 2WVSA 4UTMA 4N2YA 2H90A 3TNBA 4B5SA 4W9TA 1HO1A 1RV8A 1NQ6A 3WH7A 5FJIA 1ZP4A 5G1MA 3D3FA 4PN2A 4MB4A 3WLTA 3EDKA 2OLHA 2F7FA 3TYZA 2D0HA 1QUMA 1DWGM 3M5VA 4O8AA 1KCXA 4DWSB 3EA3A 1O60A 2WLZA 3W6MA 3IJ8A 3HO8A 3GFYA 3XIMA 2V2DA 5JIPA 3RGTA 1KBBA 4OE7A 3LYEA 4QRNA 5J5DA 5AZ0A 1PO9A 2BRVX 1RR2A 3L5LA 3IWPA 3WQWA 5A6MA 1H7RA 3WY1A 3BAYA 1YDOA 3VNJA 4GXMA 1WZLA 3W9ZA 4MWAB 3TONA 3LCIA 3ZWTA 5KETA 3G1SA 3ARTA 4F2UA 3CO8A 2GLKA 1TUFA 2E25A 3W2JA 3HURA 3UPBA 1GOIA 1S3HA 3I7RA 3QY6A 4S3FA 3T8QA 3UWZA 4PR4A 1DHKA 2E77A 1HZYA 1R8LA 4OT7A 2PDBA 1SMDA 3IIVA 3KDNA 2G97A 4RV3A 1WDDA 2SFPA 4U4MA 3KLKA 4DO5A 5CC5A 3UPMA 3CQIA 5E5CA 1W5PA 3LRMA 1XIJA 3DYMA 4ROQA 1VP5A 4QLJA 3TTEA 2Z6IA 4IP4A 1FFQA 2RJGA 2NQJA 3JZEA 4CUCA 4L9ZA 1OJMA 1LXMA 5BRQA 4NX0A 1XLJA 2O7QA 2GK1B 3TN4A 4GI4A 3KTSA 3W2UA 3MP5A 4F0LA 3UESA 3O05A 1W1ZA 2JIWA 1E6XM 3UA4A 5JQ9A 4P8VA 1PTAA 3M7SA 1I2RA 2D20A 1P43A 4L61A 3N9KA 3NPXA 1YEYA 3AMDA 2VEMA 4KEZA 2DH3A 3GH5A 1XG4A 4DPPA 3U7VA 3TCEA 4MUZA 2Z6JA 1VRDA 3MA8A 4N42A 5F2GA 4MPKA 1F8IA 3NCOA 3T81A 2NVAA 3HPSA 4JIHA 3RYSA 3MCMA 5EB8A 2BX7A 2HS8A 2P3EA 1RBAA 3XINA 3B8WA 1YX1A 2XU2A 3QGVA 2HXTA 4XX6A 1JDDA 5LA0A 1UKPA 1VBJA 5TD4A 5HA7A 1KTNA 1JPMA 2BGNE 2JGYA 4QG8A 2GQAA 2WKGA 4MZ1A 1VFTA 2R1NA 1CB7B 1OIFA 4WZHA 3WFAA 2PRMA 4ATDA 3IJ9A 3BLKA 3W29A 2Y61A 1NOFA 2HPMA 1SJBA 3QQWA 5FJUA 1NDYA 2GQ3A 4RE0A 3TK7A 4W8LA 2JK2A 2QNEA 3AHYA 4REQB 3G5EA 1F6PA 4FSAA 4RDYA 4V33A 4W86A 1E4MM 4L1XA 1VJZA 1UZDA 3R25A 4BCEA 5U4NA 3E2RA 3AXXA 1NOUA 3LRLA 3MI2A 1UD8A 1TPC1 4KF1A 1UJQA 5EFDA 4GFIA 1JZ5A 3NPVA 3WQ4A 4U10A 1TA3B 2REQB 3MSGA 2JKEA 2Z27A 2NQ9A 4AH7A 4IPJA 1BRLA 1KQZA 3W87A 1KRBC 1GVEA 4W88A 1XRSA 3GE7A 4DXVA 5HJYA 2V30A 4A3UA 3MHGA 4C6EA 3L9CA 3BG9A 3C56A 9CGTA 1F73A 3QMRA 4I5UA 3TSDA 3DHFA 1BGGA 3AC0A 3LX9A 2C13A 2BVYA 4GJJA 1HVXA 3G3DA 6XIMA 1F74A 4U3CA 4EVZA 1K9DA 4O13A 3THCA 4YYFA 2OU4A 1UKQA 3IT6B 1F8MA 4WSKA 4HOZA 3UR8A 3OJGA 2XHYA 4MF4A 1X98A 3SUTA 3UZJA 3GDBA 4XZ9A 3QF0A 1I8QA 4AY1A 1BVNP 3WBEA 1U83A 1ECEA 3RLVA 4PBFA 2YDRA 4FIRA 5FCZA 2OQYA 3KL5A 2AMGA 4C5ZA 2QDHA 1RWCA 1TTPA 2WCAA 4JIEA 1PAMA 1F4AA 4MY9A 3MZ2A 1UUMA 5AYXA 2QCEA 1YXYA 4R33A 1LLWA 3S5NA 4MZ8A 3BAWA 1D3CA 3BLEA 1XG3A 3T0TA 4AY7A 1SQ7A 3H2EA 3WMBA 4YVVA 4US6A 4J27A 5HK4A 5T9CE 3WEMA 4HYVA 1RWGA 3N3MA 1H62A 4O28A 3W73A 4KEUA 1OGSA 4QR6A 1XS2A 2HBVA 1LWHA 3L4XA 5K9XA 1ZQ5A 4KW2A 1LTDA 4C90A 4FA3A 2ZA3A 4IQLA 1X1NA 3AS2A 2HXUA 1DXEA 4YVPA 4ZSUA 4HCLA 1KQYA 1WNOA 3LG3A 2CBIA 3VMOA 3EEZA 3LXCA 3BVJA 1EEXA 4MDOA 4Q6JA 4PZVA 1PIFA 2ZDSA 2OR2A 5E6ZA 3MJYA 4HN4A 5AKQA 1CGUA 2JF7A 3VIJA 1IF2A 3SCTA 2PC8A 2X1IA 3GC5A 3ERPA 1G69A 2YLLA 3BSMA 2XWEA 3NPUA 1VFSA 4PMUA 3CAQA 1AMYA 4AAJA 4D6GA 4MWAC 1BYBA 1S1RA 3TIMA 1OEPA 1HJXA 3SQLA 3P81A 3W1QA 4FXJA 1EYEA 1EJUC 4US5D 4E4PA 