2WMOA

Structure of the complex between dock9 and cdc42.
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
423
structure length
403
Chain Sequence
b'STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEAHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVAGPLAYARAFLDDPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 149
structure length 403
sequence length 423
ec nomenclature
pdb deposition date 2009-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wmoA03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wmoA01
3B13A 2WM9A 2WMNA 2WMOA 3VHLA 2YINA
chains in the Genus database with same CATH superfamily
5KBAA 1DVPA 2QA7A 3VLDA 3DPDA 4Z91A 1A5EA 4WBOA 2E5LT 4F6RC 2XGMA 3U9WA 4C0EA 3N2GE 3NB2A 4BFRA 2XAFB 2LO6A 3IEEA 3SO8A 5F8PA 5D0QD 2L9BA 5D0OD 2I2OA 3B13A 3I4GA 2PFVA 1UW4B 2VQ2A 5HCMA 2XHEB 3UU8A 2UUAT 4GA2A 5AFUL 2EHOC 4YHHT 4GYSA 1WRDA 4ISTA 2C0SA 4O2AE 1O5MA 4JEHB 2WQHA 1N9AA 5CB4E 2ETAA 4NPPA 4I4TE 2GK9A 4RG9A 3I5PA 5CA1E 3NOGD 2FJDA 2X0YA 1YW0A 2FF4A 3ABME 5T8IA 2DZOA 3LXUX 3AAEB 5BMVE 4GYWA 5ABFA 4CXXA 4HKAA 3RO3A 3ANWB 3RRWA 2HO1A 3GW4A 3ZJ2A 3CVPA 4XI9A 2DNXA 4EZHA 3QWWA 3SNXA 4U0ZA 4A56A 2NTXA 3NOCD 4EBAA 2XASB 3AS5A 4BETA 5KX5E 3Q9NC 2NW9A 2V7JA 4AXPA 4AQYT 4X5TA 4GKKT 4KT6B 1AP7A 4HBDA 4P29A 3PE3A 4JV5T 3QB5K 1UURA 3LBXB 4ZS3A 2M6IA 2AXVA 5AQLB 4XAXB 2KATA 2XEVA 4U95D 4GTTA 4GZ6A 2IO3C 5JHAA 3ZSSA 3ENEA 3LEWA 2IJGX 1HTJF 3ASOE 5CRUA 2Q9QD 1KPSB 2JJ9A 3KS2A 3J5PA 1NEKA 3BQIA 3E32A 1XNQT 2ZMAA 4YJ3E 3UM3A 4F1SA 3QC1A 3B7TA 1TYQG 3E34A 4EYYR 2UXXB 3CPZA 1T7SA 1N4SA 4N5QA 2SPCA 2V7MA 3ZYMA 2DWKA 3UM2A 5L3DB 4E85A 5ADXL 3S7JA 4K0KT 2PJQA 1HXIA 3AEBA 1D9SA 4GZ5A 1S64A 4KYOB 2XY8B 5L3BB 1XMOT 3DEPA 2Q9QB 3LFMA 5CEDB 4F53A 3UU3A 3W15B 1INZA 4NXNT 5FIOA 4FU3A 3EJNA 3S2AA 3TL5A 4ILUA 4HTEA 3I3NA 4GYYA 2IEJA 4UWKA 1HF8A 4RQIA 4LFCT 2V6XA 1SZ9A 4CEMA 2VKHA 4CZZB 4OAVB 3KFWX 3T8OA 1TN8A 1N95A 2CHNA 4U8HA 2WXRA 3UT8A 4WYVA 4FJYA 2R05A 1HX1B 5CBOA 1XMQT 1H0AA 2X38A 3S7BA 2UUCT 3UT7A 3AECA 4ADZA 1UN9A 4XZ4A 2WQYA 5M4YA 4HWCA 4DV7T 4JEUB 4U7YA 5JH7E 3WI3A 3OYXA 4KVMA 1D0XA 3DJBA 3N71A 3DXKG 3EHNA 3EVYA 2CG2A 3FHEA 2IY0C 5J2TE 3SWHA 5FNVE 4ZI3C 3AU4A 2GRNB 4RLYA 4CYMD 4EYUA 1H2VC 5ARGA 2J9QA 5B1BE 4DI4A 5JR9C 1KNPA 3VKHA 3EHQA 4B93B 4TXPA 3AEFA 3PU8A 4FLHA 3GMIA 2XQ4A 3ZCIA 2ZISA 2LXLA 3LBXA 5B3SE 4DV6T 4GZDA 2EIJE 4H9OC 3K1SA 4GMRA 5HWXA 3FU6A 4AKRB 1H6KA 3C98B 4H7XA 3B5MA 4PH4B 1HZ4A 2ZU6B 5HKPA 2P9SG 1IZNB 2YQ8A 3FUIA 1IBMT 4LF7T 3FTYA 3AEDA 5DQVA 1PAQA 1DC2A 3I1AA 2DCPA 3P8CD 2X9HA 4B3ST 4I0UA 1QQEA 3A8YC 2Y69E 2YOEA 3NWIA 4L1BA 4DUYT 5E75A 5M72A 5FY1A 4PUCA 5LCWC 2IAKA 5GONE 2FO7A 3UUBA 2R03A 4DPRA 4P09A 3FH8A 4PFOA 4ILIA 4DVDA 4AKIA 3CVRA 3ZT7A 3FTUA 5LCYA 4O1OA 3WAJA 4HORA 1YCSB 4ZZBA 4EQFA 3ZSTA 4H63V 4YY3T 5C3JA 3APCA 3RK6A 4LF4T 3T9KA 3FTWA 3VTXA 3FBLA 1IJ6A 4I17A 2N2NA 3N2OA 1R8IA 1ZHCA 4ACLA 4WNGA 1UCUA 5HI7A 3DSVA 2NOXA 3HXCA 1IHBA 2L8KA 1UG3A 4G25A 3KEAA 2GGFA 5TAOA 4UVCB 4AI6A 4QX7B 2WP9A 1J1JA 4QKNA 4Z68A 3KVAA 3FZMB 5HEHA 3RYCE 4IYPA 1K8KG 5BR8T 1V54E 4HFGA 2RG8A 3RC3A 3LK42 4YT0A 3O9XA 4KMOA 2XQYA 3TLUA 4DI3A 4DO0A 4CN6A 4AM9A 2V6YB 1U5PA 2H89A 5LGUB 3C5RA 5DJQC 2NTYA 2N9DA 2OVBA 4QXCB 2KXPC 3ML8A 5LYJE 4KXKB 4MFRA 4U8VD 4GMJA 4DX2A 4J7WA 1TEZA 5FZQA 1ZKEA 2PZIA 3CVXA 2RA1A 4TV9E 2RFAA 4QWNB 4C91A 5FY7A 3AB3B 3L13A 2AJAA 2X9WA 3CK6A 3P4SA 1N34T 4AY6A 3N2KE 2CG3A 3Q2MA 3AXJA 4GPMA 3GN5A 2BKNA 5CMYA 3L09A 5BXUA 3T8MA 4RSYA 2X66A 1H19A 2W00A 4N2QA 2WZIA 3FY4A 2PTFA 1OWAA 2HYZA 4AOFA 2QFCA 5L3EB 1OCRE 3TWWA 2BVMA 4L2LA 1E7UA 4F3VA 1WM5A 4ZXLA 1VOMA 3N9PA 3AEGA 1W0BA 3D9IA 1UK5A 4GCNA 2YU1A 3QK6A 1LD7A 4M3OA 4HEAA 3ONKA 2XAQB 4AXHA 5C2TA 5KWDA 4EEDA 1MZCA 4C9BB 2A3DA 3QOUA 3V5SA 4J0UA 1NL4A 2C5IT 2E2EA 2NYJA 4U2YA 4UI9J 3HKDE 5LBMA 3HKBE 4KX6A 1UUSA 2BS2A 4P0AA 2C5KT 3I0OA 3NRYA 2ZGGA 4B94A 1AJ3A 3ZVVA 3RC8A 3N9MA 2H7VC 1HNWT 2HPJA 4I55E 4EZJA 4IREA 5D2MC 4GZ3A 4XI0A 4XE0A 4O4IE 3UU5A 2ZLYA 5JREA 3VLEA 1HX8A 2R17C 3D9NA 5G04C 2JABA 1OWMA 3D0TA 3S7DA 3UKRG 4EBAG 1U4QA 3J9X1 1MX2A 5LB7B 1HH8A 1B7TA 3ESLA 3AE6A 1DU2A 4WNFA 5G55A 2XQ7A 5FQ7A 1LF8A 2XPKA 2IUBA 3QJZA 1NP7A 3L17A 2XAHB 4V1Av 4ME2A 3A7MA 3TKLB 4PAGA 3AA1B 3SBTB 5BT1A 3PS6A 3CVNA 4TZ4C 2P9IG 2P9PG 2LHNA 3BU8A 4QH5A 2PBIA 2XQ3A 4N78D 3U3IA 4BWRA 3RPUA 4GTPA 4K0UA 2V7LA 2E8IA 4HWHA 3CHOA 2W4XA 3U4TA 1KF6A 1O3XA 5KJNA 5J90A 2MPKA 2WDQA 4BTAA 1V9DA 4H63H 4QXBB 2WXKA 4MKTA 4EPZA 5BNWA 1XWMA 5AAOA 3CVWA 5EIBE 3B57A 3QARA 4QQIA 3CHSA 3G2SA 4HQDA 3ZMSB 3SFXA 4F1PA 4WUYA 2P9UG 3B7RL 3R84B 2Y4UA 3JCKC 2X9YA 2ONDA 4IL9A 4KZ0A 2VGEA 3MZKB 2WQ6A 2PG8A 1S35A 3CSFA 3ZHEB 2MTQA 1WYBA 2UU9T 2CBJA 3AE7A 2LLYA 3CGHA 3SF4A 3BK9A 1OT8A 2QYWA 1OEDA 5ANLA 5A1LA 4U07A 2LSKA 2FJAA 3SRZA 5HRYA 2WXIA 3FUDA 1XGWA 2BUGA 2QVAA 3QB5A 1WG0A 5BUZA 5EN5D 1WDYA 1SE7A 2H3RA 1G8XA 2ETCA 3UTMA 4PNIA 4U0SA 3C51A 2LOPA 5KMGP 3B95A 1ZEEA 3ONLA 2RPAA 3K3OA 3PEVB 4ZOLE 4DV2T 1OXJA 3PZ3A 5LHIB 3ZMZB 5FTPA 3GA8A 3OXLA 3CX8B 4U96D 2EILE 3CX6B 1NZNA 3JC6D 3JAFA 1TNUA 1MMDA 1WYCA 3AS8A 5ENTD 2JLBA 3RIAA 2I59A 3V5UA 3QAQA 4TWHA 2CXDA 2V5CA 4J8YA 3FZFB 4WNEA 2I0MA 3AU5A 3ZFWA 1E7PA 3FDHA 3GZSA 2LSGA 4APOA 4CCAA 4JB8P 5BV0A 2R5SA 3JAEA 5ABGA 4NXMT 3LJCA 4TV3A 5AQ7A 4GTOA 4C48B 3UMVA 4YSXA 4L7TA 3R7RA 5AN8A 3U3WA 2NXPA 3SHFA 2IC6A 1W09A 5FXWA 2WXMA 1NAFA 2F37A 5LX8A 4QX8B 1X81A 2DI4A 5EX0A 2P58C 4ATGA 1D0ZA 2VQFT 3F57A 4DUIA 3FUJA 3C50A 1MX4A 2YNQA 1ZBPA 1W0AA 3L54A 4J2CA 4NIQA 5J0ZA 3L08A 4DK5A 3LK3B 2J09A 3UQ7A 1IXVA 5L3GB 3UT5E 5FT9A 5ABFB 4ANUA 2BTDA 3FUEA 4YDOA 3RRUA 2DZNA 4L2YA 2MAWA 2WDVA 2Z6EA 4CDMA 3FUNA 3BG1B 2LRLA 3T1HT 1E8XA 4HS2A 1A17A 3PURA 2LXMA 2G0UA 5CBNA 5ITZF 1QBQA 5HEGA 4O4JE 1I6ZA 1JCQA 2LSUA 3OVUA 3L9TA 4A1GA 3H3AA 3I9YA 5LMNT 3IA3A 5FYMA 2WBLA 3RRCA 4GMLA 2L0IA 1BR2A 2DLRA 4M1PA 3FTZA 3LPZA 3LVRE 3RYIE 3AVRA 3CVUA 4U63A 5KCMA 2YDRA 3WG7E 4HRLA 3PUGA 1OUVA 4AQFC 5LXTE 4YTNA 1ZV4X 2CPTA 3ZU7B 3CVVA 4GA0A 5L47A 4FADA 4TWFA 4IT4A 2OA5A 3ULQA 4IL4A 1WR0A 4LUNU 4PK4A 2X6JA 3C64A 1UOHA 1FPPA 5AYWD 3UU4A 5FZSA 4JYAT 5HQ8A 2W2UA 4G2AA 4JL0A 2VTBA 4IDNA 3ZEFA 3CHPA 2MYOA 4KMCA 3FU5A 2QC9A 3ULYA 3HHMA 2HM8A 3LVQE 2WXGA 4J8EA 2IQCA 4N3AA 3NKZA 2Q7FA 3FZHB 3RKOA 4DMVA 1JUQA 4UR9A 1IHGA 3PJAJ 1IYGA 1FMWA 1G73A 2I1KA 3Q73A 2LKHA 3EU5A 3SFDA 1LKXA 3I4RB 4MS6A 3TGOA 4WNKA 4GAAA 3ZMVB 3TXNA 4HXIA 4YVQC 1EYHA 2CXFA 3N9OA 2VL8A 4RVBA 3O1JA 3R7QA 2HH7A 3W9FA 3ZPJA 3JUIA 3ZYQA 5HXRA 3ZXSA 3NF1A 3JYSA 3IKOB 3LY8A 1JCRA 3PTRB 3DEOA 3Q5MA 4F7AA 4ERRA 3IBEA 2KINB 3E0ZA 3ABKE 3PZ2A 4YDYA 4CT4A 2WWVA 1ZB1A 2P9BA 2CLYC 2LRKA 3ZJ1A 3MCXA 2KWIB 5G05J 4YJ2E 1MNEA 2YHEA 3RU0A 3ZN0B 1FT1A 2FI7A 4NACA 3KAEA 1Q2ZA 4XKBA 2UXBT 3FHNA 4X1KE 3AVSA 4YSYA 1JWFA 3UX4A 2LSYA 3ZMUB 3FUKA 4AP2A 3FEXA 4UUCA 1HU3A 4U7IA 1TNYA 1SA0E 5IY5E 2KWHA 5EX3A 2F8XK 3UFEA 4BJMA 4H9QC 4IDZA 1MIVA 4ZI2C 4CXWA 4U3CA 5L3FB 3NAWA 2AXDS 3PE4A 5FXVA 4CN1A 4J6IA 3FXEB 4X20E 4BTBA 3C4WA 3L3PA 1BR0A 3ZUVB 3D9OA 2AE9A 4OVUA 3OAWA 2N1GA 2E9XD 3SFZA 3RYHE 2HHHT 4L9PA 2C0LA 4AKLA 4EB6E 2OOEA 2PM7A 5ABHA 5C8YE 2IF4A 4GK5E 5L3CB 3VRBA 4NUVA 3KVBA 3P7IA 5IYZE 4IE4A 5L4EA 5J08A 2LKGA 2OV9A 2ZM8A 1JWGA 2BBHA 4WBNE 1KZPA 3UFGA 3AE5A 2XQ6A 2J4BA 4GYOA 3IXEA 3OYZA 2WXHA 3SQVA 3ZXPA 3M65A 3N5LA 4UWFA 4CI2B 2Y6XA 5AJDA 4HWDA 2J07A 4JBWF 4WWPA 3PH0C 3W9GA 3D9MA 1LRZA 3CVYA 1LVFA 2CCQA 5DBKA 2OV8A 2ZM6T 1Z5SC 3CSTA 5F3JA 4JXTA 3KBUA 2KNDA 2VGXA 4DBRA 5BXOA 3AAIA 3L8RA 2WMNA 2NWBA 4HFDA 2ZGDA 2ZM0A 4YDEA 5AQRB 3HA4A 3EHZA 4UVAB 3EI0A 3ZRHA 3UUNA 3KV4A 4EZLA 2EINE 4D10C 3PUVF 4DLOA 3MV3B 1KFYA 1BI8B 3ONXA 4IDPA 2HN2A 4FP7A 1VDYA 2LAIA 2WVIA 3FU3A 2LM9A 4AJWA 1BU9A 4P0BA 3L6AA 2DHRA 3RIUC 5FKYA 4ACKA 5JDHA 1YYHA 3FFLA 4LF8T 2BBJA 2UXCT 4OVVA 2XPZA 2MOZA 1WAO1 4Z8XA 2CHXA 3HRAA 2WPVA 4FHKA 2KZ7B 2MBGA 3AXJB 3PV0F 3ZC0A 3GN5B 2XGOA 2J1DG 3MK7C 4H7YA 1ELWA 4XKCA 2JPFA 3FZLB 2WXQA 1S0PA 2QY7A 3CHQA 3AE9A 2WB2A 4L5GA 2CA5A 5AQKB 3BQOA 2ZM2A 4OHFA 3Q15A 4DJAA 3UUXA 5A7DB 2NW8A 5AQTB 4K5BA 2B0OE 5A23A 4Q96A 3E22E 3PDYA 2VYIA 3CIAA 2VWAA 5FP3A 4ANWA 4BT9A 4PS3A 3ZN3A 4U0UA 4DR5T 3ZYKA 3DRAA 2FO1E 2F4VT 5F5WA 2X67A 2V5QC 2LSIA 1SUMB 2YU2A 4YXDA 4DR7T 4HB5A 4G23A 3JCFA 3AAAB 4CQIA 4YLHA 4PS7A 4ZS2A 2XJ7A 1UGOA 2XZEA 4UEMA 2XSAA 3QC9A 1FJGT 5J1GA 2L3LA 3DSUA 2E9XA 4DV1T 2MRIA 4GTVA 4Z90A 3VLFA 1W9RA 2AXZA 4X8QA 5LOVE 3FULA 3ZCJA 4N39A 1EPUA 1D0YA 3O48A 1T8BA 1FEWA 2V5FA 5LJNA 3L16A 5JRCA 4DRXE 4FA6A 4PFPA 5DABA 3KV9A 1IAPA 2H6FA 2UXNB 4JA9A 1N0RA 2NSZA 1E8YA 1WFDA 2LOSA 2IW5B 3ETVA 4DMWA 3VKGA 3UT4A 3X1DA 5ETWA 3ISMC 3LJNA 2GRMA 1WLXA 4B0ZA 3PUSA 3BEEA 2XM2A 1KT1A 1TNZA 2C2LA 3PJAA 2IC9A 4ASKA 4A3TA 3MKDA 1NI1A 1ZP0A 3FTSA 1SHZC 3EDUA 1KLXA 4N3BA 4ZFHA 5AQBA 2BKPA 4TNWA 5EYLA 4B8CB 3B7SA 3T8KA 3UIPC 1NA0A 4AIUA 3HKEE 3APDA 3CK7A 2DL1A 