2WMOA

Structure of the complex between dock9 and cdc42.
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
423
structure length
403
Chain Sequence
STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEAHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVAGPLAYARAFLDDPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 149
structure length 403
sequence length 423
ec nomenclature
pdb deposition date 2009-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wmoA03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wmoA01
3B13A 2WM9A 2WMNA 2YINA 3VHLA 2WMOA
chains in the Genus database with same CATH superfamily
2GGFA 4HFDA 4KYOB 5E75A 4JL0A 5B3SE 3ZEFA 3CVVA 2V5CA 4M7CA 3UQ3A 2WCAA 2VVSA 4IE6A 4F53A 2HH7A 3FUEA 3ML9A 4J0UA 2DCFA 3I0QA 5G05J 3N5LA 2VQ2A 4ZI2D 4YDYA 4ASKA 1LVKA 1OCOE 3RIAA 5H7PA 1L5JA 2KBXA 2DZOA 3BQKA 2GW1A 4U63A 4JI4T 2NW7A 5ITZF 5FQ4A 5A23A 3PUZF 4YVOA 1MIYA 2I1KA 3EHZA 2XM1A 4YTNA 2UXCT 2KCLA 2JABA 5CEAA 4JI5T 4ZI3C 1D0YA 5M72A 3S7BA 1JUQA 3H3MA 4HNAD 4OVVA 1OWNA 4GK5E 2K3WA 4O60A 5AARA 2XGMA 4U07A 4HOQA 3BG1B 3V31A 4JEUB 4F8HA 2WXLA 4GPKA 3RIUA 2FJDA 4Z91A 3NZUA 5CERB 2A3DA 2WXJA 2P9SG 4BFRA 1PC2A 4F6RC 2W63A 5ENTD 1S94A 1SE7A 4H9OC 3UT8A 4NURA 3N2GE 4X20E 4BSZB 2LXLA 3KVAA 3UPVA 4KVOA 1G3NB 4E6HA 2NYJA 4XX5A 1E8YA 2EHOC 4WNGA 4HLEA 3J5PA 4QQIA 3GYZA 4H9PC 5A1LA 3TG5A 3ZLIA 2OV8A 4CXXA 3ZYMA 1IKND 1NL4A 1Z0PA 3B7TA 3S7FA 2E2AA 4DNDA 5FQ7A 2XJ7A 4GMLA 4JI3T 3IHVA 1LTXA 4WAFA 3KVBA 5LYJE 4GYOA 2RPAA 1FVFA 3LBXA 3ZPOA 1MYOA 5AQIB 4BT8A 2YK0A 2W2UA 3JAFA 1EDUA 3V2XA 5CGMA 2BBHA 3HKEE 3ZYLA 4YNDA 3SOLA 5LCWC 3FUHA 3CPZA 4CXWA 1SA0E 4C90A 1OEDC 5HCMA 5EK4A 2H88A 3UM1A 4KMCA 4M3OA 4BEPA 2Y6XA 4TXQA 5KNGA 4ZHBA 2LSGA 2ETCA 5LXTE 1IBLT 2LT3A 2V5QC 2H89A 2DNXA 1FT2A 2C5KT 4WBNE 1JCRA 2WXKA 1MQSA 1BPOA 4B6XA 2HPJA 4K5AB 4JC8A 1IQRA 4KP3C 3VR8A 4ILAA 2A4ZA 3QAQA 2VKHA 3CQXC 4XZ4A 3FTWA 1X81A 3QARA 4J7WA 4MRUA 2B76A 1CHUA 3HRAA 5AAOA 4OK0A 3ZYQA 4EAHA 2ZXWE 4IE7A 1D1BA 5DJQC 5M4YA 2V7IA 5KDMC 3DXKG 2UUCT 1ZV4X 2R5SA 1OXJA 3OXFA 1KNPA 3UXGA 2NTYA 1N95A 2C0LA 4Q69A 2XGOA 2UY1B 5ENRD 3MK7C 1TNUA 3AU4A 3HXDA 1TR4A 2CM0A 4UQZA 3MKDA 2XQAA 3RYCE 2Y48B 5HEHA 4E7ZA 5AQKB 4J8DA 2JMKA 3PZ3A 4EPZA 2E5VA 3APCA 4X8QA 3QC9A 3APFA 3DRAA 2VYIA 3ZN0B 3OTOT 1UUSA 1J5ET 4JI6T 2VGXA 2FULA 4B94A 3FTSA 5JDNA 5LB7B 3FBLA 4UWLA 3UKUG 2R05A 3J9X1 3PEVB 4KXKB 4XE0A 3RO3A 4EQFA 1FT1A 1FEWA 4COFA 1Z6TA 4HRMB 1WLXA 3LY8A 4Z68A 2HPLA 2EQXA 2VJ8A 5J2UE 4IULA 4GZ6A 4DJAA 3C5RA 1IAPA 4HWFA 4K0KT 5AQRB 4HRLA 3NQPA 4DBQA 2WAUA 4H9NC 2Y1LE 5JJTA 2I1JA 2VSXE 2LRKA 4B93B 5J1GA 5KBAA 1DVPA 4Z8XA 3U78A 5AQFB 1KEYA 3UU8A 4XI0A 5FY0A 4LF8T 2J4DA 4JZYA 5CMWA 3M3ZB 2J62A 4ANXA 4AQFC 2XAFB 5JDLA 3ZHEB 1WRDA 3UUXB 3AS4A 3DSTA 2PFVA 3I5PA 3N2OA 2MYSA 4UWGA 2W67A 2VK9A 4PS8A 2LKHA 1SUMB 3ZC0A 4U2YA 4FHKA 5LFAA 2E0IA 3A5XA 3FUFA 2I6HA 3AE1A 2P9UG 3AA1B 4G25A 1SA5A 5AQOB 1OCRE 1T72A 2X9WA 2G0UA 3KV5A 4EXTA 4HRNA 3UTKA 3P4WA 5JH7E 3R7QA 1NWMX 2N1GA 5KJKA 4F6RD 2P9IG 2JLBA 3MYVA 2BS4A 3SFDA 1EF1C 3ONLA 4NIQA 2NW8A 4JW1A 1B7TA 3QDNA 3SO8A 5BXUA 2DBAA 3RC3A 3EABA 1BR4A 4YFSA 2ZM8A 4AISA 3RRUA 3P1UA 2EHOD 4JD2G 3RC8A 2X6HA 3DP7A 3LEWA 4IT4A 3D0TA 4P29A 3FDHA 4IDPA 4GYWA 3T5VA 2KWIB 3ZC1A 2WMNA 5IWAT 3UQ4A 3FULA 2CXFA 2JMHA 2X67A 5L4EA 5CB4E 3FEYA 3FH5A 5EIBE 2RFAA 3HDXA 4O1OA 4B3TT 4GZ3A 3PNLB 2NP9A 2XS1A 3SFZA 4U0SA 5HWXA 4WWPA 1OWMA 2CXLA 4N2SA 4UVBB 2ZISA 3AE8A 5JREA 4Q94A 3TWUA 3U9WA 4C0EA 4EZ4A 2J07A 1LKXA 4DX5D 4DR1T 2FF4A 2V4HC 2WBLA 1HO8A 1O1RA 1U3CA 5G55A 4EZLA 4AEZC 3E34A 4O2BE 5FZQA 1OWAA 1KFYA 3ESLA 3P8CD 3R9AB 4U2ZA 3L16A 3E22E 3ZEFB 3BK9A 3O9XA 3PZ2A 2YEVC 3MKQA 3ETVA 1D1CA 4KBMB 1ZB1A 5BXOA 4DR4T 4MFRA 3UU6A 2R2LA 2RG8A 5H6RB 2OOEA 1YD8G 2A2FX 4LMLA 4G8LA 3UT7A 4UV9B 4GCNA 2XM2A 1SZ9A 2P2CP 2XASB 3FTYA 1IQUA 5LHGB 3CIRA 5JR9B 3RKOA 3LK2B 4AXPA 4TWFA 3ZMTB 1IBKT 4HN9A 2XCCA 1SVXA 1HNXT 4UI9J 1TNBA 4I1MA 4JHKA 2XQ7A 3ZU7B 5FXXA 3DSWA 4LF7T 4TNVA 3HYMB 3CVWA 3OBVE 4AQGA 3JADA 4CI3B 2FO7A 3AE6A 4JI7T 3SQVA 1YQ3A 2M6BA 2CMRA 4B3RT 3ZXSA 3SS1A 2CRBA 2WQHA 3UFEA 5A7DB 5JDGA 1HX8A 4FI5A 3G2TA 2KWHA 3RYFE 3PUWF 2XAJB 1KZOA 2JQ9A 4ABNA 3QOFA 4HFVA 4B8AA 2BF0X 1IHBA 1YCSB 3AA7B 5KMGP 2BBJA 4I17A 2NR4A 2YDQA 3CX8B 3RQUA 2IW5B 2Y0BG 3KD7A 1KNRA 2UXBT 4EHMA 3EDTB 2JPFA 3ZIMA 2UXDT 4X65T 3RO2A 2I59A 2NTXA 2KZ7B 4N3AA 4TWHA 3FZKB 1OT8A 2HM8A 1Z5SC 2OEVA 4OVUA 1P5QA 5D0OD 3SI5A 4YLHA 4IDOA 3FU6A 3CWZB 3HIZA 4WNEA 4N78D 3ZMZB 2WXNA 4APFA 2KCKA 5CCLA 4GYYA 2WDRA 1U2VG 2DLRA 3PRZA 4LF5T 4RLYA 2Z6EA 2UUBT 1NFIE 1X9BA 2WQYA 3L09A 4KT6B 5EIDA 1N9AA 2X6JA 2UWJG 3ISMC 3I9YA 3F31A 3FXEB 4DV3T 2WSSV 2LNIA 5D0QD 3OXGA 3RJVA 3JAEA 4DR5T 2WZIA 4L2YA 4AVXA 1L0VA 4TUYE 4NUUA 3Q75A 4GTQA 2WZHA 3FUIA 3TWWA 4DX1A 5CBNA 3Q7AA 2SPCA 5FQ6A 1JNZA 2GRLA 3S4UA 2QC9A 3TWTA 4O4JE 1MMGA 4LF6T 2PM6A 5ENNA 2EIJE 4DUIA 1HTJF 2NOXA 3CQCB 1H2TC 2N2NA 5KX5E 2AVPA 5L3DB 4YDOA 3BUAA 2ZGGA 4BX8A 1U5PA 3C4XA 1D9SA 2PQNA 3LSVA 2WMOA 2FBNA 4L7TA 4LNUD 4L2LA 3O1HA 2F37A 2VSOE 1M7KA 1E96B 4L1BA 2J4GA 2K9AA 1YXRA 4I9EA 4Z90A 3RI5A 3C98B 2RKKA 2BDEA 4OHFA 2L6JA 1N4PA 2XY8B 5JRCA 1H2UA 1O1SA 5GONE 3O1IA 4FC8A 3FH8A 1E7PA 3RRMB 2EILE 3ZW3A 4ANJA 3QJZA 4WBOA 4IE0A 1JCSA 3KBTA 4YT0A 2YDSA 3LVRE 4IN3B 3ENEA 3EAMA 3B95A 3E33A 3PUXF 3TWRA 4FLBA 3DTOA 3ZKRA 3AS8A 4HORA 3C4ZA 5LP0A 2WP9A 3EJNA 4LMJA 4IIJE 2ZIRA 5KJNA 