1EGMA 3W88A 2FZNA 5BMXA 2OWWA 3AMLA 1EOKA 2TMDA 1B3WA 4ORIA 1PB0A 2V68A 3CUGA 1HXJA 4Z17A 3S9YA 1F3WA 5K9CA 4MUPA 1CX9A 1EXPA 4DF1A 3EPOA 1CGYA 2DUAA 2VNCA 4XZWA 4C6KA 2EKGA 1S39A 3GYCA 1R3RA 2O4MA 3S9ZA 4B9YA 1Q63A 4A8IA 3EB3A 1AL7A 2XG9A 1L6WA 2WVVA 1GQNA 3S1VA 1SW0A 3ABQA 4IFKA 3LCXA 1NVMA 3QJAA 4H9UA 4KFOA 3KVKA 4LSBA 4KT2A 2D2HA 3RJXA 3WEZA 1ADSA 3A13A 2Z28A 5FOOA 1IXPA 1RJPA 1VFUA 4MNKA 5AYBA 4XAGA 1PS9A 2OGYA 3GXPA 2NV9A 5A6BA 4R88A 3KLLA 4QG6A 4WKFA 4UBPC 3T44A 3TC3A 5HPOA 1E5JA 1UR2A 3ITYA 4D6HA 2UY4A 4KWOA 3NQ7A 4X9YA 3HB9A 4O16A 2GQ9A 3T2OA 3URNA 1N7NA 3KL3A 2I9EA 4PC8A 4IJBA 4CQ8A 3MWCA 5XINA 1W3YA 4DBEA 2OXNA 1KBIA 2H9AA 3FHAA 4UMCA 4AD0A 5M5DA 4ZQRA 1W9PA 3WNNA 1XI3A 3VNLA 3I3DA 1R30A 4AG0A 4R27A 4ZVJA 1UIPA 1EF2A 3W2NA 2ZZ3A 4M29A 4BQ5A 4MGGA 2NQLA 4JX6A 4K7VA 3DKJA 2DSUA 3SY1A 4HNTA 1AD4A 1UH4A 1ZTVA 4HSHA 4QJ3B 2WC3A 5IXEA 2YPIA 3H7VA 5E9AA 4WDXA 1R3TA 2AQWA 2WMIA 1Q7MA 2EPNA 4Y7EA 2ZRVA 3KBJA 5A3HA 2VZVA 1XX1A 3ARZA 2D0GA 2QUUA 5C7VA 4GO9A 3B03A 2EO7A 2Y63A 3QY7A 1Y5XA 3SADA 3IVTA 1GCYA 4PCNA 3WLLA 1CNVA 1RY8A 4X2PA 1A50A 2QJJA 5ABGA 3LLDA 3GR4A 3OB8A 4Q4QA 2VKZG 1E6NA 4TX9A 4MYXA 5DELA 1EQPA 2QT3A 3KX6A 4ZEPA 4W4QA 3SUWA 1J96A 4TUFA 1TE1A 1A5MC 4RZ5A 2R6OA 4RKAA 2WJFA 1JYNA 4IGSA 1I45A 1W9UA 1V3IA 1RUSA 3EKGA 4AD4A 2VEPA 4H8UA 4D2JA 1V77A 1N55A 4B90A 1JF5A 4HT3A 2QUTA 3GG8A 3BDKA 1XISA 5I3IA 4PODA 2ACQA 2YSWA 3E2VA 1ICQA 5TBOA 1TQJA 3T05A 5LA2A 1DOSA 4X0VA 3VIOA 3GW3A 4CNNA 4EIVA 3VCCA 3VZZA 3SCNA 3L5MA 1EUNA 4NNAA 3HV8A 4PB5A 1DP0A 4YWSA 1ONWA 1ZCCA 1E70M 3R5EA 7ENLA 5IM51 2WMKA 5BYWA 2XH0A 1PDZA 3GW0A 3UPWA 1LROA 4AXNA 3ZR4A 4P7NA 3P61A 3P74A 1K9FA 3ZO9A 5PTDA 1OHLA 2WK2A 1WKDA 4Z1CA 4P7OA 5KEZA 2J88A 3CWHA 4CD5A 3NO3A 1HKIA 1TV8A 3AIUA 1ZBCA 2XVLA 3U9IA 3R12A 3VKBA 3S8HA 2P0IA 1E15A 3F1QA 3CAWA 1E56A 1E6ZA 1Q6QA 2PDPA 1OK6A 2UV8G 1JUKA 3PNZA 3ZLGA 1P6BA 5BWAA 1QPQA 3OU8A 1FWGC 3N2MA 4AZCA 4O11A 1ICSA 1K8CA 4WEVX 2VR2A 4CNTA 1LBLA 3W2MA 3BGJA 3C2OA 1IYXA 3JS3A 2EKCA 3L4ZA 2EG6A 4KKXA 4S1FA 1DJGA 1G4PA 1ZFJA 4A3YA 1B4EA 3LERA 3A3WA 4O10A 4ZQMA 5FF3A 4MG4A 4HNOA 3ICJA 5K4ZA 1MEIA 2Q01A 2DUXA 1AH4A 3MI6A 1O5QA 1P0EA 2DW7A 5LZLA 3GC4A 2BOEX 1YTKA 1QRQA 4BF9A 4EAMA 5K7JA 3PULA 1YQ2A 4UOJA 3IJQA 4JTIA 4L80A 4QISA 4A21A 1DE6A 3FN9A 2WM0A 4JIQA 1GZGA 3M0KA 1OJOA 3G24A 2ZICA 1JAKA 1GORA 3PBMA 1GWJA 3RHGA 2J78A 3U2EA 4NVTA 1QPNA 2NWSA 3AYVA 4D6JA 1VCFA 2V5CA 2FLIA 1BRLB 4AHOA 3VZYA 1QOQA 3CPRA 3L65A 3KOFA 1LLOA 4C7GA 3MUCA 3W86A 3VNZA 3GTFA 4FLOA 3STPA 4PE8A 3PG9A 4KCUA 3EXRA 3M5YA 1JDEA 3KS5A 1VENA 1JD7A 2ALRA 2J66A 1W9XA 1FKWA 4GBUA 1NDVA 2F6KA 1DIDA 4UTUA 4ZOAA 2YA1A 2QZRA 5C7HA 3A22A 2E1WA 2WBGA 3T4CA 2YB1A 3LSCA 1CW2A 1JDFA 4TMCA 1V6YA 4PMQA 3R10A 5MKGA 4JX5A 1KBKA 3VO0A 2EHHA 4MM1A 3B9EA 3GU2A 1FWCC 3Q67A 