3PZDA 4EECA 1XZYA 2UY1A 2FJEA 2VASA 5AIJA 4Q94A 1NFIE 2KLQA 1E90A 2YN6A 3VTYA 2XQ9A 5FQ8A 1J5ET 3QDNA 2WM9A 4KP3C 4J8SA 5FY0A 3N9QA 4JUYA 2XPYA 3UM0A 2RKKA 3TWTA 3DP7A 1E8ZA 1GQEA 4CRWA 3HVEB 2R02A 1Y6IA 3HXEA 4UV9B 4BESA 3CQXC 3UXGA 3FH7A 2K48A 2QYJA 3SFEA 3N9LA 1OEDE 2CFUA 2WWUA 1PY1A 2FBNA 2L6JA 3Q5XA 5ARFA 1FVHA 1H6PA 1VRBA 2H88A 2X0LB 4UV8B 4E7SA 3HKCE 1OEDB 1MHQA 1MQSA 3DSTA 5EK4A 1DCEA 4NQ0A 3RJVA 4OFZA 4DX1A 5AQAA 4EEBA 4I2ZA 1XDPA 3ESKA 3URZA 4ZI7E 2DYRE 2FJBA 2ODVA 1Z3XA 3ASHA 5EIDA 3G06A 5BV1A 2IFUA 2KSRA 4ISSA 5LGNB 4HI8A 4LERA 2YDSA 1FIOA 3OXFA 2LJLA 4YNDA 4XBFB 1S70B 2JMHA 4CN4A 1RZ4A 4IDOA 3V2OA 5LA6E 5ENPD 2CFZA 5KNGA 2QYUA 4CGWA 2LUHA 3AG4E 4L23A 4UF0A 1HG2A 2ODUA 4TV8E 3V31A 1FMVA 3MJXA 4LNBA 4E7ZA 2BG9A 2J49A 3AE4A 3RKGA 2GRPB 4X62T 4DR1T 1K3ZD 2IMLA 4H9NC 3IHVA 3AEEA 4HI9A 4YVOA 5LOZA 2FULA 2JMKA 2Q9QC 2GRQB 2LT3A 3ZT5A 4EV6A 3SI5A 4N2SA 3O4ZA 3Q47B 3M3ZB 5H7PA 1KK7A 3J7Yq 4YSZA 4UIGA 1BR1A 1D8DA 1YQ4A 2YK0A 2H7OA 1K1BA 4I1AA 3MA9A 3JQ1A 3V2XA 2DWZA 5ENOD 3CX7B 5CA0E 3TLSA 2XSBA 5EK2A 4G63A 4B3RT 2D9DA 4A97A 3PDNA 2X0HA 4UXNB 4TUUA 1YMPA 4L0RA 1HS6A 3CV0A 4G8KA 5FQ4A 3RO2A 4FULA 3LY9A 5AQIB 3EABA 3EUHA 3CR3A 2X6IA 1XDOA 3NQPA 4GB9A 4BSZB 4LF9T 4ABNA 4UQZA 4YTPA 2F0YA 1OXZA 4BX8A 2V26A 5JA4D 4LG6A 1H7CA 4B89A 2CXLA 1ZU2A 1I94T 1PC2A 3PZ1A 3Q4AB 4A3VA 3ASFA 3LS8A 2JQ9A 3ZC1A 2EQXA 4BSXA 3D9PA 2EIKE 3HVEA 3ASGA 4TUYE 5AQGB 3EIQC 5HYAA 2XUEA 2C5JA 4QH4A 4GK0E 5HS0A 3QNKA 2KZTA 3EUVA 3CLJA 4PJMA 1Y64B 4LCTA 3NBNB 5LJMA 3MKQA 2W61A 4MLKA 3P2BA 5IHYA 3RQUA 4HOSA 5AQPB 1TJCA 3FTVA 2IHR1 5AQNB 2J47A 2P9LG 2XAGB 5FQ6A 5T4YA 5LBQB 3KD7A 3FH5A 3UM1A 4I2WA 5LCWJ 4O4HE 3PUWF 4EIWA 2X6HA 5AQHB 3O4XE 4LNUD 3E30A 4JI5T 2J8SD 4ZHQE 3UPVA 2KM4A 3P4QA 3CWZB 3HG0D 4ILHB 3SS1A 5FXXA 4J8FA 3P4WA 4IDQA 1E8WA 2VTBB 3ZEFB 3AAAC 5HCJA 3WAKA 2LE8A 4Q25A 3ZKJA 4KHPT 4K5CA 4AEZC 4UQXA 1FT2A 3PUKA 3PREA 3KV5A 5LNKA 3P4RA 3PVLA 3LKUA 4U7EB 4N3CA 3V79K 2BDEA 2VKDA 3CK9A 3PZ4A 5ENRD 2LM2A 2IOSA 2CEAA 4U33A 1N52A 4HFBA 4WW0A 4NRHB 5HXHA 3C3QA 3AE3A 2PM6A 4HLEA 2V8SV 3A5XA 3AA0B 3CMLA 2D0TA 4X64T 2LNIA 5E76A 1P5QA 4ILGA 3UU6A 3SD5A 1CHUA 3DWLG 3G2VA 4URKA 5KNHD 5AQJB 1D1AA 3PUZF 1XNRT 3Q5WA 3KV6A 2Y0BG 3C4ZA 3D3MA 3DXMG 4GCOA 4X1IE 1S94A 1WR6A 3T1YT 2A5UA 3FEYA 4BJNA 3E37A 3BQKA 4ZZCA 4Q69A 3CVLA 2EHOA 3H3MA 5FVKA 4HRMB 3UIOC 2FBWA 5LHGB 2XPIA 4BEPA 3FWVA 2BS3A 3PNTB 1QLBA 1IJ5A 3OBVE 4NURA 3AJIA 4A5XA 3NZPA 3ZMTB 5BPPA 2XEHA 2Y4TA 4WNDA 4V3IA 3UTKA 3UQ4A 1MMNA 2VSNA 2X68A 4N5CA 2CWYA 3Q7FA 4K0RA 1YXRA 3FUHA 4I1OB 2J62A 5FL0A 3Q79A 1L0VA 3E33A 2FUPA 5CCMA 4I6JA 2WQ7A 2J4DA 1AWCB 4CI3B 1MYOA 3FUMA 3TLTA 5AQUB 2Y48B 2QRXA 1LD8A 1N32T 3D9LA 3G2TA 4GU5A 4DR6T 2AW6A 4MALA 4UWGA 3GYZA 2CBIA 1E96B 4JI2T 2HPLA 3HI2A 1OWLA 4AIFA 5JR9B 5HWYA 3EHMA 3AE2A 5D66A 4CI1B 2V7IA 1E7VA 2WSSV 3JUEA 1X79A 1HE8A 1HS7A 2BVLA 2K3WA 4GYRA 3QKYA 2XEEA 3NVOA 3ZT6A 5DQWA 4ZHBA 2OLTA 3MACA 1QYMA 1NWMX 3ONLC 4XIFA 1UN8A 4A98A 3AG2E 4AKHA 2X6KA 3PRZA 1V55E 4KI0F 2YDQA 5EYPF 5LMUT 2WZHA 5DIZA 4WWNA 5G04J 3R9AB 2XRYA 3G2WA 4GTMA 3UQ3A 2XTLA 1KT0A 4KVOA 4TRQA 4BX9A 5C2YA 4AVXA 3TWUA 4IHJE 3LJ3A 2K9AA 3N9NA 1QSDA 5JJTA 3RGLA 4F8HA 5IUXA 3PUAA 1OY3D 1WY6A 1OWNA 3TWSA 1ELRA 2K24A 4G26A 2CWOA 5KJLA 4GIWA 4O8SA 1IQUA 2VGXB 2M63A 2XS1A 5CGMA 3CKDA 1WCRA 1TJFA 3TLWA 4I6EA 3LCAA 4IE5A 2XQ8A 3UUMA 4HFIA 4TX5A 3Q78A 4DX7D 4JZYA 1TN7A 3OJAA 4HLLA 4HRNA 2JQQA 2WXOA 4I43A 3Q9DA 4COFA 3RRMB 4OK0A 4RG6A 5HEUA 2B1EA 1JNZA 1K1AA 2UXDT 4QFVA 3MZLB 5FXZA 1VCTA 3MEKA 2VQET 5LGTB 2FEZA 4MBQA 4ZEYA 2PL2A 4K03A 2OEWA 2V0PA 2KXPB 3GWHA 2CHOA 3K9IA 1BLXB 2DWGA 4E6HA 1U2VG 2PQRA 3RIUA 3TWXA 5FZRA 3FZKB 4B3MT 2E0IA 5HEJA 3RYFE 3T5VA 2R6GF 2AVPA 3L39A 2Y3AA 4UQYA 1UJJA 1G3NB 3BUAA 4GTRA 4H9PC 4UWLA 1H2UA 4DX5D 4X1YE 1MMGA 2A2FX 1DNPA 4I6GA 4YHJA 2H6HA 2V4LA 4KUMB 4YTMA 4LF6T 2J08A 5JR9A 1SA4A 3SFYA 3X2QE 1OCCE 4FJOA 3AEAA 3UUXB 2VSYA 2X6FA 3MX3A 4JLEA 4U72A 3SZ7A 1HO8A 3HL6A 1N4PA 4X66T 3B7UX 2KCKA 4PK6A 5H6RB 4JI7T 4O60A 3E08A 4LMLA 3R6NA 2IU1A 3CQCB 2WCAA 1GW6A 5B1AE 1FCHA 4DIDB 4EZ4A 4DV3T 5L2LA 2A9UA 1UX5A 4G24A 5FMNA 2E9XB 2RFMA 4UI9C 4BERA 2CM0A 5CERB 5HXCA 2DVWA 1YKEB 3PEUB 3CK8A 3TG4A 4HFEA 5JRCB 4NUUA 3LDZA 5AQ9A 3B7BA 3ZN1B 4ATZD 4B8AA 1KZOA 4IGUA 2ZXWE 4DX6D 2VSXE 3EIJA 2HR2A 3ABVA 4JI1T 3JC6C 2CHZA 3IHYA 5T3RA 4C90A 2Y8DA 3RRNB 2H6GA 4XEIG 2XRZA 5JJ7A 5AQVB 4PS8A 2V1DB 2P9NG 5HAXA 2WMOA 3VU7H 4HFHA 4QH1A 3VRAA 1N4RA 4DV0T 3V30A 3ASDA 3ZGQA 2M67A 2XHEA 5HXEA 3SOLA 2UY1B 2L6BA 4JI3T 3ZPOA 1BR4A 3RAUA 2AXUA 3KSLA 3DTOA 3WXXA 4JEHA 3EAMA 2B6CA 1IQRA 3O1IA 2VGYA 5ENSD 3ZIMA 4KBMB 1JNRA 3EU9A 2GRRB 3OPCA 1QUUA 4PK5A 3DSXA 1CUNA 5ANRA 3P1UA 5CRVA 2M6BA 4EAHA 1MIWA 5KXJA 5CCLA 4IRUA 3ANWA 3CKBA 2LHRA 3RQWA 4MLPA 3T5XA 4HFVA 5LG3A 3EHRA 2NC9A 4EHMA 5JDGA 3Q7AA 4JHKA 3F31A 4PW8A 4GTSA 4FLBA 4IE7A 2VL0A 3IHRA 1SVXA 4HGAA 3OTNA 1FVFA 4O6FA 5L4HA 1X9BA 4DLQA 4GPKA 3RSEG 5EZYE 3Q49B 2KT9A 2ILRA 3Q5EA 3MYVA 4AQGA 1Z8UA 3PNLB 4HN9A 5CEAA 3D9HA 5CFBA 5HXSA 2XQ5A 5H6QB 3CVQA 3CEQA 2DYSE 2V8SE 2F8YA 1Y01A 1TN6A 1D1BA 3JXIA 3QB2A 2X9XA 4CZ2D 4X65T 4TUMA 3MJWA 1Z0PA 3FUFA 4L9IA 2XCBA 4FHJA 2IOLA 2ETBA 5FJYA 2NP9A 4UF0B 2NW7A 2BG9E 2KMFA 4TN7B 1U3DA 3CIRA 2UUBT 2C0MA 4I9CA 2AWIA 5LP0A 2BG9B 2BKKB 2IDOB 3TWQA 1Y8MA 1UX4A 3APFA 4U31A 3U64A 2X51A 2B76A 4UI9K 3RKVA 5FL1A 2Y1LE 2DBAA 3D9JA 3ZNGA 4GOUA 3ML9A 3LY7A 4JA7A 1KNZA 4DR2T 1D1CA 5AARA 4LF5T 4AY5A 4U2ZA 3FTXA 2Q9QA 1O1RA 1KNRA 4LFBT 2A4ZA 5AJLA 3FXDB 1IBLT 3PUXF 5A6CA 2CRBA 2BS4A 2NR4A 2JQHA 3ZLIA 2CHWA 3EDTB 2UWJG 3FU0A 3C3OA 2W66A 4WWOA 2JEKA 4FJZA 3HR0A 4HE8A 1O1TA 3OTOT 1S63A 2ZIRA 3ETUA 2X3MA 3AG3E 5AQFB 2RD0A 5JDQA 1Z3YA 5EKQD 5AQSB 1OCOE 4BY6A 4BT8A 5EDSA 4TXQA 4NIKA 3I0QA 2WXFA 3JQ0A 2W67A 3RF1A 4A63B 4CXYA 1H2TC 4JPSA 5LG4A 4UVBB 2J4GA 3VHLA 2WY2A 3KBTA 2WAUA 3C3RA 4DV5T 4W9RA 5HEOA 2L9QA 4ILAA 2MYSA 1HR0T 3IBPA 4JEUA 2I1JA 1M62A 2HE0A 3DSSA 2JQKA 1SW6A 2LSVA 2VKOA 1T72A 2BZBA 2CE7A 4AKGA 2V5DA 1HFAA 5ENNA 4OYJA 4LMKA 4WAFA 1JCSA 3MKRA 4JC8A 4HOQA 1SQMA 2DCFA 2KZTB 1M7KA 2LAHA 3PUJA 4CT0A 3AE8A 3MKQB 1N36T 3AS4A 5JDLA 3BQLA 2R59A 4XX5A 3QNUA 5CMWA 3VR8A 4OYKA 1SZAA 3VR9A 4PJLA 4Y6WA 1US7B 2D2SA 2VKJA 4HVBA 3TAXA 2XGSA 5AENA 2BKGA 3CHRA 2IIUA 3GZ2A 4YDWA 4O2BE 3C98A 4DR3T 2WB5A 4OX9T 4ILBA 3KSQA 2K5BB 3G2UA 3RX6A 1MMAA 5LHHB 1N11A 3D9KA 3F2EA 2BF0X 3PUQA 3HIZA 2QGSA 4R7LA 2V7KA 4WZXA 4F6RD 2H6IA 1HNZT 4B6XA 2KBXA 5JMND 2EIME 2GW1A 2D5UA 3AG1E 2E9XC 2VJ8A 3Q5DA 1YD8G 1LVKA 1B89A 3PE0A 1XNFA 3NBXX 1HNXT 2XQ0A 1IKND 2EHOD 2GROB 3ZYLA 4I50E 1EF1C 1L5JA 2JIWA 4TXRA 4QXHB 1TNOA 2MHKA 2YHCA 1YKHB 3P4PA 4LMJA 4XZCA 4LEUA 5BW8C 4DNDA 2BEDA 5LP6E 4HOTA 3AA6B 4J8DA 4ANJA 3JADA 2VK9A 1RW2A 2QZAA 4I1MA 3KDSE 2XM1A 5JQGE 3NZUA 2VB6A 1N54A 5AQMB 4TWDA 5KDMC 2KCLA 4AV7A 5JDMA 4JI8T 4IN3B 2EHOB 2DIWA 4JHJA 5EILA 3TG5A 1N94A 3BG0B 2WU5A 5FINA 1OWPA 1O1SA 5JJ6A 2HN1A 4LRZA 2V6YA 3C4XA 1NA3A 4KHZF 3ABLE 3ASNE 5JDFA 4HWFA 1BPOA 1N33T 2VVNA 1YA0A 4ANXA 3K3QC 3K8PC 1E1HB 2CLYB 4ZI2D 1MX6A 1W3BA 4IE6A 1QZ2A 4G1TA 3TXMA 3E4BA 1MJ0A 2ACXA 1JPLA 2LSJA 4DR4T 2L0TB 2LEHA 1BI7B 1Z6TA 3EDVA 3GZ1A 2P2CP 4BAYB 4B3TT 4GTQA 5G05C 4C0MA 2XENA 3QWVA 3TWVA 3MA5A 3AA7B 3R9MA 2CMRA 4FI5A 2PQNA 4EXTA 1EDUA 1OCZE 1BD8A 2OEVA 2VVSA 4DV4T 4ANVA 1NENA 4U8YD 2I6HA 1J5WA 4MHCA 3S4UA 3Q9UC 3MV2B 2IONA 4AQFA 5C1DA 2W63A 1HCIA 1ZOYA 3RLFF 4PDXA 2P9KG 1HG5A 4JW1A 3ULEG 2XZTG 5LFAA 3Q75A 2VURA 3HYMB 5ABEA 4O1PA 1D8EA 5ENQD 4EZKA 4IULA 2KC7A 3ONJA 4HWIB 1TR4A 3FB2A 3KEZA 4G8LA 4H9RC 1EZ3A 1UJKA 4LNGA 2BG9C 3OXGA 2W62A 4JI6T 3QOFA 2IO2C 4JI4T 3J5QB 2WU2A 5KJMA 4ILCA 4FC8A 3C72A 4LFAT 3MGBA 4H9SE 1N0QA 4K5AB 2GRLA 2XS8A 2WXPA 2D0UA 4JHRA 4GA1A 3LSVA 3U66A 2E5VA 5E0OA 3L22A 2WDRA 3S7FA 5JTGA 3UINC 3DBSA 3LDQB 3L82A 2RP4A 3O1HA 1OWOA 4QHOA 1KEYA 2E2AA 1H6OA 2PNNA 1IBKT 3NRXA 4I43B 3UULA 1VCSA 3TLVA 4YFSA 4CDRA 1YQ3A 4APFA 5JHBA 2V4HC 4UWHA 4DUZT 2OVFA 1QNFA 4ZI3D 1U3CA 3SGHA 2A5EA 4JD2G 4HOUA 1MNDA 4GKJT 5JDNA 2ES0A 4O4LE 5J2UE 4OYSA 2WXNA 3UKUG 4TNVA 5CECB 4LSZE 4G2VA 1MIYA 5EK3A 3RIBA 2YEVC 3FBZA 3RIFA 1LTXA 3AE1A 3IV0A 4HNAD 4UELA 4DBQA 3HXDA 1DCQA 3U78A 4JVSA 3CKCA 4IIJE 3I9WA 3LG7A 5G2NA 3SY2A 4OAUC 1T98A 5JVDE 3QWPA 4KZCA 3F6QA 3JXJA 4U74A 2MOWA 4HFCA 3RI5A 2KCVA 1TNBA 2YINA 4PJNA 1E2AA 4JI0T 2XQAA 3PU3A 1OEDC 2R2LA 3KINB 3ZHEA 4EGWA 5IWAT 2ACZA 4BA9A 4PJJA 4G11A 2A72A 3H37A 2JRKA 5FWQA 4IE0A 1ELKA 3ZW3A 1N4QA 5KJKA 5CHEE 3RH3A 4A1SA 3HXFA 3IEGA 3CHMA 2BKOA 3LYAA 4CDNA 3PUYF 5AQOB 2W0GA 2XZDG 4GZCA 2WS3A 2OCCE 3SBSA 3OKQA 3LK2B 3FP3A 4M7CA 1X5BA 3TWRA 4A55A 4I9EA 1SA5A 4AISA 4MBGA 2VSOE 4U04A 3IF8B 2WXJA 4P1NA 5CJ5A 2XCCA 3K3NA 4CGVA 3NZQA 3QUJA 4KBQA 3DPYA 3HXBA 3RHWA 3DSWA 4MRUA 3P50A 3HDXA 3NZSA 3TJPA 3UI2A 3CQGB 2YKSA 2XAJB 4EOZB 3MXZA 5AQQB 4Y6CA 2I9CA 3QK0A 3ZKRA 5FVLA 2WXLA