3UU3A 3ZCIA 2BKNA 3DWLG 1NEKA 3NRXA 2QVAA 2NWBA 3UQ7A 2B6CA 2LO6A 4AM9A 1EPUA 1K3ZD 3E4BA 3PEUB 4MS6A 2IOLA 3PUVF 4PK5A 2XS8A 3C3QA 4RG9A 3RYHE 2V6YA 5EN5D 3E30A 3L13A 5L3GB 3DEPA 3AAIA 4PH4B 3RPUA 5CA1E 1LD7A 3JCKC 5EYPF 3EI0A 1WM5A 2V1DB 3FTVA 3FWVA 1NENA 1RZ4A 3SFEA 1I6ZA 3KFWX 1WR0A 3NAWA 3FUMA 2E8IA 2WU5A 4U7YA 3UM0A 3BQLA 4HXIA 4U95D 4HFCA 3P4QA 2W0GA 1NI1A 4ZZCA 1UX4A 3N9LA 1ZU2A 4AKGA 2B0OE 2XZEA 1IXVA 3T1HT 2MOZA 3OXLA 4ME2A 2CLYB 1TN6A 2YHEA 2WVIA 1QBQA 4N3BA 4GTOA 3F6QA 2PG8A 4JEHB 4TWDA 1PAQA 3NVOA 1TN7A 3VTYA 4P0BA 3CEQA 3PUJA 4LF9T 3D9HA 3QOUA 4CYMD 4UQXA 1TNOA 5FNVE 4JB8P 1KK7A 4ILCA 4I1AA 1JPLA 2QY7A 2GRQB 2KC7A 1HS6A 2CBIA 4IL9A 4O4HE 4NRHB 4ZHQE 3RH3A 3BU8A 2PBIA 3GZ1A 1U3DA 3PZ4A 4AQYT 4G11A 2WDQA 3ONXA 2LEHA 5LP6E 5ABFA 3TL5A 2ZLYA 1N11A 5CMYA 1TNYA 2W00A 4CI1B 4X1KE 4OFZA 1TJFA 3ANWA 3TLSA 2WQ7A 4CN1A 3AG2E 3R84B 4X62T 2R59A 2V6XA 4LF4T 4NQ0A 3AAAC 2V8SE 2OA5A 5F3JA 2XRZA 3SHFA 3VLDA 1SZAA 3HKCE 4IGUA 4TUUA 3Q49B 4DBRA 5DABA 4EIWA 3VR9A 2X6IA 5HEGA 2W4XA 1ELKA 4X5TA 2WXQA 3ZFWA 2CWYA 2VB6A 5JDQA 2LLYA 5FXWA 4IREA 5T3RA 5CEDB 4EZJA 4ANUA 2IY0C 3NKZA 2MBGA 3ZT6A 1E7VA 2EIKE 2J9QA 2R6GF 3T8MA 5AENA 3DSXA 4C48B 5FMNA 4U8HA 3LYAA 2KATA 4GB9A 1LRZA 2P9BA 3LVQE 1K1AA 2J8SD 3FTUA 2VKJA 2KXPB 2VL8A 2FEZA 4YDWA 4GTPA 1UK5A 3D9LA 5AQMB 3URZA 4LFCT 1MMAA 2H7OA 3ZSTA 2YOEA 4TNWA 1DNPA 1TYQG 3RRCA 4ZOLE 2WXPA 2UXNB 4OX9T 3Q79A 2PL2A 3DXMG 4HI8A 3P2BA 4QXHB 2AE9A 1IZNB 2P9LG 2OVBA 2PTFA 3LK3B 3L54A 3TG4A 4KUMB 1KLXA 3N9OA 2XQ5A 2H6HA 3NWIA 1PY1A 3RIFA 1Z8UA 2MRIA 4HKAA 3IXEA 3RRWA 3U4TA 3ZT7A 1E8ZA 4KMOA 4YDEA 3D9OA 3NBNB 3ABME 4K5CA 3RGLA 4OYSA 3MZKB 1GW6A 2AXVA 2HHHT 1Q2ZA 5L2LA 1EZ3A 4DV5T 2X6KA 1OUVA 1MMNA 3MX3A 1RW2A 3ZGQA 5LMUT 3K3OA 5FTPA 2W66A 3HA4A 4YTMA 4P0AA 1MMDA 5HCJA 3NF1A 4XKCA 4DV0T 3LPZA 1YKHB 4ILGA 2BG9E 1YQ4A 5KNHD 4BY6A 1YMPA 4I2WA 4ACKA 5C2YA 3FP3A 5ENQD 1QSDA 1NP7A 1I94T 3TLTA 2YU1A 1MHQA 2J4BA 5C1DA 4CGVA 2XPKA 5J0ZA 4JHRA 4CXYA 2ZM6T 4I6JA 2X0HA 3RKVA 3SRZA 3Q7FA 2XHEB 3UX4A 3S7JA 1XWMA 1ZOYA 4RG6A 3UU5A 3CR3A 1EYHA 2Q9QB 4RSYA 3ASFA 1XMOT 4DUZT 1U4QA 5T8IA 3HI2A 2IUBA 4QHOA 5JMND 4G23A 2HYZA 4BX9A 4FP7A 1WY6A 3PVLA 3PU3A 2AXZA 1R8IA 4ZI7E 2KXPC 3TGOA 4FLHA 3VRAA 1W9RA 3UU4A 2GK9A 2MYOA 3HR0A 4I0UA 3SZ7A 4FADA 3UULA 2XSAA 1UN8A 2C5IT 3DSVA 2VTBA 3O4XE 2DVWA 4DX6D 4DX7D 4LMKA 3E08A 2V5FA 3C3RA 1MX4A 4GAAA 5IUXA 4BSXA 3JYSA 3FZHB 2XGSA 2BG9B 4O1PA 5FXZA 3PH0C 3I0OA 4YVQC 2CBJA 2IIUA 1CUNA 2JQHA 3AE2A 2ETAA 2CHNA 2L0TB 5AQ7A 4AXHA 4P09A 1S64A 3KEZA 3L9TA 2CPTA 5A6CA 4LCTA 2L6BA 4XZCA 3Q9DA 2XENA 2CFZA 2IO3C 4HWHA 3B7RL 5AQTB 1BD8A 1HNZT 1MJ0A 4G2VA 2Y8DA 1YKEB 4PJJA 2A5UA 4JA9A 2VGEA 3I4RB 4J8EA 1JWGA 2XPIA 2QYUA 2KT9A 4F7AA 2D9DA 4I1OB 2BVLA 2H6GA 3LJ3A 4QH5A 4LG6A 2RP4A 1YW0A 2XQYA 1N0QA 3JQ0A 4HFIA 3GN5A 4O6FA 5AQGB 4GPMA 2WXMA 5G04C 4E85A 4M1PA 1B89A 3ZMVB 1MZCA 4EV6A 3FB2A 1SA4A 3T5XA 2IOSA 5L3CB 2LJLA 3OJAA 2LAHA 4I9CA 3CKDA 2P9PG 4DV1T 3QB2A 3CHRA 3NZQA 4HGAA 4WUYA 3CLJA 4U74A 3Q9NC 1N4RA 3EDVA 5L3BB 3CHPA 1G8XA 2PQRA 4CDRA 3N9MA 2XCBA 2Q9QC 5B1AE 3AEDA 3AXJA 3K8PC 3AVSA 4AY5A 4IE5A 5FYMA 4A1GA 3IA3A 4G24A 4U3CA 1Z3XA 2PM7A 3H37A 3ZXPA 3FZLB 2QRXA 2QFCA 1A5EA 3I9WA 1N36T 4I43B 3SFXA 5J90A 1G73A 4TZ4C 4YY3T 5HXCA 4NXMT 1MIWA 3S7DA 1DC2A 2E5LT 2HN2A 3I1AA 3VRBA 4UIGA 4F1PA 2VURA 3Q5MA 3VHLA 1VCTA 1K8KG 3RRNB 3OKQA 1HFAA 4GTSA 1N34T 1QYMA 3I4GA 5FIOA 4KX6A 3AJIA 2W61A 2BG9C 5E0OA 4QXBB 3Q5WA 3EHRA 3BEEA 4U04A 3L39A 3QWWA 2F8XK 3EU5A 4V1Av 2FUPA 4HS2A 1WR6A 2KZTB 4A98A 4H9SE 3GW4A 3AEEA 4Y6CA 1KZPA 3Q9UC 4EECA 3TXMA 3CSTA 2XQ9A 4G2AA 4TV8E 3ZMUB 3SWHA 1N4QA 1FMVA 5LA6E 5JHAA 4PAGA 1S35A 4X64T 3C4WA 2GRMA 2PNNA 3D9MA 3EDUA 3CVYA 2H6IA 5E76A 1INZA 4LNGA 4PW8A 5J2TE 3EUVA 3PZDA 2RA1A 3KBUA 2BZBA 4LFBT 2EIME 2J09A 1MNEA 4HB5A 3CK7A 1WCRA 4FULA 2EHOA 4AKLA 2B1EA 2IFUA 3AS5A 3N71A 2DL1A 2KCVA 4UF0A 4DV4T 2LUHA 5LCWJ 1MNDA 2LSYA 3F2EA 3J5QB 3IBEA 4U33A 3QK0A 4UWFA 4G8KA 3GZ2A 5L4HA 3CKCA 4HWCA 1H6PA 2WWVA 2VKOA 3VLEA 4GA0A 2FI7A 3FHEA 3IHRA 4EEDA 1ZKEA 4U8VD 3T1YT 5JDFA 5C3JA 5KWDA 3A8YC 4U7IA 3BQIA 2DYSE 3CHQA 4GYSA 1OEDA 4ZS2A 2I2OA 3HVEB 2E9XB 3LKUA 4FJZA 1UN9A 4U0UA 4JI0T 5HXRA 4HOUA 2V7JA 2RD0A 3FU5A 3EHQA 3LDQB 5LG4A 2LM9A 4LFAT 4GYRA 4EYYR 5LJMA 2I9CA 3EHMA 3L6AA 1H19A 3LFMA 2X3MA 4GMJA 4AKHA 2LRLA 4KHZF 3UFGA 3NZSA 3LXUX 4TXPA 4AY6A 4GA2A 3FU3A 1BU9A 5JTGA 5LGTB 2WB2A 1IJ6A 3HKDE 5EZYE 4GTMA 4HOTA 3Q4AB 5ENPD 4YSXA 2OV9A 3U3IA 4DUYT 4JEUA 2R02A 1E8XA 4OAUC 4K03A 2RFMA 4G1TA 2X0LB 4A3TA 3ASGA 3UTMA 4CGWA 1E2AA 3Q5DA 2IC9A 3PUGA 1JCQA 3Q47B 4IYPA 5L3FB 4FU3A 4XEIG 5FQ8A 2CFUA 4HI9A 4TX5A 2OEWA 3SD5A 4KHPT 4UVCB 5FXVA 4XI9A 3MA5A 4W9RA 4I4TE 4YHJA 4ZS3A 2BKOA 3ASOE 4N5CA 5JDHA 4TV3A 1JNRA 4NPPA 4HFEA 3ASHA 2BKGA 3CV0A 3AE3A 3PU8A 3MJXA 5BV1A 2H7VC 3AB3B 2Q9QD 3FY4A 5FVLA 3PUYF 4GTVA 4JA7A 2MPKA 3PUSA 3N9QA 1XGWA 2WXRA 2M63A 3P7IA 2MOWA 5CRUA 1BI8B 5AN8A 3ESKA 3LBXB 4TRQA 5DIZA 4HFHA 3CHMA 3L3PA 5JJ6A 2E9XC 4JXTA 4Y6WA 3ZNGA 2JQQA 3NOCD 4DV2T 2JEKA 5H6QB 5ETWA 1N52A 4J2CA 3G06A 3IBPA 2XZDG 5CBOA 5C8YE 3IV0A 5HI7A 3FFLA 3CVXA 3LG7A 4QFVA 3M65A 4AQFA 4DI3A 5CJ5A 5AYWD 1W09A 5JJ7A 3CX7B 1D0XA 2WXFA 3ZKJA 5FT9A 3MXZA 5ENOD 2H3RA 4BESA 5JR9C 1HNWT 2Y3AA 4HOSA 5IY5E 3HG0D 5JQGE 4CEMA 1ELWA 4I50E 1AP7A 3B13A 2XQ8A 4JUYA 3TWSA 4OAVB 3N9PA 1XNRT 3C64A 2DWKA 3RHWA 3DSSA 4BTBA 3FZFB 4UV8B 1T7SA 4ILIA 1W0BA 3QUJA 