3DFYA 1TPWA 3VU2A 1ZAIA 5FEZA 5LHFA 1KRCC 1VQTA 3KUMA 2Q71A 3QSRA 3DG6A 2XVKA 4L4MA 1PTGA 3HG3A 1ELSA 3MV11 3WELA 1K7FA 2YL5A 4LXFA 1KM1A 3A4WA 4DX3A 5C2GA 3WNLA 2GFTA 4Q6XA 5DCEA 1ZY9A 3OGVA 4XAZA 2XSAA 1ZCOA 5C55A 4CVWA 3CASA 4M19A 1GOXA 2OSXA 3ANUA 1V03A 1A5NC 1NWUA 3BOFA 2VC7A 3PZMA 1UMLA 1BPLB 1R2RA 3N25A 1NU5A 3KRBA 3M0ZA 1R7OA 2HNEA 4RNFA 3P62A 3WDRA 3K30A 2XSBA 3H6OA 3G6LA 3N4AA 3WNKA 3TXZA 2VD8A 5GPRA 3CAKA 5BNKA 2QCCA 2EF9A 3ZMRA 1XFCA 1F76A 3GO2A 3UT0A 3CS2A 4AWSA 3EXSA 2RHGA 4ORMA 3WLJA 4DXXA 2F8QA 5JU6A 2QXWA 4PL1A 2PCEA 3BG3A 2Y7EA 3NYDA 1GQLA 3ARSA 1PX4A 4UXDA 3U5UA 5ECUA 3LNMA 4QLKA 3MBFA 1A5AA 1WX0A 3FLUA 3S3GA 4LUTA 4HOXA 3USZA 2E40A 5HOSA 3NQGA 3T9PA 3AIWA 3WDPP 2YBTA 2QS8A 3L12A 3SFWA 3E49A 3R94A 3OZYA 3FAXA 5C9XA 4ZMGA 7PTDA 1FOBA 1XBVA 3GKAA 4K68A 3ENLA 3OQEA 1OINA 4DZAA 2DDXA 4A4AA 1BQCA 2OODA 3IANA 3TYAA 5TF0A 4DJDA 1W17A 4ML4A 3BO9A 3DYOA 4IIHA 4MKSA 3JVAA 4UQEA 2HZGA 1BVZA 3EBVA 4C5YA 4MOZA 3NURA 1LRNA 1JCNA 4BEUA 5E09A 2WVVB 2G8ZA 4IFKB 4J9JA 4ERAA 3VGBA 1WKEA 4FPSA 3E12A 2PDUA 4NZJA 4X0NA 2J7EA 1YDYA 4JQ1A 5AHEA 3EDEA 2E5BA 4XAYA 5DO8A 4FX8A 2G0WA 1KLYA 1WXYA 2Z25A 1IXOA 4XKYA 3DECA 4X22A 1OG0A 2QUMA 1EKOA 2QCHA 4DZHA 2CYGA 4XO7A 1P0NA 1P6WA 4OUEA 3WLKX 5FSDC 2VZKB 1Z32X 2ACRA 1OX5A 2I17A 3SCWA 2WNNA 4CN1A 3AZTA 1A53A 2P76A 3TXVA 2QW5A 5DRIA 2POTA 1VEPA 2WV8A 1UB3A 2H9AB 3C4UA 4UUIA 4IGMA 4LVAA 3GIPA 4EF8A 5CSSA 4Z08A 2PMQA 3BW4A 1I9CB 3MTWA 3UCCA 3OYZA 1EQCA 4DBSA 3H70A 1K9TA 4HOWA 2PTDA 3F5KA 4Q8WA 3LV6A 1CXLA 4O0QA 1QBAA 3PZNA 2ZZ7A 2EAWA 4A35A 4R34A 5CPNA 1E4NA 2ZUTA 2HTMA 4E5TA 1W1B1 5CQ1A 2DY3A 3WQDA 3PAOA 4MHBA 2WMIB 3WIJA 1NF0A 1Q6FA 3W7HA 2L5HA 3QGAC 5I07A 1VFOA 1Q8JA 1E6SM 2WMGA 1KFWA 3HPZA 3B40A 2ZZ5A 3P2VA 1K4GA 1WP6A 4CNPA 3U0HA 2ABBA 2BVWA 3HU7A 1Q7ZA 5CPQA 2CEQA 2G96A 3SW6A 3L23A 4Q33A 4BS0A 4UR9A 3C0SA 2BXZA 2TYSA 3PHAA 5CZJA 1FVPA 1PZ1A 3TTSA 4UWMA 1C3FA 1M7JA 4LRTA 1SVDA 2JEQA 4ZO8A 2XZ7A 4K6AA 2TSYA 3GUGA 1A80A 1F1SA 2OKOA 2BY2A 2R1MA 3VNDA 2TODA 3B97A 1Q7QA 1TPUA 3S1GA 1MMFA 2ZE3A 1JXKA 5AC8A 3REQA 4M1RA 1EZWA 5I3HA 3GIYA 4A3HA 3GDRA 1XD1A 4ICCX 2ZX6A 1EJRC 4LF2A 2HEJA 1RXOB 1B54A 3GG1A 1DBTA 3ID7A 2QULA 3G1XA 4CCCA 3DFOA 1TV7A 3NOYA 4P8XA 2DT3A 3PJUA 4PGLA 1SO3A 4XVDA 3VILA 3ONCA 3GDKA 3K8KA 1IZKA 2Z7GA 4CQAA 2X16A 4GZJA 1VIWA 1POJA 1JNEA 1PKMA 4JNMA 3FYOA 4JFUA 2OX1A 2ZWZA 1F05A 1HF6A 4BY3A 4ZA0A 5B7ZA 5LNWA 2NQHA 1G7UA 4GRSA 2FZMA 3R58A 1TJ0A 2QDEA 2PZNA 3RPDA 3G1HA 4B5XA 3ZT7A 4KWWA 4J3ZA 4YIWA 4P61A 2FB3A 4Y9PA 2GDUA 1TWIA 4ERIA 4ADSA 2WQDA 3LLFA 4GISA 3L67A 1T8XA 3KBNA 1F3TA 3RR4A 3CHDA 3FXYA 4N6EA 3WF4A 3UZ5A 5FSEC 1G6CA 2CLPA 5CC3A 1K7XA 4DZ5A 5EYWA 1JYXA 1ZU8A 1AJZA 5DXYA 3W2LA 3DU0A 2P3ZA 3STFA 1TCDA 4MSSA 3IGHX 3C3NA 2B7OA 1JCMP 2V5DA 3FA4A 2FB2A 2VZTA 2ONEA 3S6OA 