2WMOA

Structure of the complex between dock9 and cdc42.
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
423
structure length
403
Chain Sequence
STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEAHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVAGPLAYARAFLDDPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
total genus 149
structure length 403
sequence length 423
ec nomenclature
pdb deposition date 2009-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wmoA03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wmoA01
3VHLA 2YINA 2WMNA 2WM9A 2WMOA 3B13A
chains in the Genus database with same CATH superfamily
4XZCA 1J1JA 2B76A 1MHQA 5LG3A 3MA5A 3S4UA 2JQKA 1Z8UA 5KCMA 2V4HC 1E8ZA 4KVOA 5CEAA 2V1DB 5LNKA 3L82A 3PUXF 3AEFA 4F53A 4N3BA 1O3XA 4GK5E 5LP0A 3RHWA 1Y64B 4N39A 3UKUG 3O1JA 2VSXE 2Q9QA 3PE4A 4UWKA 3LPZA 3GN5B 5G04C 4HOQA 3PUGA 2XQ8A 2FUPA 4KUMB 1WM5A 4NXMT 4JEUB 4EPZA 1XMQT 3FTYA 3JXJA 3B7RL 4HFVA 5FINA 1I6ZA 4N5QA 2VKHA 5A23A 3GW4A 2YHCA 1E96B 3JUIA 2XGMA 1BR4A 2H3RA 5AN8A 4B89A 5JH7E 4HLEA 1FJGT 4BEPA 3SFDA 5AQ7A 4JA7A 3Q75A 3TAXA 2J1DG 2CXDA 5L3BB 5AQFB 4TV3A 4AXHA 4AY5A 2ZM0A 3LK2B 3APCA 3PUVF 4DLOA 4JI8T 3MK7C 4GYYA 2ODVA 2Q7FA 3FUHA 2X6FA 2BVMA 2BG9E 3CQXC 2OVBA 3ANWB 3L17A 4C91A 2ZXWE 4BSXA 3SOLA 5FY0A 3RLFF 5HCMA 2CHWA 1KZOA 4YJ3E 4G11A 3GYZA 2XY8B 2Y0BG 3HXEA 3TLTA 5ANLA 1IQUA 1Y01A 1HCIA 3CK6A 3R7RA 3DSVA 2YINA 3Q9UC 3C3QA 3RYIE 4ILGA 3Q47B 3ZYMA 3DSWA 4NURA 3Q9NC 3NBNB 4PW8A 3RIAA 3FWVA 2LKHA 2FBWA 4I0UA 3C98A 4I9EA 4G8KA 4FHJA 1IJ6A 3KSQA 4DBRA 1OWPA 4IDPA 4CZ2D 2FJBA 1HE8A 4GYOA 3FY4A 3QWPA 3D9MA 1S35A 5HXHA 2UXNB 1O1RA 1UW4B 3WAJA 2XEVA 4LNBA 4F1PA 3LYAA 4YNDA 4Z8XA 1Y6IA 2E5LT 5AJLA 2DYSE 2A2FX 1YW0A 2BZBA 4HOSA 4UF0A 4FADA 4G2AA 2L9BA 1UX4A 1MMGA 2CE7A 4B6XA 4KXKB 2PM7A 2LE8A 2VQ2A 3VR9A 3G2WA 5AFUL 4H9NC 5ENRD 4A55A 1YD8G 2WS3A 2J4BA 3S7DA 2Q9QC 2Y3AA 3ASGA 2OCCE 2JIWA 5KXJA 1D0ZA 2ES0A 4BX8A 3AXJA 2J9QA 4QXBB 4GTMA 5ADXL 3RIUC 4WWOA 2GRLA 4JHRA 4J8SA 1L0VA 4YXDA 3EUVA 2BBJA 4BX9A 4IE6A 5AQRB 3TKLB 1OCOE 3ABVA 5FQ6A 3B5MA 3SGHA 4J0UA 3LK42 4YVOA 5ANRA 3L39A 3RO3A 2PQNA 3N9MA 2XZEA 1VDYA 3MGBA 4O4IE 3I9WA 5FY1A 5LP6E 3EAMA 5EDSA 2XEEA 3IV0A 3SRZA 2YDQA 4ZOLE 3L13A 3PRZA 3D9NA 3TWVA 1O1SA 4LF6T 5TAOA 3QAQA 1KF6A 4JBWF 4NQ0A 3FH7A 4GKKT 3D3MA 4P0AA 5IUXA 2HO1A 3ZLIA 4GZ3A 4APFA 1AJ3A 3N2KE 3ZYLA 4FHKA 4CN4A 4MS6A 1BR0A 4EBAA 1UURA 4M7CA 3ZN0B 2DLRA 1RZ4A 1CHUA 4DV4T 3T5VA 3HKDE 5ENPD 1EZ3A 1XWMA 3UM2A 2IJGX 4PJLA 3ABKE 4U8YD 4ZEYA 4A3VA 3V5SA 3W9GA 2BKPA 1SA4A 1M7KA 2CG2A 5FTPA 2BS2A 3FXDB 2X67A 4F6RD 5T8IA 5G55A 1SA5A 4CGWA 1OWNA 4LERA 3C51A 4NIQA 4ASKA 2V6YB 2B0OE 3M3ZB 3ZCIA 4LEUA 3QC1A 4PDXA 3DP7A 4DPRA 2J49A 4C48B 5A1LA 1BR1A 2CCQA 2P9BA 3KEZA 3RIBA 3UM0A 4HGAA 2L0IA 4UVCB 5FIOA 2WSSV 3L54A 3FTSA 3HHMA 1SUMB 3R6NA 4HWCA 2R17C 3AEEA 3ZMUB 4DX2A 3B95A 5L3FB 1LTXA 2LSJA 2A4ZA 4FLBA 4GA0A 1E7VA 3PZDA 3SF4A 4DK5A 1U5PA 4TWHA 2XGOA 3TWTA 2L0TB 2CLYC 2CXLA 3LBXA 4QQIA 3ZHEA 3ZSTA 3BQOA 5KNHD 4DMVA 4C90A 3KVBA 2UUAT 3FTWA 5AQNB 4YHJA 1ZEEA 4HWHA 3RRCA 4DV0T 2Y1LE 4U2YA 4JXTA 4AKLA 2LSYA 1X9BA 2BF0X 2KINB 5ABFB 3PJAJ 2L6JA 2P9IG 5LHHB 1N32T 1FEWA 4CZZB 2DBAA 3M65A 5HQ8A 3V31A 5JQGE 5AENA 4PFPA 2ZM8A 2WQ6A 4F3VA 3ABLE 3UI2A 2YHEA 3ZSSA 4B3TT 4H9QC 5L4EA 5FVKA 4ME2A 3PU8A 1AP7A 3HYMB 5CERB 3E0ZA 2KXPC 5B1BE 1HG2A 4BWRA 5CBOA 3CVQA 4U33A 3DEPA 3Q73A 1SE7A 3UQ3A 2LKGA 4JEHB 4DV5T 2AWIA 4WNEA 5FQ7A 5B3SE 4I1MA 5AQQB 3AEAA 1FCHA 4WUYA 2P58C 3UT7A 1X5BA 1UN8A 3F31A 2BBHA 4ZI3D 1D9SA 5LBQB 1OEDE 4O2AE 2P9NG 4HORA 3I3NA 5D2MC 4GYWA 1X79A 4DUYT 1TYQG 4WW0A 3PEUB 3C98B 4IE5A 1NP7A 3IXEA 2IF4A 3C4ZA 2IQCA 3K9IA 2CWYA 5FYMA 2VTBA 1IJ5A 3EIJA 1N4PA 3RK6A 3JAFA 1QZ2A 3SBSA 3CVYA 3CK8A 5LGUB 4U31A 5LMNT 4ACKA 4HB5A 4HWFA 2FJEA 3NQPA 3L6AA 3FHEA 3FXEB 1K8KG 3R84B 2MBGA 3E22E 4AKGA 3V2XA 1WR0A 1T72A 1NA0A 2HN2A 5D66A 1YQ4A 2K9AA 2E5VA 3L16A 3LY7A 4Z91A 2GRNB 3D9HA 4B8CB 3Q9DA 2X6KA 4JZYA 5BXUA 2ZMAA 5FP3A 1S0PA 4I2WA 3EHZA 3HR0A 3GN5A 3HL6A 2W2UA 2E9XA 4V3IA 3EJNA 4PFOA 3VHLA 2Q9QB 4YJ2E 5HXCA 4A1GA 3AVRA 2BTDA 4UQYA 4HFBA 3P4QA 5JHAA 4URKA 1NENA 2IMLA 3ASHA 5JJTA 4FP7A 3ZJ2A 1KT1A 2LO6A 1H2VC 3Q7FA 4I6EA 1ZKEA 4YY3T 1XNFA 3HVEB 2LOSA 5FZSA 1O1TA 5E75A 4XIFA 2LOPA 5JJ6A 1DNPA 4LMLA 4PNIA 3PUSA 4YDWA 2F37A 5J1GA 4U63A 4ZHQE 2I9CA 4HKAA 1UCUA 2VB6A 2WBLA 3A5XA 5IWAT 4OYJA 3C50A 3PE3A 4EZ4A 3P50A 1DU2A 2C0LA 1LVFA 2FJAA 3TWXA 3AEDA 3SFXA 1MMDA 3DBSA 3AAAB 3O1IA 1JNRA 2H6FA 3FZMB 4OAUC 1WRDA 3Q78A 4RLYA 1K1AA 4CN1A 5D0QD 4A1SA 1KEYA 4YTMA 3ZXSA 5AQTB 3TLSA 3AU4A 2WCAA 3AE3A 2K3WA 3T9KA 3CSTA 3WAKA 3P4SA 3PUWF 5EN5D 4G24A 3UIOC 4RG9A 4U0ZA 1E8XA 1QBQA 2JLBA 5JDHA 1HNXT 4K0UA 5AQ9A 1N9AA 3EHMA 4L5GA 2QFCA 4W9RA 3CMLA 5FXWA 5ENTD 2XAGB 3V30A 3EUHA 1UN9A 2A5EA 2JEKA 3K3OA 4DR6T 2WXQA 3AXJB 4LRZA 2YU2A 3AECA 1N11A 2P9PG 4L1BA 5CB4E 4EZJA 2R59A 2CHNA 4PH4B 3PUJA 4NACA 2AXUA 4UF0B 2WP9A 2E2AA 2CPTA 4GKJT 4TV9E 3PZ2A 2J4DA 5KX5E 3UUXB 3ZEFA 5DIZA 3Q5MA 2Q9QD 2XEHA 2ETCA 4UVAB 4H63V 4FULA 2CHXA 3J7Yq 4BTAA 1D8EA 5AQOB 4GZ5A 5FY7A 3S2AA 1G73A 2W00A 4HVBA 2BUGA 2WZHA 3H3MA 2V5QC 4HRLA 4AI6A 4KBQA 2LXMA 1W0BA 2WDVA 4KHZF 5FMNA 4ZI2D 2XPZA 5CRVA 1OCRE 3MJWA 4LF7T 4CRWA 5LFAA 4U0SA 1UJJA 4GA1A 4ILIA 4ISSA 2KSRA 2GRQB 3N5LA 4K0RA 2XS8A 2UUCT 3UINC 2NTXA 3PH0C 5FZQA 4GK0E 3HXBA 5F3JA 1YKEB 4X20E 2NW7A 3L09A 1XNRT 4HBDA 4H9RC 3IBPA 4XX5A 2D5UA 3LJCA 4CI3B 3PUZF 3I4RB 4XAXB 4ZS2A 2QYWA 4B8AA 3B13A 5HS0A 2ZU6B 4O4JE 3MJXA 4C0EA 4PK4A 4ABNA 2NR4A 4X65T 4DV1T 2WMOA 4XI0A 4X1IE 5AQMB 2H88A 3PNTB 4ATZD 1J5ET 4L2LA 1FPPA 3FUFA 2AXVA 2OEVA 3U66A 3P4PA 4I17A 4H9OC 4XEIG 2EIJE 2VQET 3GMIA 1ZV4X 2V8SV 3QNUA 4O1OA 4HNAD 3ASNE 1OWLA 3BEEA 1XDPA 4HWDA 2ETBA 3ZXPA 4P0BA 1MX6A 3QOUA 2Y6XA 3LVRE 1YA0A 3AA0B 2V0PA 1WG0A 1KZPA 4APOA 4DX6D 4AIFA 5LOZA 4PAGA 1FT1A 2JABA 3UT4A 2X9XA 4F8HA 1NAFA 4AKHA 4DBQA 2ETAA 1ELWA 1YYHA 2A5UA 3ASDA 4TUMA 3MCXA 3CQGB 2DWKA 3FU0A 3LEWA 2LRLA 3EHRA 2GRRB 3UU3A 3UU5A 1W09A 1MX4A 4MBGA 3RC8A 3WXXA 1TNZA 4UXNB 3CVLA 3ZKRA 4NRHB 4P29A 4EAHA 2P9LG 2A9UA 1UOHA 2J4GA 5EKQD 3FFLA 1LKXA 1TNUA 3E34A 3SHFA 1OEDA 3D9IA 4G1TA 2LSGA 3RKOA 3I4GA 4H7XA 4FA6A 2N2NA 2QGSA 5FL0A 3MV2B 4X8QA 5HCJA 3IHVA 2WXOA 5HWXA 1UGOA 4A97A 3FZFB 4EB6E 1EDUA 3RU0A 5JA4D 2VK9A 1YXRA 3ZJ1A 3T1HT 1KPSB 4IL4A 4JI1T 3CWZB 5DABA 3CVXA 5JHBA 5L3EB 3AE7A 4UWGA 4OFZA 3VU7H 4ZS3A 1H2UA 3NWIA 4JEHA 1J5WA 3UUMA 2R02A 3MKQA 2C2LA 2EIME 2QZAA 2V7JA 4PJJA 4DR5T 4N78D 1N34T 2RFAA 1O5MA 3G2SA 5D0OD 4X66T 2ACXA 2X3MA 3QDNA 2UUBT 3HG0D 3FEXA 4ILHB 3VLDA 2VKOA 3TG5A 1S94A 1H6PA 3KFWX 5AARA 3N9LA 3CSFA 5AQKB 3FZLB 1TNBA 1QNFA 1QUUA 2C0MA 1ELRA 2EQXA 4IDZA 3QOFA 4GTVA 1D0XA 4U95D 2BVLA 4BA9A 2NSZA 2C5JA 3ZEFB 4LF5T 5LA6E 2CXFA 4D10C 2MOZA 4YVQC 4JPSA 4HOTA 2HHHT 2SPCA 5FQ4A 3R9MA 4L0RA 3PREA 4J8DA 4TN7B 3D9OA 3RGLA 2YEVC 3ZC1A 3PEVB 1Z3YA 1OXJA 1Z5SC 2IOSA 2B1EA 3SNXA 4YDEA 5LHGB 4GYRA 3LK3B 1TR4A 2WB2A 5DJQC 4E7SA 1BI8B 2WXGA 4TRQA 5CFBA 1AWCB 3F57A 1YMPA 3FULA 4U0UA 2XENA 3ZCJA 5C1DA 4YSZA 3Q4AB 4O6FA 4OVUA 5KJLA 3TGOA 3WI3A 1MZCA 2CFUA 3ZMZB 1E8YA 1QYMA 1KT0A 1UG3A 3ONJA 1OWAA 2XQAA 4AQFA 2NYJA 4L2YA 3ZPOA 1E90A 1BI7B 3ULQA 4HOUA 2YNQA 2R6GF 4QXHB 2RFMA 2WDQA 2WU5A 4IREA 4GPKA 2YKSA 3MEKA 2DYRE 5EYLA 4UQXA 3LY8A 3KSLA 3RJVA 1KK7A 5BR8T 2WDRA 2QYJA 4B3ST 3AE5A 2CA5A 4GZCA 4Q94A 4K5AB 2VVSA 1EPUA 4AEZC 4K5BA 1XGWA 4BFRA 3T8OA 3PUKA 4TXRA 3UT5E 5HEJA 1VCSA 2CHZA 2DI4A 3FH8A 4HE8A 2IFUA 4AKIA 4WWNA 1SW6A 5FXVA 3KDSE 2LAHA 4QX8B 3KEAA 1OUVA 3UKRG 4AOFA 3E30A 3JUEA 3O4ZA 4NXNT 5AQGB 3UU8A 3CVNA 4I4TE 1FMWA 3KINB 4G2VA 2PM6A 4B94A 2WXKA 3EABA 3NRXA 1IBLT 2JRKA 4JI5T 3ML9A 5AQLB 4ZI3C 4LF8T 3SZ7A 1HS6A 2I2OA 3CX6B 3QK0A 3IEGA 1GQEA 4TWFA 3IA3A 2E8IA 1HX1B 4NIKA 4JYAT 1YCSB 3KS2A 5KMGP 2MRIA 3TWWA 5M72A 2XAQB 1MMAA 1VOMA 1XMOT 2L8KA 2VGXA 2WXNA 1QSDA 2PTFA 2WVIA 4OYKA 5HRYA 4J8FA 2KT9A 2ZM6T 2WXJA 3UM1A 3FP3A 5FQ8A 4IGUA 2IC9A 4HWIB 4EGWA 3T1YT 4I6JA 4GCOA 1JCRA 3NZUA 4UVBB 1NFIE 3AAAC 4EIWA 4QX7B 5FL1A 3NOCD 4H9SE 1IHBA 4WNGA 1RW2A 1MJ0A 5HEUA 4KZ0A 4U96D 2WXPA 4I2ZA 4XE0A 5JRCA 3ABME 3ESKA 2XQ5A 4WBOA 4TNVA 3TWUA 5E76A 2UU9T 1XZYA 2KATA 2QVAA 4HFCA 1P5QA 1LRZA 1YKHB 2FJDA 4ANWA 4ZHBA 5CMWA 2LRKA 4I43B 3EHNA 5BW8C 5J2UE 2WXFA 2M6IA 1NI1A 4DMWA 3FU6A 4IYPA 1V55E 2BS3A 2J62A 4KI0F 4EEBA 4PJNA 3P4RA 1H0AA 1SHZC 2DHRA 3T8KA 3BG0B 3ZPJA 4XKCA 2NOXA 1D1CA 3RPUA 3FUIA 3C4WA 4EECA 2QYUA 3VRBA 3DJBA 3UXGA 3L08A 2BKKB 2L6BA 5EIBE 3CR3A 5JDLA 1NA3A 5A7DB 4ERRA 4DNDA 2UXCT 3O9XA 2NC9A 3OAWA 4LMKA 1S63A 3J5PA 5BMVE 3TLVA 3MZLB 4A3TA 5HYAA 3PUQA 4F6RC 4HN9A 3Q79A 2J07A 5KWDA 3MKDA 1UJKA 4OX9T 3OPCA 1V9DA 3MYVA 2XSAA 2H7OA 2WQHA 2D0TA 2VGYA 3QKYA 2W63A 5GONE 2BG9B 2HPJA 5FNVE 1MIVA 4MBQA 2CG3A 5M4YA 4DX1A 2VURA 3JQ1A 2LHNA 4M3OA 5LOVE 4JHKA 4UELA 2E2EA 