2YHCA 2CCQA 5G05C 4EZKA 3AAEB 2XPZA 3NBXX 4XKBA 2UY1A 1N54A 3RIUC 5EK3A 1OWOA 3PURA 1ZHCA 4HWDA 3RYIE 3TAXA 3IHYA 5CFBA 3GN5B 2Y4UA 3ASDA 3WAKA 3QNKA 4TUMA 2DIWA 2OLTA 3K1SA 2ONDA 3T9KA 2VSNA 5HYAA 1FIOA 4UWHA 5JA4D 1LVFA 3GWHA 1KT0A 4A55A 2ZM0A 1NA3A 1GQEA 1BR1A 1UG3A 2Q7FA 3UINC 5LMNT 2KSRA 2X9XA 2LAIA 5KJMA 4CT0A 2IEJA 4O8SA 1UCUA 4GZ5A 1WYCA 4NUVA 1LF8A 1AJ3A 4LERA 5LJNA 2XAQB 2ETBA 3MKRA 1XDPA 4J8FA 3R6NA 5KCMA 2FO1E 3JCFA 2HN1A 3AE9A 3LK42 2IJGX 3B57A 2VGXB 4ERRA 4LSZE 4PS3A 5F5WA 1X79A 1YYHA 4B3MT 3EVYA 1FJGT 1N0RA 2CG3A 2CHXA 4MLPA 4UVAB 4OYJA 3PUQA 4HTEA 1SQMA 1FCHA 4JV5T 2QGSA 3PV0F 2LXMA 2LKGA 4I55E 5KXJA 5LNKA 3L17A 3X2QE 2CG2A 5AQPB 5D66A 1H7CA 2KLQA 3X1DA 3P4RA 4MKTA 4ILUA 4NIKA 3PUKA 4U72A 1V54E 3ZHEA 1HG5A 4U96D 2KM4A 3UUXA 1N4SA 4L5GA 3K3QC 2UUAT 4N39A 3JUIA 2LHRA 5EILA 3Q5EA 3ML8A 4DMWA 3BQOA 4I2ZA 2WS3A 2MAWA 3CMLA 4PUCA 4U8YD 3VKGA 1H6OA 1YA0A 5LHIB 2LSJA 5BUZA 2LSUA 4GK0E 4OYKA 4EZHA 1BR0A 2R03A 3MEKA 3MCXA 3NOGD 3E37A 3O4ZA 4C0MA 4PK6A 4ISSA 1OEDE 2WDVA 2IC6A 1VRBA 4LUNU 2K5BB 3AA6B 2E2EA 2A5EA 1IBMT 4A97A 1WG0A 4QX8B 3ZN1B 5LGUB 4BJNA 2BS3A 2CHZA 2OVFA 3EU9A 5CCMA 2CA5A 2Y4TA 3VTXA 4DVDA 3DJBA 2HO1A 5LBQB 5BPPA 3DBSA 1OCZE 4J6IA 2FJBA 2XEHA 3ONJA 2NXPA 2IQCA 4GA1A 4GTTA 2YKSA 3ULEG 1TN8A 5FZRA 3HHMA 2L9QA 2LE8A 5TAOA 2YNQA 4K0RA 3UI2A 4CDMA 5LX8A 4NXNT 4C9BB 2HE0A 1OXZA 3CVNA 3UMVA 2BKPA 3KEAA 3CQGB 4LNBA 5HKPA 2AWIA 3TKLB 2E9XD 5FL0A 3TLUA 2VGYA 5AQNB 4EBAA 3B7BA 4DR6T 4C91A 2VASA 4EGWA 4IE4A 1DU2A 1OEDB 2L3LA 1HE8A 3RU0A 3PJAJ 2CLYC 4DRXE 3AE4A 3KV6A 3C51A 5EX3A 3MKQB 1LD8A 1HU3A 4ACLA 5J08A 5JR9A 4CZ2D 4UXNB 1ZEEA 4YJ2E 3O1JA 2ZU6B 4GKKT 2ILRA 3PNTB 4KBQA 2WB5A 3B5MA 3TWQA 3ZYKA 5HXSA 2X38A 3OYXA 5HXEA 1NZNA 2F0YA 3ABKE 3AEAA 4L0RA 3JQ1A 4A56A 4UWKA 3G2WA 2JRKA 4AJWA 3AG1E 3N2KE 4AIUA 3PJAA 4D10C 2NW9A 2C0SA 4WWNA 3QB5K 3LS8A 4BWRA 3ZSSA 3ZJ1A 3QK6A 3SGHA 3QWPA 4N5QA 3HL6A 3EHNA 5BR8T 4H7YA 3AECA 2ODVA 3AEGA 2CHOA 4QX7B 3AG4E 4ILHB 3JC6C 5JHBA 3AG3E 2WXGA 3ONLC 4CQIA 3Q15A 3W9GA 4UR9A 3EIJA 2OCCE 4FJOA 4X66T 3QKYA 1W0AA 4LRZA 2D2SA 3BG0B 1VDYA 3FUDA 4DMVA 2X9YA 3IEEA 3ULYA 3GA8A 3FUJA 4YXDA 1HH8A 1Z3YA 4O4IE 3LDZA 4JI8T 1D1AA 3CK6A 5ADXL 2XSBA 2YDRA 2PJQA 1OY3D 3KAEA 2A9UA 1A17A 4GCOA 5KJLA 5AQAA 2R17C 1UOHA 4MHCA 3PE4A 2IF4A 1T8BA 4ANVA 2BEDA 4I6EA 2CEAA 2V8SV 3CHSA 1T98A 4MALA 3W9FA 4UELA 5BT1A 3JXJA 4H63H 2V7LA 4BETA 3CK8A 4GKJT 4PJLA 5HXHA 3UM3A 4H63V 4BTAA 3KV9A 3QB5A 2QA7A 5DBKA 2P9NG 2AJAA 2DZNA 2L9BA 3TLVA 1H2VC 4U0ZA 3RQWA 4H7XA 4PJNA 3PDNA 5EK2A 4DPRA 4L9IA 3CHOA 2XQ3A 3H3AA 2F4VT 3C98A 3PE0A 3GMIA 1DCEA 1FPPA 3AE7A 4HQDA 1VCSA 1ZP0A 2LM2A 4L23A 5EDSA 2C5JA 2N9DA 3FUNA 3FEXA 3JUEA 4TXRA 4UUCA 4JYAT 3AEBA 2ES0A 4KVMA 2A72A 4WZXA 3KV4A 3G2VA 2WQ6A 4HBDA 4U31A 4JHJA 5ARFA 5JRCB 3FTZA 4TV9E 4DR7T 2QZAA 3CVLA 3TWXA 2DI4A 2IAKA 4DR3T 4N3CA 1VOMA 4IL4A 3HKBE 4O4LE 1KT1A 5LCYA 1OWLA 4V3IA 2XQ4A 3CX6B 5AJDA 1FVHA 2GRRB 1N33T 1QQEA 1TEZA 3D3MA 4WW0A 4DO0A 3WAJA 3KSLA 1HX1B 2X66A 5FL1A 1NA0A 2I0MA 3UIPC 4UI9C 2XAHB 3LJCA 1KF6A 5AJLA 1HS7A 5CECB 3E0ZA 3QWVA 1HR0T 5FINA 4A63B 2L0IA 2CXDA 4J8SA 4APOA 1UURA 5BMVE 2IONA 2V6YB 4AV7A 4MBQA 3UUBA 1Y6IA 2VSYA 2X51A 4B89A 4A5XA 3F57A 3ZUVB 3RF1A 3IKOB 2P58C 4HEAA 2JIWA 3WG7E 3D9JA 5AQ9A 5FZSA 3AEFA 3P50A 3FXDB 4BA9A 3TWVA 3MJWA 3VU7H 3V79K 2LSIA 3PZ1A 2WWUA 1AWCB 4JVSA 2GRPB 2IO2C 2BTDA 3L82A 4I6GA 1Y8MA 4ZFHA 4JEHA 5AQVB 3FUKA 4FHJA 1BI7B 3NRYA 3UUNA 4H9QC 1XMQT 3AU5A 3C72A 4YJ3E 2YQ8A 3ASNE 3AA0B 3ETUA 3LY7A 4URKA 5LGNB 2VWAA 1D8EA 3V2OA 3ZCJA 4CRWA 2D0TA 3KDSE 3DPDA 3PS6A 2LHNA 4XAXB 2LOPA 2P9KG 5HAXA 2W62A 5BW8C 3APDA 1D0ZA 1US7B 4ZI3D 2DYRE 2XTLA 1HZ4A 3DPYA 5JVDE 3HXBA 2KNDA 1SW6A 2XUEA 3PTRB 3SBTB 3UKRG 4YSZA 3RK6A 5DQVA 4DI4A 1WDYA 1M62A 4IDQA 3JXIA 4ILBA 5ABFB 3U3WA 3R7RA 5HEUA 3ANWB 3FU0A 3JC6D 2DWGA 2DCPA 1TJCA 4F1SA 5AQSB 3A7MA 2NC9A 2XPYA 1HXIA 4GOUA 3Q73A 5BV0A 3UT4A 5HQ8A 2YU2A 1OCCE 4JI2T 4WWOA 5EX0A 4FA6A 4HVBA 2KINB 1H6KA 4QWNB 4L9PA 2V4LA 4MLKA 3ABVA 3UT5E 4GMRA 1BLXB 1MX2A 2MHKA 5IHYA 3ZT5A 5C2TA 5LG3A 3R9MA 1QNFA 2BS2A 2NSZA 5CHEE 3ZRHA 2WY2A 3OTNA 3I3NA 2AXUA 4K5BA 2V7MA 4B0ZA 2JJ9A 3SFYA 4RQIA 2WPVA 2ZM2A 2X9HA 4AI6A 1UGOA 4LEUA 4DX2A 1IJ5A 2Y69E 2VVNA 3PE3A 2WU2A 3ONKA 4JBWF 3E32A 4G26A 3J7Yq 4BT9A 1X5BA 3MV2B 2ACXA 4QXCB 4NACA 4PFPA 5ARGA 3WXXA 4UI9K 5AFUL 4IRUA 5HWYA 4IHJE 4J8YA 5EKQD 5G04J 1HCIA 4ADZA 4YSYA 4P1NA 2M6IA 4DK5A 3MZLB 4CT4A 1N94A 2YINA 4EEBA 2GRNB 5HS0A 2BUGA 3SNXA 2V7KA 2QYJA 4KZCA 1OWPA 1J1JA 2FJAA 1XNQT 1SHZC 5CA0E 5ENSD 2DWZA 4WNKA 3AVRA 5FY7A 3WI3A 4ATZD 4HFBA 3P4SA 1Y01A 4WYVA 3C50A 3FTXA 2XAGB 1E90A 3IF8B 2H6FA 3QC1A 5HRYA 4KZ0A 5FJYA 2L8KA 4IDNA 4UEMA 4ZZBA 1KNZA 3VKHA 2VKDA 2BVMA 2D0UA 1UJKA 1D8DA 2XEVA 4GZDA 2XZTG 2QYWA 1WYBA 1UJJA 3VLFA 5LBMA 3CSFA 4QKNA 3K9IA 3HXCA 3FZMB 4ATGA 5HEJA 5AQQB 5BNWA 1XDOA 3CKBA 1S63A 1BR2A 4CI2B 4B3ST 2XHEA 3EUHA 3RSEG 2D5UA 2Q9QA 2X68A 3PUAA 1N32T 3EIQC 5AQBA 3V30A 3HXFA 2LSVA 2AXDS 2J08A 3D9IA 3OAWA 3NB2A 1NAFA 2M67A 1S0PA 1J5WA 4CZZB 4GIWA 3PREA 4JPSA 3U64A 3CVRA 4CDNA 5ABGA 3KS2A 5AQJB 4PNIA 3CIAA 5ABEA 2UU9T 2XEEA 1XNFA 1IYGA 3CVPA 1XZYA 3K3NA 3TXNA 4WNDA 4TN7B 3G2UA 4G63A 2J47A 2AW6A 5HEOA 1K1BA 3MV3B 2ODUA 4PDXA 4CN4A 2F8YA 4WNFA 2VTBB 2BG9A 4YTPA 5ANLA 1MX6A 3B7SA 3KSQA 3GZSA 5FKYA 4XIFA 4BERA 4IDZA 4YHHT 3S2AA 4ZEYA 5FP3A 3LJNA 4R7LA 2CWOA 4ZI2C 2IU1A 3ZPJA 2PZIA 1QLBA 5DQWA 