3STEA 4AZCB 2XFRA 1SZFA 2PF0A 2ALDA 4IH3A 2YFOA 4DYEA 3MKCA 3LY0A 1TREA 1Q13A 3RCNA 4P8WA 1NFBA 2CLFA 2WVUA 5TIMA 1X7FA 2XIIA 1NFPA 1JDAA 2PWFA 4PMJA 1EJTC 4RX0A 2PDJA 3IIOA 3HOJA 1QW7A 2C6QA 1A5CA 1C7TA 3GHSA 4RNHA 3UG8A 5D2VA 1BYAA 1E51A 3N34A 4CD4A 5FAJA 3O0FA 2QAPA 1NELA 4MDPA 3RG6A 4DJFA 1UZ1A 5HNTA 3CPUA 4JQAA 2NW0A 3OZOA 3BV4A 2EPMX 4PMNA 5HANA 2YL9A 1YNQA 2VRQA 4JR5A 4Q3MA 3WJWA 1S2TA 4ZTXA 4EXBA 1HP4A 1EIBA 2BASA 3D46A 2WVTA 4LUJA 4PBEA 5AC5A 1CGWA 3KBUC 1EC8A 4B4HA 3L68A 2E22A 2ZUSA 3GHRA 3FGCA 1NARA 2BP1A 1JRBA 4DHGA 1HKVA 3PY2A 4EX4A 3WLPA 3F2CA 1DKWA 3PWIA 3NG3A 6ENLA 6XIAA 5G1YA 4UQDA 1SR0A 3NZ1A 2J7BA 4PUKA 4N02A 2VOMA 1XIHA 2FTYA 3IS4A 3LPFA 1EGVA 1DIEA 3TV8A 1KFCA 3O6YX 3V5CA 1GVFA 4PTWA 1WKYA 4B91A 3WEOA 3WQ6A 5FF0A 2Y5SA 3PK7A 3AWNA 2GSEA 4WJXA 2Y24A 1E9ZB 1WO2A 1DJQA 1J0ZA 1LLQA 1JPDX 2OEKA 3PPCA 1OJXA 4H9TA 5CPMA 1NP2A 2BODX 1LOSA 4UTWA 4UNKA 2NX3A 3QKEA 4FLSA 3HBLA 5I3FA 4GJ1A 5LYRA 4YJ5A 1YIXA 4IIFA 3S6DA 4L64A 4ZOBA 4XUYA 1I8JA 4F79A 3BL3A 3SDOA 5U7SA 3UJEA 1AH3A 3DGBA 3VGEA 1GHRA 2HS6A 2FGBA 1A5BA 1JZ8A 3NEHA 2HE5A 2PZ0A 1WDPA 2XPKA 2D23A 3NVTA 1IIHA 4X60A 3UWEA 3WH9A 4F8XA 2C1IA 4FO4A 4TQTA 2WSPA 4BHYA 3M4HA 2J75A 1KCZA 2OLSA 4YCOA 5DCBA 1BXBA 1XL9A 4AC1X 2CZDA 4ZB0A 2PA6A 3N9SA 4JD4A 2MANA 1J6OA 2XIMA 5IRPA 2PS2A 2IKIA 3BW2A 4UQ9A 1V08A 3THAA 1H1YA 1E71M 2WJZA 1VGAA 1SW3A 1CLVA 4CLMA 3O2LA 3TOPA 2P8CA 1KKOA 4MJMA 3K1DA 3EWCA 4UTHA 3W1MA 1NAL1 3LHTA 1X1HA 4AZ7A 1AQFA 3LU2A 1TQXA 1UWUA 1T5AA 1PV8A 1CGTA 4I3GA 4JHMA 1E6QM 3ZJ8A 5H2ZA 2PGRA 1KRAC 2EPHA 4IIGA 3HTWA 4BFAA 1PCWA 4WF7A 1RVKA 4G2DA 4LUTB 3V3WA 3ATYA 4GYPC 2YDQA 4GG9A 3MB9A 2OQHA 5HWJA 3W3OA 2V63A 2X2YA 3GNPA 4FF7A 2J74A 3WBWA 3KDOA 1V5XA 3GXFA 4PH6A 5HMSA 3PFRA 1L0PA 2DZTA 4PMYA 3OG2A 5G4HC 3EDFA 4B3KA 1U5VA 1JVNA 3M0HA 4O8RA 4IQDA 1RCQA 4FLQA 4W85A 3RF9A 2PDFA 4JTLA 5A69A 5H8PA 2ZRXA 2GVEA 2R1LA 2VC5A 3NO1A 1B1YA 2E5DA 1H1ZA 4CQ9A 1OWQA 3KOZA 3KCLA 3NQ2A 1RA5A 3FIGA 2E4TA 3GC2A 1ML1A 5CG7A 3TSMA 2AL1A 1V0NA 4U2ZA 2ZRUA 4F0KA 5FA5A 3S2CA 4EK7A 1EHAA 1J2BA 1J5SA 3VOCA 3URBA 3R0UA 1ME7A 1JCYA 2OLAA 2I9UA 3ZLHA 3AYRA 1VFMA 4DVOA 2G3IA 4JYFA 3WLIA 2R94A 1TV2A 2Z1XA 4QROA 1FWFC 3MC5A 4PTXA 1GKQA 1KXVA 3KOXA 2W63A 4XKYB 1VRAB 3C0JA 4XZBA 3TYDA 2LLEA 1MUMA 4D71A 1TV5A 2ZXDA 2A6LA 3GBDA 1Q6GA 1C9DA 3VKAA 5K3VA 3N13A 4NAEA 4HSOA 5I5RA 3UZXA 4JXCA 1V02E 4M1BA 3WJZA 1GG0A 4LPCA 3NSMA 4PL2A 3UVAA 1ITCA 1DXFA 1ZS2A 2PDXA 1QWGA 4JTJA 1ENUA 2WCGA 1VPYA 2WNQA 3MMUA 1ISYA 2DZSA 4XV0A 2IXVA 2R91A 4JTRA 2ACUA 1GZJA 3QHMA 4LY4A 1VLIA 1Q45A 1KFLA 4G7EA 2Y7FA 3ABSA 1SFSA 3GRIA 4IL0A 4F9JA 4F0SA 2IUZA 5CBJA 3N18A 4JFSA 2OT0A 5I7GA 1CBGA 1UH2A 2X1TA 3S5SA 5GJPA 2HRWA 3E0WA 1EX1A 1R3QA 1X1ZA 2NXGA 1A47A 5AC7A 3E96A 2EBNA 3B04A 4C7DA 1VFLA 1UYQA 1TELA 2VGBA 3EPNA 