chains in the Genus database with same CATH topology
1DVPA 2QA7A 3VLDA 3DPDA 4WBOA 2XGMA 4F6RC 3U9WA 4C0EA 3N2GE 4BFRA 2XAFB 2LO6A 3IEEA 5F8PA 5D0QD 2L9BA 5D0OD 2I2OA 3B13A 3I4GA 2PFVA 1UW4B 2VQ2A 2XHEB 4GA2A 5AFUL 2EHOC 4GYSA 1WRDA 4ISTA 2C0SA 4O2AE 4JEHB 2WQHA 5CB4E 4I4TE 2GK9A 4RG9A 3I5PA 5CA1E 2FF4A 1YW0A 5T8IA 3LXUX 3AAEB 5BMVE 4GYWA 4CXXA 4HKAA 3RO3A 3ANWB 3RRWA 2HO1A 3GW4A 3ZJ2A 3CVPA 4XI9A 2DNXA 4EZHA 3QWWA 3SNXA 4U0ZA 4A56A 2NTXA 4EBAA 2XASB 3AS5A 5KX5E 2NW9A 2V7JA 4AXPA 4KT6B 4P29A 3PE3A 4ZS3A 3LBXB 2AXVA 4XAXB 2KATA 2XEVA 4GZ6A 5JHAA 3ENEA 3LEWA 2IJGX 1HTJF 2Q9QD 3KS2A 2JJ9A 3BQIA 2ZMAA 4YJ3E 4F1SA 3QC1A 3B7TA 4EYYR 2UXXB 3CPZA 2SPCA 2V7MA 3ZYMA 2DWKA 5L3DB 4E85A 5ADXL 3S7JA 2PJQA 1HXIA 4GZ5A 4KYOB 5L3BB 2Q9QB 3LFMA 4F53A 3W15B 1INZA 4FU3A 3EJNA 3S2AA 3TL5A 4ILUA 4HTEA 3I3NA 4GYYA 4UWKA 1HF8A 1SZ9A 4CEMA 2VKHA 4CZZB 3KFWX 3T8OA 4U8HA 2WXRA 3UT8A 4FJYA 1H0AA 2X38A 3S7BA 3UT7A 4ADZA 1UN9A 4XZ4A 5M4YA 4JEUB 5JH7E 3WI3A 3OYXA 4KVMA 1D0XA 3DJBA 3N71A 3EHNA 3EVYA 2CG2A 3FHEA 5J2TE 3SWHA 5FNVE 4ZI3C 3AU4A 4EYUA 1H2VC 5ARGA 2J9QA 4DI4A 5JR9C 3VKHA 3PU8A 4FLHA 3GMIA 3ZCIA 3LBXA 4GZDA 4H9OC 5HWXA 3FU6A 4AKRB 1H6KA 3C98B 4H7XA 4PH4B 1HZ4A 2ZU6B 1IZNB 2YQ8A 3FUIA 3FTYA 1PAQA 5DQVA 3I1AA 2DCPA 3P8CD 2X9HA 1QQEA 4L1BA 5E75A 5M72A 5FY1A 4PUCA 5LCWC 2FO7A 2IAKA 5GONE 4DPRA 4P09A 3FH8A 4PFOA 4ILIA 4DVDA 4AKIA 3CVRA 3FTUA 5LCYA 3WAJA 4HORA 4EQFA 4H63V 3APCA 3RK6A 3VTXA 3FTWA 3FBLA 1IJ6A 4I17A 2N2NA 3N2OA 1ZHCA 4ACLA 4WNGA 1UCUA 5HI7A 2NOXA 2L8KA 1UG3A 4G25A 2GGFA 5TAOA 4UVCB 4AI6A 4QX7B 4QKNA 3KVAA 3RYCE 4IYPA 4HFGA 2RG8A 3RC3A 3LK42 3O9XA 4KMOA 2XQYA 4DI3A 4DO0A 4AM9A 1U5PA 5LGUB 5DJQC 2NTYA 2N9DA 2OVBA 4QXCB 3ML8A 5LYJE 4KXKB 4MFRA 4GMJA 1TEZA 5FZQA 1ZKEA 2PZIA 3CVXA 2RA1A 4TV9E 4QWNB 4C91A 5FY7A 3AB3B 3L13A 2X9WA 4AY6A 3N2KE 2CG3A 3Q2MA 3GN5A 5CMYA 3L09A 3T8MA 4RSYA 2X66A 1H19A 2W00A 4N2QA 3FY4A 1OWAA 2HYZA 4AOFA 2QFCA 5L3EB 2BVMA 4L2LA 1E7UA 4F3VA 1WM5A 1VOMA 3N9PA 4GCNA 3D9IA 4M3OA 2YU1A 3QK6A 4HEAA 3ONKA 2XAQB 4AXHA 4C9BB 2A3DA 3QOUA 3V5SA 4J0UA 2C5IT 2E2EA 4UI9J 3HKDE 5LBMA 3HKBE 4P0AA 2C5KT 3I0OA 3NRYA 4B94A 1AJ3A 3ZVVA 3RC8A 3N9MA 2H7VC 2HPJA 4I55E 4EZJA 4GZ3A 4XI0A 4XE0A 4O4IE 3VLEA 2ZLYA 5JREA 1HX8A 2R17C 3D9NA 5G04C 1OWMA 3D0TA 3S7DA 4EBAG 1U4QA 3J9X1 1HH8A 1B7TA 3ESLA 4WNFA 5G55A 5FQ7A 1LF8A 3QJZA 1NP7A 3L17A 2XAHB 4V1Av 4ME2A 3TKLB 4PAGA 3AA1B 3SBTB 5BT1A 3PS6A 3CVNA 4TZ4C 2LHNA 2PBIA 4BWRA 4N78D 3U3IA 3RPUA 4K0UA 2V7LA 2E8IA 3CHOA 3U4TA 1O3XA 5KJNA 5J90A 4BTAA 1V9DA 4H63H 4QXBB 2WXKA 4MKTA 4EPZA 5BNWA 3CVWA 3B57A 3QARA 3CHSA 3G2SA 3ZMSB 4WUYA 3B7RL 3R84B 2Y4UA 3JCKC 2X9YA 2ONDA 4KZ0A 3MZKB 2WQ6A 2PG8A 1S35A 3CSFA 3ZHEB 2MTQA 1WYBA 3CGHA 3SF4A 3BK9A 5ANLA 5A1LA 4U07A 2LSKA 3SRZA 2WXIA 3FUDA 1XGWA 2BUGA 5BUZA 2H3RA 1G8XA 4PNIA 4U0SA 3C51A 2LOPA 5KMGP 1ZEEA 3ONLA 3K3OA 3PEVB 4ZOLE 5LHIB 3ZMZB 5FTPA 3GA8A 3OXLA 3CX8B 3CX6B 1NZNA 3JC6D 1MMDA 1WYCA 3AS8A 2JLBA 2I59A 3V5UA 3QAQA 2CXDA 4WNEA 3AU5A 3ZFWA 3FDHA 3GZSA 2LSGA 4APOA 4CCAA 5BV0A 2R5SA 3LJCA 4TV3A 3UMVA 4L7TA 3R7RA 3U3WA 2NXPA 3SHFA 2IC6A 5FXWA 2WXMA 1NAFA 5LX8A 4QX8B 5EX0A 2DI4A 2P58C 4ATGA 1D0ZA 3F57A 3FUJA 3C50A 2YNQA 1ZBPA 3L54A 4J2CA 3L08A 4DK5A 3LK3B 2J09A 5L3GB 3UT5E 5FT9A 4ANUA 2BTDA 3FUEA 3RRUA 4L2YA 2Z6EA 4CDMA 3FUNA 3BG1B 1E8XA 4HS2A 1A17A 3PURA 2G0UA 4O4JE 2LSUA 4A1GA 3H3AA 3I9YA 5FYMA 2WBLA 3RRCA 4GMLA 2L0IA 1BR2A 2DLRA 4M1PA 3FTZA 3LPZA 3LVRE 3RYIE 3AVRA 3CVUA 4U63A 5KCMA 3PUGA 1OUVA 4AQFC 5LXTE 1ZV4X 3CVVA 4GA0A 4FADA 2OA5A 3ULQA 4LUNU 4PK4A 2X6JA 3C64A 5AYWD 5FZSA 5HQ8A 4G2AA 4JL0A 2VTBA 3ZEFA 3CHPA 4KMCA 3FU5A 3HHMA 2HM8A 3LVQE 2WXGA 4J8EA 2IQCA 4N3AA 2Q7FA 3RKOA 4DMVA 1JUQA 1IHGA 1IYGA 1FMWA 1G73A 2I1KA 1LKXA 3I4RB 4MS6A 3TGOA 4WNKA 4GAAA 3ZMVB 3TXNA 4HXIA 4YVQC 1EYHA 2CXFA 3N9OA 2VL8A 4RVBA 3O1JA 3R7QA 2HH7A 3ZPJA 3JUIA 3ZYQA 5HXRA 3ZXSA 3NF1A 3JYSA 3IKOB 3LY8A 3PTRB 3Q5MA 4F7AA 4ERRA 3IBEA 2KINB 3E0ZA 4CT4A 2P9BA 2CLYC 3ZJ1A 3MCXA 2KWIB 5G05J 4YJ2E 1MNEA 2YHEA 3RU0A 3ZN0B 2FI7A 4NACA 3KAEA 4XKBA 3FHNA 4X1KE 3AVSA 1JWFA 3UX4A 2LSYA 3ZMUB 3FUKA 4AP2A 3FEXA 1HU3A 1SA0E 2KWHA 5EX3A 3UFEA 4BJMA 4H9QC 4IDZA 1MIVA 4ZI2C 4CXWA 5L3FB 3PE4A 5FXVA 4J6IA 3FXEB 4X20E 4BTBA 3C4WA 3L3PA 1BR0A 3D9OA 4OVUA 3OAWA 2N1GA 2E9XD 3SFZA 3RYHE 2C0LA 4AKLA 4EB6E 2OOEA 2PM7A 5C8YE 2IF4A 4GK5E 5L3CB 4NUVA 3KVBA 3P7IA 5IYZE 4IE4A 5J08A 1JWGA 2ZM8A 4WBNE 2J4BA 4GYOA 3OYZA 2WXHA 3M65A 3N5LA 4UWFA 4CI2B 2Y6XA 5AJDA 2J07A 4WWPA 3PH0C 3D9MA 1LRZA 3CVYA 1LVFA 2CCQA 5DBKA 2OV8A 3CSTA 5F3JA 4JXTA 3KBUA 2KNDA 2VGXA 4DBRA 3AAIA 2WMNA 2NWBA 2ZM0A 3HA4A 4UVAB 3ZRHA 3UUNA 3KV4A 4EZLA 4D10C 4DLOA 3MV3B 3ONXA 4FP7A 1VDYA 2WVIA 2LAIA 3FU3A 2LM9A 4AJWA 4P0BA 3L6AA 2DHRA 4ACKA 5JDHA 3FFLA 4OVVA 2XPZA 2MOZA 1WAO1 4Z8XA 2CHXA 2WPVA 4FHKA 2KZ7B 2MBGA 3ZC0A 3GN5B 2XGOA 2J1DG 3MK7C 4H7YA 1ELWA 4XKCA 2JPFA 2WXQA 1S0PA 2QY7A 3CHQA 2WB2A 4L5GA 2CA5A 2ZM2A 4OHFA 3Q15A 4DJAA 3UUXA 5A7DB 2NW8A 5A23A 4Q96A 3E22E 3PDYA 2VYIA 3CIAA 2VWAA 5FP3A 4ANWA 4BT9A 4PS3A 3ZN3A 4U0UA 3ZYKA 2X67A 2LSIA 2YU2A 4G23A 4CQIA 3AAAB 4YLHA 4PS7A 4ZS2A 4UEMA 3QC9A 5J1GA 2L3LA 2E9XA 2MRIA 3VLFA 2AXZA 5LOVE 3FULA 3ZCJA 4N39A 1EPUA 1D0YA 3O48A 2V5FA 1FEWA 3L16A 5LJNA 5JRCA 4FA6A 4PFPA 5DABA 3KV9A 1IAPA 2UXNB 4JA9A 2NSZA 1E8YA 2LOSA 2IW5B 3ETVA 4DMWA 3VKGA 3UT4A 5ETWA 2GRMA 1WLXA 4B0ZA 3PUSA 3BEEA 1KT1A 2C2LA 2IC9A 4ASKA 4A3TA 3MKDA 3FTSA 1SHZC 3EDUA 1KLXA 4N3BA 4B8CB 3B7SA 1NA0A 3HKEE 3APDA 3CK7A 3PZDA 4EECA 2UY1A 2VASA 5AIJA 4Q94A 2KLQA 1E90A 3VTYA 5FQ8A 3QDNA 2WM9A 4KP3C 4J8SA 5FY0A 3N9QA 4JUYA 2XPYA 3DP7A 1E8ZA 4CRWA 3HVEB 1Y6IA 4UV9B 3CQXC 3FH7A 2K48A 3N9LA 2CFUA 1PY1A 2L6JA 2FBNA 2WWUA 3Q5XA 5ARFA 1FVHA 1VRBA 2X0LB 4UV8B 4E7SA 3HKCE 1MHQA 1MQSA 5EK4A 4NQ0A 3RJVA 4OFZA 4I2ZA 3ESKA 3URZA 4ZI7E 3ASHA 2ODVA 1Z3XA 5BV1A 2IFUA 4ISSA 5LGNB 4LERA 3OXFA 1FIOA 2LJLA 4YNDA 4XBFB 2JMHA 5LA6E 2CFZA 4CGWA 4L23A 4UF0A 1HG2A 2ODUA 4TV8E 1FMVA 3MJXA 4E7ZA 2J49A 4H9NC 3IHVA 4YVOA 5LOZA 2FULA 2JMKA 2Q9QC 2LT3A 3SI5A 4N2SA 3O4ZA 3Q47B 1KK7A 3J7Yq 4UIGA 1BR1A 2YK0A 2H7OA 4I1AA 3MA9A 3JQ1A 3CX7B 5CA0E 5EK2A 4G63A 3PDNA 4UXNB 4TUUA 4L0RA 1HS6A 3CV0A 5FQ4A 3RO2A 4FULA 3LY9A 3EUHA 3CR3A 2X6IA 3NQPA 4GB9A 4ABNA 4UQZA 1OXZA 4BX8A 2V26A 1H7CA 4B89A 2CXLA 1ZU2A 1PC2A 3Q4AB 4A3VA 3ASFA 3LS8A 3ZC1A 2EQXA 4BSXA 3D9PA 3HVEA 3ASGA 4TUYE 3EIQC 5HYAA 2XUEA 2C5JA 4GK0E 3QNKA 2KZTA 3CLJA 4PJMA 1Y64B 4LCTA 5LJMA 3MKQA 2W61A 4MLKA 3P2BA 5IHYA 4HOSA 1TJCA 3FTVA 2XAGB 5FQ6A 5T4YA 5LBQB 3KD7A 3FH5A 4I2WA 5LCWJ 4O4HE 4EIWA 2X6HA 3O4XE 4ZHQE 3UPVA 2KM4A 3CWZB 4ILHB 3SS1A 5FXXA 4J8FA 1E8WA 2VTBB 3ZEFB 3WAKA 2LE8A 4AEZC 4UQXA 3PUKA 3PREA 3KV5A 5LNKA 3PVLA 3LKUA 4N3CA 2BDEA 2VKDA 3CK9A 2IOSA 2CEAA 1N52A 4WW0A 4NRHB 5HXHA 2PM6A 4HLEA 3A5XA 3AA0B 3CMLA 2D0TA 2LNIA 5E76A 1P5QA 4ILGA 3SD5A 3G2VA 4URKA 1D1AA 3Q5WA 3KV6A 3D3MA 3C4ZA 4GCOA 4X1IE 1S94A 1WR6A 2A5UA 3FEYA 4BJNA 3BQKA 4Q69A 3CVLA 2EHOA 5LHGB 2XPIA 3FWVA 3PNTB 1IJ5A 3OBVE 4NURA 3NZPA 3ZMTB 5BPPA 2Y4TA 4WNDA 4V3IA 3UTKA 1MMNA 2VSNA 2X68A 4N5CA 2CWYA 4K0RA 3FUHA 4I1OB 5CCMA 2WQ7A 4I6JA 2J4DA 4CI3B 3FUMA 2Y48B 3G2TA 3D9LA 4GU5A 2AW6A 4MALA 4UWGA 3GYZA 1E96B 4AIFA 2HPLA 3HI2A 1OWLA 5JR9B 5HWYA 3EHMA 4CI1B 2V7IA 1E7VA 2WSSV 1X79A 1HE8A 1HS7A 2BVLA 4GYRA 3QKYA 5DQWA 3MACA 1NWMX 4XIFA 1UN8A 4AKHA 2X6KA 3PRZA 5DIZA 4WWNA 5G04J 3R9AB 2XRYA 3G2WA 3UQ3A 2XTLA 1KT0A 4KVOA 4TRQA 4BX9A 5C2YA 4AVXA 4IHJE 3LJ3A 2K9AA 3N9NA 1QSDA 5JJTA 3PUAA 1WY6A 1OWNA 1ELRA 2K24A 4G26A 2CWOA 5KJLA 4GIWA 4O8SA 1IQUA 2VGXB 2M63A 3CKDA 1TJFA 4I6EA 3LCAA 4IE5A 3UUMA 4TX5A 4JZYA 3OJAA 2JQQA 2WXOA 4I43A 3Q9DA 3RRMB 4OK0A 4RG6A 2B1EA 4QFVA 3MZLB 5FXZA 3MEKA 2FEZA 5LGTB 4MBQA 2PL2A 4K03A 2V0PA 2KXPB 3GWHA 3K9IA 2DWGA 4E6HA 2PQRA 5FZRA 2E0IA 3RYFE 3T5VA 2AVPA 2Y3AA 4UQYA 1UJJA 4UWLA 4H9PC 1H2UA 4X1YE 1MMGA 2A2FX 1DNPA 4I6GA 4YHJA 2V4LA 4KUMB 2J08A 5JR9A 4FJOA 3UUXB 2VSYA 2X6FA 3MX3A 4JLEA 4U72A 3SZ7A 1HO8A 3HL6A 3B7UX 2KCKA 4PK6A 5H6RB 3E08A 3R6NA 2IU1A 3CQCB 1GW6A 1FCHA 4EZ4A 5L2LA 1UX5A 4G24A 5FMNA 2E9XB 4UI9C 2CM0A 5HXCA 1YKEB 3PEUB 3CK8A 3TG4A 5JRCB 4NUUA 3LDZA 3ZN1B 4B8AA 4IGUA 2VSXE 3EIJA 2HR2A 3JC6C 2CHZA 3IHYA 5T3RA 4C90A 2Y8DA 3RRNB 2XRZA 5JJ7A 4PS8A 2V1DB 5HAXA 2WMOA 3VU7H 3ASDA 3ZGQA 2M67A 2XHEA 5HXEA 3SOLA 2UY1B 3ZPOA 1BR4A 2AXUA 3DTOA 3WXXA 4JEHA 1IQRA 3O1IA 2VGYA 3ZIMA 4KBMB 1QUUA 4PK5A 1CUNA 5ANRA 3P1UA 4EAHA 1MIWA 5CCLA 4IRUA 3ANWA 3CKBA 2LHRA 4MLPA 3T5XA 4HFVA 2NC9A 5JDGA 4JHKA 3F31A 4PW8A 4FLBA 4IE7A 3IHRA 4HGAA 3OTNA 1FVFA 4O6FA 4DLQA 4GPKA 5EZYE 3Q49B 2KT9A 2ILRA 3MYVA 4AQGA 3PNLB 4HN9A 5HXSA 5H6QB 3CVQA 3CEQA 2V8SE 1D1BA 3QB2A 2X9XA 3MJWA 1Z0PA 3FUFA 4L9IA 2XCBA 4FHJA 2IOLA 5FJYA 2NP9A 4UF0B 2NW7A 2KMFA 4TN7B 1U3DA 4I9CA 2C0MA 2AWIA 5LP0A 1Y8MA 1UX4A 3APFA 3U64A 2X51A 4UI9K 3RKVA 2DBAA 3D9JA 