2EINE 3TL5A 3SO8A 1SZ9A 4LFCT 1WY6A 3CIRA 4HLLA 2DWZA 5JRCB 3Q2MA 2B6CA 1FT2A 3IHYA 4AP2A 2JQHA 4DR3T 4AVXA 5FZRA 3J9X1 3FTZA 3L8RA 3OTOT 1JUQA 1HNZT 3WG7E 1FVHA 4DX5D 4IE4A 4O4HE 5JDQA 3SFEA 3AE2A 3RQWA 2LSIA 4UR9A 2IHR1 5BXOA 4L23A 5G2NA 3DSTA 2WXLA 3P4WA 4HEAA 3FZHB 4U8VD 1U3DA 4B93B 5AJDA 4OK0A 3CVUA 3KBUA 4QH5A 3MACA 4WWPA 3OXLA 4RG6A 1B89A 5C2YA 3KBTA 4FLHA 1G8XA 5KJKA 4GYSA 4DV2T 3K3NA 4CXXA 4KZCA 4I43A 2XPIA 4ZXLA 5FT9A 1N94A 3VLEA 5AQVB 2X6JA 2Z6EA 3ZN3A 1KNRA 4X5TA 3NZPA 2NP9A 3NBXX 3UU6A 3TG4A 2WB5A 2XCCA 3DXKG 3HRAA 3C4XA 2XASB 4LNGA 3IEEA 2QA7A 3CVPA 3U3IA 3F2EA 1EYHA 4O60A 2XHEA 5EYPF 5AQUB 5LYJE 1W0AA 3HKEE 2UXXB 2AVPA 3Q49B 3ZFWA 4GTPA 5J2TE 4V1Av 3RH3A 3ZMTB 2F8XK 1T8BA 2IUBA 1H6OA 4HI8A 3N9QA 3SS1A 1Y8MA 2VWAA 5B1AE 3ETUA 2E9XD 1W9RA 5L4HA 1LF8A 1TN7A 4N5CA 4N2QA 2WMNA 3U78A 1TJCA 3ULYA 2R05A 4E85A 4BJMA 2OV9A 4UI9C 2NW8A 2BKNA 2PL2A 4GAAA 3ZHEB 3PURA 3DSUA 3FBZA 2H6GA 1W3BA 1V54E 2FO7A 4CGVA 2UXDT 3HXFA 1JCSA 2FO1E 4U04A 3ZGQA 1EF1C 3OJAA 3NKZA 3AG2E 1BLXB 3CEQA 2KWIB 1MMNA 2DNXA 2LT3A 4LFAT 3FTXA 2ZM2A 1OCCE 3AE4A 1SQMA 2IOLA 4CQIA 4GZ6A 1A5EA 3GZ2A 3PVLA 4C9BB 3PDNA 2J09A 4ILAA 1HU3A 2X6IA 3LDZA 2LM2A 1MIYA 3JCKC 4QXCB 2X6HA 3HI2A 4OYSA 3E32A 2X9WA 3AE9A 2BKOA 4NUUA 2XRYA 3ASFA 3TJPA 1SVXA 2OEWA 4FI5A 4GMJA 3VLFA 1VRBA 2IU1A 2DZOA 4YTPA 3RIUA 4BT9A 5FKYA 2OVFA 2FBNA 2XQ4A 5E0OA 3DPYA 2X9YA 4NPPA 3B57A 1NWMX 2IO2C 5LHIB 3FUKA 5LXTE 2W61A 3LVQE 3CV0A 3TWQA 4IDOA 3Q5EA 3OBVE 2XQYA 5FXXA 3ZIMA 4R7LA 1FIOA 2I0MA 2WWUA 4WBNE 3L22A 4PJMA 2DZNA 4TXPA 3BU8A 3PU3A 1YQ3A 3OYZA 4DV3T 5CJ5A 4MLKA 1H7CA 2KXPB 2XZDG 2WXHA 3GA8A 2JQ9A 1ZHCA 3DPDA 4MHCA 5H6RB 3TLUA 4TX5A 4EZKA 3UFEA 1KNZA 5LGTB 4GB9A 2V6XA 5L3GB 5LX8A 3B7BA 3UUNA 2GW1A 4GTOA 4J8EA 2MYSA 2QC9A 2W66A 4YTNA 2DWGA 3K8PC 3KV4A 3D9KA 5AQSB 4DR4T 2VGXB 4HXIA 4CXYA 3UTMA 4YLHA 2NWBA 3QB5A 5AQJB 4EV6A 5ETWA 2I1KA 2F0YA 4UWHA 2EHOA 1BR2A 2AE9A 3B7UX 1ZBPA 1N36T 4EEDA 5IY5E 5T3RA 1LD7A 4GTTA 2XRZA 4OHFA 2XAFB 4E7ZA 2H6IA 5LJMA 4XBFB 2KBXA 4QH1A 3F6QA 5IHYA 1IXVA 3GWHA 3ZYQA 1KFYA 3CLJA 2AXZA 4YSYA 1MQSA 2WU2A 3OYXA 3QNKA 4RVBA 3ZMSB 4AV7A 3E08A 2QY7A 1SA0E 4JHJA 3QK6A 5LMUT 4XKBA 4DJAA 4KX6A 5BT1A 5CECB 1T98A 2IONA 1JPLA 3FUDA 2CMRA 1VCTA 2GGFA 3FB2A 2LUHA 3I0QA 3N2GE 3O48A 1NZNA 1Q2ZA 2P9SG 3K3QC 2JMKA 2CHOA 3I9YA 2PZIA 3FH5A 3VTXA 4F7AA 1E8WA 1HO8A 1HTJF 5JDMA 5KJMA 1IAPA 4KMCA 3LSVA 5ABEA 1HZ4A 2IO3C 3V79K 4GMLA 2BKGA 1IHGA 3RO2A 5LBMA 4DV6T 5H6QB 4AQYT 5HEGA 4YFSA 3UQ4A 3ZMVB 5LCWC 2RPAA 3OVUA 3C3RA 4AJWA 5FXZA 4Q96A 5CA1E 2X66A 4CYMD 1PY1A 3HXCA 5HEHA 2KCKA 2D2SA 1N4RA 4WNKA 4X1KE 3PE0A 3URZA 3MZKB 2YK0A 4BY6A 4PK5A 3JC6C 2H89A 3BUAA 4TUUA 5ENOD 1PC2A 4GPMA 5EILA 2ODUA 2WM9A 1TNOA 2LAIA 4U7YA 1OXZA 4AKRB 4Y6WA 3VRAA 3DSSA 1NL4A 2N1GA 1JNZA 4LF4T 3HXDA 4HFIA 3CVVA 5ARGA 1HH8A 4ZI7E 1PAQA 2J8SD 2VTBB 5CEDB 3JAEA 4UV9B 2WXIA 4GCNA 4EXTA 4ANJA 3X2QE 3P8CD 4YDOA 3N2OA 1OY3D 4HI9A 3QUJA 2DIWA 5F5WA 4GTSA 3S7BA 3ONXA 2OOEA 2E9XB 5L47A 4DVDA 2V4LA 3ML8A 4KT6B 1U4QA 1ZP0A 2KNDA 1N33T 3ESLA 5ABFA 5L3CB 4U74A 2ACZA 3EI0A 4YHHT 2KZTA 4DX7D 3UUXA 1HR0T 2OV8A 2XQ6A 3BQLA 3ZYKA 3AAEB 3S7FA 3MA9A 3V2OA 3QB5K 3FUEA 4Q69A 3EIQC 4TWDA 3RAUA 3OXGA 3BQIA 3CHPA 1MYOA 4JI7T 3AS4A 2RA1A 2YDRA 5CCMA 4TUYE 2ZLYA 4BTBA 4OAVB 1SZAA 2XM2A 2PNNA 3L3PA 3SQVA 1B7TA 2XTLA 5ABGA 4FJYA 3ONLC 4IDQA 4LNUD 1Z0PA 2G0UA 4AQFC 3H3AA 2HN1A 2BG9C 2XQ7A 3Q5WA 4Q25A 3CK7A 4AIUA 4ANVA 4B3MT 2MPKA 4QFVA 4ACLA 1HFAA 3A7MA 2MAWA 4N2SA 2XQ9A 4I1AA 2RD0A 4HRMB 5JJ7A 4I55E 4UV8B 3J5QB 2I59A 4H7YA 4JL0A 3RRWA 3P2BA 3S7JA 2V7IA 1S70B 1N4QA 2MTQA 2NXPA 2P9KG 3TXNA 1H6KA 1XNQT 4MALA 1BPOA 3SY2A 4CEMA 3LBXB 3SFYA 4ILBA 4HQDA 2UXBT 3LS8A 4MKTA 2WQYA 4BETA 4KVMA 5AAOA 4N3CA 4DR2T 1D1AA 2LNIA 4O8SA 2XHEB 2WXMA 4L7TA 3ONLA 5C3JA 3P1UA 4KYOB 2VGEA 2VJ8A 2V26A 4UQZA 4G8LA 3DTOA 3X1DA 3RRNB 4GTQA 3NOGD 2CEAA 3KAEA 4PS8A 2I1JA 5A6CA 4UIGA 4A5XA 3ANWA 3UPVA 3D0TA 2X0YA 4G23A 2VSYA 1WR6A 1E7PA 3E37A 2ZIRA 4UWLA 4AQGA 5HXEA 3APDA 2C5IT 4YSXA 1WYCA 1NEKA 4F1SA 3O1HA 2I6HA 4ANXA 2ZGDA 5FVLA 3QB2A 2FEZA 2AJAA 3ZN1B 1D0YA 4GOUA 1TN6A 3EHQA 3AAIA 3VR8A 4ILUA 2JJ9A 2UWJG 3E33A 2WAUA 4DUZT 4PK6A 3I0OA 2XPKA 3IHRA 2XGSA 5JTGA 4FU3A 2IIUA 3CHQA 4JI0T 3PS6A 5ITZF 5T4YA 3LJNA 2LLYA 3CHMA 3L9TA 3CKDA 2LJLA 2KCVA 1KLXA 5JDGA 3ENEA 3QC9A 3AS8A 3MX3A 1IZNB 4ZI2C 4E6HA 2CFZA 4HS2A 2DVWA 2XSBA 3AE6A 2RG8A 5J08A 4WNDA 3KV5A 1DVPA 4FJOA 3EVYA 4DR7T 2IW5B 3C3OA 1N95A 4L9PA 4JUYA 2XQ3A 3PJAA 4AM9A 3AG4E 5EIDA 3RSEG 3NZSA 4LMJA 4OVVA 4ATGA 3O4XE 5JDFA 1XDOA 4WYVA 2XCBA 4IDNA 1UX5A 3ULEG 3ZT6A 3UUBA 3NAWA 2V7LA 3CX7B 4ANUA 3LXUX 3UQ7A 3PDYA 5G05C 1IBMT 1R8IA 3NRYA 4UEMA 2VL8A 2ILRA 4X64T 2YQ8A 2IEJA 2XAHB 3CX8B 3MV3B 5JR9B 4FJZA 2RP4A 2VKJA 4HTEA 1JWGA 2UY1A 4IULA 2EHOD 4JB8P 3Q5DA 4DV7T 1E7UA 3SWHA 3VTYA 2XJ7A 3W15B 5L2LA 2Y4TA 3KVAA 2YOEA 2E0IA 3APFA 4UUCA 4B0ZA 2PBIA 4BESA 1US7B 4H63H 5HXRA 3AU5A 2J08A 2CM0A 2K24A 3AB3B 3DXMG 2IY0C 3G2UA 1UUSA 3PTRB 4QHOA 2DCPA 4CCAA 4IT4A 5KDMC 3I5PA 3ASOE 3AE8A 2HYZA 5HXSA 4JI3T 4DO0A 3LJ3A 4QKNA 2X0HA 2W0GA 2KWHA 2IAKA 2VASA 1H2TC 1IBKT 2Y4UA 5HEOA 4J6IA 2W4XA 3A8YC 4ZFHA 4H9PC 1OWOA 3DEOA 1T7SA 3AG1E 3SI5A 1BD8A 3Q5XA 2R03A 3G06A 3KV9A 2WZIA 4WNFA 2DCFA 2K5BB 2XUEA 4A98A 4M1PA 4L9IA 5EZYE 4X62T 2VSNA 3DSXA 1S64A 3FUMA 3RX6A 2Y8DA 4UWFA 3D9JA 2ZGGA 1K1BA 5ENQD 5BV0A 3ZC0A 4IRUA 4GMRA 3CQCB 5AIJA 2Y69E 3DRAA 3LCAA 1TJFA 5FWQA 3QWWA 4PS7A 5HWYA 2XAJB 4HFDA 2LHRA 1JCQA 1IQRA 5JR9A 2WPVA 4MRUA 4UI9J 2LXLA 3UIPC 2LSUA 2L3LA 2E9XC 3AVSA 3T5XA 1HNWT 2CBJA 1L5JA 4GIWA 3I1AA 3LG7A 2WXRA 4KMOA 4XZ4A 3CHRA 4LG6A 2BG9A 3QJZA 3KD7A 4CI2B 1QLBA 2P9UG 3PV0F 3BQKA 3CKCA 2F4VT 1KNPA 4U07A 5CCLA 2GK9A 4TV8E 2V6YA 4CN6A 2GROB 2J47A 2JPFA 4J8YA 4J7WA 5J0ZA 2Y48B 2YU1A 3VKHA 2KMFA 2BEDA 5H7PA 4U2ZA 1Z3XA 3HVEA 5AQIB 3RYCE 4Z90A 4LSZE 2FULA 5BV1A 3EU5A 3MKRA 1MNDA 4K03A 4IE0A 3MKQB 4PUCA 4ZZBA 1Z6TA 3EDTB 2AW6A 1ZU2A 1X81A 2PFVA 5ENSD 3AEBA 2PJQA 3C5RA 2V5CA 1WCRA 3AS5A 2FF4A 3OKQA 4BERA 3LKUA 1WYBA 4N3AA 3TWRA 3U3WA 1CUNA 1I94T 5EX0A 2X51A 4Z68A 2KZ7B 2F8YA 4JI6T 1MNEA 2W62A 4CT4A 3FUJA 1N52A 5LB7B 1H19A 5C2TA 3FEYA 3TWSA 3GZ1A 4I6GA 3UULA 1D1BA 2CRBA 4JI4T 2GRPB 4JLEA 3FUNA 3CVRA 2L9QA 2XM1A 4JI2T 5AQPB 3CHSA 2CBIA 3B7SA 4K0KT 4DI3A 4ILCA 5JREA 1N0RA 2VL0A 3QWVA 3PUAA 4TNWA 4DLQA 1G3NB 1M62A 2OA5A 1WFDA 3FZKB 2JQQA 3HKBE 1UK5A 4P09A 3H37A 2UY1B 4CDRA 1N0QA 3HA4A 1BU9A 3AG3E 5J90A 1HF8A 1JWFA 3ZRHA 5JR9C 4AY6A 2X38A 3BG1B 3PZ1A 3RKVA 5LG4A 3R7QA 4Y6CA 4B3RT 3JQ0A 3ZKJA 2KC7A 4U72A 4PS3A 3T8MA 4BT8A 4J2CA 1MX2A 5KJNA 1HXIA 5CMYA 2XZTG 2VQFT 3FU3A 4JW1A 3Q15A 2HE0A 1WLXA 2KM4A 3UM3A 5EX3A 4COFA 2X9HA 3TXMA 5ARFA 4DI4A 3ZT5A 3PZ3A 5HAXA 2KCLA 3ETVA 2AXDS 1IYGA 1ZOYA 5LCWJ 5DQWA 1WAO1 5AQBA 4A63B 3BK9A 2JMHA 2VVNA 4U8HA 4NUVA 5AQAA 4DRXE 1N4SA 4G26A 4I1OB 3D9PA 4YDYA 2VKDA 3U64A 3TLWA 3UFGA 1MIWA 3HIZA 2XPYA 3LDQB 5G04J 4EZLA 3B7TA 3FTVA 1WDYA 2R2LA 3AA1B 3V5UA 3ZT7A 4G63A 3N9NA 2X0LB 5CGMA 2LSKA 4IIJE 5ENNA 1E2AA 2ZISA 2NW9A 3LFMA 1N54A 5DBKA 4FC8A 2PQRA 3DWLG 4HFGA 1LD8A 4O1PA 4I9CA 5IYZE 4JC8A 3RKGA 5AQHB 1OEDC 4GTRA 4HFEA 4AXPA 3ONKA 5LJNA 1D8DA 1OWMA 3KV6A 4GA2A 4RSYA 5EK3A 3FDHA 5ABHA 3FHNA 2QRXA 2VYIA 3CIAA 3K1SA 4EYYR 3EDVA 4EOZB 1IKND 2H6HA 5LCYA 3N9PA 2LEHA 5G05J 3RC3A 2NTYA 4GU5A 4EHMA 4DR1T 4RQIA 3RI5A 2MYOA 3P7IA 5KNGA 4AISA 3SFZA 3FBLA 1FMVA 2MOWA 3RYFE 4CXWA 1DCEA 4LCTA 2BS4A 3CGHA 3CK9A 1HS7A 3IF8B 3ZW3A 1HX8A 2GRMA 5HKPA 3FU5A 2RKKA 1U3CA 4EZHA 4UI9K 4MFRA 3UU4A 1ZB1A 2PG8A 3HDXA 5BPPA 4ISTA 5CRUA 3NB2A 4WZXA 4HFHA 4LFBT 3PZ4A 3CHOA 3NF1A 2IC6A 3RQUA 1LVKA 3UT8A 2EHOB 4P1NA 1A17A 1TEZA 3NZQA 4IHJE 2MHKA 3PNLB 4JEUA 2K48A 4WAFA 2WWVA 2R5SA 2C0SA 3MXZA 4X1YE 4BAYB 2N9DA 3EU9A 2V5DA 4DUIA 2A3DA 3JADA 3U4TA 3U9WA 1TN8A 2YN6A 4BJNA 1K3ZD 3Q7AA 1U2VG 5CHEE 4U3CA 4JV5T 2XQ0A 5AYWD 4IN3B 5JDNA 3FTUA 1HG5A 4O2BE 3C72A 2FI7A 3SD5A 2V8SE 3OTNA 4KBMB 3E4BA 4U7EB 2V5FA 3JC6D 2HPLA 2KLQA 5DQVA 4CDNA 2LM9A 2IDOB 2EIKE 2WQ7A 1QQEA 1DC2A 3JCFA 3RYHE 3IBEA 2HM8A 2CWOA 5HI7A 2C5KT 1OT8A 4KHPT 3AE1A 3IKOB 1E1HB 5F8PA 4C0MA 3RRMB 5CA0E 4KP3C 4MLPA 2D0UA 1DCQA 4A56A 3G2VA 3CVWA 5LGNB 3EDUA 5FJYA 3UMVA 3ZVVA 5BNWA 3ISMC 3HKCE 5JVDE 3AA7B 5C8YE 2EILE 4XI9A 2D9DA 3PUYF 4I50E 1INZA 4CDMA 4GZDA 1FVFA 3ZU7B 5EK4A 4JVSA 2X68A 4TXQA 3RIFA 2WY2A 4U7IA 3ZNGA 3UTKA 3JXIA 3W9FA 4TZ4C 5L3DB 2HH7A 5EK2A 2V7MA 1ELKA 3AA6B 4CT0A 5BUZA 2CLYB 5JMND 4LF9T 3NVOA 4EYUA 3CPZA 3AEGA 1TNYA 2HR2A 3QARA 2LSVA 2YDSA 4BSZB 2H7VC 4K5CA 2V7KA 4CI1B 3R9AB 2W67A 2A72A 4IE7A 2VSOE 3N9OA 4EBAG 3D9LA 4EQFA 3GZSA 3G2TA 4G25A 3N71A 3UX4A 2DL1A 3ZUVB 2OLTA 5CBNA 1GW6A 4DIDB 4JD2G 2P2CP 2XS1A 3RF1A 3JYSA 3SBTB 3OXFA 4HRNA 2KZTB 2EHOC 4IL9A 3RRUA 3AJIA 1OEDB 1OCZE 5KBAA 2M63A 4QWNB 2M6BA 4YT0A 2M67A 4JA9A 4LUNU 4O4LE 3LY9A 2ONDA 4ZZCA 4QH4A 3C64A 2BDEA 3CKBA 4ADZA 3VKGA