1ODZA 3CIVA 5EMYA 3PJXA 3T55A 1GYLA 2QV4A 3UZYA 2HK1A 3NQMA 4JGDA 8XIMA 3WD1A 2YCKX 5M17A 1UP2A 3TSBA 2R14A 3BJFA 2OZ3A 1BKHA 5AVNA 2HVMA 4TVDA 2QCGA 4UCGA 3ZJ6A 1E3ZA 3MT1A 5EU9A 3MV01 3M16A 1VCVA 3MMWA 2J8GA 3TX9A 1WOBA 4H9YA 4S38A 5HMFA 3OIHA 1CZ1A 5J8LA 2PTZA 3REQB 2IQTA 3WK0A 1I4NA 4GNKB 1V8EA 2DZUA 2XH2A 4Z1AA 1GK8A 3RO6A 3GYEA 4S3GA 1S2CA 4O50A 2FJUB 4XD3A 4FLRA 4WX2A 2QHAA 1OQFA 4UQAA 2R1PA 3NQFA 3H2MA 2BRWA 2C79A 4E6MA 4AWUA 4KCVA 3GNRA 1ME8A 3DKLA 1OFOA 2G41A 2JFEX 2OCZA 1L9WA 4BQ4A 4QEEA 1V4YA 3HPFA 5KZMA 1RBLA 4GWEA 5GNYA 1YTEA 3AXIA 4QS5A 2CLHA 1H7XA 2X1RA 3UR2A 5DT5A 2PRLA 1R9XA 1TWDA 4S3JA 1QI0A 4JNZA 4LX4A 3WNPA 1IGWA 4LC8A 2QJNA 2FFIA 3BLFA 3N6HA 3WQFA 3EDDA 4QE4A 1XRFA 1XRTA 4DNHA 1N82A 3QPYA 1UIOA 5HAOA 1KGUA 1FXPA 1HL8A 2NX9A 1XQLA 4PMVA 2P88A 1ITQA 2VXNA 4XD4A 4DLQA 1R86A 1F3XA 4LNYA 3TDFA 3W0KA 4MB5A 3CUXA 3HMJG 3OLDA 1RP8A 1XRVA 2WQPA 2CLLA 3AIRA 1W5MA 1A5OC 1JG9A 1FH8A 1YMYA 1TPVA 4MKNA 4V15A 1WDSA 4ZQCA 1WDWA 4GYFA 4Q7NA 2O0TA 3M44A 1TVPA 1OCBA 4Q7BA 4DUWA 1WPCA 3W07A 3VD4A 1AW1A 1IT0A 3A4AA 3M47A 5HPCA 1FWHC 3WF2A 4QG9A 2WSYA 4JHOA 4QAWA 2GGEA 2WWCA 3AHXA 4DYJA 4KS0A 4TX8A 5CGMA 4GC3A 3CV2A 2YEPF 3M5XA 3LSBA 1CXFA 1L6YA 2X30A 2H3DA 5CKSA 1E72M 3V0TA 2A3AA 3I10A 3VIKA 2XSXA 3GVGA 4EACA 2Z7KA 4X3ZA 1LBMA 4OBTA 1BWKA 2AOSA 1OX6A 5C2XA 4CEUC 1DPMA 1VLWA 1K4HA 2YCEA 4BWLA 4ZO7A 1PKNA 1ZJHA 3FV9A 3IJLA 4MIMA 1A4MA 1WB0A 3HF3A 3DHDA 5DQPA 3LD5A 3NL5A 1OSEA 1GONA 1WBJA 1IGSA 3FVDA 4CD8A 4WR3A 4LEQA 4WDTA 4XBSA 1RSCA 3KM8A 5H1WA 1UA3A 3FGCB 2JKPA 4KCTA 4PCTA 2YW3A 5EL1A 1B3VA 4FNQA 1BXNA 1MW3A 1BF6A 4H9MA 3VOHA 4KFPA 1JFXA 4C1LA 4HA3A 1ICPA 3QV9A 4D6IA 3URQA 1BTMA 1A3XA 1EIXA 1OZQA 2WHKA 5HDRA 3NDOA 4JL1A 3LI0A 1LJYA 2NWRA 3M1ZA 1QMLA 4QFUA 4IMDA 3THQA 3BMWA 1R6WA 5A1AA 1XGDA 3IIZA 4MY1A 3BAJA 2QJIA 1Q6EA 3FA5A 4AMCA 4HK5A 3KCJA 2DH2A 4HGXA 4Q8UA 4PRWA 3VIFA 4B5WA 3WNOA 3OIXA 3PTKA 3BJTA 4R9OA 4MJZA 2EG8A 2YW4A 1CGVA 1NFGA 3GY1A 4KIEA 1PHQA 5HQMA 1IT8A 1SJAA 4Q8NA 4KGLA 1JCJA 4UTTA 3PF3A 5AHFA 3TAKA 3Q37A 2E7FA 3Q4DA 4D6FA 3O06A 4IOTA 4C7FA 4B2DA 1Z42A 1CXEA 2ZC1A 4A8NA 3L4WA 1IZCA 1OIMA 3G0SA 3BGAA 1M04A 1IEXA 3GH4A 1IT7A 4GXPA 2PTWA 2PWGA 4UOZA 3HQNA 3UJSA 4R7JA 3AZSA 1QW9A 3UWQA 5FACA 3D3AA 1LCOA 4JY9A 3JU2A 3AO0A 5F4XA 1WZAA 3O15A 4NNCA 2IW0A 3GS6A 1FWJC 2G4FA 2A5HA 2UWFA 4I90A 1CXKA 2CHNA 1Q4NX 2EPOA 1QPOA 2NT1A 1GG1A 3GU9A 3NXFA 4GXWA 5EMUA 3ABXA 4K38A 1EA9C 5I09A 3TQPA 3NR0A 3W02A 1VC4A 4MZYA 1IEWA 3OOQA 2RAGA 3GK0A 3CJPA 1L6FA 3SO7A 4PUJA 3TNOA 3THUA 4GY0A 4ZQNA 4C6QA 2GWGA 2VDGA 2CWNA 3BH4A 1RWHA 3LCGA 3UZWA 5CAKA 3DFQA 3YPIA 1V6XA 1V3KA 4G5DA 3H2FA 1XLMA 4PMZA 1LT7A 2Z2UA 2D2JA 3WBYA 1Z7AA 1TO3A 2YCLA 3WLHA 2DGAA 1E6RA 1OFPA 4M81A 3MO4A 4O1FA 3T0DA 4ZXLA 1V02A 4OVXA 1VYSX 5LIXX 3LGDA 3IUHA 2Z4GA 