4GOUA 3ML9A 3LY7A 4JA7A 1KNZA 1D1CA 4AY5A 3FTXA 2Q9QA 2A4ZA 5AJLA 3FXDB 5A6CA 2CHWA 3ZLIA 3EDTB 2UWJG 3FU0A 4WWOA 2JEKA 4FJZA 3HR0A 4HE8A 3ETUA 2X3MA 2RD0A 5JDQA 1Z3YA 5EKQD 4BY6A 4BT8A 5EDSA 3I0QA 2WXFA 3JQ0A 4CXYA 1H2TC 4JPSA 5LG4A 4UVBB 3VHLA 3KBTA 2WAUA 4W9RA 2L9QA 2MYSA 3IBPA 4JEUA 2I1JA 2LSVA 2VKOA 2BZBA 2CE7A 4AKGA 1HFAA 5ENNA 4OYJA 4WAFA 3MKRA 4JC8A 4HOQA 1SQMA 2DCFA 2KZTB 2LAHA 3PUJA 4CT0A 3MKQB 3AS4A 5JDLA 3BQLA 2R59A 4XX5A 5CMWA 4OYKA 1SZAA 4PJLA 4Y6WA 1US7B 2D2SA 2VKJA 4HVBA 3TAXA 2XGSA 5AENA 3CHRA 3GZ2A 4O2BE 3C98A 3G2UA 2K5BB 3RX6A 1MMAA 5LHHB 3D9KA 3F2EA 2BF0X 3PUQA 3HIZA 2QGSA 4R7LA 2V7KA 4B6XA 2GW1A 2D5UA 2E9XC 2VJ8A 1YD8G 1LVKA 1B89A 3PE0A 1XNFA 3NBXX 2XQ0A 2EHOD 3ZYLA 4I50E 1EF1C 1L5JA 4QXHB 2MHKA 2YHCA 1YKHB 4XZCA 4LEUA 5BW8C 4DNDA 5LP6E 4HOTA 3AA6B 4J8DA 4ANJA 2VK9A 4I1MA 3KDSE 5JQGE 3NZUA 2VB6A 1N54A 5KDMC 2KCLA 4AV7A 5JDMA 4IN3B 2EHOB 2DIWA 4JHJA 3TG5A 3BG0B 1OWPA 5JJ6A 4LRZA 3C4XA 1NA3A 5JDFA 1BPOA 1YA0A 4ANXA 3K3QC 3K8PC 1E1HB 2CLYB 4ZI2D 1W3BA 4IE6A 1QZ2A 4G1TA 3TXMA 3E4BA 2ACXA 1JPLA 2LSJA 2L0TB 2LEHA 1Z6TA 3EDVA 3GZ1A 4BAYB 5G05C 4C0MA 3QWVA 3MA5A 3AA7B 2CMRA 4FI5A 2PQNA 4EXTA 1EDUA 4ANVA 2I6HA 4MHCA 3S4UA 3MV2B 2IONA 4AQFA 5C1DA 2W63A 1HCIA 4PDXA 1HG5A 4JW1A 5LFAA 3HYMB 4EZKA 4IULA 2KC7A 3FB2A 3KEZA 4H9RC 1EZ3A 1UJKA 3OXGA 2W62A 5KJMA 4FC8A 3MGBA 4H9SE 2GRLA 2WXPA 2D0UA 4JHRA 4GA1A 3U66A 5E0OA 3L22A 3S7FA 3DBSA 2RP4A 3O1HA 1OWOA 4QHOA 3NRXA 4I43B 3UULA 4YFSA 4CDRA 4APFA 5JHBA 4UWHA 2OVFA 1QNFA 4ZI3D 1U3CA 3SGHA 4HOUA 1MNDA 5JDNA 2ES0A 4O4LE 5J2UE 4OYSA 2WXNA 4G2VA 1MIYA 5EK3A 3RIBA 2YEVC 3FBZA 3IV0A 4UELA 4DBQA 4JVSA 3U78A 3CKCA 4IIJE 3I9WA 3LG7A 5G2NA 1T98A 5JVDE 3QWPA 4KZCA 4U74A 2MOWA 2KCVA 2YINA 4PJNA 3PU3A 3KINB 3ZHEA 4BA9A 4PJJA 4G11A 2A72A 3H37A 2JRKA 5FWQA 4IE0A 1ELKA 3ZW3A 5KJKA 5CHEE 3RH3A 4A1SA 3IEGA 3CHMA 3LYAA 4CDNA 2W0GA 4GZCA 3SBSA 3OKQA 3LK2B 3FP3A 4A55A 1X5BA 4I9EA 2VSOE 4U04A 3IF8B 2WXJA 2XCCA 3K3NA 4CGVA 3NZQA 3QUJA 4KBQA 4MRUA 3HDXA 3NZSA 3TJPA 3CQGB 2XAJB 4EOZB 3MXZA 4Y6CA 2I9CA 3QK0A 2WXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B13 A;  2WM9 A;  2WMN A;  2WMO A;  3VHL A;  2YIN A; 
#chains in the Genus database with same CATH topology
 5KBA A;  1DVP A;  2QA7 A;  3VLD A;  3DPD A;  4Z91 A;  1A5E A;  4WBO A;  2E5L T;  4F6R C;  2XGM A;  3U9W A;  4C0E A;  3N2G E;  3NB2 A;  4BFR A;  2XAF B;  2LO6 A;  3IEE A;  3SO8 A;  5F8P A;  5D0Q D;  2L9B A;  5D0O D;  2I2O A;  3B13 A;  3I4G A;  2PFV A;  1UW4 B;  2VQ2 A;  5HCM A;  2XHE B;  3UU8 A;  2UUA T;  4GA2 A;  5AFU L;  2EHO C;  4YHH T;  4GYS A;  1WRD A;  4IST A;  2C0S A;  4O2A E;  1O5M A;  4JEH B;  2WQH A;  1N9A A;  5CB4 E;  2ETA A;  4NPP A;  4I4T E;  2GK9 A;  4RG9 A;  3I5P A;  5CA1 E;  3NOG D;  2FJD A;  2X0Y A;  1YW0 A;  2FF4 A;  3ABM E;  5T8I A;  2DZO A;  3LXU X;  3AAE B;  5BMV E;  4GYW A;  5ABF A;  4CXX A;  4HKA A;  3RO3 A;  3ANW B;  3RRW A;  2HO1 A;  3GW4 A;  3ZJ2 A;  3CVP A;  4XI9 A;  2DNX A;  4EZH A;  3QWW A;  3SNX A;  4U0Z A;  4A56 A;  2NTX A;  3NOC D;  4EBA A;  2XAS B;  3AS5 A;  4BET A;  5KX5 E;  3Q9N C;  2NW9 A;  2V7J A;  4AXP A;  4AQY T;  4X5T A;  4GKK T;  4KT6 B;  1AP7 A;  4HBD A;  4P29 A;  3PE3 A;  4JV5 T;  3QB5 K;  1UUR A;  3LBX B;  4ZS3 A;  2M6I A;  2AXV A;  5AQL B;  4XAX B;  2KAT A;  2XEV A;  4U95 D;  4GTT A;  4GZ6 A;  2IO3 C;  5JHA A;  3ZSS A;  3ENE A;  3LEW A;  2IJG X;  1HTJ F;  3ASO E;  5CRU A;  2Q9Q D;  1KPS B;  2JJ9 A;  3KS2 A;  3J5P A;  1NEK A;  3BQI A;  3E32 A;  1XNQ T;  2ZMA A;  4YJ3 E;  3UM3 A;  4F1S A;  3QC1 A;  3B7T A;  1TYQ G;  3E34 A;  4EYY R;  2UXX B;  3CPZ A;  1T7S A;  1N4S A;  4N5Q A;  2SPC A;  2V7M A;  3ZYM A;  2DWK A;  3UM2 A;  5L3D B;  4E85 A;  5ADX L;  3S7J A;  4K0K T;  2PJQ A;  1HXI A;  3AEB A;  1D9S A;  4GZ5 A;  1S64 A;  4KYO B;  2XY8 B;  5L3B B;  1XMO T;  3DEP A;  2Q9Q B;  3LFM A;  5CED B;  4F53 A;  3UU3 A;  3W15 B;  1INZ A;  4NXN T;  5FIO A;  4FU3 A;  3EJN A;  3S2A A;  3TL5 A;  4ILU A;  4HTE A;  3I3N A;  4GYY A;  2IEJ A;  4UWK A;  1HF8 A;  4RQI A;  4LFC T;  2V6X A;  1SZ9 A;  4CEM A;  2VKH A;  4CZZ B;  4OAV B;  3KFW X;  3T8O A;  1TN8 A;  1N95 A;  2CHN A;  4U8H A;  2WXR A;  3UT8 A;  4WYV A;  4FJY A;  2R05 A;  1HX1 B;  5CBO A;  1XMQ T;  1H0A A;  2X38 A;  3S7B A;  2UUC T;  3UT7 A;  3AEC A;  4ADZ A;  1UN9 A;  4XZ4 A;  2WQY A;  5M4Y A;  4HWC A;  4DV7 T;  4JEU B;  4U7Y A;  5JH7 E;  3WI3 A;  3OYX A;  4KVM A;  1D0X A;  3DJB A;  3N71 A;  3DXK G;  3EHN A;  3EVY A;  2CG2 A;  3FHE A;  2IY0 C;  5J2T E;  3SWH A;  5FNV E;  4ZI3 C;  3AU4 A;  2GRN B;  4RLY A;  4CYM D;  4EYU A;  1H2V C;  5ARG A;  2J9Q A;  5B1B E;  4DI4 A;  5JR9 C;  1KNP A;  3VKH A;  3EHQ A;  4B93 B;  4TXP A;  3AEF A;  3PU8 A;  4FLH A;  3GMI A;  2XQ4 A;  3ZCI A;  2ZIS A;  2LXL A;  3LBX A;  5B3S E;  4DV6 T;  4GZD A;  2EIJ E;  4H9O C;  3K1S A;  4GMR A;  5HWX A;  3FU6 A;  4AKR B;  1H6K A;  3C98 B;  4H7X A;  3B5M A;  4PH4 B;  1HZ4 A;  2ZU6 B;  5HKP A;  2P9S G;  1IZN B;  2YQ8 A;  3FUI A;  1IBM T;  4LF7 T;  3FTY A;  3AED A;  5DQV A;  1PAQ A;  1DC2 A;  3I1A A;  2DCP A;  3P8C D;  2X9H A;  4B3S T;  4I0U A;  1QQE A;  3A8Y C;  2Y69 E;  2YOE A;  3NWI A;  4L1B A;  4DUY T;  5E75 A;  5M72 A;  5FY1 A;  4PUC A;  5LCW C;  2IAK A;  5GON E;  2FO7 A;  3UUB A;  2R03 A;  4DPR A;  4P09 A;  3FH8 A;  4PFO A;  4ILI A;  4DVD A;  4AKI A;  3CVR A;  3ZT7 A;  3FTU A;  5LCY A;  4O1O A;  3WAJ A;  4HOR A;  1YCS B;  4ZZB A;  4EQF A;  3ZST A;  4H63 V;  4YY3 T;  5C3J A;  3APC A;  3RK6 A;  4LF4 T;  3T9K A;  3FTW A;  3VTX A;  3FBL A;  1IJ6 A;  4I17 A;  2N2N A;  3N2O A;  1R8I A;  1ZHC A;  4ACL A;  4WNG A;  1UCU A;  5HI7 A;  3DSV A;  2NOX A;  3HXC A;  1IHB A;  2L8K A;  1UG3 A;  4G25 A;  3KEA A;  2GGF A;  5TAO A;  4UVC B;  4AI6 A;  4QX7 B;  2WP9 A;  1J1J A;  4QKN A;  4Z68 A;  3KVA A;  3FZM B;  5HEH A;  3RYC E;  4IYP A;  1K8K G;  5BR8 T;  1V54 E;  4HFG A;  2RG8 A;  3RC3 A;  3LK4 2;  4YT0 A;  3O9X A;  4KMO A;  2XQY A;  3TLU A;  4DI3 A;  4DO0 A;  4CN6 A;  4AM9 A;  2V6Y B;  1U5P A;  2H89 A;  5LGU B;  3C5R A;  5DJQ C;  2NTY A;  2N9D A;  2OVB A;  4QXC B;  2KXP C;  3ML8 A;  5LYJ E;  4KXK B;  4MFR A;  4U8V D;  4GMJ A;  4DX2 A;  4J7W A;  1TEZ A;  5FZQ A;  1ZKE A;  2PZI A;  3CVX A;  2RA1 A;  4TV9 E;  2RFA A;  4QWN B;  4C91 A;  5FY7 A;  3AB3 B;  3L13 A;  2AJA A;  2X9W A;  3CK6 A;  3P4S A;  1N34 T;  4AY6 A;  3N2K E;  2CG3 A;  3Q2M A;  3AXJ A;  4GPM A;  3GN5 A;  2BKN A;  5CMY A;  3L09 A;  5BXU A;  3T8M A;  4RSY A;  2X66 A;  1H19 A;  2W00 A;  4N2Q A;  2WZI A;  3FY4 A;  2PTF A;  1OWA A;  2HYZ A;  4AOF A;  2QFC A;  5L3E B;  1OCR E;  3TWW A;  2BVM A;  4L2L A;  1E7U A;  4F3V A;  1WM5 A;  4ZXL A;  1VOM A;  3N9P A;  3AEG A;  1W0B A;  3D9I A;  1UK5 A;  4GCN A;  2YU1 A;  3QK6 A;  1LD7 A;  4M3O A;  4HEA A;  3ONK A;  2XAQ B;  4AXH A;  5C2T A;  5KWD A;  4EED A;  1MZC A;  4C9B B;  2A3D A;  3QOU A;  3V5S A;  4J0U A;  1NL4 A;  2C5I T;  2E2E A;  2NYJ A;  4U2Y A;  4UI9 J;  3HKD E;  5LBM A;  3HKB E;  4KX6 A;  1UUS A;  2BS2 A;  4P0A A;  2C5K T;  3I0O A;  3NRY A;  2ZGG A;  4B94 A;  1AJ3 A;  3ZVV A;  3RC8 A;  3N9M A;  2H7V C;  1HNW T;  2HPJ A;  4I55 E;  4EZJ A;  4IRE A;  5D2M C;  4GZ3 A;  4XI0 A;  4XE0 A;  4O4I E;  3UU5 A;  2ZLY A;  5JRE A;  3VLE A;  1HX8 A;  2R17 C;  3D9N A;  5G04 C;  2JAB A;  1OWM A;  3D0T A;  3S7D A;  3UKR G;  4EBA G;  1U4Q A;  3J9X 1;  1MX2 A;  5LB7 B;  1HH8 A;  1B7T A;  3ESL A;  3AE6 A;  1DU2 A;  4WNF A;  5G55 A;  2XQ7 A;  5FQ7 A;  1LF8 A;  2XPK A;  2IUB A;  3QJZ A;  1NP7 A;  3L17 A;  2XAH B;  4V1A v;  4ME2 A;  3A7M A;  3TKL B;  4PAG A;  3AA1 B;  3SBT B;  5BT1 A;  3PS6 A;  3CVN A;  4TZ4 C;  2P9I G;  2P9P G;  2LHN A;  3BU8 A;  4QH5 A;  2PBI A;  2XQ3 A;  4N78 D;  3U3I A;  4BWR A;  3RPU A;  4GTP A;  4K0U A;  2V7L A;  2E8I A;  4HWH A;  3CHO A;  2W4X A;  3U4T A;  1KF6 A;  1O3X A;  5KJN A;  5J90 A;  2MPK A;  2WDQ A;  4BTA A;  1V9D A;  4H63 H;  4QXB B;  2WXK A;  4MKT A;  4EPZ A;  5BNW A;  1XWM A;  5AAO A;  3CVW A;  5EIB E;  3B57 A;  3QAR A;  4QQI A;  3CHS A;  3G2S A;  4HQD A;  3ZMS B;  3SFX A;  4F1P A;  4WUY A;  2P9U G;  3B7R L;  3R84 B;  2Y4U A;  3JCK C;  2X9Y A;  2OND A;  4IL9 A;  4KZ0 A;  2VGE A;  3MZK B;  2WQ6 A;  2PG8 A;  1S35 A;  3CSF A;  3ZHE B;  2MTQ A;  1WYB A;  2UU9 T;  2CBJ A;  3AE7 A;  2LLY A;  3CGH A;  3SF4 A;  3BK9 A;  1OT8 A;  2QYW A;  1OED A;  5ANL A;  5A1L A;  4U07 A;  2LSK A;  2FJA A;  3SRZ A;  5HRY A;  2WXI A;  3FUD A;  1XGW A;  2BUG A;  2QVA A;  3QB5 A;  1WG0 A;  5BUZ A;  5EN5 D;  1WDY A;  1SE7 A;  2H3R A;  1G8X A;  2ETC A;  3UTM A;  4PNI A;  4U0S A;  3C51 A;  2LOP A;  5KMG P;  3B95 A;  1ZEE A;  3ONL A;  2RPA A;  3K3O A;  3PEV B;  4ZOL E;  4DV2 T;  1OXJ A;  3PZ3 A;  5LHI B;  3ZMZ B;  5FTP A;  3GA8 A;  3OXL A;  3CX8 B;  4U96 D;  2EIL E;  3CX6 B;  1NZN A;  