3CGHA 1IHGA 2WM9A 3SBSA 4Q96A 2VQFT 4AP2A 2MTQA 2V26A 3QNUA 1O5MA 2IMLA 2XRYA 5AIJA 4E7SA 4X1YE 4EB6E 4GZCA 3TLWA 5LOVE 4PS7A 2GROB 3C3OA 2HR2A 3CVQA 1KPSB 5FY1A 3FHNA 4DV7T 4GU5A 4HWIB 2C2LA 3UIOC 1WFDA 4AIFA 3L22A 2FBWA 5AQUB 5F8PA 3KINB 3W15B 3ZN3A 5AQHB 1WAO1 1FMWA 1QUUA 2CE7A 5FWQA 1W3BA 5JDMA 1HG2A 2FJEA 3AAAB 3ULQA 2K24A 4U7EB 3D9NA 5B1BE 2XQ6A 4A3VA 2EINE 3MA9A 4QH4A 4EYUA 3CK9A 3Q2MA 3O48A 1Y64B 4JLEA 4K0UA 3AXJB 1JWFA 3L08A 2LSKA 4DLOA 4I43A 3B7UX 5LOZA 5T4YA 4UQYA 2BKKB 3AE5A 3Q5XA 3RIBA 4GTRA 2DHRA 3U66A 4DIDB 3P4PA 3ZMSB 4HLLA 3NZPA 3PDYA 4AKIA 3SF4A 5L47A 4ANWA 4HE8A 3TJPA 3OYZA 3T8OA 5ANRA 4AKRB 3RLFF 5EYLA 3UM2A 3LY9A 4CCAA 1MIVA 5ABHA 4DR2T 1V55E 3L8RA 3LCAA 4PJMA 2ZMAA 2XQ0A 2KZTA 3ABLE 3ZJ2A 2K48A 2VL0A 4Q25A 4X1IE 3D9KA 3Q78A 4XBFB 3HXEA 2CHWA 1O3XA 2IHR1 1E8WA 3V5SA 5AQLB 5CRVA 2J1DG 1E1HB 2UXXB 4JI1T 4A1SA 4AOFA 4HFGA 2ACZA 5G2NA 1DCQA 3MGBA 3D9PA 4N2QA 1UX5A 4ISTA 4PFOA 4CN6A 5L3EB 1ELRA 2YN6A 4EOZB 3T8KA 4H9RC 4MBGA 3RX6A 4PK4A 3UUMA 4O2AE 3IEGA 3RKGA 2ZGDA 3ZVVA 1ZBPA 2JQKA 3MACA 2V5DA 1HF8A 3G2SA 1QZ2A 3FH7A 4FJYA 4QH1A 4ZXLA 1S70B 1V9DA 2EHOB 3N9NA 4F3VA 2LOSA 2WXHA 3FBZA 4UF0B 4KI0F 1TNZA 2C0MA 2IDOB 3OPCA 3SY2A 3DSUA 5LHHB 2KMFA 3CVUA 1H0AA 1UW4B 5FVKA 2J49A 4EBAG 2V0PA 2WXOA 4BAYB 1O1TA 3RAUA 5IYZE 4DV6T 5D2MC 4BJMA 2X0YA 1E7UA 3DEOA 3OVUA 2WXIA 4RVBA 4DLQA 2VQET 3HVEA 2E9XA 4B8CB 2X6FA 3V5UA
chains in the Genus database with same CATH topology
2GGFA 4KYOB 5E75A 4JL0A 3ZEFA 3CVVA 3UQ3A 4IE6A 4F53A 2HH7A 3FUEA 3ML9A 4J0UA 2DCFA 3I0QA 5G05J 3N5LA 2VQ2A 4ZI2D 4ASKA 1LVKA 1L5JA 3BQKA 2GW1A 4U63A 2NW7A 5FQ4A 5A23A 4YVOA 1MIYA 2I1KA 2KCLA 4ZI3C 1D0YA 5M72A 3S7BA 1JUQA 4OVVA 1OWNA 4GK5E 2XGMA 4U07A 4HOQA 3BG1B 4JEUB 2WXLA 4GPKA 3NZUA 2A3DA 2WXJA 4BFRA 1PC2A 4F6RC 2W63A 1S94A 4H9OC 3UT8A 4NURA 3N2GE 4X20E 3UPVA 3KVAA 4KVOA 4E6HA 4XX5A 1E8YA 2EHOC 4WNGA 4HLEA 3GYZA 4H9PC 5A1LA 3TG5A 3ZLIA 2OV8A 4CXXA 3ZYMA 3S7FA 3B7TA 1Z0PA 4DNDA 5FQ7A 4GMLA 3IHVA 4WAFA 3KVBA 5LYJE 4GYOA 1FVFA 3LBXA 3ZPOA 4BT8A 2YK0A 1EDUA 3HKEE 3ZYLA 4YNDA 3SOLA 5LCWC 3FUHA 3CPZA 4CXWA 1SA0E 4C90A 5EK4A 4KMCA 4M3OA 2Y6XA 2LSGA 5LXTE 2LT3A 2DNXA 2C5KT 4WBNE 2WXKA 1MQSA 1BPOA 4B6XA 2HPJA 4JC8A 1IQRA 4KP3C 2A4ZA 3QAQA 2VKHA 3CQXC 4XZ4A 3FTWA 3QARA 4MRUA 4OK0A 3ZYQA 4EAHA 4IE7A 1D1BA 5DJQC 5M4YA 2V7IA 5KDMC 1ZV4X 2R5SA 3OXFA 2NTYA 2C0LA 4Q69A 2XGOA 2UY1B 3MK7C 3AU4A 2CM0A 4UQZA 3MKDA 3RYCE 2Y48B 4E7ZA 4J8DA 2JMKA 4EPZA 3APCA 3QC9A 3APFA 2VYIA 3ZN0B 2VGXA 2FULA 4B94A 3FTSA 5JDNA 4UWLA 3FBLA 3J9X1 3PEVB 4KXKB 4XE0A 3RO3A 4EQFA 1FEWA 1Z6TA 1WLXA 3LY8A 2HPLA 2EQXA 2VJ8A 5J2UE 4IULA 4GZ6A 4DJAA 1IAPA 3NQPA 4DBQA 2WAUA 4H9NC 5JJTA 2I1JA 2VSXE 5J1GA 1DVPA 4Z8XA 3U78A 4XI0A 5FY0A 2J4DA 4JZYA 5CMWA 4ANXA 4AQFC 2XAFB 5JDLA 3ZHEB 1WRDA 3UUXB 3AS4A 2PFVA 3I5PA 3N2OA 2MYSA 4UWGA 2VK9A 4PS8A 3ZC0A 4FHKA 5LFAA 2E0IA 3A5XA 3FUFA 2I6HA 3AA1B 4G25A 2X9WA 2G0UA 3KV5A 4EXTA 3UTKA 5JH7E 3R7QA 5KJKA 1NWMX 2N1GA 2JLBA 3MYVA 3ONLA 1EF1C 4JW1A 2NW8A 1B7TA 3QDNA 2DBAA 3RC3A 1BR4A 4YFSA 2ZM8A 3RRUA 3P1UA 2EHOD 3RC8A 2X6HA 3DP7A 3LEWA 3D0TA 4P29A 3FDHA 4GYWA 3T5VA 2KWIB 3ZC1A 2WMNA 3FULA 2CXFA 2JMHA 2X67A 5CB4E 3FEYA 3FH5A 3HDXA 4GZ3A 3PNLB 2NP9A 3SFZA 4U0SA 5HWXA 4WWPA 1OWMA 2CXLA 4N2SA 4UVBB 5JREA 4Q94A 3U9WA 4C0EA 4EZ4A 2J07A 1LKXA 2FF4A 2WBLA 1HO8A 1U3CA 5G55A 4EZLA 4AEZC 4O2BE 5FZQA 1OWAA 3ESLA 3P8CD 3R9AB 3L16A 3E22E 3ZEFB 3BK9A 3O9XA 2YEVC 3MKQA 3ETVA 1D1CA 4KBMB 4MFRA 2RG8A 5H6RB 2OOEA 1YD8G 2A2FX 3UT7A 4UV9B 4GCNA 1SZ9A 2XASB 3FTYA 1IQUA 5LHGB 5JR9B 3RKOA 3LK2B 4AXPA 3ZMTB 2XCCA 4HN9A 4UI9J 4I1MA 4JHKA 5FXXA 3HYMB 3CVWA 3OBVE 4AQGA 4CI3B 2FO7A 2CMRA 3ZXSA 3SS1A 2WQHA 3UFEA 5A7DB 5JDGA 1HX8A 4FI5A 3G2TA 2KWHA 3RYFE 2XAJB 4ABNA 4HFVA 4B8AA 2BF0X 3AA7B 5KMGP 4I17A 3CX8B 2IW5B 3KD7A 3EDTB 2JPFA 3ZIMA 3RO2A 2I59A 2NTXA 2KZ7B 4N3AA 2HM8A 4OVUA 1P5QA 5D0OD 3SI5A 4YLHA 3FU6A 3CWZB 3HIZA 4WNEA 4N78D 3ZMZB 2WXNA 4APFA 2KCKA 5CCLA 4GYYA 2DLRA 3PRZA 2Z6EA 3L09A 4KT6B 2X6JA 2UWJG 3I9YA 3F31A 3FXEB 2LNIA 2WSSV 5D0QD 3RJVA 3OXGA 4L2YA 4AVXA 4TUYE 4NUUA 3FUIA 5FQ6A 2SPCA 2GRLA 3S4UA 4O4JE 1MMGA 2PM6A 5ENNA 1HTJF 2NOXA 3CQCB 1H2TC 2N2NA 5KX5E 2AVPA 5L3DB 4BX8A 1U5PA 3C4XA 2PQNA 2WMOA 2FBNA 4L7TA 4L2LA 3O1HA 2VSOE 1E96B 4L1BA 2K9AA 4I9EA 3C98B 2BDEA 4OHFA 2L6JA 5JRCA 1H2UA 5GONE 3O1IA 4FC8A 3FH8A 3RRMB 3ZW3A 4ANJA 3QJZA 4WBOA 4IE0A 3KBTA 3LVRE 4IN3B 3ENEA 4FLBA 3DTOA 3AS8A 4HORA 3C4ZA 5LP0A 3EJNA 4IIJE 5KJNA 3ZCIA 3NRXA 2NWBA 2LO6A 4AM9A 1EPUA 4MS6A 3E4BA 3PEUB 4RG9A 2IOLA 4PK5A 3RYHE 3L13A 5L3GB 4PH4B 3AAIA 3RPUA 5CA1E 3JCKC 1WM5A 2V1DB 3FTVA 3FWVA 3KFWX 3FUMA 2E8IA 3BQLA 4HXIA 2W0GA 1UX4A 3N9LA 1ZU2A 4AKGA 2MOZA 3OXLA 4ME2A 2CLYB 2YHEA 2WVIA 4N3BA 2PG8A 4JEHB 1PAQA 3VTYA 4P0BA 3CEQA 3PUJA 3QOUA 4UQXA 5FNVE 1KK7A 4I1AA 1JPLA 2QY7A 2KC7A 1HS6A 4O4HE 4NRHB 4ZHQE 3RH3A 2PBIA 3GZ1A 1U3DA 4G11A 3ONXA 5LP6E 2LEHA 3TL5A 2ZLYA 5CMYA 2W00A 4X1KE 4CI1B 4OFZA 1TJFA 3ANWA 2WQ7A 3R84B 2R59A 4NQ0A 2V8SE 2OA5A 5F3JA 2XRZA 3SHFA 3VLDA 1SZAA 3HKCE 4IGUA 4TUUA 3Q49B 4DBRA 5DABA 4EIWA 2X6IA 1ELKA 2WXQA 3ZFWA 2CWYA 2VB6A 5JDQA 5FXWA 5T3RA 4EZJA 4ANUA 2J9QA 2MBGA 1E7VA 3T8MA 5AENA 5FMNA 4U8HA 3LYAA 2KATA 4GB9A 1LRZA 2P9BA 3LVQE 3FTUA 2VKJA 2KXPB 2VL8A 2FEZA 3D9LA 3URZA 1MMAA 2H7OA 1DNPA 3RRCA 4ZOLE 2WXPA 2UXNB 2PL2A 3P2BA 4QXHB 1IZNB 2OVBA 3LK3B 3L54A 3TG4A 4KUMB 1KLXA 3N9OA 1PY1A 2MRIA 4HKAA 3RRWA 3U4TA 