chains in the Genus database with same CATH topology
4XZCA 3MA5A 1MHQA 3S4UA 5KCMA 1E8ZA 4KVOA 2V1DB 5LNKA 4F53A 4N3BA 1O3XA 4GK5E 5LP0A 1Y64B 4N39A 3O1JA 2VSXE 2Q9QA 3PE4A 4UWKA 3LPZA 3GN5B 5G04C 4HOQA 3PUGA 4KUMB 1WM5A 4JEUB 4EPZA 3FTYA 3B7RL 4HFVA 2VKHA 5A23A 3GW4A 2YHCA 1E96B 3JUIA 2XGMA 1BR4A 2H3RA 4B89A 5JH7E 4HLEA 4JA7A 3TAXA 2J1DG 2CXDA 5L3BB 4TV3A 4AXHA 4AY5A 2ZM0A 3LK2B 3APCA 4DLOA 3MK7C 4GYYA 2ODVA 2Q7FA 3FUHA 2X6FA 2BVMA 3CQXC 2OVBA 3ANWB 3L17A 4C91A 4BSXA 3SOLA 5FY0A 2CHWA 4YJ3E 4G11A 3GYZA 5ANLA 1IQUA 1HCIA 3R7RA 2YINA 3RYIE 4ILGA 3Q47B 3ZYMA 4NURA 4PW8A 3FWVA 3C98A 4I9EA 4FHJA 1IJ6A 4DBRA 1OWPA 1HE8A 4GYOA 3FY4A 3QWPA 3D9MA 1S35A 5HXHA 2UXNB 1UW4B 3WAJA 2XEVA 3LYAA 4YNDA 4Z8XA 1Y6IA 5AJLA 2A2FX 1YW0A 2BZBA 4HOSA 4UF0A 4FADA 4G2AA 2L9BA 1UX4A 1MMGA 2CE7A 4B6XA 4KXKB 2PM7A 2LE8A 2VQ2A 3G2WA 5AFUL 4H9NC 4A55A 1YD8G 2J4BA 3S7DA 2Q9QC 2Y3AA 3ASGA 1D0ZA 2ES0A 4BX8A 2J9QA 4QXBB 5ADXL 4WWOA 2GRLA 4JHRA 4J8SA 4BX9A 4IE6A 3TKLB 5FQ6A 3SGHA 4J0UA 3LK42 4YVOA 5ANRA 3RO3A 2PQNA 3N9MA 1VDYA 3MGBA 4O4IE 3I9WA 5FY1A 5LP6E 5EDSA 3L13A 3IV0A 3SRZA 4ZOLE 3PRZA 3D9NA 5TAOA 3QAQA 4NQ0A 3FH7A 3D3MA 4P0AA 2HO1A 3ZLIA 4GZ3A 4APFA 1AJ3A 3N2KE 3ZYLA 4FHKA 4MS6A 1BR0A 4EBAA 3ZN0B 2DLRA 3T5VA 3HKDE 1EZ3A 2IJGX 4PJLA 4A3VA 3V5SA 2CG2A 5FTPA 3FXDB 2X67A 5T8IA 5G55A 4CGWA 1OWNA 4LERA 3C51A 4ASKA 4LEUA 3ZCIA 3QC1A 4PDXA 3DP7A 4DPRA 2J49A 5A1LA 1BR1A 2CCQA 2P9BA 3KEZA 3RIBA 4HGAA 2L0IA 4UVCB 3L54A 2WSSV 3FTSA 3HHMA 3R6NA 2R17C 3ZMUB 5L3FB 2LSJA 2A4ZA 4FLBA 4GA0A 3PZDA 1E7VA 3SF4A 4DK5A 1U5PA 2XGOA 2L0TB 2CLYC 2CXLA 3LBXA 3ZHEA 4DMVA 4C90A 3KVBA 3FTWA 4YHJA 1ZEEA 3RRCA 4JXTA 4AKLA 2LSYA 2BF0X 2KINB 2L6JA 5LHHB 1FEWA 4CZZB 2DBAA 3M65A 5HQ8A 5JQGE 5AENA 4PFPA 2ZM8A 2WQ6A 4F3VA 2YHEA 4H9QC 4ME2A 3PU8A 3HYMB 3E0ZA 1HG2A 4BWRA 3CVQA 3UQ3A 4JEHB 2AWIA 4WNEA 5FQ7A 4I1MA 1FCHA 4WUYA 2P58C 3UT7A 1X5BA 1UN8A 3F31A 4ZI3D 5LBQB 4O2AE 4HORA 3I3NA 4GYWA 1X79A 4WW0A 3PEUB 3C98B 4IE5A 1NP7A 2IF4A 3C4ZA 2IQCA 3K9IA 2CWYA 5FYMA 2VTBA 1IJ5A 3EIJA 3RK6A 3CVYA 1QZ2A 3SBSA 3CK8A 5LGUB 4ACKA 3NQPA 3L6AA 3FHEA 3FXEB 3R84B 4AKGA 3E22E 2MBGA 1NA0A 2K9AA 3L16A 3LY7A 4B8CB 3Q9DA 2X6KA 4JZYA 2ZMAA 5FP3A 1S0PA 4I2WA 3HR0A 3GN5A 3HL6A 2E9XA 4V3IA 3EJNA 4PFOA 3VHLA 2Q9QB 4YJ2E 5HXCA 4A1GA 3AVRA 2BTDA 4UQYA 5JHAA 4URKA 3ASHA 5JJTA 4FP7A 3ZJ2A 1KT1A 2LO6A 1H2VC 4I6EA 1ZKEA 1XNFA 3HVEB 2LOSA 5FZSA 5E75A 4XIFA 2LOPA 5JJ6A 1DNPA 4PNIA 3PUSA 5J1GA 4U63A 4ZHQE 2I9CA 4HKAA 1UCUA 2VB6A 2WBLA 3A5XA 4OYJA 3C50A 3PE3A 4EZ4A 2C0LA 1LVFA 1MMDA 3DBSA 3AAAB 3O1IA 1WRDA 5D0QD 4A1SA 3ZXSA 3AU4A 3CSTA 3WAKA 4G24A 4RG9A 4U0ZA 1E8XA 2JLBA 5JDHA 4K0UA 3EHMA 4L5GA 2QFCA 4W9RA 3CMLA 5FXWA 2XAGB 3EUHA 1UN9A 2JEKA 3K3OA 2WXQA 4LRZA 2YU2A 4L1BA 5CB4E 4EZJA 2R59A 4PH4B 3PUJA 4NACA 2AXUA 4UF0B 4TV9E 2J4DA 5KX5E 3UUXB 3ZEFA 5DIZA 3Q5MA 2Q9QD 4UVAB 4H63V 4FULA 2CHXA 3J7Yq 4BTAA 4GZ5A 5FY7A 3S2AA 1G73A 2W00A 4HVBA 2BUGA 4AI6A 4KBQA 4ZI2D 5FMNA 2XPZA 3MJWA 4CRWA 5LFAA 4U0SA 1UJJA 4GA1A 4ILIA 4ISSA 3N5LA 4K0RA 2NTXA 3PH0C 5FZQA 4GK0E 5F3JA 1YKEB 4X20E 2NW7A 3L09A 4H9RC 3IBPA 4XX5A 2D5UA 3LJCA 4CI3B 3I4RB 4XAXB 4ZS2A 4B8AA 3B13A 2ZU6B 4O4JE 3MJXA 4C0EA 4PK4A 4ABNA 2WMOA 4XI0A 4X1IE 3PNTB 4L2LA 3FUFA 2AXVA 3U66A 4I17A 4H9OC 3GMIA 1ZV4X 1OWLA 3BEEA 4P0BA 3QOUA 2Y6XA 3LVRE 1YA0A 3AA0B 2V0PA 4APOA 4AIFA 5LOZA 4PAGA 3UT4A 2X9XA 1NAFA 4AKHA 4DBQA 1ELWA 2A5UA 3ASDA 3MCXA 3CQGB 2DWKA 3FU0A 3LEWA 3RC8A 3WXXA 4UXNB 3CVLA 4NRHB 4P29A 4EAHA 5EKQD 3FFLA 1LKXA 3SHFA 3D9IA 4G1TA 2LSGA 3RKOA 3I4GA 4H7XA 4FA6A 2N2NA 2QGSA 3MV2B 3IHVA 2WXOA 5HWXA 4EB6E 1EDUA 3RU0A 2VK9A 3ZJ1A 3CWZB 5DABA 3CVXA 5JHBA 5L3EB 4UWGA 4OFZA 3VU7H 4ZS3A 1H2UA 4JEHA 3UUMA 3MKQA 2C2LA 2V7JA 4PJJA 4N78D 3G2SA 5D0OD 2ACXA 2X3MA 3QDNA 3FEXA 4ILHB 3VLDA 2VKOA 3TG5A 1S94A 3KFWX 3N9LA 3CSFA 1QNFA 1QUUA 2C0MA 1ELRA 2EQXA 4IDZA 1D0XA 2BVLA 4BA9A 2NSZA 2C5JA 3ZEFB 5LA6E 2CXFA 4D10C 2MOZA 4YVQC 4JPSA 4HOTA 2SPCA 5FQ4A 4L0RA 3PREA 4J8DA 4TN7B 3D9OA 2YEVC 3ZC1A 3PEVB 1Z3YA 2IOSA 2B1EA 3SNXA 5LHGB 4GYRA 3LK3B 2WB2A 5DJQC 4E7SA 4TRQA 2WXGA 3F57A 3FULA 4U0UA 3ZCJA 5C1DA 3Q4AB 4O6FA 5KJLA 4OVUA 3TGOA 3WI3A 2CFUA 3ZMZB 1E8YA 1KT0A 1UG3A 1OWAA 4L2YA 4AQFA 3ZPOA 1E90A 3ULQA 4HOUA 2YNQA 4QXHB 4GPKA 3MEKA 4UQXA 3LY8A 3RJVA 1KK7A 2CA5A 4GZCA 4Q94A 1EPUA 4AEZC 1XGWA 4BFRA 3T8OA 3PUKA 3UT5E 2CHZA 2DI4A 3FH8A 4HE8A 2IFUA 4AKIA 4WWNA 5FXVA 3KDSE 2LAHA 4QX8B 1OUVA 4AOFA 3O4ZA 3CVNA 4I4TE 1FMWA 3KINB 4G2VA 2PM6A 4B94A 2WXKA 3NRXA 2JRKA 3ML9A 4ZI3C 3SZ7A 1HS6A 2I2OA 3CX6B 3QK0A 3IEGA 2E8IA 3KS2A 5KMGP 2MRIA 5M72A 2XAQB 1MMAA 1VOMA 2VGXA 2L8KA 2WXNA 1QSDA 2WVIA 4OYKA 4J8FA 2KT9A 2WXJA 3FP3A 5FQ8A 4IGUA 2IC9A 4I6JA 4GCOA 3NZUA 4UVBB 4EIWA 4QX7B 4H9SE 4WNGA 4KZ0A 2WXPA 4I2ZA 4XE0A 5JRCA 3ESKA 4WBOA 5E76A 2KATA 1P5QA 1LRZA 1YKHB 4ANWA 5CMWA 4I43B 3EHNA 5BW8C 5J2UE 2WXFA 4DMWA 3FU6A 4IYPA 4PJNA 1H0AA 1SHZC 2DHRA 3BG0B 3ZPJA 4XKCA 2NOXA 1D1CA 3RPUA 3FUIA 3C4WA 4EECA 3DJBA 3L08A 3CR3A 5JDLA 1NA3A 5A7DB 4ERRA 4DNDA 2NC9A 3O9XA 3OAWA 5BMVE 3MZLB 4A3TA 5HYAA 3PUQA 4F6RC 4HN9A 2J07A 3MKDA 1UJKA 1V9DA 3MYVA 2WQHA 2H7OA 2D0TA 2VGYA 3QKYA 2W63A 5GONE 2HPJA 5FNVE 1MIVA 4MBQA 2CG3A 5M4YA 3JQ1A 2LHNA 4M3OA 5LOVE 4JHKA 4UELA 2E2EA 3TL5A 1SZ9A 1WY6A 5JRCB 3Q2MA 3IHYA 4AP2A 4AVXA 5FZRA 3J9X1 3FTZA 1JUQA 1FVHA 4IE4A 4O4HE 5JDQA 2LSIA 4L23A 5G2NA 2WXLA 4HEAA 1U3DA 5AJDA 4OK0A 3CVUA 3KBUA 3MACA 4WWPA 3OXLA 4RG6A 1B89A 5C2YA 3KBTA 4FLHA 1G8XA 5KJKA 4GYSA 3K3NA 4CXXA 4KZCA 4I43A 2XPIA 5FT9A 3VLEA 2X6JA 2Z6EA 3ZN3A 3NZPA 2NP9A 3NBXX 3TG4A 2XCCA 3C4XA 2XASB 3IEEA 2QA7A 3CVPA 3U3IA 3F2EA 1EYHA 2XHEA 5LYJE 3HKEE 2UXXB 2AVPA 3Q49B 3ZFWA 5J2TE 4V1Av 3RH3A 3ZMTB 3N9QA 3SS1A 1Y8MA 2VWAA 3ETUA 2E9XD 4N5CA 4N2QA 1LF8A 2WMNA 3U78A 1TJCA 4E85A 4BJMA 4UI9C 2NW8A 2PL2A 4GAAA 3ZHEB 3PURA 3FBZA 1W3BA 2FO7A 4CGVA 4U04A 3ZGQA 1EF1C 3OJAA 3CEQA 2KWIB 1MMNA 2DNXA 2LT3A 3FTXA 2ZM2A 1SQMA 2IOLA 4CQIA 4GZ6A 3GZ2A 3PVLA 4C9BB 3PDNA 2J09A 1HU3A 2X6IA 3LDZA 1MIYA 3JCKC 4QXCB 2X6HA 3HI2A 4OYSA 2X9WA 4NUUA 2XRYA 3ASFA 3TJPA 4FI5A 4GMJA 3VLFA 1VRBA 2IU1A 4BT9A 2OVFA 2FBNA 5E0OA 2X9YA 3FUKA 3B57A 1NWMX 5LHIB 5LXTE 2W61A 3LVQE 3CV0A 3OBVE 2XQYA 5FXXA 3ZIMA 4R7LA 1FIOA 2WWUA 4WBNE 3L22A 4PJMA 3PU3A 3OYZA 4MLKA 1H7CA 2KXPB 2WXHA 3GA8A 1ZHCA 3DPDA 4MHCA 5H6RB 4TX5A 4EZKA 3UFEA 1KNZA 5LGTB 4GB9A 5L3GB 5LX8A 3UUNA 2GW1A 4J8EA 2MYSA 2DWGA 3K8PC 3KV4A 3D9KA 2VGXB 4HXIA 4CXYA 4YLHA 2NWBA 5ETWA 2I1KA 4UWHA 2EHOA 1BR2A 3B7UX 1ZBPA 5T3RA 2XRZA 4OHFA 2XAFB 4E7ZA 5LJMA 4XBFB 5IHYA 3GWHA 3ZYQA 3CLJA 2AXZA 1MQSA 4RVBA 3OYXA 3QNKA 4AV7A 3ZMSB 3E08A 2QY7A 1SA0E 4JHJA 3QK6A 4XKBA 4DJAA 5BT1A 1T98A 2IONA 1JPLA 3FUDA 2CMRA 2GGFA 3FB2A 3I0QA 3N2GE 3O48A 1NZNA 3K3QC 2JMKA 2PZIA 3I9YA 3FH5A 3VTXA 4F7AA 1E8WA 1HO8A 1HTJF 5JDMA 5KJMA 1IAPA 4KMCA 1HZ4A 4GMLA 1IHGA 3RO2A 5LBMA 5H6QB 4YFSA 3ZMVB 5LCWC 4AJWA 5FXZA 4Q96A 5CA1E 2X66A 1PY1A 2KCKA 2D2SA 4WNKA 4X1KE 3PE0A 3URZA 3MZKB 2YK0A 4BY6A 4PK5A 3JC6C 4TUUA 1PC2A 2ODUA 2WM9A 2LAIA 1OXZA 4AKRB 4Y6WA 2N1GA 3CVVA 5ARGA 1HH8A 4ZI7E 1PAQA 2VTBB 4UV9B 2WXIA 4GCNA 4EXTA 4ANJA 3P8CD 3N2OA 3QUJA 2DIWA 3S7BA 3ONXA 2OOEA 2E9XB 3ML8A 4DVDA 2V4LA 4KT6B 1U4QA 2KNDA 3ESLA 5L3CB 4U74A 2KZTA 3UUXA 2OV8A 3BQLA 3ZYKA 3AAEB 3S7FA 3MA9A 4Q69A 3FUEA 3EIQC 3OXGA 3BQIA 3CHPA 3AS4A 2RA1A 5CCMA 4TUYE 2ZLYA 4BTBA 1SZAA 3L3PA 1B7TA 2XTLA 4FJYA 1Z0PA 2G0UA 4AQFC 3H3AA 3Q5WA 3CK7A 4ANVA 4QFVA 4ACLA 1HFAA 4N2SA 4I1AA 2RD0A 5JJ7A 4I55E 4UV8B 4H7YA 2I59A 4JL0A 3RRWA 3P2BA 3S7JA 2V7IA 2NXPA 2MTQA 3TXNA 1H6KA 4MALA 1BPOA 4CEMA 3LBXB 3LS8A 4MKTA 4KVMA 4N3CA 2WXMA 1D1AA 2LNIA 2XHEB 4O8SA 4L7TA 3ONLA 3P1UA 4KYOB 2VJ8A 2V26A 4UQZA 3DTOA 3RRNB 2CEAA 3KAEA 4PS8A 2I1JA 5A6CA 4UIGA 3ANWA 3UPVA 3D0TA 4G23A 2VSYA 1WR6A 4UWLA 4AQGA 5HXEA 3APDA 2C5IT 1WYCA 4F1SA 3O1HA 2I6HA 4ANXA 3QB2A 2FEZA 3ZN1B 1D0YA 4GOUA 3AAIA 4ILUA 2JJ9A 2UWJG 2WAUA 4PK6A 3I0OA 3IHRA 2XGSA 4FU3A 3CHQA 3PS6A 5T4YA 3CHMA 3CKDA 2LJLA 2KCVA 1KLXA 5JDGA 3ENEA 3QC9A 3AS8A 3MX3A 1IZNB 4ZI2C 4E6HA 2CFZA 4HS2A 5J08A 2RG8A 4WNDA 3KV5A 1DVPA 4FJOA 3EVYA 2IW5B 4JUYA 4AM9A 3NZSA 4OVVA 4ATGA 3O4XE 5JDFA 2XCBA 1UX5A 2V7LA 3CX7B 4ANUA 3LXUX 3PDYA 5G05C 4UEMA 3NRYA 2VL8A 2ILRA 2YQ8A 2XAHB 3CX8B 3MV3B 5JR9B 4FJZA 2RP4A 2VKJA 4HTEA 1JWGA 2UY1A 4IULA 2EHOD 1E7UA 3SWHA 3VTYA 3W15B 5L2LA 2Y4TA 3KVAA 2E0IA 3APFA 4B0ZA 2PBIA 1US7B 4H63H 5HXRA 3AU5A 2J08A 2CM0A 2K24A 3AB3B 3G2UA 3PTRB 4QHOA 2DCPA 4CCAA 5KDMC 3I5PA 2HYZA 5HXSA 4DO0A 3LJ3A 4QKNA 2W0GA 2KWHA 2IAKA 2VASA 1H2TC 2Y4UA 4J6IA 4H9PC 1OWOA 3SI5A 3Q5XA 3KV9A 4WNFA 2DCFA 2K5BB 2XUEA 4M1PA 4L9IA 5EZYE 2VSNA 3FUMA 3RX6A 2Y8DA 4UWFA 3D9JA 5BV0A 3ZC0A 4IRUA 3CQCB 5AIJA 3LCAA 1TJFA 5FWQA 3QWWA 4PS7A 5HWYA 2XAJB 2LHRA 1IQRA 5JR9A 2WPVA 4MRUA 4UI9J 2LSUA 2L3LA 2E9XC 3AVSA 3T5XA 1L5JA 4GIWA 3I1AA 3LG7A 2WXRA 4KMOA 