3JC6 D;  3JAF A;  1TNU A;  1MMD A;  1WYC A;  3AS8 A;  5ENT D;  2JLB A;  3RIA A;  2I59 A;  3V5U A;  3QAQ A;  4TWH A;  2CXD A;  2V5C A;  4J8Y A;  3FZF B;  4WNE A;  2I0M A;  3AU5 A;  3ZFW A;  1E7P A;  3FDH A;  3GZS A;  2LSG A;  4APO A;  4CCA A;  4JB8 P;  5BV0 A;  2R5S A;  3JAE A;  5ABG A;  4NXM T;  3LJC A;  4TV3 A;  5AQ7 A;  4GTO A;  4C48 B;  3UMV A;  4YSX A;  4L7T A;  3R7R A;  5AN8 A;  3U3W A;  2NXP A;  3SHF A;  2IC6 A;  1W09 A;  5FXW A;  2WXM A;  1NAF A;  2F37 A;  5LX8 A;  4QX8 B;  1X81 A;  2DI4 A;  5EX0 A;  2P58 C;  4ATG A;  1D0Z A;  2VQF T;  3F57 A;  4DUI A;  3FUJ A;  3C50 A;  1MX4 A;  2YNQ A;  1ZBP A;  1W0A A;  3L54 A;  4J2C A;  4NIQ A;  5J0Z A;  3L08 A;  4DK5 A;  3LK3 B;  2J09 A;  3UQ7 A;  1IXV A;  5L3G B;  3UT5 E;  5FT9 A;  5ABF B;  4ANU A;  2BTD A;  3FUE A;  4YDO A;  3RRU A;  2DZN A;  4L2Y A;  2MAW A;  2WDV A;  2Z6E A;  4CDM A;  3FUN A;  3BG1 B;  2LRL A;  3T1H T;  1E8X A;  4HS2 A;  1A17 A;  3PUR A;  2LXM A;  2G0U A;  5CBN A;  5ITZ F;  1QBQ A;  5HEG A;  4O4J E;  1I6Z A;  1JCQ A;  2LSU A;  3OVU A;  3L9T A;  4A1G A;  3H3A A;  3I9Y A;  5LMN T;  3IA3 A;  5FYM A;  2WBL A;  3RRC A;  4GML A;  2L0I A;  1BR2 A;  2DLR A;  4M1P A;  3FTZ A;  3LPZ A;  3LVR E;  3RYI E;  3AVR A;  3CVU A;  4U63 A;  5KCM A;  2YDR A;  3WG7 E;  4HRL A;  3PUG A;  1OUV A;  4AQF C;  5LXT E;  4YTN A;  1ZV4 X;  2CPT A;  3ZU7 B;  3CVV A;  4GA0 A;  5L47 A;  4FAD A;  4TWF A;  4IT4 A;  2OA5 A;  3ULQ A;  4IL4 A;  1WR0 A;  4LUN U;  4PK4 A;  2X6J A;  3C64 A;  1UOH A;  1FPP A;  5AYW D;  3UU4 A;  5FZS A;  4JYA T;  5HQ8 A;  2W2U A;  4G2A A;  4JL0 A;  2VTB A;  4IDN A;  3ZEF A;  3CHP A;  2MYO A;  4KMC A;  3FU5 A;  2QC9 A;  3ULY A;  3HHM A;  2HM8 A;  3LVQ E;  2WXG A;  4J8E A;  2IQC A;  4N3A A;  3NKZ A;  2Q7F A;  3FZH B;  3RKO A;  4DMV A;  1JUQ A;  4UR9 A;  1IHG A;  3PJA J;  1IYG A;  1FMW A;  1G73 A;  2I1K A;  3Q73 A;  2LKH A;  3EU5 A;  3SFD A;  1LKX A;  3I4R B;  4MS6 A;  3TGO A;  4WNK A;  4GAA A;  3ZMV B;  3TXN A;  4HXI A;  4YVQ C;  1EYH A;  2CXF A;  3N9O A;  2VL8 A;  4RVB A;  3O1J A;  3R7Q A;  2HH7 A;  3W9F A;  3ZPJ A;  3JUI A;  3ZYQ A;  5HXR A;  3ZXS A;  3NF1 A;  3JYS A;  3IKO B;  3LY8 A;  1JCR A;  3PTR B;  3DEO A;  3Q5M A;  4F7A A;  4ERR A;  3IBE A;  2KIN B;  3E0Z A;  3ABK E;  3PZ2 A;  4YDY A;  4CT4 A;  2WWV A;  1ZB1 A;  2P9B A;  2CLY C;  2LRK A;  3ZJ1 A;  3MCX A;  2KWI B;  5G05 J;  4YJ2 E;  1MNE A;  2YHE A;  3RU0 A;  3ZN0 B;  1FT1 A;  2FI7 A;  4NAC A;  3KAE A;  1Q2Z A;  4XKB A;  2UXB T;  3FHN A;  4X1K E;  3AVS A;  4YSY A;  1JWF A;  3UX4 A;  2LSY A;  3ZMU B;  3FUK A;  4AP2 A;  3FEX A;  4UUC A;  1HU3 A;  4U7I A;  1TNY A;  1SA0 E;  5IY5 E;  2KWH A;  5EX3 A;  2F8X K;  3UFE A;  4BJM A;  4H9Q C;  4IDZ A;  1MIV A;  4ZI2 C;  4CXW A;  4U3C A;  5L3F B;  3NAW A;  2AXD S;  3PE4 A;  5FXV A;  4CN1 A;  4J6I A;  3FXE B;  4X20 E;  4BTB A;  3C4W A;  3L3P A;  1BR0 A;  3ZUV B;  3D9O A;  2AE9 A;  4OVU A;  3OAW A;  2N1G A;  2E9X D;  3SFZ A;  3RYH E;  2HHH T;  4L9P A;  2C0L A;  4AKL A;  4EB6 E;  2OOE A;  2PM7 A;  5ABH A;  5C8Y E;  2IF4 A;  4GK5 E;  5L3C B;  3VRB A;  4NUV A;  3KVB A;  3P7I A;  5IYZ E;  4IE4 A;  5L4E A;  5J08 A;  2LKG A;  2OV9 A;  2ZM8 A;  1JWG A;  2BBH A;  4WBN E;  1KZP A;  3UFG A;  3AE5 A;  2XQ6 A;  2J4B A;  4GYO A;  3IXE A;  3OYZ A;  2WXH A;  3SQV A;  3ZXP A;  3M65 A;  3N5L A;  4UWF A;  4CI2 B;  2Y6X A;  5AJD A;  4HWD A;  2J07 A;  4JBW F;  4WWP A;  3PH0 C;  3W9G A;  3D9M A;  1LRZ A;  3CVY A;  1LVF A;  2CCQ A;  5DBK A;  2OV8 A;  2ZM6 T;  1Z5S C;  3CST A;  5F3J A;  4JXT A;  3KBU A;  2KND A;  2VGX A;  4DBR A;  5BXO A;  3AAI A;  3L8R A;  2WMN A;  2NWB A;  4HFD A;  2ZGD A;  2ZM0 A;  4YDE A;  5AQR B;  3HA4 A;  3EHZ A;  4UVA B;  3EI0 A;  3ZRH A;  3UUN A;  3KV4 A;  4EZL A;  2EIN E;  4D10 C;  3PUV F;  4DLO A;  3MV3 B;  1KFY A;  1BI8 B;  3ONX A;  4IDP A;  2HN2 A;  4FP7 A;  1VDY A;  2LAI A;  2WVI A;  3FU3 A;  2LM9 A;  4AJW A;  1BU9 A;  4P0B A;  3L6A A;  2DHR A;  3RIU C;  5FKY A;  4ACK A;  5JDH A;  1YYH A;  3FFL A;  4LF8 T;  2BBJ A;  2UXC T;  4OVV A;  2XPZ A;  2MOZ A;  1WAO 1;  4Z8X A;  2CHX A;  3HRA A;  2WPV A;  4FHK A;  2KZ7 B;  2MBG A;  3AXJ B;  3PV0 F;  3ZC0 A;  3GN5 B;  2XGO A;  2J1D G;  3MK7 C;  4H7Y A;  1ELW A;  4XKC A;  2JPF A;  3FZL B;  2WXQ A;  1S0P A;  2QY7 A;  3CHQ A;  3AE9 A;  2WB2 A;  4L5G A;  2CA5 A;  5AQK B;  3BQO A;  2ZM2 A;  4OHF A;  3Q15 A;  4DJA A;  3UUX A;  5A7D B;  2NW8 A;  5AQT B;  4K5B A;  2B0O E;  5A23 A;  4Q96 A;  3E22 E;  3PDY A;  2VYI A;  3CIA A;  2VWA A;  5FP3 A;  4ANW A;  4BT9 A;  4PS3 A;  3ZN3 A;  4U0U A;  4DR5 T;  3ZYK A;  3DRA A;  2FO1 E;  2F4V T;  5F5W A;  2X67 A;  2V5Q C;  2LSI A;  1SUM B;  2YU2 A;  4YXD A;  4DR7 T;  4HB5 A;  4G23 A;  3JCF A;  3AAA B;  4CQI A;  4YLH A;  4PS7 A;  4ZS2 A;  2XJ7 A;  1UGO A;  2XZE A;  4UEM A;  2XSA A;  3QC9 A;  1FJG T;  5J1G A;  2L3L A;  3DSU A;  2E9X A;  4DV1 T;  2MRI A;  4GTV A;  4Z90 A;  3VLF A;  1W9R A;  2AXZ A;  4X8Q A;  5LOV E;  3FUL A;  3ZCJ A;  4N39 A;  1EPU A;  1D0Y A;  3O48 A;  1T8B A;  1FEW A;  2V5F A;  5LJN A;  3L16 A;  5JRC A;  4DRX E;  4FA6 A;  4PFP A;  5DAB A;  3KV9 A;  1IAP A;  2H6F A;  2UXN B;  4JA9 A;  1N0R A;  2NSZ A;  1E8Y A;  1WFD A;  2LOS A;  2IW5 B;  3ETV A;  4DMW A;  3VKG A;  3UT4 A;  3X1D A;  5ETW A;  3ISM C;  3LJN A;  2GRM A;  1WLX A;  4B0Z A;  3PUS A;  3BEE A;  2XM2 A;  1KT1 A;  1TNZ A;  2C2L A;  3PJA A;  2IC9 A;  4ASK A;  4A3T A;  3MKD A;  1NI1 A;  1ZP0 A;  3FTS A;  1SHZ C;  3EDU A;  1KLX A;  4N3B A;  4ZFH A;  5AQB A;  2BKP A;  4TNW A;  5EYL A;  4B8C B;  3B7S A;  3T8K A;  3UIP C;  1NA0 A;  4AIU A;  3HKE E;  3APD A;  3CK7 A;  2DL1 A;  3PZD A;  4EEC A;  1XZY A;  2UY1 A;  2FJE A;  2VAS A;  5AIJ A;  4Q94 A;  1NFI E;  2KLQ A;  1E90 A;  2YN6 A;  3VTY A;  2XQ9 A;  5FQ8 A;  1J5E T;  3QDN A;  2WM9 A;  4KP3 C;  4J8S A;  5FY0 A;  3N9Q A;  4JUY A;  2XPY A;  3UM0 A;  2RKK A;  3TWT A;  3DP7 A;  1E8Z A;  1GQE A;  4CRW A;  3HVE B;  2R02 A;  1Y6I A;  3HXE A;  4UV9 B;  4BES A;  3CQX C;  3UXG A;  3FH7 A;  2K48 A;  2QYJ A;  3SFE A;  3N9L A;  1OED E;  2CFU A;  2WWU A;  1PY1 A;  2FBN A;  2L6J A;  3Q5X A;  5ARF A;  1FVH A;  1H6P A;  1VRB A;  2H88 A;  2X0L B;  4UV8 B;  4E7S A;  3HKC E;  1OED B;  1MHQ A;  1MQS A;  3DST A;  5EK4 A;  1DCE A;  4NQ0 A;  3RJV A;  4OFZ A;  4DX1 A;  5AQA A;  4EEB A;  4I2Z A;  1XDP A;  3ESK A;  3URZ A;  4ZI7 E;  2DYR E;  2FJB A;  2ODV A;  1Z3X A;  3ASH A;  5EID A;  3G06 A;  5BV1 A;  2IFU A;  2KSR A;  4ISS A;  5LGN B;  4HI8 A;  4LER A;  2YDS A;  1FIO A;  3OXF A;  2LJL A;  4YND A;  4XBF B;  1S70 B;  2JMH A;  4CN4 A;  1RZ4 A;  4IDO A;  3V2O A;  5LA6 E;  5ENP D;  2CFZ A;  5KNG A;  2QYU A;  4CGW A;  2LUH A;  3AG4 E;  4L23 A;  4UF0 A;  1HG2 A;  2ODU A;  4TV8 E;  3V31 A;  1FMV A;  3MJX A;  4LNB A;  4E7Z A;  2BG9 A;  2J49 A;  3AE4 A;  3RKG A;  2GRP B;  4X62 T;  4DR1 T;  1K3Z D;  2IML A;  4H9N C;  3IHV A;  3AEE A;  4HI9 A;  4YVO A;  5LOZ A;  2FUL A;  2JMK A;  2Q9Q C;  2GRQ B;  2LT3 A;  3ZT5 A;  4EV6 A;  3SI5 A;  4N2S A;  3O4Z A;  3Q47 B;  3M3Z B;  5H7P A;  1KK7 A;  3J7Y q;  4YSZ A;  4UIG A;  1BR1 A;  1D8D A;  1YQ4 A;  2YK0 A;  2H7O A;  1K1B A;  4I1A A;  3MA9 A;  3JQ1 A;  3V2X A;  2DWZ A;  5ENO D;  3CX7 B;  5CA0 E;  3TLS A;  2XSB A;  5EK2 A;  4G63 A;  4B3R T;  2D9D A;  4A97 A;  3PDN A;  2X0H A;  4UXN B;  4TUU A;  1YMP A;  4L0R A;  1HS6 A;  3CV0 A;  4G8K A;  5FQ4 A;  3RO2 A;  4FUL A;  3LY9 A;  5AQI B;  3EAB A;  3EUH A;  3CR3 A;  2X6I A;  1XDO A;  3NQP A;  4GB9 A;  4BSZ B;  4LF9 T;  4ABN A;  4UQZ A;  4YTP A;  2F0Y A;  1OXZ A;  4BX8 A;  2V26 A;  5JA4 D;  4LG6 A;  1H7C A;  4B89 A;  2CXL A;  1ZU2 A;  1I94 T;  1PC2 A;  3PZ1 A;  3Q4A B;  4A3V A;  3ASF A;  3LS8 A;  2JQ9 A;  3ZC1 A;  2EQX A;  4BSX A;  3D9P A;  2EIK E;  3HVE A;  3ASG A;  4TUY E;  5AQG B;  3EIQ C;  5HYA A;  2XUE A;  2C5J A;  4QH4 A;  4GK0 E;  5HS0 A;  3QNK A;  2KZT A;  3EUV A;  3CLJ A;  4PJM A;  1Y64 B;  4LCT A;  3NBN B;  5LJM A;  3MKQ A;  2W61 A;  4MLK A;  3P2B A;  5IHY A;  3RQU A;  4HOS A;  5AQP B;  1TJC A;  3FTV A;  2IHR 1;  5AQN B;  2J47 A;  2P9L G;  2XAG B;  5FQ6 A;  5T4Y A;  5LBQ B;  3KD7 A;  3FH5 A;  3UM1 A;  4I2W A;  5LCW J;  4O4H E;  3PUW F;  4EIW A;  2X6H A;  5AQH B;  3O4X E;  4LNU D;  3E30 A;  4JI5 T;  2J8S D;  4ZHQ E;  3UPV A;  2KM4 A;  3P4Q A;  3CWZ B;  3HG0 D;  4ILH B;  3SS1 A;  5FXX A;  4J8F A;  3P4W A;  4IDQ A;  1E8W A;  2VTB B;  3ZEF B;  3AAA C;  5HCJ A;  3WAK A;  2LE8 A;  4Q25 A;  3ZKJ A;  4KHP T;  4K5C A;  4AEZ C;  4UQX A;  1FT2 A;  3PUK A;  3PRE A;  3KV5 A;  5LNK A;  3P4R A;  3PVL A;  3LKU A;  4U7E B;  4N3C A;  3V79 K;  2BDE A;  2VKD A;  3CK9 A;  3PZ4 A;  5ENR D;  2LM2 A;  2IOS A;  2CEA A;  4U33 A;  1N52 A;  4HFB A;  4WW0 A;  4NRH B;  5HXH A;  3C3Q A;  3AE3 A;  2PM6 A;  4HLE A;  2V8S V;  3A5X A;  