1E8ZA 4KMOA 3D9OA 4OYSA 3MZKB 1GW6A 2AXVA 5L2LA 1EZ3A 2X6KA 1OUVA 1MMNA 3MX3A 3ZGQA 5FTPA 3K3OA 3HA4A 4P0AA 1MMDA 3NF1A 4XKCA 3LPZA 1YKHB 4ILGA 4BY6A 4I2WA 4ACKA 5C2YA 3FP3A 1QSDA 1NP7A 2YU1A 1MHQA 2J4BA 5C1DA 4CGVA 4JHRA 4CXYA 4I6JA 3RKVA 3SRZA 2XHEB 3UX4A 3S7JA 4RG6A 3CR3A 1EYHA 2Q9QB 4RSYA 3ASFA 1U4QA 5T8IA 3HI2A 4QHOA 4G23A 2HYZA 4BX9A 4FP7A 1WY6A 3PVLA 3PU3A 2AXZA 4ZI7E 3TGOA 4FLHA 2GK9A 3HR0A 3SZ7A 4FADA 3UULA 1UN8A 2C5IT 2VTBA 3O4XE 3E08A 2V5FA 4GAAA 4BSXA 3JYSA 2XGSA 5FXZA 3PH0C 3I0OA 4YVQC 1CUNA 2L0TB 4AXHA 4P09A 3KEZA 5A6CA 4LCTA 4XZCA 3Q9DA 2CFZA 3B7RL 4G2VA 2Y8DA 1YKEB 4PJJA 2A5UA 4JA9A 3I4RB 4J8EA 1JWGA 2XPIA 2KT9A 4F7AA 4I1OB 2BVLA 3LJ3A 2RP4A 1YW0A 2XQYA 3JQ0A 3GN5A 4O6FA 2WXMA 5G04C 4E85A 4M1PA 1B89A 3ZMVB 3FB2A 3T5XA 2IOSA 5L3CB 2LJLA 3OJAA 2LAHA 4I9CA 3CKDA 3QB2A 3CHRA 3NZQA 4HGAA 4WUYA 3CLJA 4U74A 3EDVA 5L3BB 3CHPA 1G8XA 2PQRA 4CDRA 3N9MA 2XCBA 2Q9QC 3K8PC 3AVSA 4AY5A 4IE5A 5FYMA 4A1GA 4G24A 1Z3XA 2PM7A 3H37A 2QFCA 3I9WA 4I43B 5J90A 1G73A 4TZ4C 5HXCA 1MIWA 3S7DA 3I1AA 4UIGA 3Q5MA 3VHLA 3RRNB 3OKQA 1HFAA 3I4GA 2W61A 5E0OA 4QXBB 3Q5WA 3BEEA 4U04A 3QWWA 4V1Av 4HS2A 1WR6A 2KZTB 4H9SE 3GW4A 4Y6CA 4EECA 3TXMA 3CSTA 4G2AA 4TV8E 3ZMUB 3SWHA 1FMVA 5LA6E 5JHAA 4PAGA 1S35A 3C4WA 2GRMA 3D9MA 3EDUA 3CVYA 5E76A 1INZA 4PW8A 5J2TE 3PZDA 2RA1A 3KBUA 2BZBA 2J09A 1MNEA 3CK7A 4FULA 2EHOA 4AKLA 2B1EA 2IFUA 3AS5A 3N71A 2KCVA 4UF0A 5LCWJ 1MNDA 2LSYA 3F2EA 3IBEA 3QK0A 4UWFA 3GZ2A 3CKCA 3VLEA 2VKOA 4GA0A 2FI7A 3FHEA 3IHRA 1ZKEA 5JDFA 3BQIA 3CHQA 4GYSA 3LKUA 4ZS2A 2I2OA 3HVEB 2E9XB 4FJZA 1UN9A 4U0UA 5HXRA 4HOUA 2V7JA 2RD0A 3FU5A 5LG4A 2LM9A 4GYRA 4EYYR 5LJMA 2I9CA 3EHMA 3L6AA 1H19A 3LFMA 2X3MA 4GMJA 4AKHA 3NZSA 3LXUX 4AY6A 4GA2A 3FU3A 5LGTB 2WB2A 1IJ6A 3HKDE 5EZYE 4HOTA 3Q4AB 3U3IA 4JEUA 1E8XA 4K03A 4G1TA 2X0LB 4A3TA 3ASGA 4CGWA 2IC9A 3PUGA 3Q47B 4IYPA 5L3FB 4FU3A 5FQ8A 2CFUA 4TX5A 3SD5A 4UVCB 5FXVA 4XI9A 3MA5A 4W9RA 4I4TE 4YHJA 4ZS3A 4N5CA 5JDHA 4TV3A 3ASHA 3CV0A 3PU8A 3MJXA 5BV1A 2H7VC 3AB3B 2Q9QD 3FY4A 4JA7A 3PUSA 3N9QA 1XGWA 2WXRA 2M63A 3P7IA 2MOWA 3ESKA 3LBXB 4TRQA 5DIZA 3CHMA 3L3PA 5JJ6A 2E9XC 4JXTA 4Y6WA 2JQQA 2JEKA 5H6QB 5ETWA 1N52A 4J2CA 3IBPA 5C8YE 3IV0A 5HI7A 3FFLA 3CVXA 3LG7A 4QFVA 3M65A 4AQFA 4DI3A 5AYWD 5JJ7A 3CX7B 1D0XA 2WXFA 5FT9A 3MXZA 2H3RA 5JR9C 2Y3AA 4HOSA 5JQGE 4CEMA 1ELWA 4I50E 3B13A 4JUYA 3N9PA 3C64A 2DWKA 4BTBA 4UV8B 4ILIA 3QUJA 2YHCA 2CCQA 5G05C 4EZKA 3AAEB 2XPZA 3NBXX 4XKBA 2UY1A 1N54A 5EK3A 1OWOA 3PURA 1ZHCA 3RYIE 3TAXA 3IHYA 3GN5B 2Y4UA 3ASDA 3WAKA 3QNKA 2DIWA 2ONDA 2VSNA 5HYAA 1FIOA 4UWHA 1LVFA 3GWHA 1KT0A 4A55A 2ZM0A 1NA3A 1BR1A 1UG3A 2Q7FA 2LAIA 2X9XA 5KJMA 4CT0A 4O8SA 1UCUA 4GZ5A 1WYCA 4NUVA 1LF8A 1AJ3A 4LERA 5LJNA 2XAQB 3MKRA 4J8FA 3R6NA 5KCMA 3LK42 2IJGX 3B57A 2VGXB 4ERRA 4PS3A 1X79A 3EVYA 2CG3A 2CHXA 4MLPA 4UVAB 4OYJA 3PUQA 4HTEA 1SQMA 1FCHA 2QGSA 4I55E 5LNKA 3L17A 2CG2A 1H7CA 2KLQA 4MKTA 4ILUA 3PUKA 4U72A 3ZHEA 1HG5A 2KM4A 3UUXA 4L5GA 3K3QC 4N39A 3JUIA 2LHRA 4I2ZA 3ML8A 4DMWA 3CMLA 4PUCA 3VKGA 1YA0A 5LHIB 2LSJA 5BUZA 2LSUA 4GK0E 4OYKA 4EZHA 1BR0A 3MEKA 3MCXA 4C0MA 3O4ZA 4PK6A 4ISSA 2IC6A 1VRBA 4LUNU 2K5BB 3AA6B 2E2EA 4QX8B 3ZN1B 5LGUB 4BJNA 2CHZA 2OVFA 5CCMA 2CA5A 2Y4TA 3VTXA 4DVDA 3DJBA 2HO1A 5LBQB 5BPPA 3DBSA 4J6IA 2NXPA 2IQCA 4GA1A 5FZRA 3HHMA 2L9QA 2LE8A 5TAOA 2YNQA 4K0RA 4CDMA 5LX8A 4C9BB 1OXZA 3CVNA 3UMVA 3CQGB 2AWIA 3TKLB 2E9XD 2VGYA 4EBAA 4C91A 2VASA 4IE4A 2L3LA 1HE8A 3RU0A 2CLYC 3KV6A 3C51A 5EX3A 3MKQB 1HU3A 4ACLA 5J08A 5JR9A 4UXNB 1ZEEA 4YJ2E 3O1JA 2ZU6B 2ILRA 3PNTB 4KBQA 3ZYKA 5HXSA 2X38A 3OYXA 5HXEA 1NZNA 4L0RA 3JQ1A 4A56A 4UWKA 3G2WA 2JRKA 4AJWA 3N2KE 4D10C 2NW9A 2C0SA 4WWNA 4BWRA 3LS8A 3ZJ1A 3QK6A 3SGHA 3QWPA 3HL6A 3EHNA 4H7YA 2ODVA 4QX7B 4ILHB 3JC6C 5JHBA 2WXGA 4CQIA 3Q15A 3EIJA 4FJOA 3QKYA 4LRZA 2D2SA 3BG0B 1VDYA 3FUDA 4DMVA 2X9YA 3IEEA 3GA8A 3FUJA 1HH8A 1Z3YA 4O4IE 3LDZA 1D1AA 5ADXL 2PJQA 3KAEA 1A17A 4GCOA 5KJLA 2R17C 4MHCA 3PE4A 2IF4A 4ANVA 4I6EA 2CEAA 3CHSA 1T98A 4MALA 4UELA 5BT1A 4H63H 2V7LA 3CK8A 4PJLA 5HXHA 4H63V 4BTAA 3KV9A 2QA7A 5DBKA 2L9BA 1H2VC 4U0ZA 4H7XA 4PJNA 3PDNA 5EK2A 4DPRA 4L9IA 3CHOA 3H3AA 3C98A 3PE0A 3GMIA 4L23A 5EDSA 2C5JA 2N9DA 3FUNA 3FEXA 2ES0A 4KVMA 2A72A 3KV4A 3G2VA 2WQ6A 4JHJA 5ARFA 5JRCB 3FTZA 4TV9E 3CVLA 2DI4A 2IAKA 4N3CA 1VOMA 3HKBE 4O4LE 1KT1A 5LCYA 1OWLA 4V3IA 3CX6B 5AJDA 1FVHA 1QQEA 1TEZA 3D3MA 4WW0A 4DO0A 3WAJA 1NA0A 2X66A 4UI9C 2XAHB 3LJCA 5AJLA 1HS7A 3E0ZA 3QWVA 2L0IA 2CXDA 4J8SA 4APOA 5BMVE 2IONA 4AV7A 4MBQA 1Y6IA 2VSYA 2X51A 4B89A 3F57A 3IKOB 2P58C 4HEAA 3D9JA 5FZSA 4BA9A 3FXDB 3MJWA 3VU7H 2LSIA 2WWUA 4JVSA 2BTDA 4I6GA 1Y8MA 4JEHA 3FUKA 4FHJA 3NRYA 3UUNA 4H9QC 3AU5A 4YJ3E 2YQ8A 3AA0B 3ETUA 3LY7A 4URKA 5LGNB 2VWAA 3ZCJA 4CRWA 2D0TA 3KDSE 3DPDA 3PS6A 2LHNA 4XAXB 2LOPA 5HAXA 2W62A 5BW8C 3APDA 1D0ZA 1US7B 4ZI3D 2XTLA 1HZ4A 5JVDE 2KNDA 2XUEA 3PTRB 3SBTB 3RK6A 5DQVA 4DI4A 3U3WA 3R7RA 3ANWB 3FU0A 3JC6D 2DWGA 2DCPA 1TJCA 4F1SA 2XPYA 2NC9A 1HXIA 4GOUA 5BV0A 3UT4A 5HQ8A 2YU2A 4WWOA 5EX0A 4FA6A 4HVBA 2KINB 1H6KA 4QWNB 2V4LA 4MLKA 3UT5E 2MHKA 5IHYA 1QNFA 2NSZA 5CHEE 3ZRHA 3OTNA 3I3NA 2AXUA 2V7MA 4B0ZA 2JJ9A 2WPVA 2ZM2A 2X9HA 4AI6A 4LEUA 1IJ5A 3PE3A 3ONKA 4G26A 3J7Yq 4BT9A 1X5BA 3MV2B 2ACXA 4QXCB 4NACA 4PFPA 5ARGA 3WXXA 4UI9K 5AFUL 4IRUA 5HWYA 4IHJE 5G04J 5EKQD 1HCIA 4ADZA 4DK5A 3MZLB 4CT4A 2YINA 2BUGA 3SNXA 2V7KA 4KZCA 1OWPA 1SHZC 5CA0E 4WNKA 3AVRA 5FY7A 3WI3A 