4XZ4A 3CHRA 3QJZA 3KD7A 4CI2B 3BQKA 3CKCA 4U07A 5CCLA 2GK9A 4TV8E 2JPFA 2Y48B 2YU1A 3VKHA 2KMFA 1Z3XA 3HVEA 3RYCE 2FULA 5BV1A 4K03A 3MKRA 1MNDA 4IE0A 3MKQB 4PUCA 1Z6TA 3EDTB 2AW6A 1ZU2A 2PFVA 2PJQA 3AS5A 2FF4A 3OKQA 3LKUA 1WYBA 4N3AA 3U3WA 1CUNA 5EX0A 2X51A 2KZ7B 1MNEA 2W62A 4CT4A 3FUJA 1N52A 1H19A 3FEYA 3GZ1A 4I6GA 3UULA 1D1BA 4JLEA 3FUNA 3CVRA 2L9QA 3CHSA 3B7SA 4DI3A 5JREA 3QWVA 3PUAA 4DLQA 2OA5A 2JQQA 3HKBE 4P09A 3H37A 2UY1B 4CDRA 3HA4A 5J90A 1HF8A 1JWFA 3ZRHA 5JR9C 4AY6A 2X38A 3BG1B 3RKVA 5LG4A 3R7QA 4Y6CA 3JQ0A 2KC7A 4U72A 4PS3A 3T8MA 4BT8A 4J2CA 5KJNA 1HXIA 5CMYA 3FU3A 4JW1A 3Q15A 2KM4A 1WLXA 5EX3A 2X9HA 3TXMA 5ARFA 4DI4A 5HAXA 2KCLA 3ETVA 1IYGA 5LCWJ 5DQWA 1WAO1 3BK9A 2JMHA 4U8HA 4NUVA 4G26A 4I1OB 3D9PA 2VKDA 3U64A 3HIZA 1MIWA 2XPYA 5G04J 4EZLA 3B7TA 3FTVA 3AA1B 3V5UA 4G63A 3N9NA 2X0LB 2LSKA 4IIJE 5ENNA 2NW9A 3LFMA 1N54A 5DBKA 4FC8A 2PQRA 4HFGA 4I9CA 5IYZE 4JC8A 4AXPA 3ONKA 5LJNA 1OWMA 3KV6A 4GA2A 4RSYA 5EK3A 3FDHA 3FHNA 2VYIA 3CIAA 4EYYR 3EDVA 4EOZB 5LCYA 3N9PA 2LEHA 5G05J 3RC3A 2NTYA 4GU5A 3P7IA 3SFZA 3FBLA 1FMVA 2MOWA 3RYFE 4CXWA 4LCTA 3CGHA 3CK9A 1HS7A 3IF8B 3ZW3A 1HX8A 2GRMA 3FU5A 1U3CA 4EZHA 4UI9K 4MFRA 2PG8A 3HDXA 5BPPA 4ISTA 3CHOA 3NF1A 2IC6A 1LVKA 3UT8A 2EHOB 1A17A 1TEZA 3NZQA 4IHJE 2MHKA 3PNLB 4JEUA 2K48A 4WAFA 2R5SA 2C0SA 3MXZA 4X1YE 4BAYB 2N9DA 2A3DA 3U4TA 3U9WA 4BJNA 5CHEE 2XQ0A 5AYWD 4IN3B 5JDNA 3FTUA 1HG5A 4O2BE 2FI7A 3SD5A 2V8SE 3OTNA 4KBMB 3E4BA 2V5FA 3JC6D 2HPLA 2KLQA 5DQVA 4CDNA 2LM9A 2WQ7A 1QQEA 3RYHE 3IBEA 2HM8A 2CWOA 5HI7A 2C5KT 3IKOB 1E1HB 5F8PA 4C0MA 3RRMB 5CA0E 4KP3C 4MLPA 2D0UA 3G2VA 4A56A 3CVWA 5LGNB 3EDUA 5FJYA 3UMVA 3ZVVA 5BNWA 3HKCE 5JVDE 3AA7B 5C8YE 4XI9A 4I50E 1INZA 4CDMA 4GZDA 1FVFA 5EK4A 4JVSA 2X68A 3UTKA 4TZ4C 5L3DB 2HH7A 5EK2A 2V7MA 1ELKA 3AA6B 4CT0A 5BUZA 2CLYB 4EYUA 3CPZA 2HR2A 3QARA 2LSVA 2H7VC 2V7KA 4CI1B 3R9AB 2A72A 4IE7A 2VSOE 3N9OA 4EBAG 3D9LA 4EQFA 3GZSA 3G2TA 4G25A 3N71A 3UX4A 1GW6A 3JYSA 3SBTB 3OXFA 2KZTB 2EHOC 3RRUA 2M63A 4QWNB 2M67A 4JA9A 4LUNU 4O4LE 3LY9A 2ONDA 3C64A 2BDEA 3CKBA 4ADZA 3VKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VHL A;  2YIN A;  2WMN A;  2WM9 A;  2WMO A;  3B13 A; 
#chains in the Genus database with same CATH topology
 4XZC A;  1J1J A;  2B76 A;  1MHQ A;  5LG3 A;  3MA5 A;  3S4U A;  2JQK A;  1Z8U A;  5KCM A;  2V4H C;  1E8Z A;  4KVO A;  5CEA A;  2V1D B;  5LNK A;  3L82 A;  3PUX F;  3AEF A;  4F53 A;  4N3B A;  1O3X A;  4GK5 E;  5LP0 A;  3RHW A;  1Y64 B;  4N39 A;  3UKU G;  3O1J A;  2VSX E;  2Q9Q A;  3PE4 A;  4UWK A;  3LPZ A;  3GN5 B;  5G04 C;  4HOQ A;  3PUG A;  2XQ8 A;  2FUP A;  4KUM B;  1WM5 A;  4NXM T;  4JEU B;  4EPZ A;  1XMQ T;  3FTY A;  3JXJ A;  3B7R L;  4HFV A;  5FIN A;  1I6Z A;  4N5Q A;  2VKH A;  5A23 A;  3GW4 A;  2YHC A;  1E96 B;  3JUI A;  2XGM A;  1BR4 A;  2H3R A;  5AN8 A;  4B89 A;  5JH7 E;  4HLE A;  1FJG T;  4BEP A;  3SFD A;  5AQ7 A;  4JA7 A;  3Q75 A;  3TAX A;  2J1D G;  2CXD A;  5L3B B;  5AQF B;  4TV3 A;  4AXH A;  4AY5 A;  2ZM0 A;  3LK2 B;  3APC A;  3PUV F;  4DLO A;  4JI8 T;  3MK7 C;  4GYY A;  2ODV A;  2Q7F A;  3FUH A;  2X6F A;  2BVM A;  2BG9 E;  3CQX C;  2OVB A;  3ANW B;  3L17 A;  4C91 A;  2ZXW E;  4BSX A;  3SOL A;  5FY0 A;  3RLF F;  5HCM A;  2CHW A;  1KZO A;  4YJ3 E;  4G11 A;  3GYZ A;  2XY8 B;  2Y0B G;  3HXE A;  3TLT A;  5ANL A;  1IQU A;  1Y01 A;  1HCI A;  3CK6 A;  3R7R A;  3DSV A;  2YIN A;  3Q9U C;  3C3Q A;  3RYI E;  4ILG A;  3Q47 B;  3ZYM A;  3DSW A;  4NUR A;  3Q9N C;  3NBN B;  4PW8 A;  3RIA A;  3FWV A;  2LKH A;  2FBW A;  4I0U A;  3C98 A;  4I9E A;  4G8K A;  4FHJ A;  1IJ6 A;  3KSQ A;  4DBR A;  1OWP A;  4IDP A;  4CZ2 D;  2FJB A;  1HE8 A;  4GYO A;  3FY4 A;  3QWP A;  3D9M A;  1S35 A;  5HXH A;  2UXN B;  1O1R A;  1UW4 B;  3WAJ A;  2XEV A;  4LNB A;  4F1P A;  3LYA A;  4YND A;  4Z8X A;  1Y6I A;  2E5L T;  5AJL A;  2DYS E;  2A2F X;  1YW0 A;  2BZB A;  4HOS A;  4UF0 A;  4FAD A;  4G2A A;  2L9B A;  1UX4 A;  1MMG A;  2CE7 A;  4B6X A;  4KXK B;  2PM7 A;  2LE8 A;  2VQ2 A;  3VR9 A;  3G2W A;  5AFU L;  4H9N C;  5ENR D;  4A55 A;  1YD8 G;  2WS3 A;  2J4B A;  3S7D A;  2Q9Q C;  2Y3A A;  3ASG A;  2OCC E;  2JIW A;  5KXJ A;  1D0Z A;  2ES0 A;  4BX8 A;  3AXJ A;  2J9Q A;  4QXB B;  4GTM A;  5ADX L;  3RIU C;  4WWO A;  2GRL A;  4JHR A;  4J8S A;  1L0V A;  4YXD A;  3EUV A;  2BBJ A;  4BX9 A;  4IE6 A;  5AQR B;  3TKL B;  1OCO E;  3ABV A;  5FQ6 A;  3B5M A;  3SGH A;  4J0U A;  3LK4 2;  4YVO A;  5ANR A;  3L39 A;  3RO3 A;  2PQN A;  3N9M A;  2XZE A;  1VDY A;  3MGB A;  4O4I E;  3I9W A;  5FY1 A;  5LP6 E;  3EAM A;  5EDS A;  2XEE A;  3IV0 A;  3SRZ A;  2YDQ A;  4ZOL E;  3L13 A;  3PRZ A;  3D9N A;  3TWV A;  1O1S A;  4LF6 T;  5TAO A;  3QAQ A;  1KF6 A;  4JBW F;  4NQ0 A;  3FH7 A;  4GKK T;  3D3M A;  4P0A A;  5IUX A;  2HO1 A;  3ZLI A;  4GZ3 A;  4APF A;  1AJ3 A;  3N2K E;  3ZYL A;  4FHK A;  4CN4 A;  4MS6 A;  1BR0 A;  4EBA A;  1UUR A;  4M7C A;  3ZN0 B;  2DLR A;  1RZ4 A;  1CHU A;  4DV4 T;  3T5V A;  3HKD E;  5ENP D;  1EZ3 A;  1XWM A;  3UM2 A;  2IJG X;  4PJL A;  3ABK E;  4U8Y D;  4ZEY A;  4A3V A;  3V5S A;  3W9G A;  2BKP A;  1SA4 A;  1M7K A;  2CG2 A;  5FTP A;  2BS2 A;  3FXD B;  2X67 A;  4F6R D;  5T8I A;  5G55 A;  1SA5 A;  4CGW A;  1OWN A;  4LER A;  3C51 A;  4NIQ A;  4ASK A;  2V6Y B;  2B0O E;  3M3Z B;  3ZCI A;  4LEU A;  3QC1 A;  4PDX A;  3DP7 A;  4DPR A;  2J49 A;  4C48 B;  5A1L A;  1BR1 A;  2CCQ A;  2P9B A;  3KEZ A;  3RIB A;  3UM0 A;  4HGA A;  2L0I A;  4UVC B;  5FIO A;  2WSS V;  3L54 A;  3FTS A;  3HHM A;  1SUM B;  3R6N A;  4HWC A;  2R17 C;  3AEE A;  3ZMU B;  4DX2 A;  3B95 A;  5L3F B;  1LTX A;  2LSJ A;  2A4Z A;  4FLB A;  4GA0 A;  1E7V A;  3PZD A;  3SF4 A;  4DK5 A;  1U5P A;  4TWH A;  2XGO A;  3TWT A;  2L0T B;  2CLY C;  2CXL A;  3LBX A;  4QQI A;  3ZHE A;  3ZST A;  3BQO A;  5KNH D;  4DMV A;  4C90 A;  3KVB A;  2UUA T;  3FTW A;  5AQN B;  4YHJ A;  1ZEE A;  4HWH A;  3RRC A;  4DV0 T;  2Y1L E;  4U2Y A;  4JXT A;  4AKL A;  2LSY A;  1X9B A;  2BF0 X;  2KIN B;  5ABF B;  3PJA J;  2L6J A;  2P9I G;  5LHH B;  1N32 T;  1FEW A;  4CZZ B;  2DBA A;  3M65 A;  5HQ8 A;  3V31 A;  5JQG E;  5AEN A;  4PFP A;  2ZM8 A;  2WQ6 A;  4F3V A;  3ABL E;  3UI2 A;  2YHE A;  3ZSS A;  4B3T T;  4H9Q C;  5L4E A;  5FVK A;  4ME2 A;  3PU8 A;  1AP7 A;  3HYM B;  5CER B;  3E0Z A;  2KXP C;  5B1B E;  1HG2 A;  4BWR A;  5CBO A;  3CVQ A;  4U33 A;  3DEP A;  3Q73 A;  1SE7 A;  3UQ3 A;  2LKG A;  4JEH B;  4DV5 T;  2AWI A;  4WNE A;  5FQ7 A;  5B3S E;  4I1M A;  5AQQ B;  3AEA A;  1FCH A;  4WUY A;  2P58 C;  3UT7 A;  1X5B A;  1UN8 A;  3F31 A;  2BBH A;  4ZI3 D;  1D9S A;  5LBQ B;  1OED E;  4O2A E;  2P9N G;  4HOR A;  3I3N A;  5D2M C;  4GYW A;  1X79 A;  4DUY T;  1TYQ G;  4WW0 A;  3PEU B;  3C98 B;  4IE5 A;  1NP7 A;  3IXE A;  2IF4 A;  3C4Z A;  2IQC A;  3K9I A;  2CWY A;  5FYM A;  2VTB A;  1IJ5 A;  3EIJ A;  1N4P A;  3RK6 A;  3JAF A;  1QZ2 A;  3SBS A;  3CVY A;  3CK8 A;  5LGU B;  4U31 A;  5LMN T;  4ACK A;  4HB5 A;  4HWF A;  2FJE A;  3NQP A;  3L6A A;  3FHE A;  3FXE B;  1K8K G;  3R84 B;  2MBG A;  3E22 E;  4AKG A;  3V2X A;  1WR0 A;  1T72 A;  1NA0 A;  2HN2 A;  5D66 A;  1YQ4 A;  2K9A A;  2E5V A;  3L16 A;  3LY7 A;  4Z91 A;  2GRN B;  3D9H A;  4B8C B;  3Q9D A;  2X6K A;  4JZY A;  5BXU A;  2ZMA A;  5FP3 A;  1S0P A;  4I2W A;  3EHZ A;  3HR0 A;  3GN5 A;  3HL6 A;  2W2U A;  2E9X A;  4V3I A;  3EJN A;  4PFO A;  3VHL A;  2Q9Q B;  4YJ2 E;  5HXC A;  4A1G A;  3AVR A;  2BTD A;  4UQY A;  4HFB A;  3P4Q A;  5JHA A;  4URK A;  1NEN A;  2IML A;  3ASH A;  5JJT A;  4FP7 A;  3ZJ2 A;  1KT1 A;  2LO6 A;  1H2V C;  3Q7F A;  4I6E A;  1ZKE A;  4YY3 T;  1XNF A;  3HVE B;  2LOS A;  5FZS A;  1O1T A;  5E75 A;  4XIF A;  2LOP A;  5JJ6 A;  1DNP A;  4LML A;  4PNI A;  3PUS A;  4YDW A;  2F37 A;  5J1G A;  4U63 A;  4ZHQ E;  2I9C A;  4HKA A;  1UCU A;  2VB6 A;  2WBL A;  3A5X A;  5IWA T;  4OYJ A;  3C50 A;  3PE3 A;  4EZ4 A;  3P50 A;  1DU2 A;  2C0L A;  1LVF A;  2FJA A;  3TWX A;  3AED A;  3SFX A;  1MMD A;  3DBS A;  3AAA B;  3O1I A;  1JNR A;  2H6F A;  3FZM B;  4OAU C;  1WRD A;  3Q78 A;  4RLY A;  1K1A A;  4CN1 A;  5D0Q D;  4A1S A;  1KEY A;  4YTM A;  3ZXS A;  5AQT B;  3TLS A;  3AU4 A;  2WCA A;  3AE3 A;  2K3W A;  3T9K A;  3CST A;  3WAK A;  3P4S A;  3PUW F;  5EN5 D;  4G24 A;  3UIO C;  4RG9 A;  4U0Z A;  1E8X A;  1QBQ A;  2JLB A;  5JDH A;  1HNX T;  4K0U A;  5AQ9 A;  1N9A A;  3EHM A;  4L5G A;  2QFC A;  4W9R A;  3CML A;  5FXW A;  5ENT D;  2XAG B;  3V30 A;  3EUH A;  1UN9 A;  2A5E A;  2JEK A;  3K3O A;  4DR6 T;  2WXQ A;  3AXJ B;  4LRZ A;  2YU2 A;  3AEC A;  1N11 A;  2P9P G;  4L1B A;  5CB4 E;  4EZJ A;  2R59 A;  2CHN A;  4PH4 B;  3PUJ A;  4NAC A;  2AXU A;  4UF0 B;  2WP9 A;  2E2A A;  2CPT A;  4GKJ T;  4TV9 E;  3PZ2 A;  2J4D A;  5KX5 E;  3UUX B;  3ZEF A;  5DIZ A;  3Q5M A;  2Q9Q D;  2XEH A;  2ETC A;  4UVA B;  4H63 V;  4FUL