3AA0 B;  3CML A;  2D0T A;  4X64 T;  2LNI A;  5E76 A;  1P5Q A;  4ILG A;  3UU6 A;  3SD5 A;  1CHU A;  3DWL G;  3G2V A;  4URK A;  5KNH D;  5AQJ B;  1D1A A;  3PUZ F;  1XNR T;  3Q5W A;  3KV6 A;  2Y0B G;  3C4Z A;  3D3M A;  3DXM G;  4GCO A;  4X1I E;  1S94 A;  1WR6 A;  3T1Y T;  2A5U A;  3FEY A;  4BJN A;  3E37 A;  3BQK A;  4ZZC A;  4Q69 A;  3CVL A;  2EHO A;  3H3M A;  5FVK A;  4HRM B;  3UIO C;  2FBW A;  5LHG B;  2XPI A;  4BEP A;  3FWV A;  2BS3 A;  3PNT B;  1QLB A;  1IJ5 A;  3OBV E;  4NUR A;  3AJI A;  4A5X A;  3NZP A;  3ZMT B;  5BPP A;  2XEH A;  2Y4T A;  4WND A;  4V3I A;  3UTK A;  3UQ4 A;  1MMN A;  2VSN A;  2X68 A;  4N5C A;  2CWY A;  3Q7F A;  4K0R A;  1YXR A;  3FUH A;  4I1O B;  2J62 A;  5FL0 A;  3Q79 A;  1L0V A;  3E33 A;  2FUP A;  5CCM A;  4I6J A;  2WQ7 A;  2J4D A;  1AWC B;  4CI3 B;  1MYO A;  3FUM A;  3TLT A;  5AQU B;  2Y48 B;  2QRX A;  1LD8 A;  1N32 T;  3D9L A;  3G2T A;  4GU5 A;  4DR6 T;  2AW6 A;  4MAL A;  4UWG A;  3GYZ A;  2CBI A;  1E96 B;  4JI2 T;  2HPL A;  3HI2 A;  1OWL A;  4AIF A;  5JR9 B;  5HWY A;  3EHM A;  3AE2 A;  5D66 A;  4CI1 B;  2V7I A;  1E7V A;  2WSS V;  3JUE A;  1X79 A;  1HE8 A;  1HS7 A;  2BVL A;  2K3W A;  4GYR A;  3QKY A;  2XEE A;  3NVO A;  3ZT6 A;  5DQW A;  4ZHB A;  2OLT A;  3MAC A;  1QYM A;  1NWM X;  3ONL C;  4XIF A;  1UN8 A;  4A98 A;  3AG2 E;  4AKH A;  2X6K A;  3PRZ A;  1V55 E;  4KI0 F;  2YDQ A;  5EYP F;  5LMU T;  2WZH A;  5DIZ A;  4WWN A;  5G04 J;  3R9A B;  2XRY A;  3G2W A;  4GTM A;  3UQ3 A;  2XTL A;  1KT0 A;  4KVO A;  4TRQ A;  4BX9 A;  5C2Y A;  4AVX A;  3TWU A;  4IHJ E;  3LJ3 A;  2K9A A;  3N9N A;  1QSD A;  5JJT A;  3RGL A;  4F8H A;  5IUX A;  3PUA A;  1OY3 D;  1WY6 A;  1OWN A;  3TWS A;  1ELR A;  2K24 A;  4G26 A;  2CWO A;  5KJL A;  4GIW A;  4O8S A;  1IQU A;  2VGX B;  2M63 A;  2XS1 A;  5CGM A;  3CKD A;  1WCR A;  1TJF A;  3TLW A;  4I6E A;  3LCA A;  4IE5 A;  2XQ8 A;  3UUM A;  4HFI A;  4TX5 A;  3Q78 A;  4DX7 D;  4JZY A;  1TN7 A;  3OJA A;  4HLL A;  4HRN A;  2JQQ A;  2WXO A;  4I43 A;  3Q9D A;  4COF A;  3RRM B;  4OK0 A;  4RG6 A;  5HEU A;  2B1E A;  1JNZ A;  1K1A A;  2UXD T;  4QFV A;  3MZL B;  5FXZ A;  1VCT A;  3MEK A;  2VQE T;  5LGT B;  2FEZ A;  4MBQ A;  4ZEY A;  2PL2 A;  4K03 A;  2OEW A;  2V0P A;  2KXP B;  3GWH A;  2CHO A;  3K9I A;  1BLX B;  2DWG A;  4E6H A;  1U2V G;  2PQR A;  3RIU A;  3TWX A;  5FZR A;  3FZK B;  4B3M T;  2E0I A;  5HEJ A;  3RYF E;  3T5V A;  2R6G F;  2AVP A;  3L39 A;  2Y3A A;  4UQY A;  1UJJ A;  1G3N B;  3BUA A;  4GTR A;  4H9P C;  4UWL A;  1H2U A;  4DX5 D;  4X1Y E;  1MMG A;  2A2F X;  1DNP A;  4I6G A;  4YHJ A;  2H6H A;  2V4L A;  4KUM B;  4YTM A;  4LF6 T;  2J08 A;  5JR9 A;  1SA4 A;  3SFY A;  3X2Q E;  1OCC E;  4FJO A;  3AEA A;  3UUX B;  2VSY A;  2X6F A;  3MX3 A;  4JLE A;  4U72 A;  3SZ7 A;  1HO8 A;  3HL6 A;  1N4P A;  4X66 T;  3B7U X;  2KCK A;  4PK6 A;  5H6R B;  4JI7 T;  4O60 A;  3E08 A;  4LML A;  3R6N A;  2IU1 A;  3CQC B;  2WCA A;  1GW6 A;  5B1A E;  1FCH A;  4DID B;  4EZ4 A;  4DV3 T;  5L2L A;  2A9U A;  1UX5 A;  4G24 A;  5FMN A;  2E9X B;  2RFM A;  4UI9 C;  4BER A;  2CM0 A;  5CER B;  5HXC A;  2DVW A;  1YKE B;  3PEU B;  3CK8 A;  3TG4 A;  4HFE A;  5JRC B;  4NUU A;  3LDZ A;  5AQ9 A;  3B7B A;  3ZN1 B;  4ATZ D;  4B8A A;  1KZO A;  4IGU A;  2ZXW E;  4DX6 D;  2VSX E;  3EIJ A;  2HR2 A;  3ABV A;  4JI1 T;  3JC6 C;  2CHZ A;  3IHY A;  5T3R A;  4C90 A;  2Y8D A;  3RRN B;  2H6G A;  4XEI G;  2XRZ A;  5JJ7 A;  5AQV B;  4PS8 A;  2V1D B;  2P9N G;  5HAX A;  2WMO A;  3VU7 H;  4HFH A;  4QH1 A;  3VRA A;  1N4R A;  4DV0 T;  3V30 A;  3ASD A;  3ZGQ A;  2M67 A;  2XHE A;  5HXE A;  3SOL A;  2UY1 B;  2L6B A;  4JI3 T;  3ZPO A;  1BR4 A;  3RAU A;  2AXU A;  3KSL A;  3DTO A;  3WXX A;  4JEH A;  3EAM A;  2B6C A;  1IQR A;  3O1I A;  2VGY A;  5ENS D;  3ZIM A;  4KBM B;  1JNR A;  3EU9 A;  2GRR B;  3OPC A;  1QUU A;  4PK5 A;  3DSX A;  1CUN A;  5ANR A;  3P1U A;  5CRV A;  2M6B A;  4EAH A;  1MIW A;  5KXJ A;  5CCL A;  4IRU A;  3ANW A;  3CKB A;  2LHR A;  3RQW A;  4MLP A;  3T5X A;  4HFV A;  5LG3 A;  3EHR A;  2NC9 A;  4EHM A;  5JDG A;  3Q7A A;  4JHK A;  3F31 A;  4PW8 A;  4GTS A;  4FLB A;  4IE7 A;  2VL0 A;  3IHR A;  1SVX A;  4HGA A;  3OTN A;  1FVF A;  4O6F A;  5L4H A;  1X9B A;  4DLQ A;  4GPK A;  3RSE G;  5EZY E;  3Q49 B;  2KT9 A;  2ILR A;  3Q5E A;  3MYV A;  4AQG A;  1Z8U A;  3PNL B;  4HN9 A;  5CEA A;  3D9H A;  5CFB A;  5HXS A;  2XQ5 A;  5H6Q B;  3CVQ A;  3CEQ A;  2DYS E;  2V8S E;  2F8Y A;  1Y01 A;  1TN6 A;  1D1B A;  3JXI A;  3QB2 A;  2X9X A;  4CZ2 D;  4X65 T;  4TUM A;  3MJW A;  1Z0P A;  3FUF A;  4L9I A;  2XCB A;  4FHJ A;  2IOL A;  2ETB A;  5FJY A;  2NP9 A;  4UF0 B;  2NW7 A;  2BG9 E;  2KMF A;  4TN7 B;  1U3D A;  3CIR A;  2UUB T;  2C0M A;  4I9C A;  2AWI A;  5LP0 A;  2BG9 B;  2BKK B;  2IDO B;  3TWQ A;  1Y8M A;  1UX4 A;  3APF A;  4U31 A;  3U64 A;  2X51 A;  2B76 A;  4UI9 K;  3RKV A;  5FL1 A;  2Y1L E;  2DBA A;  3D9J A;  3ZNG A;  4GOU A;  3ML9 A;  3LY7 A;  4JA7 A;  1KNZ A;  4DR2 T;  1D1C A;  5AAR A;  4LF5 T;  4AY5 A;  4U2Z A;  3FTX A;  2Q9Q A;  1O1R A;  1KNR A;  4LFB T;  2A4Z A;  5AJL A;  3FXD B;  1IBL T;  3PUX F;  5A6C A;  2CRB A;  2BS4 A;  2NR4 A;  2JQH A;  3ZLI A;  2CHW A;  3EDT B;  2UWJ G;  3FU0 A;  3C3O A;  2W66 A;  4WWO A;  2JEK A;  4FJZ A;  3HR0 A;  4HE8 A;  1O1T A;  3OTO T;  1S63 A;  2ZIR A;  3ETU A;  2X3M A;  3AG3 E;  5AQF B;  2RD0 A;  5JDQ A;  1Z3Y A;  5EKQ D;  5AQS B;  1OCO E;  4BY6 A;  4BT8 A;  5EDS A;  4TXQ A;  4NIK A;  3I0Q A;  2WXF A;  3JQ0 A;  2W67 A;  3RF1 A;  4A63 B;  4CXY A;  1H2T C;  4JPS A;  5LG4 A;  4UVB B;  2J4G A;  3VHL A;  2WY2 A;  3KBT A;  2WAU A;  3C3R A;  4DV5 T;  4W9R A;  5HEO A;  2L9Q A;  4ILA A;  2MYS A;  1HR0 T;  3IBP A;  4JEU A;  2I1J A;  1M62 A;  2HE0 A;  3DSS A;  2JQK A;  1SW6 A;  2LSV A;  2VKO A;  1T72 A;  2BZB A;  2CE7 A;  4AKG A;  2V5D A;  1HFA A;  5ENN A;  4OYJ A;  4LMK A;  4WAF A;  1JCS A;  3MKR A;  4JC8 A;  4HOQ A;  1SQM A;  2DCF A;  2KZT B;  1M7K A;  2LAH A;  3PUJ A;  4CT0 A;  3AE8 A;  3MKQ B;  1N36 T;  3AS4 A;  5JDL A;  3BQL A;  2R59 A;  4XX5 A;  3QNU A;  5CMW A;  3VR8 A;  4OYK A;  1SZA A;  3VR9 A;  4PJL A;  4Y6W A;  1US7 B;  2D2S A;  2VKJ A;  4HVB A;  3TAX A;  2XGS A;  5AEN A;  2BKG A;  3CHR A;  2IIU A;  3GZ2 A;  4YDW A;  4O2B E;  3C98 A;  4DR3 T;  2WB5 A;  4OX9 T;  4ILB A;  3KSQ A;  2K5B B;  3G2U A;  3RX6 A;  1MMA A;  5LHH B;  1N11 A;  3D9K A;  3F2E A;  2BF0 X;  3PUQ A;  3HIZ A;  2QGS A;  4R7L A;  2V7K A;  4WZX A;  4F6R D;  2H6I A;  1HNZ T;  4B6X A;  2KBX A;  5JMN D;  2EIM E;  2GW1 A;  2D5U A;  3AG1 E;  2E9X C;  2VJ8 A;  3Q5D A;  1YD8 G;  1LVK A;  1B89 A;  3PE0 A;  1XNF A;  3NBX X;  1HNX T;  2XQ0 A;  1IKN D;  2EHO D;  2GRO B;  3ZYL A;  4I50 E;  1EF1 C;  1L5J A;  2JIW A;  4TXR A;  4QXH B;  1TNO A;  2MHK A;  2YHC A;  1YKH B;  3P4P A;  4LMJ A;  4XZC A;  4LEU A;  5BW8 C;  4DND A;  2BED A;  5LP6 E;  4HOT A;  3AA6 B;  4J8D A;  4ANJ A;  3JAD A;  2VK9 A;  1RW2 A;  2QZA A;  4I1M A;  3KDS E;  2XM1 A;  5JQG E;  3NZU A;  2VB6 A;  1N54 A;  5AQM B;  4TWD A;  5KDM C;  2KCL A;  4AV7 A;  5JDM A;  4JI8 T;  4IN3 B;  2EHO B;  2DIW A;  4JHJ A;  5EIL A;  3TG5 A;  1N94 A;  3BG0 B;  2WU5 A;  5FIN A;  1OWP A;  1O1S A;  5JJ6 A;  2HN1 A;  4LRZ A;  2V6Y A;  3C4X A;  1NA3 A;  4KHZ F;  3ABL E;  3ASN E;  5JDF A;  4HWF A;  1BPO A;  1N33 T;  2VVN A;  1YA0 A;  4ANX A;  3K3Q C;  3K8P C;  1E1H B;  2CLY B;  4ZI2 D;  1MX6 A;  1W3B A;  4IE6 A;  1QZ2 A;  4G1T A;  3TXM A;  3E4B A;  1MJ0 A;  2ACX A;  1JPL A;  2LSJ A;  4DR4 T;  2L0T B;  2LEH A;  1BI7 B;  1Z6T A;  3EDV A;  3GZ1 A;  2P2C P;  4BAY B;  4B3T T;  4GTQ A;  5G05 C;  4C0M A;  2XEN A;  3QWV A;  3TWV A;  3MA5 A;  3AA7 B;  3R9M A;  2CMR A;  4FI5 A;  2PQN A;  4EXT A;  1EDU A;  1OCZ E;  1BD8 A;  2OEV A;  2VVS A;  4DV4 T;  4ANV A;  1NEN A;  4U8Y D;  2I6H A;  1J5W A;  4MHC A;  3S4U A;  3Q9U C;  3MV2 B;  2ION A;  4AQF A;  5C1D A;  2W63 A;  1HCI A;  1ZOY A;  3RLF F;  4PDX A;  2P9K G;  1HG5 A;  4JW1 A;  3ULE G;  2XZT G;  5LFA A;  3Q75 A;  2VUR A;  3HYM B;  5ABE A;  4O1P A;  1D8E A;  5ENQ D;  4EZK A;  4IUL A;  2KC7 A;  3ONJ A;  4HWI B;  1TR4 A;  3FB2 A;  3KEZ A;  4G8L A;  4H9R C;  1EZ3 A;  1UJK A;  4LNG A;  2BG9 C;  3OXG A;  2W62 A;  4JI6 T;  3QOF A;  2IO2 C;  4JI4 T;  3J5Q B;  2WU2 A;  5KJM A;  4ILC A;  4FC8 A;  3C72 A;  4LFA T;  3MGB A;  4H9S E;  1N0Q A;  4K5A B;  2GRL A;  2XS8 A;  2WXP A;  2D0U A;  4JHR A;  4GA1 A;  3LSV A;  3U66 A;  2E5V A;  5E0O A;  3L22 A;  2WDR A;  3S7F A;  5JTG A;  3UIN C;  3DBS A;  3LDQ B;  3L82 A;  2RP4 A;  3O1H A;  1OWO A;  4QHO A;  1KEY A;  2E2A A;  1H6O A;  2PNN A;  1IBK T;  3NRX A;  4I43 B;  3UUL A;  1VCS A;  3TLV A;  4YFS A;  4CDR A;  1YQ3 A;  4APF A;  5JHB A;  2V4H C;  4UWH A;  4DUZ T;  2OVF A;  1QNF A;  4ZI3 D;  1U3C A;  3SGH A;  2A5E A;  4JD2 G;  4HOU A;  1MND A;  4GKJ T;  5JDN A;  2ES0 A;  4O4L E;  5J2U E;  4OYS A;  2WXN A;  3UKU G;  4TNV A;  5CEC B;  4LSZ E;  4G2V A;  1MIY A;  5EK3 A;  3RIB A;  2YEV C;  3FBZ A;  3RIF A;  1LTX A;  3AE1 A;  3IV0 A;  4HNA D;  4UEL A;  4DBQ A;  3HXD A;  1DCQ A;  3U78 A;  4JVS A;  3CKC A;  4IIJ E;  3I9W A;  3LG7 A;  5G2N A;  3SY2 A;  4OAU C;  1T98 A;  5JVD E;  3QWP A;  4KZC A;  3F6Q A;  3JXJ A;  4U74 A;  2MOW A;  4HFC A;  3RI5 A;  2KCV A;  1TNB A;  2YIN A;  4PJN A;  1E2A A;  4JI0 T;  2XQA A;  3PU3 A;  1OED C;  2R2L A;  3KIN B;  3ZHE A;  4EGW A;  5IWA T;  2ACZ A;  4BA9 A;  4PJJ A;  4G11 A;  2A72 A;  3H37 A;  2JRK A;  5FWQ A;  4IE0 A;  1ELK A;  3ZW3 A;  1N4Q A;  5KJK A;  5CHE E;  3RH3 A;  4A1S A;  3HXF A;  3IEG A;  3CHM A;  2BKO A;  3LYA A;  4CDN A;  3PUY F;  5AQO B;  2W0G A;  2XZD G;  4GZC A;  2WS3 A;  2OCC E;  3SBS A;  3OKQ A;  3LK2 B;  3FP3 A;  4M7C A;  1X5B A;  3TWR A;  4A55 A;  4I9E A;  1SA5 A;  4AIS A;  4MBG A;  2VSO E;  4U04 A;  3IF8 B;  2WXJ A;  4P1N A;  5CJ5 A;  2XCC A;  3K3N A;  4CGV A;  3NZQ A;  3QUJ A;  4KBQ A;  3DPY A;  3HXB A;  3RHW A;  3DSW A;  4MRU A;  3P50 A;  3HDX A;  3NZS A;  3TJP A;  3UI2 A;  3CQG B;  2YKS A;  2XAJ B;  4EOZ B;  3MXZ A;  5AQQ B;  4Y6C A;  2I9C A;  3QK0 A;  3ZKR A;  5FVL A;  2WXL A; 