3C50A 3FTXA 2XAGB 1E90A 3IF8B 3QC1A 4KZ0A 5FJYA 2L8KA 1KNZA 4UEMA 3VKHA 2VKDA 2BVMA 2D0UA 1UJKA 4GZDA 2XEVA 1WYBA 1UJJA 3VLFA 5LBMA 3CSFA 4QKNA 3K9IA 4ATGA 5BNWA 3CKBA 1BR2A 4CI2B 2XHEA 3EUHA 2D5UA 2Q9QA 2X68A 3PUAA 3EIQC 2LSVA 2J08A 3D9IA 3OAWA 1NAFA 2M67A 1S0PA 4CZZB 4GIWA 3PREA 4JPSA 3U64A 3CVRA 4CDNA 3KS2A 4PNIA 3CIAA 1XNFA 1IYGA 3CVPA 3K3NA 3TXNA 4WNDA 4TN7B 3G2UA 4G63A 2AW6A 3MV3B 2ODUA 4PDXA 4WNFA 2VTBB 5ANLA 3B7SA 3GZSA 4XIFA 4IDZA 3S2AA 5FP3A 4R7LA 2CWOA 4ZI2C 2IU1A 3ZPJA 2PZIA 5DQWA 3CGHA 1IHGA 2WM9A 3SBSA 4Q96A 4AP2A 2MTQA 2V26A 2XRYA 5AIJA 4E7SA 4X1YE 4EB6E 4GZCA 5LOVE 4PS7A 2HR2A 3CVQA 5FY1A 3FHNA 4GU5A 2C2LA 4AIFA 3L22A 5F8PA 3KINB 3W15B 3ZN3A 1WAO1 1FMWA 1QUUA 2CE7A 5FWQA 1W3BA 5JDMA 1HG2A 3AAAB 3ULQA 2K24A 3D9NA 4A3VA 3MA9A 4EYUA 3CK9A 3Q2MA 3O48A 1Y64B 4JLEA 4K0UA 1JWFA 3L08A 2LSKA 4DLOA 4I43A 3B7UX 5LOZA 5T4YA 4UQYA 3Q5XA 3RIBA 2DHRA 3U66A 3ZMSB 3NZPA 3PDYA 4AKIA 3SF4A 4ANWA 4HE8A 3TJPA 3OYZA 3T8OA 5ANRA 4AKRB 3LY9A 4CCAA 1MIVA 3LCAA 4PJMA 2ZMAA 2XQ0A 2KZTA 3ZJ2A 2K48A 4X1IE 3D9KA 4XBFB 2CHWA 1O3XA 1E8WA 3V5SA 2J1DG 1E1HB 2UXXB 4A1SA 4AOFA 4HFGA 5G2NA 3MGBA 3D9PA 4N2QA 1UX5A 4ISTA 4PFOA 5L3EB 1ELRA 4EOZB 4H9RC 3RX6A 4PK4A 3UUMA 4O2AE 3IEGA 3ZVVA 1ZBPA 3MACA 1HF8A 3G2SA 1QZ2A 3FH7A 4FJYA 1V9DA 2EHOB 3N9NA 4F3VA 2LOSA 2WXHA 3FBZA 4UF0B 2C0MA 5LHHB 2KMFA 3CVUA 1H0AA 1UW4B 2J49A 4EBAG 2V0PA 2WXOA 4BAYB 5IYZE 4BJMA 1E7UA 2WXIA 4RVBA 4DLQA 3HVEA 2E9XA 4B8CB 2X6FA 3V5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B13 A;  2WM9 A;  2WMN A;  2YIN A;  3VHL A;  2WMO A; 
#chains in the Genus database with same CATH topology
 2GGF A;  4HFD A;  4KYO B;  5E75 A;  4JL0 A;  5B3S E;  3ZEF A;  3CVV A;  2V5C A;  4M7C A;  3UQ3 A;  2WCA A;  2VVS A;  4IE6 A;  4F53 A;  2HH7 A;  3FUE A;  3ML9 A;  4J0U A;  2DCF A;  3I0Q A;  5G05 J;  3N5L A;  2VQ2 A;  4ZI2 D;  4YDY A;  4ASK A;  1LVK A;  1OCO E;  3RIA A;  5H7P A;  1L5J A;  2KBX A;  2DZO A;  3BQK A;  2GW1 A;  4U63 A;  4JI4 T;  2NW7 A;  5ITZ F;  5FQ4 A;  5A23 A;  3PUZ F;  4YVO A;  1MIY A;  2I1K A;  3EHZ A;  2XM1 A;  4YTN A;  2UXC T;  2KCL A;  2JAB A;  5CEA A;  4JI5 T;  4ZI3 C;  1D0Y A;  5M72 A;  3S7B A;  1JUQ A;  3H3M A;  4HNA D;  4OVV A;  1OWN A;  4GK5 E;  2K3W A;  4O60 A;  5AAR A;  2XGM A;  4U07 A;  4HOQ A;  3BG1 B;  3V31 A;  4JEU B;  4F8H A;  2WXL A;  4GPK A;  3RIU A;  2FJD A;  4Z91 A;  3NZU A;  5CER B;  2A3D A;  2WXJ A;  2P9S G;  4BFR A;  1PC2 A;  4F6R C;  2W63 A;  5ENT D;  1S94 A;  1SE7 A;  4H9O C;  3UT8 A;  4NUR A;  3N2G E;  4X20 E;  4BSZ B;  2LXL A;  3KVA A;  3UPV A;  4KVO A;  1G3N B;  4E6H A;  2NYJ A;  4XX5 A;  1E8Y A;  2EHO C;  4WNG A;  4HLE A;  3J5P A;  4QQI A;  3GYZ A;  4H9P C;  5A1L A;  3TG5 A;  3ZLI A;  2OV8 A;  4CXX A;  3ZYM A;  1IKN D;  1NL4 A;  1Z0P A;  3B7T A;  3S7F A;  2E2A A;  4DND A;  5FQ7 A;  2XJ7 A;  4GML A;  4JI3 T;  3IHV A;  1LTX A;  4WAF A;  3KVB A;  5LYJ E;  4GYO A;  2RPA A;  1FVF A;  3LBX A;  3ZPO A;  1MYO A;  5AQI B;  4BT8 A;  2YK0 A;  2W2U A;  3JAF A;  1EDU A;  3V2X A;  5CGM A;  2BBH A;  3HKE E;  3ZYL A;  4YND A;  3SOL A;  5LCW C;  3FUH A;  3CPZ A;  4CXW A;  1SA0 E;  4C90 A;  1OED C;  5HCM A;  5EK4 A;  2H88 A;  3UM1 A;  4KMC A;  4M3O A;  4BEP A;  2Y6X A;  4TXQ A;  5KNG A;  4ZHB A;  2LSG A;  2ETC A;  5LXT E;  1IBL T;  2LT3 A;  2V5Q C;  2H89 A;  2DNX A;  1FT2 A;  2C5K T;  4WBN E;  1JCR A;  2WXK A;  1MQS A;  1BPO A;  4B6X A;  2HPJ A;  4K5A B;  4JC8 A;  1IQR A;  4KP3 C;  3VR8 A;  4ILA A;  2A4Z A;  3QAQ A;  2VKH A;  3CQX C;  4XZ4 A;  3FTW A;  1X81 A;  3QAR A;  4J7W A;  4MRU A;  2B76 A;  1CHU A;  3HRA A;  5AAO A;  4OK0 A;  3ZYQ A;  4EAH A;  2ZXW E;  4IE7 A;  1D1B A;  5DJQ C;  5M4Y A;  2V7I A;  5KDM C;  3DXK G;  2UUC T;  1ZV4 X;  2R5S A;  1OXJ A;  3OXF A;  1KNP A;  3UXG A;  2NTY A;  1N95 A;  2C0L A;  4Q69 A;  2XGO A;  2UY1 B;  5ENR D;  3MK7 C;  1TNU A;  3AU4 A;  3HXD A;  1TR4 A;  2CM0 A;  4UQZ A;  3MKD A;  2XQA A;  3RYC E;  2Y48 B;  5HEH A;  4E7Z A;  5AQK B;  4J8D A;  2JMK A;  3PZ3 A;  4EPZ A;  2E5V A;  3APC A;  4X8Q A;  3QC9 A;  3APF A;  3DRA A;  2VYI A;  3ZN0 B;  3OTO T;  1UUS A;  1J5E T;  4JI6 T;  2VGX A;  2FUL A;  4B94 A;  3FTS A;  5JDN A;  5LB7 B;  3FBL A;  4UWL A;  3UKU G;  2R05 A;  3J9X 1;  3PEV B;  4KXK B;  4XE0 A;  3RO3 A;  4EQF A;  1FT1 A;  1FEW A;  4COF A;  1Z6T A;  4HRM B;  1WLX A;  3LY8 A;  4Z68 A;  2HPL A;  2EQX A;  2VJ8 A;  5J2U E;  4IUL A;  4GZ6 A;  4DJA A;  3C5R A;  1IAP A;  4HWF A;  4K0K T;  5AQR B;  4HRL A;  3NQP A;  4DBQ A;  2WAU A;  4H9N C;  2Y1L E;  5JJT A;  2I1J A;  2VSX E;  2LRK A;  4B93 B;  5J1G A;  5KBA A;  1DVP A;  4Z8X A;  3U78 A;  5AQF B;  1KEY A;  3UU8 A;  4XI0 A;  5FY0 A;  4LF8 T;  2J4D A;  4JZY A;  5CMW A;  3M3Z B;  2J62 A;  4ANX A;  4AQF C;  2XAF B;  5JDL A;  3ZHE B;  1WRD A;  3UUX B;  3AS4 A;  3DST A;  2PFV A;  3I5P A;  3N2O A;  2MYS A;  4UWG A;  2W67 A;  2VK9 A;  4PS8 A;  2LKH A;  1SUM B;  3ZC0 A;  4U2Y A;  4FHK A;  5LFA A;  2E0I A;  3A5X A;  3FUF A;  2I6H A;  3AE1 A;  2P9U G;  3AA1 B;  4G25 A;  1SA5 A;  5AQO B;  1OCR E;  1T72 A;  2X9W A;  2G0U A;  3KV5 A;  4EXT A;  4HRN A;  3UTK A;  3P4W A;  5JH7 E;  3R7Q A;  1NWM X;  2N1G A;  5KJK A;  4F6R D;  2P9I G;  2JLB A;  3MYV A;  2BS4 A;  3SFD A;  1EF1 C;  3ONL A;  4NIQ A;  2NW8 A;  4JW1 A;  1B7T A;  3QDN A;  3SO8 A;  5BXU A;  2DBA A;  3RC3 A;  3EAB A;  1BR4 A;  4YFS A;  2ZM8 A;  4AIS