A;  2CHX A;  3J7Y q;  4BTA A;  1D8E A;  5AQO B;  4GZ5 A;  5FY7 A;  3S2A A;  1G73 A;  2W00 A;  4HVB A;  2BUG A;  2WZH A;  3H3M A;  2V5Q C;  4HRL A;  4AI6 A;  4KBQ A;  2LXM A;  1W0B A;  2WDV A;  4KHZ F;  5FMN A;  4ZI2 D;  2XPZ A;  5CRV A;  1OCR E;  3MJW A;  4LF7 T;  4CRW A;  5LFA A;  4U0S A;  1UJJ A;  4GA1 A;  4ILI A;  4ISS A;  2KSR A;  2GRQ B;  3N5L A;  4K0R A;  2XS8 A;  2UUC T;  3UIN C;  2NTX A;  3PH0 C;  5FZQ A;  4GK0 E;  3HXB A;  5F3J A;  1YKE B;  4X20 E;  2NW7 A;  3L09 A;  1XNR T;  4HBD A;  4H9R C;  3IBP A;  4XX5 A;  2D5U A;  3LJC A;  4CI3 B;  3PUZ F;  3I4R B;  4XAX B;  4ZS2 A;  2QYW A;  4B8A A;  3B13 A;  5HS0 A;  2ZU6 B;  4O4J E;  3MJX A;  4C0E A;  4PK4 A;  4ABN A;  2NR4 A;  4X65 T;  4DV1 T;  2WMO A;  4XI0 A;  4X1I E;  5AQM B;  2H88 A;  3PNT B;  4ATZ D;  1J5E T;  4L2L A;  1FPP A;  3FUF A;  2AXV A;  2OEV A;  3U66 A;  3P4P A;  4I17 A;  4H9O C;  4XEI G;  2EIJ E;  2VQE T;  3GMI A;  1ZV4 X;  2V8S V;  3QNU A;  4O1O A;  4HNA D;  3ASN E;  1OWL A;  3BEE A;  1XDP A;  4HWD A;  2ETB A;  3ZXP A;  4P0B A;  1MX6 A;  3QOU A;  2Y6X A;  3LVR E;  1YA0 A;  3AA0 B;  2V0P A;  1WG0 A;  1KZP A;  4APO A;  4DX6 D;  4AIF A;  5LOZ A;  4PAG A;  1FT1 A;  2JAB A;  3UT4 A;  2X9X A;  4F8H A;  1NAF A;  4AKH A;  4DBQ A;  2ETA A;  1ELW A;  1YYH A;  2A5U A;  3ASD A;  4TUM A;  3MCX A;  3CQG B;  2DWK A;  3FU0 A;  3LEW A;  2LRL A;  3EHR A;  2GRR B;  3UU3 A;  3UU5 A;  1W09 A;  1MX4 A;  4MBG A;  3RC8 A;  3WXX A;  1TNZ A;  4UXN B;  3CVL A;  3ZKR A;  4NRH B;  4P29 A;  4EAH A;  2P9L G;  2A9U A;  1UOH A;  2J4G A;  5EKQ D;  3FFL A;  1LKX A;  1TNU A;  3E34 A;  3SHF A;  1OED A;  3D9I A;  4G1T A;  2LSG A;  3RKO A;  3I4G A;  4H7X A;  4FA6 A;  2N2N A;  2QGS A;  5FL0 A;  3MV2 B;  4X8Q A;  5HCJ A;  3IHV A;  2WXO A;  5HWX A;  1UGO A;  4A97 A;  3FZF B;  4EB6 E;  1EDU A;  3RU0 A;  5JA4 D;  2VK9 A;  1YXR A;  3ZJ1 A;  3T1H T;  1KPS B;  4IL4 A;  4JI1 T;  3CWZ B;  5DAB A;  3CVX A;  5JHB A;  5L3E B;  3AE7 A;  4UWG A;  4OFZ A;  3VU7 H;  4ZS3 A;  1H2U A;  3NWI A;  4JEH A;  1J5W A;  3UUM A;  2R02 A;  3MKQ A;  2C2L A;  2EIM E;  2QZA A;  2V7J A;  4PJJ A;  4DR5 T;  4N78 D;  1N34 T;  2RFA A;  1O5M A;  3G2S A;  5D0O D;  4X66 T;  2ACX A;  2X3M A;  3QDN A;  2UUB T;  3HG0 D;  3FEX A;  4ILH B;  3VLD A;  2VKO A;  3TG5 A;  1S94 A;  1H6P A;  3KFW X;  5AAR A;  3N9L A;  3CSF A;  5AQK B;  3FZL B;  1TNB A;  1QNF A;  1QUU A;  2C0M A;  1ELR A;  2EQX A;  4IDZ A;  3QOF A;  4GTV A;  1D0X A;  4U95 D;  2BVL A;  4BA9 A;  2NSZ A;  2C5J A;  3ZEF B;  4LF5 T;  5LA6 E;  2CXF A;  4D10 C;  2MOZ A;  4YVQ C;  4JPS A;  4HOT A;  2HHH T;  2SPC A;  5FQ4 A;  3R9M A;  4L0R A;  3PRE A;  4J8D A;  4TN7 B;  3D9O A;  3RGL A;  2YEV C;  3ZC1 A;  3PEV B;  1Z3Y A;  1OXJ A;  1Z5S C;  2IOS A;  2B1E A;  3SNX A;  4YDE A;  5LHG B;  4GYR A;  3LK3 B;  1TR4 A;  2WB2 A;  5DJQ C;  4E7S A;  1BI8 B;  2WXG A;  4TRQ A;  5CFB A;  1AWC B;  3F57 A;  1YMP A;  3FUL A;  4U0U A;  2XEN A;  3ZCJ A;  5C1D A;  4YSZ A;  3Q4A B;  4O6F A;  4OVU A;  5KJL A;  3TGO A;  3WI3 A;  1MZC A;  2CFU A;  3ZMZ B;  1E8Y A;  1QYM A;  1KT0 A;  1UG3 A;  3ONJ A;  1OWA A;  2XQA A;  4AQF A;  2NYJ A;  4L2Y A;  3ZPO A;  1E90 A;  1BI7 B;  3ULQ A;  4HOU A;  2YNQ A;  2R6G F;  4QXH B;  2RFM A;  2WDQ A;  2WU5 A;  4IRE A;  4GPK A;  2YKS A;  3MEK A;  2DYR E;  5EYL A;  4UQX A;  3LY8 A;  3KSL A;  3RJV A;  1KK7 A;  5BR8 T;  2WDR A;  2QYJ A;  4B3S T;  3AE5 A;  2CA5 A;  4GZC A;  4Q94 A;  4K5A B;  2VVS A;  1EPU A;  4AEZ C;  4K5B A;  1XGW A;  4BFR A;  3T8O A;  3PUK A;  4TXR A;  3UT5 E;  5HEJ A;  1VCS A;  2CHZ A;  2DI4 A;  3FH8 A;  4HE8 A;  2IFU A;  4AKI A;  4WWN A;  1SW6 A;  5FXV A;  3KDS E;  2LAH A;  4QX8 B;  3KEA A;  1OUV A;  3UKR G;  4AOF A;  3E30 A;  3JUE A;  3O4Z A;  4NXN T;  5AQG B;  3UU8 A;  3CVN A;  4I4T E;  1FMW A;  3KIN B;  4G2V A;  2PM6 A;  4B94 A;  2WXK A;  3EAB A;  3NRX A;  1IBL T;  2JRK A;  4JI5 T;  3ML9 A;  5AQL B;  4ZI3 C;  4LF8 T;  3SZ7 A;  1HS6 A;  2I2O A;  3CX6 B;  3QK0 A;  3IEG A;  1GQE A;  4TWF A;  3IA3 A;  2E8I A;  1HX1 B;  4NIK A;  4JYA T;  1YCS B;  3KS2 A;  5KMG P;  2MRI A;  3TWW A;  5M72 A;  2XAQ B;  1MMA A;  1VOM A;  1XMO T;  2L8K A;  2VGX A;  2WXN A;  1QSD A;  2PTF A;  2WVI A;  4OYK A;  5HRY A;  4J8F A;  2KT9 A;  2ZM6 T;  2WXJ A;  3UM1 A;  3FP3 A;  5FQ8 A;  4IGU A;  2IC9 A;  4HWI B;  4EGW A;  3T1Y T;  4I6J A;  4GCO A;  1JCR A;  3NZU A;  4UVB B;  1NFI E;  3AAA C;  4EIW A;  4QX7 B;  5FL1 A;  3NOC D;  4H9S E;  1IHB A;  4WNG A;  1RW2 A;  1MJ0 A;  5HEU A;  4KZ0 A;  4U96 D;  2WXP A;  4I2Z A;  4XE0 A;  5JRC A;  3ABM E;  3ESK A;  2XQ5 A;  4WBO A;  4TNV A;  3TWU A;  5E76 A;  2UU9 T;  1XZY A;  2KAT A;  2QVA A;  4HFC A;  1P5Q A;  1LRZ A;  1YKH B;  2FJD A;  4ANW A;  4ZHB A;  5CMW A;  2LRK A;  4I43 B;  3EHN A;  5BW8 C;  5J2U E;  2WXF A;  2M6I A;  1NI1 A;  4DMW A;  3FU6 A;  4IYP A;  1V55 E;  2BS3 A;  2J62 A;  4KI0 F;  4EEB A;  4PJN A;  3P4R A;  1H0A A;  1SHZ C;  2DHR A;  3T8K A;  3BG0 B;  3ZPJ A;  4XKC A;  2NOX A;  1D1C A;  3RPU A;  3FUI A;  3C4W A;  4EEC A;  2QYU A;  3VRB A;  3DJB A;  3UXG A;  3L08 A;  2BKK B;  2L6B A;  5EIB E;  3CR3 A;  5JDL A;  1NA3 A;  5A7D B;  4ERR A;  4DND A;  2UXC T;  3O9X A;  2NC9 A;  3OAW A;  4LMK A;  1S63 A;  3J5P A;  5BMV E;  3TLV A;  3MZL B;  4A3T A;  5HYA A;  3PUQ A;  4F6R C;  4HN9 A;  3Q79 A;  2J07 A;  5KWD A;  3MKD A;  1UJK A;  4OX9 T;  3OPC A;  1V9D A;  3MYV A;  2XSA A;  2H7O A;  2WQH A;  2D0T A;  2VGY A;  3QKY A;  2W63 A;  5GON E;  2BG9 B;  2HPJ A;  5FNV E;  1MIV A;  4MBQ A;  2CG3 A;  5M4Y A;  4DX1 A;  2VUR A;  3JQ1 A;  2LHN A;  4M3O A;  5LOV E;  4JHK A;  4UEL A;  2E2E A;  2EIN E;  3TL5 A;  3SO8 A;  1SZ9 A;  4LFC T;  1WY6 A;  3CIR A;  4HLL A;  2DWZ A;  5JRC B;  3Q2M A;  2B6C A;  1FT2 A;  3IHY A;  4AP2 A;  2JQH A;  4DR3 T;  4AVX A;  5FZR A;  3J9X 1;  3FTZ A;  3L8R A;  3OTO T;  1JUQ A;  1HNZ T;  3WG7 E;  1FVH A;  4DX5 D;  4IE4 A;  4O4H E;  5JDQ A;  3SFE A;  3AE2 A;  3RQW A;  2LSI A;  4UR9 A;  2IHR 1;  5BXO A;  4L23 A;  5G2N A;  3DST A;  2WXL A;  3P4W A;  4HEA A;  3FZH B;  4U8V D;  1U3D A;  4B93 B;  5AJD A;  4OK0 A;  3CVU A;  3KBU A;  4QH5 A;  3MAC A;  4WWP A;  3OXL A;  4RG6 A;  1B89 A;  5C2Y A;  3KBT A;  4FLH A;  1G8X A;  5KJK A;  4GYS A;  4DV2 T;  3K3N A;  4CXX A;  4KZC A;  4I43 A;  2XPI A;  4ZXL A;  5FT9 A;  1N94 A;  3VLE A;  5AQV B;  2X6J A;  2Z6E A;  3ZN3 A;  1KNR A;  4X5T A;  3NZP A;  2NP9 A;  3NBX X;  3UU6 A;  3TG4 A;  2WB5 A;  2XCC A;  3DXK G;  3HRA A;  3C4X A;  2XAS B;  4LNG A;  3IEE A;  2QA7 A;  3CVP A;  3U3I A;  3F2E A;  1EYH A;  4O60 A;  2XHE A;  5EYP F;  5AQU B;  5LYJ E;  1W0A A;  3HKE E;  2UXX B;  2AVP A;  3Q49 B;  3ZFW A;  4GTP A;  5J2T E;  4V1A v;  3RH3 A;  3ZMT B;  2F8X K;  1T8B A;  2IUB A;  1H6O A;  4HI8 A;  3N9Q A;  3SS1 A;  1Y8M A;  2VWA A;  5B1A E;  3ETU A;  2E9X D;  1W9R A;  5L4H A;  1LF8 A;  1TN7 A;  4N5C A;  4N2Q A;  2WMN A;  3U78 A;  1TJC A;  3ULY A;  2R05 A;  4E85 A;  4BJM A;  2OV9 A;  4UI9 C;  2NW8 A;  2BKN A;  2PL2 A;  4GAA A;  3ZHE B;  3PUR A;  3DSU A;  3FBZ A;  2H6G A;  1W3B A;  1V54 E;  2FO7 A;  4CGV A;  2UXD T;  3HXF A;  1JCS A;  2FO1 E;  4U04 A;  3ZGQ A;  1EF1 C;  3OJA A;  3NKZ A;  3AG2 E;  1BLX B;  3CEQ A;  2KWI B;  1MMN A;  2DNX A;  2LT3 A;  4LFA T;  3FTX A;  2ZM2 A;  1OCC E;  3AE4 A;  1SQM A;  2IOL A;  4CQI A;  4GZ6 A;  1A5E A;  3GZ2 A;  3PVL A;  4C9B B;  3PDN A;  2J09 A;  4ILA A;  1HU3 A;  2X6I A;  3LDZ A;  2LM2 A;  1MIY A;  3JCK C;  4QXC B;  2X6H A;  3HI2 A;  4OYS A;  3E32 A;  2X9W A;  3AE9 A;  2BKO A;  4NUU A;  2XRY A;  3ASF A;  3TJP A;  1SVX A;  2OEW A;  4FI5 A;  4GMJ A;  3VLF A;  1VRB A;  2IU1 A;  2DZO A;  4YTP A;  3RIU A;  4BT9 A;  5FKY A;  2OVF A;  2FBN A;  2XQ4 A;  5E0O A;  3DPY A;  2X9Y A;  4NPP A;  3B57 A;  1NWM X;  2IO2 C;  5LHI B;  3FUK A;  5LXT E;  2W61 A;  3LVQ E;  3CV0 A;  3TWQ A;  4IDO A;  3Q5E A;  3OBV E;  2XQY A;  5FXX A;  3ZIM A;  4R7L A;  1FIO A;  2I0M A;  2WWU A;  4WBN E;  3L22 A;  4PJM A;  2DZN A;  4TXP A;  3BU8 A;  3PU3 A;  1YQ3 A;  3OYZ A;  4DV3 T;  5CJ5 A;  4MLK A;  1H7C A;  2KXP B;  2XZD G;  2WXH A;  3GA8 A;  2JQ9 A;  1ZHC A;  3DPD A;  4MHC A;  5H6R B;  3TLU A;  4TX5 A;  4EZK A;  3UFE A;  1KNZ A;  5LGT B;  4GB9 A;  2V6X A;  5L3G B;  5LX8 A;  3B7B A;  3UUN A;  2GW1 A;  4GTO A;  4J8E A;  2MYS A;  2QC9 A;  2W66 A;  4YTN A;  2DWG A;  3K8P C;  3KV4 A;  3D9K A;  5AQS B;  4DR4 T;  2VGX B;  4HXI A;  4CXY A;  3UTM A;  4YLH A;  2NWB A;  3QB5 A;  5AQJ B;  4EV6 A;  5ETW A;  2I1K A;  2F0Y A;  4UWH A;  2EHO A;  1BR2 A;  2AE9 A;  3B7U X;  1ZBP A;  1N36 T;  4EED A;  5IY5 E;  5T3R A;  1LD7 A;  4GTT A;  2XRZ A;  4OHF A;  2XAF B;  4E7Z A;  2H6I A;  5LJM A;  4XBF B;  2KBX A;  4QH1 A;  3F6Q A;  5IHY A;  1IXV A;  3GWH A;  3ZYQ A;  1KFY A;  3CLJ A;  2AXZ A;  4YSY A;  1MQS A;  2WU2 