#chains in the Genus database with same CATH homology
 1DVP A;  2QA7 A;  3VLD A;  3DPD A;  4WBO A;  2XGM A;  4F6R C;  3U9W A;  4C0E A;  3N2G E;  4BFR A;  2XAF B;  2LO6 A;  3IEE A;  5F8P A;  5D0Q D;  2L9B A;  5D0O D;  2I2O A;  3B13 A;  3I4G A;  2PFV A;  1UW4 B;  2VQ2 A;  2XHE B;  4GA2 A;  5AFU L;  2EHO C;  4GYS A;  1WRD A;  4IST A;  2C0S A;  4O2A E;  4JEH B;  2WQH A;  5CB4 E;  4I4T E;  2GK9 A;  4RG9 A;  3I5P A;  5CA1 E;  2FF4 A;  1YW0 A;  5T8I A;  3LXU X;  3AAE B;  5BMV E;  4GYW A;  4CXX A;  4HKA A;  3RO3 A;  3ANW B;  3RRW A;  2HO1 A;  3GW4 A;  3ZJ2 A;  3CVP A;  4XI9 A;  2DNX A;  4EZH A;  3QWW A;  3SNX A;  4U0Z A;  4A56 A;  2NTX A;  4EBA A;  2XAS B;  3AS5 A;  5KX5 E;  2NW9 A;  2V7J A;  4AXP A;  4KT6 B;  4P29 A;  3PE3 A;  4ZS3 A;  3LBX B;  2AXV A;  4XAX B;  2KAT A;  2XEV A;  4GZ6 A;  5JHA A;  3ENE A;  3LEW A;  2IJG X;  1HTJ F;  2Q9Q D;  3KS2 A;  2JJ9 A;  3BQI A;  2ZMA A;  4YJ3 E;  4F1S A;  3QC1 A;  3B7T A;  4EYY R;  2UXX B;  3CPZ A;  2SPC A;  2V7M A;  3ZYM A;  2DWK A;  5L3D B;  4E85 A;  5ADX L;  3S7J A;  2PJQ A;  1HXI A;  4GZ5 A;  4KYO B;  5L3B B;  2Q9Q B;  3LFM A;  4F53 A;  3W15 B;  1INZ A;  4FU3 A;  3EJN A;  3S2A A;  3TL5 A;  4ILU A;  4HTE A;  3I3N A;  4GYY A;  4UWK A;  1HF8 A;  1SZ9 A;  4CEM A;  2VKH A;  4CZZ B;  3KFW X;  3T8O A;  4U8H A;  2WXR A;  3UT8 A;  4FJY A;  1H0A A;  2X38 A;  3S7B A;  3UT7 A;  4ADZ A;  1UN9 A;  4XZ4 A;  5M4Y A;  4JEU B;  5JH7 E;  3WI3 A;  3OYX A;  4KVM A;  1D0X A;  3DJB A;  3N71 A;  3EHN A;  3EVY A;  2CG2 A;  3FHE A;  5J2T E;  3SWH A;  5FNV E;  4ZI3 C;  3AU4 A;  4EYU A;  1H2V C;  5ARG A;  2J9Q A;  4DI4 A;  5JR9 C;  3VKH A;  3PU8 A;  4FLH A;  3GMI A;  3ZCI A;  3LBX A;  4GZD A;  4H9O C;  5HWX A;  3FU6 A;  4AKR B;  1H6K A;  3C98 B;  4H7X A;  4PH4 B;  1HZ4 A;  2ZU6 B;  1IZN B;  2YQ8 A;  3FUI A;  3FTY A;  1PAQ A;  5DQV A;  3I1A A;  2DCP A;  3P8C D;  2X9H A;  1QQE A;  4L1B A;  5E75 A;  5M72 A;  5FY1 A;  4PUC A;  5LCW C;  2FO7 A;  2IAK A;  5GON E;  4DPR A;  4P09 A;  3FH8 A;  4PFO A;  4ILI A;  4DVD A;  4AKI A;  3CVR A;  3FTU A;  5LCY A;  3WAJ A;  4HOR A;  4EQF A;  4H63 V;  3APC A;  3RK6 A;  3VTX A;  3FTW A;  3FBL A;  1IJ6 A;  4I17 A;  2N2N A;  3N2O A;  1ZHC A;  4ACL A;  4WNG A;  1UCU A;  5HI7 A;  2NOX A;  2L8K A;  1UG3 A;  4G25 A;  2GGF A;  5TAO A;  4UVC B;  4AI6 A;  4QX7 B;  4QKN A;  3KVA A;  3RYC E;  4IYP A;  4HFG A;  2RG8 A;  3RC3 A;  3LK4 2;  3O9X A;  4KMO A;  2XQY A;  4DI3 A;  4DO0 A;  4AM9 A;  1U5P A;  5LGU B;  5DJQ C;  2NTY A;  2N9D A;  2OVB A;  4QXC B;  3ML8 A;  5LYJ E;  4KXK B;  4MFR A;  4GMJ A;  1TEZ A;  5FZQ A;  1ZKE A;  2PZI A;  3CVX A;  2RA1 A;  4TV9 E;  4QWN B;  4C91 A;  5FY7 A;  3AB3 B;  3L13 A;  2X9W A;  4AY6 A;  3N2K E;  2CG3 A;  3Q2M A;  3GN5 A;  5CMY A;  3L09 A;  3T8M A;  4RSY A;  2X66 A;  1H19 A;  2W00 A;  4N2Q A;  3FY4 A;  1OWA A;  2HYZ A;  4AOF A;  2QFC A;  5L3E B;  2BVM A;  4L2L A;  1E7U A;  4F3V A;  1WM5 A;  1VOM A;  3N9P A;  4GCN A;  3D9I A;  4M3O A;  2YU1 A;  3QK6 A;  4HEA A;  3ONK A;  2XAQ B;  4AXH A;  4C9B B;  2A3D A;  3QOU A;  3V5S A;  4J0U A;  2C5I T;  2E2E A;  4UI9 J;  3HKD E;  5LBM A;  3HKB E;  4P0A A;  2C5K T;  3I0O A;  3NRY A;  4B94 A;  1AJ3 A;  3ZVV A;  3RC8 A;  3N9M A;  2H7V C;  2HPJ A;  4I55 E;  4EZJ A;  4GZ3 A;  4XI0 A;  4XE0 A;  4O4I E;  3VLE A;  2ZLY A;  5JRE A;  1HX8 A;  2R17 C;  3D9N A;  5G04 C;  1OWM A;  3D0T A;  3S7D A;  4EBA G;  1U4Q A;  3J9X 1;  1HH8 A;  1B7T A;  3ESL A;  4WNF A;  5G55 A;  5FQ7 A;  1LF8 A;  3QJZ A;  1NP7 A;  3L17 A;  2XAH B;  4V1A v;  4ME2 A;  3TKL B;  4PAG A;  3AA1 B;  3SBT B;  5BT1 A;  3PS6 A;  3CVN A;  4TZ4 C;  2LHN A;  2PBI A;  4BWR A;  4N78 D;  3U3I A;  3RPU A;  4K0U A;  2V7L A;  2E8I A;  3CHO A;  3U4T A;  1O3X A;  5KJN A;  5J90 A;  4BTA A;  1V9D A;  4H63 H;  4QXB B;  2WXK A;  4MKT A;  4EPZ A;  5BNW A;  3CVW A;  3B57 A;  3QAR A;  3CHS A;  3G2S A;  3ZMS B;  4WUY A;  3B7R L;  3R84 B;  2Y4U A;  3JCK C;  2X9Y A;  2OND A;  4KZ0 A;  3MZK B;  2WQ6 A;  2PG8 A;  1S35 A;  3CSF A;  3ZHE B;  2MTQ A;  1WYB A;  3CGH A;  3SF4 A;  3BK9 A;  5ANL A;  5A1L A;  4U07 A;  2LSK A;  3SRZ A;  2WXI A;  3FUD A;  1XGW A;  2BUG A;  5BUZ A;  2H3R A;  1G8X A;  4PNI A;  4U0S A;  3C51 A;  2LOP A;  5KMG P;  1ZEE A;  3ONL A;  3K3O A;  3PEV B;  4ZOL E;  5LHI B;  3ZMZ B;  5FTP A;  3GA8 A;  3OXL A;  3CX8 B;  3CX6 B;  1NZN A;  3JC6 D;  1MMD A;  1WYC A;  3AS8 A;  2JLB A;  2I59 A;  3V5U A;  3QAQ A;  2CXD A;  4WNE A;  3AU5 A;  3ZFW A;  3FDH A;  3GZS A;  2LSG A;  4APO A;  4CCA A;  5BV0 A;  2R5S A;  3LJC A;  4TV3 A;  3UMV A;  4L7T A;  3R7R A;  3U3W A;  2NXP A;  3SHF A;  2IC6 A;  5FXW A;  2WXM A;  1NAF A;  5LX8 A;  4QX8 B;  5EX0 A;  2DI4 A;  2P58 C;  4ATG A;  1D0Z A;  3F57 A;  3FUJ A;  3C50 A;  2YNQ A;  1ZBP A;  3L54 A;  4J2C A;  3L08 A;  4DK5 A;  3LK3 B;  2J09 A;  5L3G B;  3UT5 E;  5FT9 A;  4ANU A;  2BTD A;  3FUE A;  3RRU A;  4L2Y A;  2Z6E A;  4CDM A;  3FUN A;  3BG1 B;  1E8X A;  4HS2 A;  1A17 A;  3PUR A;  2G0U A;  4O4J E;  2LSU A;  4A1G A;  3H3A A;  3I9Y A;  5FYM A;  2WBL A;  3RRC A;  4GML A;  2L0I A;  1BR2 A;  2DLR A;  4M1P A;  3FTZ A;  3LPZ A;  3LVR E;  3RYI E;  3AVR A;  3CVU A;  4U63 A;  5KCM A;  3PUG A;  1OUV A;  4AQF C;  5LXT E;  1ZV4 X;  3CVV A;  4GA0 A;  4FAD A;  2OA5 A;  3ULQ A;  4LUN U;  4PK4 A;  2X6J A;  3C64 A;  5AYW D;  5FZS A;  5HQ8 A;  4G2A A;  4JL0 A;  2VTB A;  3ZEF A;  3CHP A;  4KMC A;  3FU5 A;  3HHM A;  2HM8 A;  3LVQ E;  2WXG A;  4J8E A;  2IQC A;  4N3A A;  2Q7F A;  3RKO A;  4DMV A;  1JUQ A;  1IHG A;  1IYG A;  1FMW A;  1G73 A;  2I1K A;  1LKX A;  3I4R B;  4MS6 A;  3TGO A;  4WNK A;  4GAA A;  3ZMV B;  3TXN A;  4HXI A;  4YVQ C;  1EYH A;  2CXF A;  3N9O A;  2VL8 A;  4RVB A;  3O1J A;  3R7Q A;  2HH7 A;  3ZPJ A;  3JUI A;  3ZYQ A;  5HXR A;  3ZXS A;  3NF1 A;  3JYS A;  3IKO B;  3LY8 A;  3PTR B;  3Q5M A;  4F7A A;  4ERR A;  3IBE A;  2KIN B;  3E0Z A;  4CT4 A;  2P9B A;  2CLY C;  3ZJ1 A;  3MCX A;  2KWI B;  5G05 J;  4YJ2 E;  1MNE A;  2YHE A;  3RU0 A;  3ZN0 B;  2FI7 A;  4NAC A;  3KAE A;  4XKB A;  3FHN A;  4X1K E;  3AVS A;  1JWF A;  3UX4 A;  2LSY A;  3ZMU B;  3FUK A;  4AP2 A;  3FEX A;  1HU3 A;  1SA0 E;  2KWH A;  5EX3 A;  3UFE A;  4BJM A;  4H9Q C;  4IDZ A;  1MIV A;  4ZI2 C;  4CXW A;  5L3F B;  3PE4 A;  5FXV A;  4J6I A;  3FXE B;  4X20 E;  4BTB A;  3C4W A;  3L3P A;  1BR0 A;  3D9O A;  4OVU A;  3OAW A;  2N1G A;  2E9X D;  3SFZ A;  3RYH E;  2C0L A;  4AKL A;  4EB6 E;  2OOE A;  2PM7 A;  5C8Y E;  2IF4 A;  4GK5 E;  5L3C B;  4NUV A;  3KVB A;  3P7I A;  5IYZ E;  4IE4 A;  5J08 A;  1JWG A;  2ZM8 A;  4WBN E;  2J4B A;  4GYO A;  3OYZ A;  2WXH A;  3M65 A;  3N5L A;  4UWF A;  4CI2 B;  2Y6X A;  5AJD A;  2J07 A;  4WWP A;  3PH0 C;  3D9M A;  1LRZ A;  3CVY A;  1LVF A;  2CCQ A;  5DBK A;  2OV8 A;  3CST A;  5F3J A;  4JXT A;  3KBU A;  2KND A;  2VGX A;  4DBR A;  3AAI A;  2WMN A;  2NWB A;  2ZM0 A;  3HA4 A;  4UVA B;  3ZRH A;  3UUN A;  3KV4 A;  4EZL A;  4D10 C;  4DLO A;  3MV3 B;  3ONX A;  4FP7 A;  1VDY A;  2WVI A;  2LAI A;  3FU3 A;  2LM9 A;  4AJW A;  4P0B A;  3L6A A;  2DHR A;  4ACK A;  5JDH A;  3FFL A;  4OVV A;  2XPZ A;  2MOZ A;  1WAO 1;  4Z8X A;  2CHX A;  2WPV A;  4FHK A;  2KZ7 B;  2MBG A;  3ZC0 A;  3GN5 B;  2XGO A;  2J1D G;  3MK7 C;  4H7Y A;  1ELW A;  4XKC A;  2JPF A;  2WXQ A;  1S0P A;  2QY7 A;  3CHQ A;  2WB2 A;  4L5G A;  2CA5 A;  2ZM2 A;  4OHF A;  3Q15 A;  4DJA A;  3UUX A;  5A7D B;  2NW8 A;  5A23 A;  4Q96 A;  3E22 E;  3PDY A;  2VYI A;  3CIA A;  2VWA A;  5FP3 A;  4ANW A;  4BT9 A;  4PS3 A;  3ZN3 A;  4U0U