A;  3RRU A;  3P1U A;  2EHO D;  4JD2 G;  3RC8 A;  2X6H A;  3DP7 A;  3LEW A;  4IT4 A;  3D0T A;  4P29 A;  3FDH A;  4IDP A;  4GYW A;  3T5V A;  2KWI B;  3ZC1 A;  2WMN A;  5IWA T;  3UQ4 A;  3FUL A;  2CXF A;  2JMH A;  2X67 A;  5L4E A;  5CB4 E;  3FEY A;  3FH5 A;  5EIB E;  2RFA A;  3HDX A;  4O1O A;  4B3T T;  4GZ3 A;  3PNL B;  2NP9 A;  2XS1 A;  3SFZ A;  4U0S A;  5HWX A;  4WWP A;  1OWM A;  2CXL A;  4N2S A;  4UVB B;  2ZIS A;  3AE8 A;  5JRE A;  4Q94 A;  3TWU A;  3U9W A;  4C0E A;  4EZ4 A;  2J07 A;  1LKX A;  4DX5 D;  4DR1 T;  2FF4 A;  2V4H C;  2WBL A;  1HO8 A;  1O1R A;  1U3C A;  5G55 A;  4EZL A;  4AEZ C;  3E34 A;  4O2B E;  5FZQ A;  1OWA A;  1KFY A;  3ESL A;  3P8C D;  3R9A B;  4U2Z A;  3L16 A;  3E22 E;  3ZEF B;  3BK9 A;  3O9X A;  3PZ2 A;  2YEV C;  3MKQ A;  3ETV A;  1D1C A;  4KBM B;  1ZB1 A;  5BXO A;  4DR4 T;  4MFR A;  3UU6 A;  2R2L A;  2RG8 A;  5H6R B;  2OOE A;  1YD8 G;  2A2F X;  4LML A;  4G8L A;  3UT7 A;  4UV9 B;  4GCN A;  2XM2 A;  1SZ9 A;  2P2C P;  2XAS B;  3FTY A;  1IQU A;  5LHG B;  3CIR A;  5JR9 B;  3RKO A;  3LK2 B;  4AXP A;  4TWF A;  3ZMT B;  1IBK T;  4HN9 A;  2XCC A;  1SVX A;  1HNX T;  4UI9 J;  1TNB A;  4I1M A;  4JHK A;  2XQ7 A;  3ZU7 B;  5FXX A;  3DSW A;  4LF7 T;  4TNV A;  3HYM B;  3CVW A;  3OBV E;  4AQG A;  3JAD A;  4CI3 B;  2FO7 A;  3AE6 A;  4JI7 T;  3SQV A;  1YQ3 A;  2M6B A;  2CMR A;  4B3R T;  3ZXS A;  3SS1 A;  2CRB A;  2WQH A;  3UFE A;  5A7D B;  5JDG A;  1HX8 A;  4FI5 A;  3G2T A;  2KWH A;  3RYF E;  3PUW F;  2XAJ B;  1KZO A;  2JQ9 A;  4ABN A;  3QOF A;  4HFV A;  4B8A A;  2BF0 X;  1IHB A;  1YCS B;  3AA7 B;  5KMG P;  2BBJ A;  4I17 A;  2NR4 A;  2YDQ A;  3CX8 B;  3RQU A;  2IW5 B;  2Y0B G;  3KD7 A;  1KNR A;  2UXB T;  4EHM A;  3EDT B;  2JPF A;  3ZIM A;  2UXD T;  4X65 T;  3RO2 A;  2I59 A;  2NTX A;  2KZ7 B;  4N3A A;  4TWH A;  3FZK B;  1OT8 A;  2HM8 A;  1Z5S C;  2OEV A;  4OVU A;  1P5Q A;  5D0O D;  3SI5 A;  4YLH A;  4IDO A;  3FU6 A;  3CWZ B;  3HIZ A;  4WNE A;  4N78 D;  3ZMZ B;  2WXN A;  4APF A;  2KCK A;  5CCL A;  4GYY A;  2WDR A;  1U2V G;  2DLR A;  3PRZ A;  4LF5 T;  4RLY A;  2Z6E A;  2UUB T;  1NFI E;  1X9B A;  2WQY A;  3L09 A;  4KT6 B;  5EID A;  1N9A A;  2X6J A;  2UWJ G;  3ISM C;  3I9Y A;  3F31 A;  3FXE B;  4DV3 T;  2WSS V;  2LNI A;  5D0Q D;  3OXG A;  3RJV A;  3JAE A;  4DR5 T;  2WZI A;  4L2Y A;  4AVX A;  1L0V A;  4TUY E;  4NUU A;  3Q75 A;  4GTQ A;  2WZH A;  3FUI A;  3TWW A;  4DX1 A;  5CBN A;  3Q7A A;  2SPC A;  5FQ6 A;  1JNZ A;  2GRL A;  3S4U A;  2QC9 A;  3TWT A;  4O4J E;  1MMG A;  4LF6 T;  2PM6 A;  5ENN A;  2EIJ E;  4DUI A;  1HTJ F;  2NOX A;  3CQC B;  1H2T C;  2N2N A;  5KX5 E;  2AVP A;  5L3D B;  4YDO A;  3BUA A;  2ZGG A;  4BX8 A;  1U5P A;  3C4X A;  1D9S A;  2PQN A;  3LSV A;  2WMO A;  2FBN A;  4L7T A;  4LNU D;  4L2L A;  3O1H A;  2F37 A;  2VSO E;  1M7K A;  1E96 B;  4L1B A;  2J4G A;  2K9A A;  1YXR A;  4I9E A;  4Z90 A;  3RI5 A;  3C98 B;  2RKK A;  2BDE A;  4OHF A;  2L6J A;  1N4P A;  2XY8 B;  5JRC A;  1H2U A;  1O1S A;  5GON E;  3O1I A;  4FC8 A;  3FH8 A;  1E7P A;  3RRM B;  2EIL E;  3ZW3 A;  4ANJ A;  3QJZ A;  4WBO A;  4IE0 A;  1JCS A;  3KBT A;  4YT0 A;  2YDS A;  3LVR E;  4IN3 B;  3ENE A;  3EAM A;  3B95 A;  3E33 A;  3PUX F;  3TWR A;  4FLB A;  3DTO A;  3ZKR A;  3AS8 A;  4HOR A;  3C4Z A;  5LP0 A;  2WP9 A;  3EJN A;  4LMJ A;  4IIJ E;  2ZIR A;  5KJN A;  3UU3 A;  3ZCI A;  2BKN A;  3DWL G;  1NEK A;  3NRX A;  2QVA A;  2NWB A;  3UQ7 A;  2B6C A;  2LO6 A;  4AM9 A;  1EPU A;  1K3Z D;  3E4B A;  3PEU B;  4MS6 A;  2IOL A;  3PUV F;  4PK5 A;  2XS8 A;  3C3Q A;  4RG9 A;  3RYH E;  2V6Y A;  5EN5 D;  3E30 A;  3L13 A;  5L3G B;  3DEP A;  3AAI A;  4PH4 B;  3RPU A;  5CA1 E;  1LD7 A;  3JCK C;  5EYP F;  3EI0 A;  1WM5 A;  2V1D B;  3FTV A;  3FWV A;  1NEN A;  1RZ4 A;  3SFE A;  1I6Z A;  3KFW X;  1WR0 A;  3NAW A;  3FUM A;  2E8I A;  2WU5 A;  4U7Y A;  3UM0 A;  3BQL A;  4HXI A;  4U95 D;  4HFC A;  3P4Q A;  2W0G A;  1NI1 A;  4ZZC A;  1UX4 A;  3N9L A;  1ZU2 A;  4AKG A;  2B0O E;  2XZE A;  1IXV A;  3T1H T;  2MOZ A;  3OXL A;  4ME2 A;  2CLY B;  1TN6 A;  2YHE A;  2WVI A;  1QBQ A;  4N3B A;  4GTO A;  3F6Q A;  2PG8 A;  4JEH B;  4TWD A;  1PAQ A;  3NVO A;  1TN7 A;  3VTY A;  4P0B A;  3CEQ A;  3PUJ A;  4LF9 T;  3D9H A;  3QOU A;  4CYM D;  4UQX A;  1TNO A;  5FNV E;  4JB8 P;  1KK7 A;  4ILC A;  4I1A A;  1JPL A;  2QY7 A;  2GRQ B;  2KC7 A;  1HS6 A;  2CBI A;  4IL9 A;  4O4H E;  4NRH B;  4ZHQ E;  3RH3 A;  3BU8 A;  2PBI A;  3GZ1 A;  1U3D A;  3PZ4 A;  4AQY T;  4G11 A;  2WDQ A;  3ONX A;  2LEH A;  5LP6 E;  5ABF A;  3TL5 A;  2ZLY A;  1N11 A;  5CMY A;  1TNY A;  2W00 A;  4CI1 B;  4X1K E;  4OFZ A;  1TJF A;  3ANW A;  3TLS A;  2WQ7 A;  4CN1 A;  3AG2 E;  3R84 B;  4X62 T;  2R59 A;  2V6X A;  4LF4 T;  4NQ0 A;  3AAA C;  2V8S E;  2OA5 A;  5F3J A;  2XRZ A;  3SHF A;  3VLD A;  1SZA A;  3HKC E;  4IGU A;  4TUU A;  3Q49 B;  4DBR A;  5DAB A;  4EIW A;  3VR9 A;  2X6I A;  5HEG A;  2W4X A;  1ELK A;  4X5T A;  2WXQ A;  3ZFW A;  2CWY A;  2VB6 A;  5JDQ A;  2LLY A;  5FXW A;  4IRE A;  5T3R A;  5CED B;  4EZJ A;  4ANU A;  2IY0 C;  3NKZ A;  2MBG A;  3ZT6 A;  1E7V A;  2EIK E;  2J9Q A;  2R6G F;  3T8M A;  5AEN A;  3DSX A;  4C48 B;  5FMN A;  4U8H A;  3LYA A;  2KAT A;  4GB9 A;  1LRZ A;  2P9B A;  3LVQ E;  1K1A A;  2J8S D;  3FTU A;  2VKJ A;  2KXP B;  2VL8 A;  2FEZ A;  4YDW A;  4GTP A;  1UK5 A;  3D9L A;  5AQM B;  3URZ A;  4LFC T;  1MMA A;  2H7O A;  3ZST A;  