A;  3OYX A;  3QNK A;  4RVB A;  3ZMS B;  4AV7 A;  3E08 A;  2QY7 A;  1SA0 E;  4JHJ A;  3QK6 A;  5LMU T;  4XKB A;  4DJA A;  4KX6 A;  5BT1 A;  5CEC B;  1T98 A;  2ION A;  1JPL A;  3FUD A;  2CMR A;  1VCT A;  2GGF A;  3FB2 A;  2LUH A;  3I0Q A;  3N2G E;  3O48 A;  1NZN A;  1Q2Z A;  2P9S G;  3K3Q C;  2JMK A;  2CHO A;  3I9Y A;  2PZI A;  3FH5 A;  3VTX A;  4F7A A;  1E8W A;  1HO8 A;  1HTJ F;  5JDM A;  5KJM A;  1IAP A;  4KMC A;  3LSV A;  5ABE A;  1HZ4 A;  2IO3 C;  3V79 K;  4GML A;  2BKG A;  1IHG A;  3RO2 A;  5LBM A;  4DV6 T;  5H6Q B;  4AQY T;  5HEG A;  4YFS A;  3UQ4 A;  3ZMV B;  5LCW C;  2RPA A;  3OVU A;  3C3R A;  4AJW A;  5FXZ A;  4Q96 A;  5CA1 E;  2X66 A;  4CYM D;  1PY1 A;  3HXC A;  5HEH A;  2KCK A;  2D2S A;  1N4R A;  4WNK A;  4X1K E;  3PE0 A;  3URZ A;  3MZK B;  2YK0 A;  4BY6 A;  4PK5 A;  3JC6 C;  2H89 A;  3BUA A;  4TUU A;  5ENO D;  1PC2 A;  4GPM A;  5EIL A;  2ODU A;  2WM9 A;  1TNO A;  2LAI A;  4U7Y A;  1OXZ A;  4AKR B;  4Y6W A;  3VRA A;  3DSS A;  1NL4 A;  2N1G A;  1JNZ A;  4LF4 T;  3HXD A;  4HFI A;  3CVV A;  5ARG A;  1HH8 A;  4ZI7 E;  1PAQ A;  2J8S D;  2VTB B;  5CED B;  3JAE A;  4UV9 B;  2WXI A;  4GCN A;  4EXT A;  4ANJ A;  3X2Q E;  3P8C D;  4YDO A;  3N2O A;  1OY3 D;  4HI9 A;  3QUJ A;  2DIW A;  5F5W A;  4GTS A;  3S7B A;  3ONX A;  2OOE A;  2E9X B;  5L47 A;  4DVD A;  2V4L A;  3ML8 A;  4KT6 B;  1U4Q A;  1ZP0 A;  2KND A;  1N33 T;  3ESL A;  5ABF A;  5L3C B;  4U74 A;  2ACZ A;  3EI0 A;  4YHH T;  2KZT A;  4DX7 D;  3UUX A;  1HR0 T;  2OV8 A;  2XQ6 A;  3BQL A;  3ZYK A;  3AAE B;  3S7F A;  3MA9 A;  3V2O A;  3QB5 K;  3FUE A;  4Q69 A;  3EIQ C;  4TWD A;  3RAU A;  3OXG A;  3BQI A;  3CHP A;  1MYO A;  4JI7 T;  3AS4 A;  2RA1 A;  2YDR A;  5CCM A;  4TUY E;  2ZLY A;  4BTB A;  4OAV B;  1SZA A;  2XM2 A;  2PNN A;  3L3P A;  3SQV A;  1B7T A;  2XTL A;  5ABG A;  4FJY A;  3ONL C;  4IDQ A;  4LNU D;  1Z0P A;  2G0U A;  4AQF C;  3H3A A;  2HN1 A;  2BG9 C;  2XQ7 A;  3Q5W A;  4Q25 A;  3CK7 A;  4AIU A;  4ANV A;  4B3M T;  2MPK A;  4QFV A;  4ACL A;  1HFA A;  3A7M A;  2MAW A;  4N2S A;  2XQ9 A;  4I1A A;  2RD0 A;  4HRM B;  5JJ7 A;  4I55 E;  4UV8 B;  3J5Q B;  2I59 A;  4H7Y A;  4JL0 A;  3RRW A;  3P2B A;  3S7J A;  2V7I A;  1S70 B;  1N4Q A;  2MTQ A;  2NXP A;  2P9K G;  3TXN A;  1H6K A;  1XNQ T;  4MAL A;  1BPO A;  3SY2 A;  4CEM A;  3LBX B;  3SFY A;  4ILB A;  4HQD A;  2UXB T;  3LS8 A;  4MKT A;  2WQY A;  4BET A;  4KVM A;  5AAO A;  4N3C A;  4DR2 T;  1D1A A;  2LNI A;  4O8S A;  2XHE B;  2WXM A;  4L7T A;  3ONL A;  5C3J A;  3P1U A;  4KYO B;  2VGE A;  2VJ8 A;  2V26 A;  4UQZ A;  4G8L A;  3DTO A;  3X1D A;  3RRN B;  4GTQ A;  3NOG D;  2CEA A;  3KAE A;  4PS8 A;  2I1J A;  5A6C A;  4UIG A;  4A5X A;  3ANW A;  3UPV A;  3D0T A;  2X0Y A;  4G23 A;  2VSY A;  1WR6 A;  1E7P A;  3E37 A;  2ZIR A;  4UWL A;  4AQG A;  5HXE A;  3APD A;  2C5I T;  4YSX A;  1WYC A;  1NEK A;  4F1S A;  3O1H A;  2I6H A;  4ANX A;  2ZGD A;  5FVL A;  3QB2 A;  2FEZ A;  2AJA A;  3ZN1 B;  1D0Y A;  4GOU A;  1TN6 A;  3EHQ A;  3AAI A;  3VR8 A;  4ILU A;  2JJ9 A;  2UWJ G;  3E33 A;  2WAU A;  4DUZ T;  4PK6 A;  3I0O A;  2XPK A;  3IHR A;  2XGS A;  5JTG A;  4FU3 A;  2IIU A;  3CHQ A;  4JI0 T;  3PS6 A;  5ITZ F;  5T4Y A;  3LJN A;  2LLY A;  3CHM A;  3L9T A;  3CKD A;  2LJL A;  2KCV A;  1KLX A;  5JDG A;  3ENE A;  3QC9 A;  3AS8 A;  3MX3 A;  1IZN B;  4ZI2 C;  4E6H A;  2CFZ A;  4HS2 A;  2DVW A;  2XSB A;  3AE6 A;  2RG8 A;  5J08 A;  4WND A;  3KV5 A;  1DVP A;  4FJO A;  3EVY A;  4DR7 T;  2IW5 B;  3C3O A;  1N95 A;  4L9P A;  4JUY A;  2XQ3 A;  3PJA A;  4AM9 A;  3AG4 E;  5EID A;  3RSE G;  3NZS A;  4LMJ A;  4OVV A;  4ATG A;  3O4X E;  5JDF A;  1XDO A;  4WYV A;  2XCB A;  4IDN A;  1UX5 A;  3ULE G;  3ZT6 A;  3UUB A;  3NAW A;  2V7L A;  3CX7 B;  4ANU A;  3LXU X;  3UQ7 A;  3PDY A;  5G05 C;  1IBM T;  1R8I A;  3NRY A;  4UEM A;  2VL8 A;  2ILR A;  4X64 T;  2YQ8 A;  2IEJ A;  2XAH B;  3CX8 B;  3MV3 B;  5JR9 B;  4FJZ A;  2RP4 A;  2VKJ A;  4HTE A;  1JWG A;  2UY1 A;  4IUL A;  2EHO D;  4JB8 P;  3Q5D A;  4DV7 T;  1E7U A;  3SWH A;  3VTY A;  2XJ7 A;  3W15 B;  5L2L A;  2Y4T A;  3KVA A;  2YOE A;  2E0I A;  3APF A;  4UUC A;  4B0Z A;  2PBI A;  4BES A;  1US7 B;  4H63 H;  5HXR A;  3AU5 A;  2J08 A;  2CM0 A;  2K24 A;  3AB3 B;  3DXM G;  2IY0 C;  3G2U A;  1UUS A;  3PTR B;  4QHO A;  2DCP A;  4CCA A;  4IT4 A;  5KDM C;  3I5P A;  3ASO E;  3AE8 A;  2HYZ A;  5HXS A;  4JI3 T;  4DO0 A;  3LJ3 A;  4QKN A;  2X0H A;  2W0G A;  2KWH A;  2IAK A;  2VAS A;  1H2T C;  1IBK T;  2Y4U A;  5HEO A;  4J6I A;  2W4X A;  3A8Y C;  4ZFH A;  4H9P C;  1OWO A;  3DEO A;  1T7S A;  3AG1 E;  3SI5 A;  1BD8 A;  3Q5X A;  2R03 A;  3G06 A;  3KV9 A;  2WZI A;  4WNF A;  2DCF A;  2K5B B;  2XUE A;  4A98 A;  4M1P A;  4L9I A;  5EZY E;  4X62 T;  2VSN A;  3DSX A;  1S64 A;  3FUM A;  3RX6 A;  2Y8D A;  4UWF A;  3D9J A;  2ZGG A;  1K1B A;  5ENQ D;  5BV0 A;  3ZC0 A;  4IRU A;  4GMR A;  3CQC B;  5AIJ A;  2Y69 E;  3DRA A;  3LCA A;  1TJF A;  5FWQ A;  3QWW A;  4PS7 A;  5HWY A;  2XAJ B;  4HFD A;  2LHR A;  1JCQ A;  1IQR A;  5JR9 A;  2WPV A;  4MRU A;  4UI9 J;  2LXL A;  3UIP C;  2LSU A;  2L3L A;  2E9X C;  3AVS A;  3T5X A;  1HNW T;  2CBJ A;  1L5J A;  4GIW A;  3I1A A;  3LG7 A;  2WXR A;  4KMO A;  4XZ4 A;  3CHR A;  4LG6 A;  2BG9 A;  3QJZ A;  3KD7 A;  4CI2 B;  1QLB A;  2P9U G;  3PV0 F;  3BQK A;  3CKC A;  2F4V T;  1KNP A;  4U07 A;  5CCL A;  2GK9 A;  4TV8 E;  2V6Y A;  4CN6 A;  2GRO B;  2J47 A;  2JPF A;  4J8Y A;  4J7W A;  5J0Z A;  2Y48 B;  2YU1 A;  3VKH A;  2KMF A;  2BED A;  5H7P A;  4U2Z A;  1Z3X A;  3HVE A;  5AQI B;  3RYC E;  4Z90 A;  4LSZ E;  2FUL A;  5BV1 A;  3EU5 A;  3MKR A;  1MND A;  4K03 A;  4IE0 A;  3MKQ B;  4PUC A;  4ZZB A;  1Z6T A;  3EDT B;  2AW6 A;  1ZU2 A;  1X81 A;  2PFV A;  5ENS D;  3AEB A;  2PJQ A;  3C5R A;  2V5C A;  1WCR A;  3AS5 A;  2FF4 A;  3OKQ A;  4BER A;  3LKU A;  1WYB A;  4N3A A;  3TWR A;  3U3W A;  1CUN A;  1I94 T;  5EX0 A;  2X51 A;  4Z68 A;  2KZ7 B;  2F8Y A;  4JI6 T;  1MNE A;  2W62 A;  4CT4 A;  3FUJ A;  1N52 A;  5LB7 B;  1H19 A;  5C2T A;  3FEY A;  3TWS A;  3GZ1 A;  4I6G A;  3UUL A;  1D1B A;  2CRB A;  4JI4 T;  2GRP B;  4JLE A;  3FUN A;  3CVR A;  2L9Q A;  2XM1 A;  4JI2 T;  5AQP B;  3CHS A;  2CBI A;  3B7S A;  4K0K T;  4DI3 A;  4ILC A;  5JRE A;  1N0R A;  2VL0 A;  3QWV A;  3PUA A;  4TNW A;  4DLQ A;  1G3N B;  1M62 A;  2OA5 A;  1WFD A;  3FZK B;  2JQQ A;  3HKB E;  1UK5 A;  4P09 A;  3H37 A;  2UY1 B;  4CDR A;  1N0Q A;  3HA4 A;  1BU9 A;  3AG3 E;  5J90 A;  1HF8 A;  1JWF A;  3ZRH A;  5JR9 C;  4AY6 A;  2X38 A;  3BG1 B;  3PZ1 A;  3RKV A;  5LG4 A;  3R7Q A;  4Y6C A;  4B3R T;  3JQ0 A;  3ZKJ A;  2KC7 A;  4U72 A;  4PS3 A;  3T8M A;  4BT8 A;  4J2C A;  1MX2 A;  5KJN A;  1HXI A;  5CMY A;  2XZT G;  2VQF T;  3FU3 A;  4JW1 A;  3Q15 A;  2HE0 A;  1WLX A;  2KM4 A;  3UM3 A;  5EX3 A;  4COF A;  2X9H A;  3TXM A;  5ARF A;  4DI4 A;  3ZT5 A;  3PZ3 A;  5HAX A;  2KCL A;  3ETV A;  2AXD S;  1IYG A;  1ZOY A;  5LCW J;  5DQW A;  1WAO 1;  5AQB A;  4A63 B;  3BK9 A;  2JMH A;  2VVN A;  4U8H A;  4NUV A;  5AQA A;  4DRX E;  1N4S A;  4G26 A;  4I1O B;  3D9P A;  4YDY A;  2VKD A;  3U64 A;  3TLW A;  3UFG A;  1MIW A;  3HIZ A;  2XPY A;  3LDQ B;  5G04 J;  4EZL A;  3B7T A;  3FTV A;  1WDY A;  2R2L A;  3AA1 B;  3V5U A;  3ZT7 A;  4G63 A;  3N9N A;  2X0L B;  5CGM A;  2LSK A;  4IIJ E;  5ENN A;  1E2A A;  2ZIS A;  2NW9 A;  3LFM A;  1N54 A;  5DBK A;  4FC8 A;  2PQR A;  3DWL G;  4HFG A;  1LD8 A;  4O1P A;  4I9C A;  5IYZ E;  4JC8 A;  3RKG A;  5AQH B;  1OED C;  4GTR A;  4HFE A;  4AXP A;  3ONK A;  5LJN A;  1D8D A;  1OWM A;  3KV6 A;  4GA2 A;  4RSY A;  5EK3 A;  3FDH A;  5ABH A;  3FHN A;  2QRX A;  2VYI A;  3CIA A;  3K1S A;  4EYY R;  3EDV A;  4EOZ B;  1IKN D;  2H6H A;  5LCY A;  3N9P A;  2LEH A;  5G05 J;  3RC3 A;  2NTY A;  4GU5 A;  4EHM A;  4DR1 T;  4RQI A;  3RI5 A;  2MYO A;  3P7I A;  5KNG A;  4AIS A;  3SFZ A;  3FBL A;  1FMV A;  2MOW A;  3RYF E;  4CXW A;  1DCE A;  4LCT A;  2BS4 A;  3CGH A;  3CK9 A;  1HS7 A;  3IF8 B;  3ZW3 A;  1HX8 A;  2GRM A;  5HKP A;  3FU5 A;  2RKK A;  1U3C A;  4EZH A;  4UI9 K;  4MFR A;  3UU4 A;  1ZB1 A;  2PG8 A;  3HDX A;  5BPP A;  4IST A;  5CRU A;  3NB2 A;  4WZX A;  4HFH A;  4LFB T;  3PZ4 A;  3CHO A;  3NF1 A;  2IC6 A;  3RQU A;  1LVK A;  3UT8 A;  2EHO B;  4P1N A;  1A17 A;  1TEZ A;  3NZQ A;  4IHJ E;  2MHK A;  3PNL B;  4JEU A;  2K48 A;  4WAF A;  2WWV A;  2R5S A;  2C0S A;  3MXZ A;  4X1Y E;  4BAY B;  2N9D A;  3EU9 A;  2V5D A;  4DUI A;  2A3D A;  3JAD A;  3U4T A;  3U9W A;  1TN8 A;  2YN6 A;  4BJN A;  1K3Z D;  3Q7A A;  1U2V G;  5CHE E;  4U3C A;  4JV5 T;  2XQ0 A;  5AYW D;  4IN3 B;  5JDN A;  3FTU A;  1HG5 A;  4O2B E;  3C72 A;  2FI7 A;  3SD5 A;  2V8S E;  3OTN A;  4KBM B;  3E4B A;  4U7E B;  2V5F A;  3JC6 D;  2HPL A;  2KLQ A;  5DQV A;  4CDN A;  2LM9 A;  2IDO B;  2EIK E;  2WQ7 A;  1QQE A;  1DC2 A;  3JCF A;  3RYH E;  3IBE A;  2HM8 A;  2CWO A;  5HI7 A;  2C5K T;  1OT8 A;  4KHP T;  3AE1 A;  3IKO B;  1E1H B;  5F8P A;  4C0M A;  3RRM B;  5CA0 E;  4KP3 C;  4MLP A;  2D0U A;  1DCQ A;  4A56 A;  3G2V A;  3CVW A;  5LGN B;  3EDU A;  5FJY A;  3UMV A;  3ZVV A;  5BNW A;  3ISM C;  3HKC E;  5JVD E;  3AA7 B;  5C8Y E;  2EIL E;  4XI9 A;  2D9D A;  3PUY F;  4I50 E;  1INZ A;  4CDM A;  4GZD A;  1FVF A;  3ZU7 B;  5EK4 A;  4JVS A;  2X68 A;  4TXQ A;  3RIF A;  2WY2 A;  4U7I A;  3ZNG A;  3UTK A;  3JXI A;  3W9F A;  4TZ4 C;  5L3D B;  2HH7 A;  5EK2 A;  2V7M A;  1ELK A;  3AA6 B;  4CT0 A;  5BUZ A;  2CLY B;  5JMN D;  4LF9 T;  3NVO A;  4EYU A;  3CPZ A;  3AEG A;  1TNY A;  2HR2 A;  3QAR A;  2LSV A;  2YDS A;  4BSZ B;  2H7V C;  4K5C A;  2V7K A;  4CI1 B;  3R9A B;  2W67 A;  2A72 A;  4IE7 A;  2VSO E;  3N9O A;  4EBA G;  3D9L A;  4EQF A;  3GZS A;  3G2T A;  4G25 A;  3N71 A;  3UX4 A;  2DL1 A;  3ZUV B;  2OLT A;  5CBN A;  1GW6 A;  4DID B;  4JD2 G;  2P2C P;  2XS1 A;  3RF1 A;  3JYS A;  3SBT B;  3OXF A;  4HRN A;  2KZT B;  2EHO C;  4IL9 A;  3RRU A;  3AJI A;  1OED B;  1OCZ E;  5KBA A;  2M63 A;  4QWN B;  2M6B A;  4YT0 A;  2M67 A;  4JA9 A;  4LUN U;  4O4L E;  3LY9 A;  2OND A;  4ZZC A;  4QH4 A;  3C64 A;  2BDE A;  3CKB A;  4ADZ A;  3VKG A; 