1XIGA 1RPXA 2IPJA 3WMLA 3MI3A 1A4LA 2AAMA 5I3KA 4DWSD 4NRSA 3RFAA 2IPGA 1DQUA 2UBPC 5AHMA 4JTSA 2OQLA 3I68A 4RNJA 1MNZA 1OB0A 1BD0A 3FVMA 4PUMA 1MRAA 5G2HA 3ANVA 1HJQA 5CAHA 5I24A 5XIMA 2J77A 2PDQA 1ZBWA 2IQDA 4GK8A 4LYKA 4MWAD 3M46A 4BJHA 2XM1A 4NX5A 5LNRA 3UVIA 1CI1A 5CPTA 2ZRWA 3KE0A 3Q94A 2F2KA 3KS6A 3M7WA 3CQKA 1J0YA 1UKSA 4JTHA 2R1KA 1XSIA 3URAA 1PCKA 3W38A 2XM2A 4NL1A 3MYPA 4IMEA 1OFDA 1Z9AA 4GH3A 3QV7A 1SZGA 2FZBA 1LLZA 1FBAA 5LNSA 4L4PA 1GQKA 1MEWA 1L2UA 3QV8A 2XN1A 1TCMA 4NJJA 1WCGA 1ZRQA 2NVDA 1EF3A 2G37A 3Q65A 1JGIA 4G7EB 1KWKA 1PEZA 4JN6A 4F0HA 1ZAHA 4LVBA 8TIMA 4DBDA 1FCVA 4QHRA 1C9WA 4KEVA 3L4TA 4RZ6A 2ZZ6A 4ZL1A 1W3KA 2NLYA 4RE4A 1ZAJA 3GUWA 1N8IA 2WC4A 4N9DA 3UXAA 2RFGA 3E0IA 4IHCA 3TA9A 2QJMA 2YBVA 2BB0A 3N04A 4R7WA 3IAPA 2CNCA 2Q1FA 1UH3A 4A05A 3EMQA 3V4BA 1POKA 2J6XA 1PZ2A 4RUBA 3O6CA 4Z1DA 1HM3A 1Q5MA 5ENLA 1IR1A 5IOBA 4LYRA 1BAGA 1GJWA 3KTCA 1ZJBA 3U2ZA 5KZEA 2BFGA 1V93A 4YCPA 3EWUA 2RKXA 2QCNA 4PEEA 4D8ZA 3NGJA 1G7VA 2QQ6A 3PC0A 1MNSA 3ARXA 1HFBA 4ENLA 3EOUA 4MNLA 4CQDA 1VZWA 4JBRA 4X63A 3U3HA 4DLFA 4RR4A 2DZBA 2JE8A 1M3UA 2B7QA 5EA9A 3VGDA 3K5XA 1H0IA 3I3BA 2ASHA 3PTMA 2QF8A 1C91A 3CH9A 1RD6A 4MPQA 3CB3A 3ANYA 1EGUA 1FDJA 4GGBA 3NZRA 4HA4A 2HE8A 4EP8C 3CC1A 1J0NA 2BSLA 2ZC8A 2J24A 3LTPA 1CEOA 4WVXA 1TX0A 2YJQA 3ORWA 2CU0A 3PJWA 2IKHA 5CZSA 3FKRA 2BXYA 2CKRA 3CO4A 4HJWA 1Z48A 4J3TA 1V6TA 3VDCA 5FF7A 1P1MA 5HUPA 4PFMA 4D1JA 1XIFA 2BTMA 3WENA 1MZRA 4GI9A 4UTWC 2KZHA 4TMBA 1RLCL 1ZNNA 2P0OA 4PB4A 3EOOA 1UD3A 3S1WA 1W8SA 2VEIA 4MY8A 2INFA 3R79A 2GDVA 2A7NA 4NP7A 2ZUWA 5T91A 1JYVA 3TA6A 4REQA 3MUZ1 2ZUUA 1KV8A 4I7WA 3L0GA 3TQVA 2YDSA 4K3ZA 4CQCA 1KXTA 3SRKA 1K77A 2PCQA 3GDLA 5GJNA 3MY9A 3AROA 4IPLA 4QE1A 3SRFA 3W28A 1MDRA 3W6LA 4PCFA 2J8FA 4H6KA 4GKLA 3TKFA 4HMEA 3CMFA 3F5JA 3W74A 3LENA 3SN4A 2GJRA 5D2TA 2WAGA 3J7HA 4OBSA 5FKYA 4DAFA 4HPNA 4IJRA 1GVRA 4FALA 4J28A 1W54A 5I2UA 2V5BA 1MZHA 2WZHA 1G9HA 1ADOA 3F2BA 1GZ1A 4AEFA 1JCLA 4ZFMA 3QMTA 4D9PA 1GOMA 1RPKA 3KVJA 1CECA 4UFHA 4AW7A 2P10A 1XD0A 2DW6A 5A2BA 1GEHA 4WXYA 4IICA 4IMFA 4TXEA 2A1YA 4RDZA 3CGTA 3VKKA 3HM7A 1HMWA 1XLIA 2ZVIA 4V28A 1NJJA 2Y6ZA 1JF6A 5FEPA 4CVUA 2WLYA 4NY2A 3SBFA 4GUFA 2X40A 4YNGA 5I0DA 3W1LA 5BWFA 5TQLA 4QEHA 2DU2A 4GCXA 3P8IA 2CBJA 3KHJA 3B0XA 3MWAA 2DJLA 1R7AA 2J9XA 2V69A 4A3RA 4F40A 3C3UA 2G3NA 5AC6A 4JKLA 3LCWA 3SIMA 3LHYA 3VUPA 4WKHA 4XAPA 1K6AA 1S2UA 1YXCA 2XUCA 3QPEA 4LWWA 4JCLA 1QASA 3T09A 5D2WA 1E5NA 3RO8A 2CIPA 3U48A 3I6RA 4V1YA 2Y70A 2INZA 3NQVA 3DYPA 2PEVA 4L56A 3GKFA 3V0SA 2Z00A 1HN0A 4UNIA 5M3WA 2Z0IA 4NNBA 1E6PA 2NLIA 4A22A 3ITCA 2E24A 2O9OA 4NZFA 5I79A 2VUNA 4E4FA 3ES8A 5CCZA 4IGHA 1B57A 1YDNA 3IGXA 1GT8A 3WQEA 4JQ4A 3W72A 1LP6A 5FIPA 4DQWA 2C91A 1R3SA 1T8QA 4IUOA 3K4WA 3QY8A 3MU7A 3BWWA 5MHBA 1EO7A 1TPEA 1ZPTA 1H50A 4N6FA 