A;  3ZYK A;  2X67 A;  2LSI A;  2YU2 A;  4G23 A;  4CQI A;  3AAA B;  4YLH A;  4PS7 A;  4ZS2 A;  4UEM A;  3QC9 A;  5J1G A;  2L3L A;  2E9X A;  2MRI A;  3VLF A;  2AXZ A;  5LOV E;  3FUL A;  3ZCJ A;  4N39 A;  1EPU A;  1D0Y A;  3O48 A;  2V5F A;  1FEW A;  3L16 A;  5LJN A;  5JRC A;  4FA6 A;  4PFP A;  5DAB A;  3KV9 A;  1IAP A;  2UXN B;  4JA9 A;  2NSZ A;  1E8Y A;  2LOS A;  2IW5 B;  3ETV A;  4DMW A;  3VKG A;  3UT4 A;  5ETW A;  2GRM A;  1WLX A;  4B0Z A;  3PUS A;  3BEE A;  1KT1 A;  2C2L A;  2IC9 A;  4ASK A;  4A3T A;  3MKD A;  3FTS A;  1SHZ C;  3EDU A;  1KLX A;  4N3B A;  4B8C B;  3B7S A;  1NA0 A;  3HKE E;  3APD A;  3CK7 A;  3PZD A;  4EEC A;  2UY1 A;  2VAS A;  5AIJ A;  4Q94 A;  2KLQ A;  1E90 A;  3VTY A;  5FQ8 A;  3QDN A;  2WM9 A;  4KP3 C;  4J8S A;  5FY0 A;  3N9Q A;  4JUY A;  2XPY A;  3DP7 A;  1E8Z A;  4CRW A;  3HVE B;  1Y6I A;  4UV9 B;  3CQX C;  3FH7 A;  2K48 A;  3N9L A;  2CFU A;  1PY1 A;  2L6J A;  2FBN A;  2WWU A;  3Q5X A;  5ARF A;  1FVH A;  1VRB A;  2X0L B;  4UV8 B;  4E7S A;  3HKC E;  1MHQ A;  1MQS A;  5EK4 A;  4NQ0 A;  3RJV A;  4OFZ A;  4I2Z A;  3ESK A;  3URZ A;  4ZI7 E;  3ASH A;  2ODV A;  1Z3X A;  5BV1 A;  2IFU A;  4ISS A;  5LGN B;  4LER A;  3OXF A;  1FIO A;  2LJL A;  4YND A;  4XBF B;  2JMH A;  5LA6 E;  2CFZ A;  4CGW A;  4L23 A;  4UF0 A;  1HG2 A;  2ODU A;  4TV8 E;  1FMV A;  3MJX A;  4E7Z A;  2J49 A;  4H9N C;  3IHV A;  4YVO A;  5LOZ A;  2FUL A;  2JMK A;  2Q9Q C;  2LT3 A;  3SI5 A;  4N2S A;  3O4Z A;  3Q47 B;  1KK7 A;  3J7Y q;  4UIG A;  1BR1 A;  2YK0 A;  2H7O A;  4I1A A;  3MA9 A;  3JQ1 A;  3CX7 B;  5CA0 E;  5EK2 A;  4G63 A;  3PDN A;  4UXN B;  4TUU A;  4L0R A;  1HS6 A;  3CV0 A;  5FQ4 A;  3RO2 A;  4FUL A;  3LY9 A;  3EUH A;  3CR3 A;  2X6I A;  3NQP A;  4GB9 A;  4ABN A;  4UQZ A;  1OXZ A;  4BX8 A;  2V26 A;  1H7C A;  4B89 A;  2CXL A;  1ZU2 A;  1PC2 A;  3Q4A B;  4A3V A;  3ASF A;  3LS8 A;  3ZC1 A;  2EQX A;  4BSX A;  3D9P A;  3HVE A;  3ASG A;  4TUY E;  3EIQ C;  5HYA A;  2XUE A;  2C5J A;  4GK0 E;  3QNK A;  2KZT A;  3CLJ A;  4PJM A;  1Y64 B;  4LCT A;  5LJM A;  3MKQ A;  2W61 A;  4MLK A;  3P2B A;  5IHY A;  4HOS A;  1TJC A;  3FTV A;  2XAG B;  5FQ6 A;  5T4Y A;  5LBQ B;  3KD7 A;  3FH5 A;  4I2W A;  5LCW J;  4O4H E;  4EIW A;  2X6H A;  3O4X E;  4ZHQ E;  3UPV A;  2KM4 A;  3CWZ B;  4ILH B;  3SS1 A;  5FXX A;  4J8F A;  1E8W A;  2VTB B;  3ZEF B;  3WAK A;  2LE8 A;  4AEZ C;  4UQX A;  3PUK A;  3PRE A;  3KV5 A;  5LNK A;  3PVL A;  3LKU A;  4N3C A;  2BDE A;  2VKD A;  3CK9 A;  2IOS A;  2CEA A;  1N52 A;  4WW0 A;  4NRH B;  5HXH A;  2PM6 A;  4HLE A;  3A5X A;  3AA0 B;  3CML A;  2D0T A;  2LNI A;  5E76 A;  1P5Q A;  4ILG A;  3SD5 A;  3G2V A;  4URK A;  1D1A A;  3Q5W A;  3KV6 A;  3D3M A;  3C4Z A;  4GCO A;  4X1I E;  1S94 A;  1WR6 A;  2A5U A;  3FEY A;  4BJN A;  3BQK A;  4Q69 A;  3CVL A;  2EHO A;  5LHG B;  2XPI A;  3FWV A;  3PNT B;  1IJ5 A;  3OBV E;  4NUR A;  3NZP A;  3ZMT B;  5BPP A;  2Y4T A;  4WND A;  4V3I A;  3UTK A;  1MMN A;  2VSN A;  2X68 A;  4N5C A;  2CWY A;  4K0R A;  3FUH A;  4I1O B;  5CCM A;  2WQ7 A;  4I6J A;  2J4D A;  4CI3 B;  3FUM A;  2Y48 B;  3G2T A;  3D9L A;  4GU5 A;  2AW6 A;  4MAL A;  4UWG A;  3GYZ A;  1E96 B;  4AIF A;  2HPL A;  3HI2 A;  1OWL A;  5JR9 B;  5HWY A;  3EHM A;  4CI1 B;  2V7I A;  1E7V A;  2WSS V;  1X79 A;  1HE8 A;  1HS7 A;  2BVL A;  4GYR A;  3QKY A;  5DQW A;  3MAC A;  1NWM X;  4XIF A;  1UN8 A;  4AKH A;  2X6K A;  3PRZ A;  5DIZ A;  4WWN A;  5G04 J;  3R9A B;  2XRY A;  3G2W A;  3UQ3 A;  2XTL A;  1KT0 A;  4KVO A;  4TRQ A;  4BX9 A;  5C2Y A;  4AVX A;  4IHJ E;  3LJ3 A;  2K9A A;  3N9N A;  1QSD A;  5JJT A;  3PUA A;  1WY6 A;  1OWN A;  1ELR A;  2K24 A;  4G26 A;  2CWO A;  5KJL A;  4GIW A;  4O8S A;  1IQU A;  2VGX B;  2M63 A;  3CKD A;  1TJF A;  4I6E A;  3LCA A;  4IE5 A;  3UUM A;  4TX5 A;  4JZY A;  3OJA A;  2JQQ A;  2WXO A;  4I43 A;  3Q9D A;  3RRM B;  4OK0 A;  4RG6 A;  2B1E A;  4QFV A;  3MZL B;  5FXZ A;  3MEK A;  2FEZ A;  5LGT B;  4MBQ A;  2PL2 A;  4K03 A;  2V0P A;  2KXP B;  3GWH A;  3K9I A;  2DWG A;  4E6H A;  2PQR A;  5FZR A;  2E0I A;  3RYF E;  3T5V A;  2AVP A;  2Y3A A;  4UQY A;  1UJJ A;  4UWL A;  4H9P C;  1H2U A;  4X1Y E;  1MMG A;  2A2F X;  1DNP A;  4I6G A;  4YHJ A;  2V4L A;  4KUM B;  2J08 A;  5JR9 A;  4FJO A;  3UUX B;  2VSY A;  2X6F A;  3MX3 A;  4JLE A;  4U72 A;  3SZ7 A;  1HO8 A;  3HL6 A;  3B7U X;  2KCK A;  4PK6 A;  5H6R B;  3E08 A;  3R6N A;  2IU1 A;  3CQC B;  1GW6 A;  1FCH A;  4EZ4 A;  5L2L A;  1UX5 A;  4G24 A;  5FMN A;  2E9X B;  4UI9 C;  2CM0 A;  5HXC A;  1YKE B;  3PEU B;  3CK8 A;  3TG4 A;  5JRC B;  4NUU A;  3LDZ A;  3ZN1 B;  4B8A A;  4IGU A;  2VSX E;  3EIJ A;  2HR2 A;  3JC6 C;  2CHZ A;  3IHY A;  5T3R A;  4C90 A;  2Y8D A;  3RRN B;  2XRZ A;  5JJ7 A;  4PS8 A;  2V1D B;  5HAX A;  2WMO A;  3VU7 H;  3ASD A;  3ZGQ A;  2M67 A;  2XHE A;  5HXE A;  3SOL A;  2UY1 B;  3ZPO A;  1BR4 A;  2AXU A;  3DTO A;  3WXX A;  4JEH A;  1IQR A;  3O1I A;  2VGY A;  3ZIM A;  4KBM B;  1QUU A;  4PK5 A;  1CUN A;  5ANR A;  3P1U A;  4EAH A;  1MIW A;  5CCL A;  4IRU A;  3ANW A;  3CKB A;  2LHR A;  4MLP A;  3T5X A;  4HFV A;  2NC9 A;  5JDG A;  4JHK A;  3F31 A;  4PW8 A;  4FLB A;  4IE7 A;  3IHR A;  4HGA A;  3OTN A;  1FVF A;  4O6F A;  4DLQ A;  4GPK A;  5EZY E;  3Q49 B;  2KT9 A;  2ILR A;  3MYV A;  4AQG A;  3PNL B;  4HN9 A;  5HXS A;  5H6Q B;  3CVQ A;  3CEQ A;  2V8S E;  1D1B A;  3QB2 A;  2X9X A;  3MJW A;  1Z0P A;  3FUF A;  4L9I A;  2XCB A;  4FHJ A;  2IOL A;  5FJY A;  2NP9 A;  4UF0 B;  2NW7 A;  2KMF A;  4TN7 B;  1U3D A;  4I9C A;  2C0M A;  2AWI A;  5LP0 A;  1Y8M A;  1UX4 A;  3APF A;  3U64 A;  2X51 A;  4UI9 K;  3RKV A;  2DBA A;  3D9J A;  4GOU A;  3ML9 A;  3LY7 A;  4JA7 A;  1KNZ A;  1D1C A;  4AY5 A;  3FTX A;  2Q9Q A;  2A4Z A;  5AJL A;  3FXD B;  5A6C A;  2CHW A;  3ZLI A;  3EDT B;  2UWJ G;  3FU0 A;  4WWO A;  2JEK A;  4FJZ A;  3HR0 A;  4HE8 A;  3ETU A;  2X3M A;  2RD0 A;  5JDQ A;  1Z3Y A;  5EKQ D;  4BY6 A;  4BT8 A;  5EDS A;  3I0Q A;  2WXF A;  3JQ0 A;  4CXY A;  1H2T C;  4JPS A;  5LG4 A;  4UVB B;  3VHL A;  3KBT A;  2WAU A;  4W9R A;  2L9Q A;  2MYS A;  3IBP A;  4JEU A;  2I1J A;  2LSV A;  2VKO A;  2BZB A;  2CE7 A;  4AKG A;  1HFA A;  5ENN A;  4OYJ A;  4WAF A;  3MKR A;  4JC8 A;  4HOQ A;  1SQM A;  2DCF A;  2KZT B;  2LAH A;  3PUJ A;  4CT0 A;  3MKQ B;  3AS4 A;  5JDL A;  3BQL A;  2R59 A;  4XX5 A;  5CMW A;  4OYK A;  1SZA A;  4PJL A;  4Y6W A;  1US7 B;  2D2S A;  2VKJ A;  4HVB A;  3TAX A;  2XGS A;  5AEN A;  3CHR A;  3GZ2 A;  4O2B E;  3C98 A;  3G2U A;  2K5B B;  3RX6 A;  1MMA A;  5LHH B;  3D9K A;  3F2E A;  2BF0 X;  3PUQ A;  3HIZ A;  2QGS A;  4R7L A;  2V7K A;  4B6X A;  2GW1 A;  2D5U A;  2E9X C;  2VJ8 A;  1YD8 G;  1LVK A;  1B89 A;  3PE0 A;  1XNF A;  3NBX X;  2XQ0 A;  2EHO D;  3ZYL A;  4I50 E;  1EF1 C;  1L5J A;  4QXH B;  2MHK A;  2YHC A;  1YKH B;  4XZC A;  4LEU A;  5BW8 C;  4DND A;  5LP6 E;  4HOT A;  3AA6 B;  4J8D A;  4ANJ A;  2VK9 A;  4I1M A;  3KDS E;  5JQG E;  3NZU A;  2VB6 A;  1N54 A;  5KDM C;  2KCL A;  4AV7 A;  5JDM A;  4IN3 B;  2EHO B;  2DIW A;  4JHJ A;  3TG5 A;  3BG0 B;  1OWP A;  5JJ6 A;  4LRZ A;  3C4X A;  1NA3 A;  5JDF A;  1BPO A;  1YA0 A;  4ANX A;  3K3Q C;  3K8P C;  1E1H B;  2CLY B;  4ZI2 D;  1W3B A;  4IE6 A;  1QZ2 A;  4G1T A;  3TXM A;  3E4B A;  2ACX A;  1JPL A;  2LSJ A;  2L0T B;  2LEH A;  1Z6T A;  3EDV A;  3GZ1 A;  4BAY B;  5G05 C;  4C0M A;  3QWV A;  3MA5 A;  3AA7 B;  2CMR A;  4FI5 A;  2PQN A;  4EXT A;  1EDU A;  4ANV A;  2I6H A;  4MHC A;  3S4U A;  3MV2 B;  2ION A;  4AQF A;  5C1D A;  2W63 A;  1HCI A;  4PDX A;  1HG5 A;  4JW1 A;  5LFA A;  3HYM B;  4EZK A;  4IUL A;  2KC7 A;  3FB2 A;  3KEZ A;  4H9R C;  1EZ3 A;  1UJK A;  3OXG A;  2W62 A;  5KJM A;  4FC8 A;  3MGB A;  4H9S E;  2GRL A;  2WXP A;  2D0U A;  4JHR A;  4GA1 A;  3U66 A;  5E0O A;  3L22 A;  3S7F A;  3DBS A;  2RP4 A;  3O1H A;  1OWO A;  4QHO A;  3NRX A;  4I43 B;  3UUL A;  4YFS A;  4CDR A;  4APF A;  5JHB A;  4UWH A;  2OVF A;  1QNF A;  4ZI3 D;  1U3C A;  3SGH A;  4HOU A;  1MND A;  5JDN A;  2ES0 A;  4O4L E;  5J2U E;  4OYS A;  2WXN A;  4G2V A;  1MIY A;  5EK3 A;  3RIB A;  2YEV C;  3FBZ A;  3IV0 A;  4UEL A;  4DBQ A;  4JVS A;  3U78 A;  3CKC A;  4IIJ E;  3I9W A;  3LG7 A;  5G2N A;  1T98 A;  5JVD E;  3QWP A;  4KZC A;  4U74 A;  2MOW A;  2KCV A;  2YIN A;  4PJN A;  3PU3 A;  3KIN B;  3ZHE A;  4BA9 A;  4PJJ A;  4G11 A;  2A72 A;  3H37 A;  2JRK A;  5FWQ A;  4IE0 A;  1ELK A;  3ZW3 A;  5KJK A;  5CHE E;  3RH3 A;  4A1S A;  3IEG A;  3CHM A;  3LYA A;  4CDN A;  2W0G A;  4GZC A;  3SBS A;  3OKQ A;  3LK2 B;  3FP3 A;  4A55 A;  1X5B A;  4I9E A;  2VSO E;  4U04 A;  3IF8 B;  2WXJ A;  2XCC A;  3K3N A;  4CGV A;  3NZQ A;  3QUJ A;  4KBQ A;  4MRU A;  3HDX A;  3NZS A;  3TJP A;  3CQG B;  2XAJ B;  4EOZ B;  3MXZ A;  4Y6C A;  2I9C A;  3QK0 A;  2WXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...