#chains in the Genus database with same CATH homology
 4XZC A;  3MA5 A;  1MHQ A;  3S4U A;  5KCM A;  1E8Z A;  4KVO A;  2V1D B;  5LNK A;  4F53 A;  4N3B A;  1O3X A;  4GK5 E;  5LP0 A;  1Y64 B;  4N39 A;  3O1J A;  2VSX E;  2Q9Q A;  3PE4 A;  4UWK A;  3LPZ A;  3GN5 B;  5G04 C;  4HOQ A;  3PUG A;  4KUM B;  1WM5 A;  4JEU B;  4EPZ A;  3FTY A;  3B7R L;  4HFV A;  2VKH A;  5A23 A;  3GW4 A;  2YHC A;  1E96 B;  3JUI A;  2XGM A;  1BR4 A;  2H3R A;  4B89 A;  5JH7 E;  4HLE A;  4JA7 A;  3TAX A;  2J1D G;  2CXD A;  5L3B B;  4TV3 A;  4AXH A;  4AY5 A;  2ZM0 A;  3LK2 B;  3APC A;  4DLO A;  3MK7 C;  4GYY A;  2ODV A;  2Q7F A;  3FUH A;  2X6F A;  2BVM A;  3CQX C;  2OVB A;  3ANW B;  3L17 A;  4C91 A;  4BSX A;  3SOL A;  5FY0 A;  2CHW A;  4YJ3 E;  4G11 A;  3GYZ A;  5ANL A;  1IQU A;  1HCI A;  3R7R A;  2YIN A;  3RYI E;  4ILG A;  3Q47 B;  3ZYM A;  4NUR A;  4PW8 A;  3FWV A;  3C98 A;  4I9E A;  4FHJ A;  1IJ6 A;  4DBR A;  1OWP A;  1HE8 A;  4GYO A;  3FY4 A;  3QWP A;  3D9M A;  1S35 A;  5HXH A;  2UXN B;  1UW4 B;  3WAJ A;  2XEV A;  3LYA A;  4YND A;  4Z8X A;  1Y6I A;  5AJL A;  2A2F X;  1YW0 A;  2BZB A;  4HOS A;  4UF0 A;  4FAD A;  4G2A A;  2L9B A;  1UX4 A;  1MMG A;  2CE7 A;  4B6X A;  4KXK B;  2PM7 A;  2LE8 A;  2VQ2 A;  3G2W A;  5AFU L;  4H9N C;  4A55 A;  1YD8 G;  2J4B A;  3S7D A;  2Q9Q C;  2Y3A A;  3ASG A;  1D0Z A;  2ES0 A;  4BX8 A;  2J9Q A;  4QXB B;  5ADX L;  4WWO A;  2GRL A;  4JHR A;  4J8S A;  4BX9 A;  4IE6 A;  3TKL B;  5FQ6 A;  3SGH A;  4J0U A;  3LK4 2;  4YVO A;  5ANR A;  3RO3 A;  2PQN A;  3N9M A;  1VDY A;  3MGB A;  4O4I E;  3I9W A;  5FY1 A;  5LP6 E;  5EDS A;  3L13 A;  3IV0 A;  3SRZ A;  4ZOL E;  3PRZ A;  3D9N A;  5TAO A;  3QAQ A;  4NQ0 A;  3FH7 A;  3D3M A;  4P0A A;  2HO1 A;  3ZLI A;  4GZ3 A;  4APF A;  1AJ3 A;  3N2K E;  3ZYL A;  4FHK A;  4MS6 A;  1BR0 A;  4EBA A;  3ZN0 B;  2DLR A;  3T5V A;  3HKD E;  1EZ3 A;  2IJG X;  4PJL A;  4A3V A;  3V5S A;  2CG2 A;  5FTP A;  3FXD B;  2X67 A;  5T8I A;  5G55 A;  4CGW A;  1OWN A;  4LER A;  3C51 A;  4ASK A;  4LEU A;  3ZCI A;  3QC1 A;  4PDX A;  3DP7 A;  4DPR A;  2J49 A;  5A1L A;  1BR1 A;  2CCQ A;  2P9B A;  3KEZ A;  3RIB A;  4HGA A;  2L0I A;  4UVC B;  3L54 A;  2WSS V;  3FTS A;  3HHM A;  3R6N A;  2R17 C;  3ZMU B;  5L3F B;  2LSJ A;  2A4Z A;  4FLB A;  4GA0 A;  3PZD A;  1E7V A;  3SF4 A;  4DK5 A;  1U5P A;  2XGO A;  2L0T B;  2CLY C;  2CXL A;  3LBX A;  3ZHE A;  4DMV A;  4C90 A;  3KVB A;  3FTW A;  4YHJ A;  1ZEE A;  3RRC A;  4JXT A;  4AKL A;  2LSY A;  2BF0 X;  2KIN B;  2L6J A;  5LHH B;  1FEW A;  4CZZ B;  2DBA A;  3M65 A;  5HQ8 A;  5JQG E;  5AEN A;  4PFP A;  2ZM8 A;  2WQ6 A;  4F3V A;  2YHE A;  4H9Q C;  4ME2 A;  3PU8 A;  3HYM B;  3E0Z A;  1HG2 A;  4BWR A;  3CVQ A;  3UQ3 A;  4JEH B;  2AWI A;  4WNE A;  5FQ7 A;  4I1M A;  1FCH A;  4WUY A;  2P58 C;  3UT7 A;  1X5B A;  1UN8 A;  3F31 A;  4ZI3 D;  5LBQ B;  4O2A E;  4HOR A;  3I3N A;  4GYW A;  1X79 A;  4WW0 A;  3PEU B;  3C98 B;  4IE5 A;  1NP7 A;  2IF4 A;  3C4Z A;  2IQC A;  3K9I A;  2CWY A;  5FYM A;  2VTB A;  1IJ5 A;  3EIJ A;  3RK6 A;  3CVY A;  1QZ2 A;  3SBS A;  3CK8 A;  5LGU B;  4ACK A;  3NQP A;  3L6A A;  3FHE A;  3FXE B;  3R84 B;  4AKG A;  3E22 E;  2MBG A;  1NA0 A;  2K9A A;  3L16 A;  3LY7 A;  4B8C B;  3Q9D A;  2X6K A;  4JZY A;  2ZMA A;  5FP3 A;  1S0P A;  4I2W A;  3HR0 A;  3GN5 A;  3HL6 A;  2E9X A;  4V3I A;  3EJN A;  4PFO A;  3VHL A;  2Q9Q B;  4YJ2 E;  5HXC A;  4A1G A;  3AVR A;  2BTD A;  4UQY A;  5JHA A;  4URK A;  3ASH A;  5JJT A;  4FP7 A;  3ZJ2 A;  1KT1 A;  2LO6 A;  1H2V C;  4I6E A;  1ZKE A;  1XNF A;  3HVE B;  2LOS A;  5FZS A;  5E75 A;  4XIF A;  2LOP A;  5JJ6 A;  1DNP A;  4PNI A;  3PUS A;  5J1G A;  4U63 A;  4ZHQ E;  2I9C A;  4HKA A;  1UCU A;  2VB6 A;  2WBL A;  3A5X A;  4OYJ A;  3C50 A;  3PE3 A;  4EZ4 A;  2C0L A;  1LVF A;  1MMD A;  3DBS A;  3AAA B;  3O1I A;  1WRD A;  5D0Q D;  4A1S A;  3ZXS A;  3AU4 A;  3CST A;  3WAK A;  4G24 A;  4RG9 A;  4U0Z A;  1E8X A;  2JLB A;  5JDH A;  4K0U A;  3EHM A;  4L5G A;  2QFC A;  4W9R A;  3CML A;  5FXW A;  2XAG B;  3EUH A;  1UN9 A;  2JEK A;  3K3O A;  2WXQ A;  4LRZ A;  2YU2 A;  4L1B A;  5CB4 E;  4EZJ A;  2R59 A;  4PH4 B;  3PUJ A;  4NAC A;  2AXU A;  4UF0 B;  4TV9 E;  2J4D A;  5KX5 E;  3UUX B;  3ZEF A;  5DIZ A;  3Q5M A;  2Q9Q D;  4UVA B;  4H63 V;  4FUL A;  2CHX A;  3J7Y q;  4BTA A;  4GZ5 A;  5FY7 A;  3S2A A;  1G73 A;  2W00 A;  4HVB A;  2BUG A;  4AI6 A;  4KBQ A;  4ZI2 D;  5FMN A;  2XPZ A;  3MJW A;  4CRW A;  5LFA A;  4U0S A;  1UJJ A;  4GA1 A;  4ILI A;  4ISS A;  3N5L A;  4K0R A;  2NTX A;  3PH0 C;  5FZQ A;  4GK0 E;  5F3J A;  1YKE B;  4X20 E;  2NW7 A;  3L09 A;  4H9R C;  3IBP A;  4XX5 A;  2D5U A;  3LJC A;  4CI3 B;  3I4R B;  4XAX B;  4ZS2 A;  4B8A A;  3B13 A;  2ZU6 B;  4O4J E;  3MJX A;  4C0E A;  4PK4 A;  4ABN A;  2WMO A;  4XI0 A;  4X1I E;  3PNT B;  4L2L A;  3FUF A;  2AXV A;  3U66 A;  4I17 A;  4H9O C;  3GMI A;  1ZV4 X;  1OWL A;  3BEE A;  4P0B A;  3QOU A;  2Y6X A;  3LVR E;  1YA0 A;  3AA0 B;  2V0P A;  4APO A;  4AIF A;  5LOZ A;  4PAG A;  3UT4 A;  2X9X A;  1NAF A;  4AKH A;  4DBQ A;  1ELW A;  2A5U A;  3ASD A;  3MCX A;  3CQG B;  2DWK A;  3FU0 A;  3LEW A;  3RC8 A;  3WXX A;  4UXN B;  3CVL A;  4NRH B;  4P29 A;  4EAH A;  5EKQ D;  3FFL A;  1LKX A;  3SHF A;  3D9I A;  4G1T A;  2LSG A;  3RKO A;  3I4G A;  4H7X A;  4FA6 A;  2N2N A;  2QGS A;  3MV2 B;  3IHV A;  2WXO A;  5HWX A;  4EB6 E;  1EDU A;  3RU0 A;  2VK9 A;  3ZJ1 A;  3CWZ B;  5DAB A;  3CVX A;  5JHB A;  5L3E B;  4UWG A;  4OFZ A;  3VU7 H;  4ZS3 A;  1H2U A;  4JEH A;  3UUM A;  3MKQ A;  2C2L A;  2V7J A;  4PJJ A;  4N78 D;  3G2S A;  5D0O D;  2ACX A;  2X3M A;  3QDN A;  3FEX A;  4ILH B;  3VLD A;  2VKO A;  3TG5 A;  1S94 A;  3KFW X;  3N9L A;  3CSF A;  1QNF A;  1QUU A;  2C0M A;  1ELR A;  2EQX A;  4IDZ A;  1D0X A;  2BVL A;  4BA9 A;  2NSZ A;  2C5J A;  3ZEF B;  5LA6 E;  2CXF A;  4D10 C;  2MOZ A;  4YVQ C;  4JPS A;  4HOT A;  2SPC A;  5FQ4 A;  4L0R A;  3PRE A;  4J8D A;  4TN7 B;  3D9O A;  2YEV C;  3ZC1 A;  3PEV B;  1Z3Y A;  2IOS A;  2B1E A;  3SNX A;  5LHG B;  4GYR A;  3LK3 B;  2WB2 A;  5DJQ C;  4E7S A;  4TRQ A;  2WXG A;  3F57 A;  3FUL A;  4U0U A;  3ZCJ A;  5C1D A;  3Q4A B;  4O6F A;  5KJL A;  4OVU A;  3TGO A;  3WI3 A;  2CFU A;  3ZMZ B;  1E8Y A;  1KT0 A;  1UG3 A;  1OWA A;  4L2Y A;  4AQF A;  3ZPO A;  1E90 A;  3ULQ A;  4HOU A;  2YNQ A;  4QXH B;  4GPK A;  3MEK A;  4UQX A;  3LY8 A;  3RJV A;  1KK7 A;  2CA5 A;  4GZC A;  4Q94 A;  1EPU A;  4AEZ C;  1XGW A;  4BFR A;  3T8O A;  3PUK A;  3UT5 E;  2CHZ A;  2DI4 A;  3FH8 A;  4HE8 A;  2IFU A;  4AKI A;  4WWN A;  5FXV A;  3KDS E;  2LAH A;  4QX8 B;  1OUV A;  4AOF A;  3O4Z A;  3CVN A;  4I4T E;  1FMW A;  3KIN B;  4G2V A;  2PM6 A;  4B94 A;  2WXK A;  3NRX A;  2JRK A;  3ML9 A;  4ZI3 C;  3SZ7 A;  1HS6 A;  2I2O A;  3CX6 B;  3QK0 A;  3IEG A;  2E8I A;  3KS2 A;  5KMG P;  2MRI A;  5M72 A;  2XAQ B;  1MMA A;  1VOM A;  2VGX A;  2L8K A;  2WXN A;  1QSD A;  2WVI A;  4OYK A;  4J8F A;  2KT9 A;  2WXJ A;  3FP3 A;  5FQ8 A;  4IGU A;  2IC9 A;  4I6J A;  4GCO A;  3NZU A;  4UVB B;  4EIW A;  4QX7 B;  4H9S E;  4WNG A;  4KZ0 A;  2WXP A;  4I2Z A;  4XE0 A;  5JRC A;  3ESK A;  4WBO A;  5E76 A;  2KAT A;  1P5Q A;  1LRZ A;  1YKH B;  4ANW A;  5CMW A;  4I43 B;  3EHN A;  5BW8 C;  5J2U E;  2WXF A;  4DMW A;  3FU6 A;  4IYP A;  4PJN A;  1H0A A;  1SHZ C;  2DHR A;  3BG0 B;  3ZPJ A;  4XKC A;  2NOX A;  1D1C A;  3RPU A;  3FUI A;  3C4W A;  4EEC A;  3DJB A;  3L08 A;  3CR3 A;  5JDL A;  1NA3 A;  5A7D B;  4ERR A;  4DND A;  2NC9 A;  3O9X A;  3OAW A;  5BMV E;  3MZL B;  4A3T A;  5HYA