1QO5A 3N11A 3S2MA 3AAMA 4H6QA 4LB3A 4PMXA 3I7SA 2BY0A 4ZGYA 5JXQA 2E09A 4H19A 1VEOA 2E1DA 3UJFA 2YXXA 1X8FA 4LAZA 1JJKA 5KTLA 1KWGA 2PDWA 4LAKA 3TZNA 4GUGA 3ARUA 2OOFA 1DE5A 7XIMA 4J3UA 2XVNA 3WBAA 4LGXA 1W1IE 4PCSA 4PMOA 1Q85A 1RWFA 4GUJA 1JAEA 5HR7A 1UJPA 1XIIA 3LA4A 3I65A 1TJ2A 3M64A 3OHIA 4M24A 1JRCA 4S3BA 3ZT5A 1YNPA 4JIIX 4I5XA 1GW1A 4YS1A 1SPQA 4FNRA 1HMUA 5DY3A 1T96A 4HNVA 5C0QA 3RX2A 3JR2A 1LOQA 4RZ4A 4GPNA 2HVNA 2G3JA 1YKWA 2CBVA 4M80A 3SUVA 4NJGA 2FFCA 2CC0A 3CBWA 2XISA 3MW7A 2MNRA 3B4YA 3ES7A 4RPQA 2KXSA 3IV8A 1SJDA 3GFXA 1UUOA 2H8XA 4G1NA 3ZFHA 5C2CA 3VX1A 4UIOA 2GUUA 4OKDA 1Q2RA 2VL4A 4YVXA 1FHLA 4HU0A 2C1GA 2YCLB 1V3HA 2WB5A 5EMMA 2I1OA 4GCAA 1AMKA 4FS9A 2HNHA 2Y8VA 2YOCA 4WGHA 1MWOA 4GIAA 5AZ1A 4X2RA 1O1ZA 3T6CA 4LC6A 1ISZA 1H2JA 5EGRA 3MUIA 2RDUA 3KL0A 5D9OA 1F7BA 4QITA 4K37A 2ESCA 2PDGA 2BG5A 2V38A 4JN8A 3CWNA 3EAUA 1G4SA 2WOQA 3UWUA 1J0MA 1RK5A 5DT7A 4O1AA 2VFDA 3VD9A 3QZ6A 2DQWA 2F2HA 2Y2WA 1AD1A 2FHBA 2WHJA 3W1NA 4EPKA 1E0WA 4YL2A 1E1CA 2ON3A 3PZ9A 3H54A 2HQAA 3HIJA 2PDYA 3RPMA 3PPHA 1UQYA 3PZUA 2DZPA 3DAQA 3TZFA 2QCDB 2RDWA 2FPVA 1EBGA 3VMPA 4C6LA 1JCTA 4U31A 1UR3M 1Q65A 3AU6A 3ISIX 3W1XA 3V36A 5ABHA 2D69A 3G1YA 3UBPC 3KTXA 3LEPA 4AVFA 1HL2A 4YMZA 1VHCA 3UEQA 5D9MA 3B8DA 4WRHA 4GY1A 1EP3A 4O1CA 4M7SA 2VELA 1S1PA 1JEZA 3SSZA 3MHUA 2CITA 1S2WA 4Z0JA 3AUOA 1LBFA 3ITLA 3WQVA 3B8UA 5JH2A 3W75A 4IFOA 4F2BA 3K1GA 4JTDA 4I9AA 1KLZA 3GAKA 3RXZA 3UG3A 3FYYA 5B80A 2HBXA 5EFFA 3TC7A 1IWPA 5CPSA 4YTRA 1PKLA 3GG0A 3PQIA 3PNUA 3CEPA 1JZ6A 3F4WA 3CIXA 2V3GA 1J2WA 2CWXA 1PIIA 2J7CA 1UKOA 1ISVA 1GGOA 3B8TA 4O0ZA 1J8VA 2I56A 3QRHA 1UOZA 5E6YA 5J04A 4ZO6A 4TO8A 1OYAA 1NOWA 2PSNA 4D6CA 5IFPA 4CD6A 2CHRA 4F0RA 3BUVA 2Z1SA 2PGFA 3PZOA 1A0DA 2HCVA 4ZQPA 3CUJA 3NQ6A 3G1DA 4GO8A 1VEMA 3IJ6A 2VFEA 1LQAA 2V4IB 3IVSA 5A6KA 2C18A 1EP1A 2E5CA 1GVYA 3ITOA 4HPJA 5KSWA 4DJEA 2OPJA 2WZEA 4XBJA 7TIMA 2F6XA 2PP3A 2X41A 3LMYA 4QNEA 3SQMA 5GVJA 5HNNA 1YHTA 1EHNA 1UC5A 3MCOA 3GSMA 3BAXA 1HX0A 3OTRA 1JULA 4NRRA 2V3EA 3WJSA 1QWKA 3BCFA 1WA3A 4RPPA 3MANA 3LLXA 3P3BA 2CZEA 2DIJA 4TVCA 2PDKA 1LQ2A 4KCWA 1WDQA 2OZ0A 3VIIA 2ZZ1A 5IFTA 4O1DA 1WQ5A 4O14A 2QVHA 2BVDA 6ALDA 4JTQA 4UTTC 4KERA 2PBGA 2WHMA 4WXZA 1RY0A 3GD6A 5XIAA 4HU4A 2FMOA 1Q6RA 3T78A 1GJPA 3MO7A 3T4WA 1IE7C 3QV6A 1PTDA 2CESA 4N9EA 3NOEA 5C70A 4JQ2A 3JZUA 3W7EA 2ZRZA 2GGHA 5DMMA 5JUVA 4MFDA 1VJSA 3TFXA 3LS9A 1V51A 4JL2A 5FESA 1J0HA 3MJMA 3TUUA 4WJEA 5AHLA 3C52A 2B7NA 4ZCWA 3BQ6A 2PD9A 1NDZA 2W0UA 4CGTA 1UP0A 2VDHA 2CW6A 5T8GA 1L8PA 1TIWA 1Q6DA 4DM2A 1SR9A 4HPXA 1TPDA 4CNSA 4DF2A 3VC5A 3CZ8A 5LSMA 3L4VA 1CPUA 3L2LA 5G2IA 2VFIA 3CZKA 4JN7A 3MVTA 4Q8PA 1X6UA 3B0VC 2Z24A 4O52A 1LWIA 2XH7A 2YFNA 5D03A 2WNZA 3W81A 1VPXA 1NP0A 3QH2A 4ADTA 3AIBA 3P60A 2HJPA 2C15A 4KPLA 2VFGA 3CV6A 4FXSA 2GOKA 