A;  3PUQ A;  4F6R C;  4HN9 A;  2J07 A;  3MKD A;  1UJK A;  1V9D A;  3MYV A;  2WQH A;  2H7O A;  2D0T A;  2VGY A;  3QKY A;  2W63 A;  5GON E;  2HPJ A;  5FNV E;  1MIV A;  4MBQ A;  2CG3 A;  5M4Y A;  3JQ1 A;  2LHN A;  4M3O A;  5LOV E;  4JHK A;  4UEL A;  2E2E A;  3TL5 A;  1SZ9 A;  1WY6 A;  5JRC B;  3Q2M A;  3IHY A;  4AP2 A;  4AVX A;  5FZR A;  3J9X 1;  3FTZ A;  1JUQ A;  1FVH A;  4IE4 A;  4O4H E;  5JDQ A;  2LSI A;  4L23 A;  5G2N A;  2WXL A;  4HEA A;  1U3D A;  5AJD A;  4OK0 A;  3CVU A;  3KBU A;  3MAC A;  4WWP A;  3OXL A;  4RG6 A;  1B89 A;  5C2Y A;  3KBT A;  4FLH A;  1G8X A;  5KJK A;  4GYS A;  3K3N A;  4CXX A;  4KZC A;  4I43 A;  2XPI A;  5FT9 A;  3VLE A;  2X6J A;  2Z6E A;  3ZN3 A;  3NZP A;  2NP9 A;  3NBX X;  3TG4 A;  2XCC A;  3C4X A;  2XAS B;  3IEE A;  2QA7 A;  3CVP A;  3U3I A;  3F2E A;  1EYH A;  2XHE A;  5LYJ E;  3HKE E;  2UXX B;  2AVP A;  3Q49 B;  3ZFW A;  5J2T E;  4V1A v;  3RH3 A;  3ZMT B;  3N9Q A;  3SS1 A;  1Y8M A;  2VWA A;  3ETU A;  2E9X D;  4N5C A;  4N2Q A;  1LF8 A;  2WMN A;  3U78 A;  1TJC A;  4E85 A;  4BJM A;  4UI9 C;  2NW8 A;  2PL2 A;  4GAA A;  3ZHE B;  3PUR A;  3FBZ A;  1W3B A;  2FO7 A;  4CGV A;  4U04 A;  3ZGQ A;  1EF1 C;  3OJA A;  3CEQ A;  2KWI B;  1MMN A;  2DNX A;  2LT3 A;  3FTX A;  2ZM2 A;  1SQM A;  2IOL A;  4CQI A;  4GZ6 A;  3GZ2 A;  3PVL A;  4C9B B;  3PDN A;  2J09 A;  1HU3 A;  2X6I A;  3LDZ A;  1MIY A;  3JCK C;  4QXC B;  2X6H A;  3HI2 A;  4OYS A;  2X9W A;  4NUU A;  2XRY A;  3ASF A;  3TJP A;  4FI5 A;  4GMJ A;  3VLF A;  1VRB A;  2IU1 A;  4BT9 A;  2OVF A;  2FBN A;  5E0O A;  2X9Y A;  3FUK A;  3B57 A;  1NWM X;  5LHI B;  5LXT E;  2W61 A;  3LVQ E;  3CV0 A;  3OBV E;  2XQY A;  5FXX A;  3ZIM A;  4R7L A;  1FIO A;  2WWU A;  4WBN E;  3L22 A;  4PJM A;  3PU3 A;  3OYZ A;  4MLK A;  1H7C A;  2KXP B;  2WXH A;  3GA8 A;  1ZHC A;  3DPD A;  4MHC A;  5H6R B;  4TX5 A;  4EZK A;  3UFE A;  1KNZ A;  5LGT B;  4GB9 A;  5L3G B;  5LX8 A;  3UUN A;  2GW1 A;  4J8E A;  2MYS A;  2DWG A;  3K8P C;  3KV4 A;  3D9K A;  2VGX B;  4HXI A;  4CXY A;  4YLH A;  2NWB A;  5ETW A;  2I1K A;  4UWH A;  2EHO A;  1BR2 A;  3B7U X;  1ZBP A;  5T3R A;  2XRZ A;  4OHF A;  2XAF B;  4E7Z A;  5LJM A;  4XBF B;  5IHY A;  3GWH A;  3ZYQ A;  3CLJ A;  2AXZ A;  1MQS A;  4RVB A;  3OYX A;  3QNK A;  4AV7 A;  3ZMS B;  3E08 A;  2QY7 A;  1SA0 E;  4JHJ A;  3QK6 A;  4XKB A;  4DJA A;  5BT1 A;  1T98 A;  2ION A;  1JPL A;  3FUD A;  2CMR A;  2GGF A;  3FB2 A;  3I0Q A;  3N2G E;  3O48 A;  1NZN A;  3K3Q C;  2JMK A;  2PZI A;  3I9Y A;  3FH5 A;  3VTX A;  4F7A A;  1E8W A;  1HO8 A;  1HTJ F;  5JDM A;  5KJM A;  1IAP A;  4KMC A;  1HZ4 A;  4GML A;  1IHG A;  3RO2 A;  5LBM A;  5H6Q B;  4YFS A;  3ZMV B;  5LCW C;  4AJW A;  5FXZ A;  4Q96 A;  5CA1 E;  2X66 A;  1PY1 A;  2KCK A;  2D2S A;  4WNK A;  4X1K E;  3PE0 A;  3URZ A;  3MZK B;  2YK0 A;  4BY6 A;  4PK5 A;  3JC6 C;  4TUU A;  1PC2 A;  2ODU A;  2WM9 A;  2LAI A;  1OXZ A;  4AKR B;  4Y6W A;  2N1G A;  3CVV A;  5ARG A;  1HH8 A;  4ZI7 E;  1PAQ A;  2VTB B;  4UV9 B;  2WXI A;  4GCN A;  4EXT A;  4ANJ A;  3P8C D;  3N2O A;  3QUJ A;  2DIW A;  3S7B A;  3ONX A;  2OOE A;  2E9X B;  3ML8 A;  4DVD A;  2V4L A;  4KT6 B;  1U4Q A;  2KND A;  3ESL A;  5L3C B;  4U74 A;  2KZT A;  3UUX A;  2OV8 A;  3BQL A;  3ZYK A;  3AAE B;  3S7F A;  3MA9 A;  4Q69 A;  3FUE A;  3EIQ C;  3OXG A;  3BQI A;  3CHP A;  3AS4 A;  2RA1 A;  5CCM A;  4TUY E;  2ZLY A;  4BTB A;  1SZA A;  3L3P A;  1B7T A;  2XTL A;  4FJY A;  1Z0P A;  2G0U A;  4AQF C;  3H3A A;  3Q5W A;  3CK7 A;  4ANV A;  4QFV A;  4ACL A;  1HFA A;  4N2S A;  4I1A A;  2RD0 A;  5JJ7 A;  4I55 E;  4UV8 B;  4H7Y A;  2I59 A;  4JL0 A;  3RRW A;  3P2B A;  3S7J A;  2V7I A;  2NXP A;  2MTQ A;  3TXN A;  1H6K A;  4MAL A;  1BPO A;  4CEM A;  3LBX B;  3LS8 A;  4MKT A;  4KVM A;  4N3C A;  2WXM A;  1D1A A;  2LNI A;  2XHE B;  4O8S A;  4L7T A;  3ONL A;  3P1U A;  4KYO B;  2VJ8 A;  2V26 A;  4UQZ A;  3DTO A;  3RRN B;  2CEA A;  3KAE A;  4PS8 A;  2I1J A;  5A6C A;  4UIG A;  3ANW A;  3UPV A;  3D0T A;  4G23 A;  2VSY A;  1WR6 A;  4UWL A;  4AQG A;  5HXE A;  3APD A;  2C5I T;  1WYC A;  4F1S A;  3O1H A;  2I6H A;  4ANX A;  3QB2 A;  2FEZ A;  3ZN1 B;  1D0Y A;  4GOU A;  3AAI A;  4ILU A;  2JJ9 A;  2UWJ G;  2WAU A;  4PK6 A;  3I0O A;  3IHR A;  2XGS A;  4FU3 A;  3CHQ A;  3PS6 A;  5T4Y A;  3CHM A;  3CKD A;  2LJL A;  2KCV A;  1KLX A;  5JDG A;  3ENE A;  3QC9 A;  3AS8 A;  3MX3 A;  1IZN B;  4ZI2 C;  4E6H A;  2CFZ A;  4HS2 A;  5J08 A;  2RG8 A;  4WND A;  3KV5 A;  1DVP A;  4FJO A;  3EVY A;  2IW5 B;  4JUY A;  4AM9 A;  3NZS A;  4OVV A;  4ATG A;  3O4X E;  5JDF A;  2XCB A;  1UX5 A;  2V7L A;  3CX7 B;  4ANU A;  3LXU X;  3PDY A;  5G05 C;  4UEM A;  3NRY A;  2VL8 A;  2ILR A;  2YQ8 A;  2XAH B;  3CX8 B;  3MV3 B;  5JR9 B;  4FJZ A;  2RP4 A;  2VKJ A;  4HTE A;  1JWG A;  2UY1 A;  4IUL A;  2EHO D;  1E7U A;  3SWH A;  3VTY A;  3W15 B;  5L2L A;  2Y4T A;  3KVA A;  2E0I A;  3APF A;  4B0Z A;  2PBI A;  1US7 B;  4H63 H;  5HXR A;  3AU5 A;  2J08 A;  2CM0 A;  2K24 A;  3AB3 B;  3G2U A;  3PTR B;  4QHO A;  2DCP A;  4CCA A;  5KDM C;  3I5P A;  2HYZ A;  5HXS A;  4DO0 A;  3LJ3 A;  4QKN A;  2W0G A;  2KWH A;  2IAK A;  2VAS A;  1H2T C;  2Y4U A;  4J6I A;  4H9P C;  1OWO A;  3SI5 A;  3Q5X A;  3KV9 A;  4WNF A;  2DCF A;  2K5B B;  2XUE A;  4M1P A;  4L9I A;  5EZY E;  2VSN A;  3FUM A;  3RX6 A;  2Y8D A;  4UWF A;  3D9J A;  5BV0 A;  3ZC0 A;  4IRU A;  3CQC B;  5AIJ A;  3LCA A;  1TJF A;  5FWQ A;  3QWW A;  4PS7 A;  5HWY A;  2XAJ B;  2LHR A;  1IQR A;  5JR9 A;  2WPV A;  4MRU A;  4UI9 J;  2LSU A;  2L3L A;  2E9X C;  3AVS A;  3T5X A;  1L5J A;  4GIW A;  3I1A A;  3LG7 A;  2WXR A;  4KMO A;  4XZ4 A;  3CHR A;  3QJZ A;  3KD7 A;  4CI2 B;  3BQK A;  3CKC A;  4U07 A;  5CCL A;  2GK9 A;  4TV8 E;  2JPF A;  2Y48 B;  2YU1 A;  3VKH A;  2KMF A;  1Z3X A;  3HVE A;  3RYC E;  2FUL A;  5BV1 A;  4K03 A;  3MKR A;  1MND A;  4IE0 A;  3MKQ B;  4PUC A;  1Z6T A;  3EDT B;  2AW6 A;  1ZU2 A;  2PFV A;  2PJQ A;  3AS5 A;  2FF4 A;  3OKQ A;  3LKU A;  1WYB A;  4N3A A;  3U3W A;  1CUN A;  5EX0 A;  2X51 A;  2KZ7 B;  1MNE A;  2W62 A;  4CT4 A;  3FUJ A;  1N52 A;  1H19 A;  3FEY A;  3GZ1 A;  4I6G A;  3UUL A;  1D1B A;  4JLE A;  3FUN A;  3CVR A;  2L9Q A;  3CHS A;  3B7S A;  4DI3 A;  5JRE A;  3QWV A;  3PUA A;  4DLQ A;  2OA5 A;  2JQQ A;  3HKB E;  4P09 A;  3H37 A;  2UY1 B;  4CDR A;  3HA4 A;  5J90 A;  1HF8 A;  1JWF A;  3ZRH A;  5JR9 C;  4AY6 A;  2X38 A;  3BG1 B;  3RKV A;  5LG4 A;  3R7Q A;  4Y6C A;  3JQ0 A;  2KC7 A;  4U72 A;  4PS3 A;  3T8M A;  4BT8 A;  4J2C A;  5KJN A;  1HXI A;  5CMY A;  3FU3 A;  4JW1 A;  3Q15 A;  2KM4 A;  1WLX A;  5EX3 A;  2X9H A;  3TXM A;  5ARF A;  4DI4 A;  5HAX A;  2KCL A;  3ETV A;  1IYG A;  5LCW J;  5DQW A;  1WAO 1;  3BK9 A;  2JMH A;  4U8H A;  4NUV A;  4G26 A;  4I1O B;  3D9P A;  2VKD A;  3U64 A;  3HIZ A;  1MIW A;  2XPY A;  5G04 J;  4EZL A;  3B7T A;  3FTV A;  3AA1 B;  3V5U A;  4G63 A;  3N9N A;  2X0L B;  2LSK A;  4IIJ E;  5ENN A;  2NW9 A;  3LFM A;  1N54 A;  5DBK A;  4FC8 A;  2PQR A;  4HFG A;  4I9C A;  5IYZ E;  4JC8 A;  4AXP A;  3ONK A;  5LJN A;  1OWM A;  3KV6 A;  4GA2 A;  4RSY A;  5EK3 A;  3FDH A;  3FHN A;  2VYI A;  3CIA A;  4EYY R;  3EDV A;  4EOZ B;  5LCY A;  3N9P A;  2LEH A;  5G05 J;  3RC3 A;  2NTY A;  4GU5 A;  3P7I A;  3SFZ A;  3FBL A;  1FMV A;  2MOW A;  3RYF E;  4CXW A;  4LCT A;  3CGH A;  3CK9 A;  1HS7 A;  3IF8 B;  3ZW3 A;  1HX8 A;  2GRM A;  3FU5 A;  1U3C A;  4EZH A;  4UI9 K;  4MFR A;  2PG8 A;  3HDX A;  5BPP A;  4IST A;  3CHO A;  3NF1 A;  2IC6 A;  1LVK A;  3UT8 A;  2EHO B;  1A17 A;  1TEZ A;  3NZQ A;  4IHJ E;  2MHK A;  3PNL B;  4JEU A;  2K48 A;  4WAF A;  2R5S A;  2C0S A;  3MXZ A;  4X1Y E;  4BAY B;  2N9D A;  2A3D A;  3U4T A;  3U9W A;  4BJN A;  5CHE E;  2XQ0 A;  5AYW D;  4IN3 B;  5JDN A;  3FTU A;  1HG5 A;  4O2B E;  2FI7 A;  3SD5 A;  2V8S E;  3OTN A;  4KBM B;  3E4B A;  2V5F A;  3JC6 D;  2HPL A;  2KLQ A;  5DQV A;  4CDN A;  2LM9 A;  2WQ7 A;  1QQE A;  3RYH E;  3IBE A;  2HM8 A;  2CWO A;  5HI7 A;  2C5K T;  3IKO B;  1E1H B;  5F8P A;  4C0M A;  3RRM B;  5CA0 E;  4KP3 C;  4MLP A;  2D0U A;  3G2V A;  4A56 A;  3CVW A;  5LGN B;  3EDU A;  5FJY A;  3UMV A;  3ZVV A;  5BNW A;  3HKC E;  5JVD E;  3AA7 B;  5C8Y E;  4XI9 A;  4I50 E;  1INZ A;  4CDM A;  4GZD A;  1FVF A;  5EK4 A;  4JVS A;  2X68 A;  3UTK A;  4TZ4 C;  5L3D B;  2HH7 A;  5EK2 A;  2V7M A;  1ELK A;  3AA6 B;  4CT0 A;  5BUZ A;  2CLY B;  4EYU A;  3CPZ A;  2HR2 A;  3QAR A;  2LSV A;  2H7V C;  2V7K A;  4CI1 B;  3R9A B;  2A72 A;  4IE7 A;  2VSO E;  3N9O A;  4EBA G;  3D9L A;  4EQF A;  3GZS A;  3G2T A;  4G25 A;  3N71 A;  3UX4 A;  1GW6 A;  3JYS A;  3SBT B;  3OXF A;  2KZT B;  2EHO C;  3RRU A;  2M63 A;  4QWN B;  2M67 A;  4JA9 A;  4LUN U;  4O4L E;  3LY9 A;  2OND A;  3C64 A;  2BDE A;  3CKB A;  4ADZ A;  3VKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...