4NSBA 2YLAA 2VX4A 3WK1A 1US2A 3CM4A 1V6WA 1QDSA 4AEOA 1NM9A 5HR6A 1H7NA 3PTQA 4LUIA 4TVUA 1N7KA 1PXGA 1E0XA 3UR5A 4DBUA 3OVPA 1ME9A 2A2IA 3BLPX 4OOUA 3WK3A 3FYPA 2RJHA 3E3HA 4I8YA 4O12A 1S2AA 2V0TA 1YTDA 1LWJA 4P8UA 2VYOA 3NQEA 1YPXA 4IISA 3EB2A 1T6MA 3QM3A 3TCSA 2PF8A 1XYBA 3W71A 4LS1A 5HULA 2QPUA 3CHCA 4O54A 3TLQA 4YYCA 4PYSA 1M5WA 2A7PA 4CCZA 3NAVA 3QOMA 4BZYA 3H24A 3MMTA 1QATA 2CXGA 4AEEA 3KZPA 3RDKA 4INFA 1KM4A 1B5TA 3AISA 4HD5A 4HKPA 2WXDM 1GHSA 4JS3A 5L9FA 1FWTA 3NYZA 3UJRA 1XDJA 3LPGA 3ARPA 2ZX7A 1JDCA 5F4SA 3LBMA 4LVFA 3WQGA 2DZVA 5T9BG 3HGJA 4EWJA 2Y8UA 3BLOA 5SWUA 1NIUA 1ODUA 1QI5A 4KWVA 2VGIA 3FNDA 5BCAA 4XO6A 3A6OA 2CZFA 2Z1BA 3ARQA 2ZXAA 4DPQA 1XLEA 1XLGA 3ZIZA 1CWYA 1SYTA 3WMSA 4GVIA 3BMXA 1C93A 1OJPA 4DWSC 1WKFA 4DUOA 3HFYA 3STGA 1EDQA 3NSXA 1WZMA 3VNYA 4IMGA 4J3SA 5GNZA 4PMRA 1K02A 1TMQA 3KBWA 1O4UA 2ACSA 4RW5A 3MBDA 3RITA 4KRZA 1F6KA 5DY2A 2GSJA 3W23A 1UASA 2OELA 3DESA 4B4FA 4A2SA 4O18A 3S5ZA 3LN3A 3T2QA 2J25A 1R0MA 3FJNA 3H4GA 1GNXA 4LYQA 2ZADA 5D32A 1D3HA 3MPGA 5FJOA 3RR1A 1AW5A 4JYDA 3W24A 3W53A 5A6BD 3BLLA 2CLKA 4O0KA 1ISWA 2BS9A 2OOGA 1DEDA 1XBZA 4Y8FA 2WM1A 2O9PA 5HBFA 3T0CA 1UWRA 3KRSA 3EA1A 5ABTA 2BY1A 2VZKD 1JI1A 3WUGA 1IEIA 8A3HA 1TTQA 4HHPA 3P5ZA 1OF8A 1Z8AA 3ZOAA 3ZSTA 4XQ6A 4L9YA 3QQ1A 4CU6A 3VCRA 4LF1A 2G50A 2NUYA 2QV5A 3CB8A 4U2YA 5D4YA 4BQ3A 1J6PA 3O8AA 3SM0A 4DLMA 4JTEA 5CZKA 3LTSA 4K8EA 3W84A 2FDSA 3DXIA 4F48A 1OM0A 2OYLA 4ZE5A 3P14A 1DQXA 2QUVA 1O5XA 1JR1A 4UTLA 1W1VA 4J3VA 1JPKA 1QCWA 1AZ1A 2AQOA 3RCMA 1ZP3A 1V0MA 1XCXA 2ICSA 4GC4A 3SI9A 2GVJA 1M65A 3E2SA 3QXBA 7ODCA 3M41A 2V3FA 1TSIA 1M01A 4H7CA 1OBAA 2PURA 4EPEC 3QGKC 1JD9A 1M41A 3AHTA 3BPWA 3PUDA 1E1CB 3UG4A 1TJPA 3DERA 3BURA 3AIQA 1MW0A 3QQ0A 1DJXA 3A12A 4DUXA 5D37A 5A8PA 2C1HA 2V5JA 4GVHA 4AB4A 4PA8A 1ESWA 4A3QA 3N14A 4NI8A 2FIQA 5DFAA 3T2PA 3P93A 3TW9A 2YL8A 2HK0A 3HPAA 3TYUA 1BKSA 1E9LA 1FXQA 1OC5A 3RRAA 2B7PA 4PUNA 2CBUA 4LV9A 1KB3A 4UOQA 2YEPB 5A6LA 1J18A 4O57A 4GQGA 3MYOA 1CLKA 2PWHA 1QHPA 5K4XA 3UXKA 4H9ZA 4FR1A 3WZ0E 1H60A 3KZSA 1QO2A 2VOTA 1GVQA 1UG6A 4O1BA 2QYGA 3KAOA 1EYWA 5A2AA 4B5VA 1PX3A 1XYMA 3ZJKA 4JAWA 3RMJA 4XWUA 2AL2A 3KWSA 4W5ZA 3V5FA 1QNSA 4UR7A 4TTUA 3VC6A 3TYCA 1TR1A 5CGTA 4GBDA 5GNXA 4RNIA 1G4EA 1DYSA 2VFHA 4LVGA 4NZCA 1FWAC 3H7UA 4ZBCA 2NSOA 1TMLA 2ZUVA 2IMRA 4ECLA 3FDKA 1XICA 4Q4PA 1NEYA 1FX6A 1OC6A 3WX7A 3A4JA 2VZOA 4B5UA 3W7DA 2OEMA 3GU1A 3W7OA 5CSYA 2PRHA 1H3GA 3ME3A 3NXLA 2PDMA 3DUGA 1RQBA 1TR9A 2ZYFA 2XFYA 4S2BA 3SECA 2PPGA 2DVXA 1U5HA 1XGZA 3PZGA 2ZUNA 1VD6A 4QDWA 3O6DA 2TAAA 5HWNA 4MB3A 1QHZA 2GJNA 1Y0EA 5HUOA 4DI8A 5AY7A 1QR7A 2D2GA 3FJ6A 1GOWA 3DCPA 1T7LA 3ZR6A 3RCYA 1MDLA 4LOCA 4QSFA 1DWAM 1PYMA 1H4PA 3NL2A 1P48A 5JVLA 3GM8A 1TTIA 2PTYA 2ADAA 2PP0A 4J35A 4O4WA 1WDRA 4IPPA 3IJ7A 2KAUC 1U5JA 1VH7A