2YOE A;  4TNW A;  1DNP A;  1TYQ G;  3RRC A;  4ZOL E;  2WXP A;  2UXN B;  4OX9 T;  3Q79 A;  2PL2 A;  3DXM G;  4HI8 A;  3P2B A;  4QXH B;  2AE9 A;  1IZN B;  2P9L G;  2OVB A;  2PTF A;  3LK3 B;  3L54 A;  3TG4 A;  4KUM B;  1KLX A;  3N9O A;  2XQ5 A;  2H6H A;  3NWI A;  1PY1 A;  3RIF A;  1Z8U A;  2MRI A;  4HKA A;  3IXE A;  3RRW A;  3U4T A;  3ZT7 A;  1E8Z A;  4KMO A;  4YDE A;  3D9O A;  3NBN B;  3ABM E;  4K5C A;  3RGL A;  4OYS A;  3MZK B;  1GW6 A;  2AXV A;  2HHH T;  1Q2Z A;  5L2L A;  1EZ3 A;  4DV5 T;  2X6K A;  1OUV A;  1MMN A;  3MX3 A;  1RW2 A;  3ZGQ A;  5LMU T;  3K3O A;  5FTP A;  2W66 A;  3HA4 A;  4YTM A;  4P0A A;  1MMD A;  5HCJ A;  3NF1 A;  4XKC A;  4DV0 T;  3LPZ A;  1YKH B;  4ILG A;  2BG9 E;  1YQ4 A;  5KNH D;  4BY6 A;  1YMP A;  4I2W A;  4ACK A;  5C2Y A;  3FP3 A;  5ENQ D;  1QSD A;  1NP7 A;  1I94 T;  3TLT A;  2YU1 A;  1MHQ A;  2J4B A;  5C1D A;  4CGV A;  2XPK A;  5J0Z A;  4JHR A;  4CXY A;  2ZM6 T;  4I6J A;  2X0H A;  3RKV A;  3SRZ A;  3Q7F A;  2XHE B;  3UX4 A;  3S7J A;  1XWM A;  1ZOY A;  4RG6 A;  3UU5 A;  3CR3 A;  1EYH A;  2Q9Q B;  4RSY A;  3ASF A;  1XMO T;  4DUZ T;  1U4Q A;  5T8I A;  3HI2 A;  2IUB A;  4QHO A;  5JMN D;  4G23 A;  2HYZ A;  4BX9 A;  4FP7 A;  1WY6 A;  3PVL A;  3PU3 A;  2AXZ A;  1R8I A;  4ZI7 E;  2KXP C;  3TGO A;  4FLH A;  3VRA A;  1W9R A;  3UU4 A;  2GK9 A;  2MYO A;  3HR0 A;  4I0U A;  3SZ7 A;  4FAD A;  3UUL A;  2XSA A;  1UN8 A;  2C5I T;  3DSV A;  2VTB A;  3O4X E;  2DVW A;  4DX6 D;  4DX7 D;  4LMK A;  3E08 A;  2V5F A;  3C3R A;  1MX4 A;  4GAA A;  5IUX A;  4BSX A;  3JYS A;  3FZH B;  2XGS A;  2BG9 B;  4O1P A;  5FXZ A;  3PH0 C;  3I0O A;  4YVQ C;  2CBJ A;  2IIU A;  1CUN A;  2JQH A;  3AE2 A;  2ETA A;  2CHN A;  2L0T B;  5AQ7 A;  4AXH A;  4P09 A;  1S64 A;  3KEZ A;  3L9T A;  2CPT A;  5A6C A;  4LCT A;  2L6B A;  4XZC A;  3Q9D A;  2XEN A;  2CFZ A;  2IO3 C;  4HWH A;  3B7R L;  5AQT B;  1BD8 A;  1HNZ T;  1MJ0 A;  4G2V A;  2Y8D A;  1YKE B;  4PJJ A;  2A5U A;  4JA9 A;  2VGE A;  3I4R B;  4J8E A;  1JWG A;  2XPI A;  2QYU A;  2KT9 A;  4F7A A;  2D9D A;  4I1O B;  2BVL A;  2H6G A;  3LJ3 A;  4QH5 A;  4LG6 A;  2RP4 A;  1YW0 A;  2XQY A;  1N0Q A;  3JQ0 A;  4HFI A;  3GN5 A;  4O6F A;  5AQG B;  4GPM A;  2WXM A;  5G04 C;  4E85 A;  4M1P A;  1B89 A;  3ZMV B;  1MZC A;  4EV6 A;  3FB2 A;  1SA4 A;  3T5X A;  2IOS A;  5L3C B;  2LJL A;  3OJA A;  2LAH A;  4I9C A;  3CKD A;  2P9P G;  4DV1 T;  3QB2 A;  3CHR A;  3NZQ A;  4HGA A;  4WUY A;  3CLJ A;  4U74 A;  3Q9N C;  1N4R A;  3EDV A;  5L3B B;  3CHP A;  1G8X A;  2PQR A;  4CDR A;  3N9M A;  2XCB A;  2Q9Q C;  5B1A E;  3AED A;  3AXJ A;  3K8P C;  3AVS A;  4AY5 A;  4IE5 A;  5FYM A;  4A1G A;  3IA3 A;  4G24 A;  4U3C A;  1Z3X A;  2PM7 A;  3H37 A;  3ZXP A;  3FZL B;  2QRX A;  2QFC A;  1A5E A;  3I9W A;  1N36 T;  4I43 B;  3SFX A;  5J90 A;  1G73 A;  4TZ4 C;  4YY3 T;  5HXC A;  4NXM T;  1MIW A;  3S7D A;  1DC2 A;  2E5L T;  2HN2 A;  3I1A A;  3VRB A;  4UIG A;  4F1P A;  2VUR A;  3Q5M A;  3VHL A;  1VCT A;  1K8K G;  3RRN B;  3OKQ A;  1HFA A;  4GTS A;  1N34 T;  1QYM A;  3I4G A;  5FIO A;  4KX6 A;  3AJI A;  2W61 A;  2BG9 C;  5E0O A;  4QXB B;  3Q5W A;  3EHR A;  3BEE A;  4U04 A;  3L39 A;  3QWW A;  2F8X K;  3EU5 A;  4V1A v;  2FUP A;  4HS2 A;  1WR6 A;  2KZT B;  4A98 A;  4H9S E;  3GW4 A;  3AEE A;  4Y6C A;  1KZP A;  3Q9U C;  4EEC A;  3TXM A;  3CST A;  2XQ9 A;  4G2A A;  4TV8 E;  3ZMU B;  3SWH A;  1N4Q A;  1FMV A;  5LA6 E;  5JHA A;  4PAG A;  1S35 A;  4X64 T;  3C4W A;  2GRM A;  2PNN A;  3D9M A;  3EDU A;  3CVY A;  2H6I A;  5E76 A;  1INZ A;  4LNG A;  4PW8 A;  5J2T E;  3EUV A;  3PZD A;  2RA1 A;  3KBU A;  2BZB A;  4LFB T;  2EIM E;  2J09 A;  1MNE A;  4HB5 A;  3CK7 A;  1WCR A;  4FUL A;  2EHO A;  4AKL A;  2B1E A;  2IFU A;  3AS5 A;  3N71 A;  2DL1 A;  2KCV A;  4UF0 A;  4DV4 T;  2LUH A;  5LCW J;  1MND A;  2LSY A;  3F2E A;  3J5Q B;  3IBE A;  4U33 A;  3QK0 A;  4UWF A;  4G8K A;  3GZ2 A;  5L4H A;  3CKC A;  4HWC A;  1H6P A;  2WWV A;  2VKO A;  3VLE A;  4GA0 A;  2FI7 A;  3FHE A;  3IHR A;  4EED A;  1ZKE A;  4U8V D;  3T1Y T;  5JDF A;  5C3J A;  5KWD A;  3A8Y C;  4U7I A;  3BQI A;  2DYS E;  3CHQ A;  4GYS A;  1OED A;  4ZS2 A;  2I2O A;  3HVE B;  2E9X B;  3LKU A;  4FJZ A;  1UN9 A;  4U0U A;  4JI0 T;  5HXR A;  4HOU A;  2V7J A;  2RD0 A;  3FU5 A;  3EHQ A;  3LDQ B;  5LG4 A;  2LM9 A;  4LFA T;  4GYR A;  4EYY R;  5LJM A;  2I9C A;  3EHM A;  3L6A A;  1H19 A;  3LFM A;  2X3M A;  4GMJ A;  4AKH A;  2LRL A;  4KHZ F;  3UFG A;  3NZS A;  3LXU X;  4TXP A;  4AY6 A;  4GA2 A;  3FU3 A;  1BU9 A;  5JTG A;  5LGT B;  2WB2 A;  1IJ6 A;  3HKD E;  5EZY E;  4GTM A;  4HOT A;  3Q4A B;  5ENP D;  4YSX A;  2OV9 A;  3U3I A;  4DUY T;  4JEU A;  2R02 A;  1E8X A;  4OAU C;  4K03 A;  2RFM A;  4G1T A;  2X0L B;  4A3T A;  3ASG A;  3UTM A;  4CGW A;  1E2A A;  3Q5D A;  2IC9 A;  3PUG A;  1JCQ A;  3Q47 B;  4IYP A;  5L3F B;  4FU3 A;  4XEI G;  5FQ8 A;  2CFU A;  4HI9 A;  4TX5 A;  2OEW A;  3SD5 A;  4KHP T;  4UVC B;  5FXV A;  4XI9 A;  3MA5 A;  4W9R A;  4I4T E;  4YHJ A;  4ZS3 A;  2BKO A;  3ASO E;  4N5C A;  5JDH A;  4TV3 A;  1JNR A;  4NPP A;  4HFE A;  3ASH A;  2BKG A;  3CV0 A;  3AE3 A;  3PU8 A;  3MJX A;  5BV1 A;  2H7V C;  3AB3 B;  2Q9Q D;  3FY4 A;  5FVL A;  3PUY F;  4GTV A;  4JA7 A;  2MPK A;  3PUS A;  3N9Q A;  1XGW A;  2WXR A;  2M63 A;  3P7I A;  2MOW A;  5CRU A;  1BI8 B;  5AN8 A;  3ESK A;  3LBX B;  4TRQ A;  5DIZ A;  4HFH A;  3CHM A;  3L3P A;  5JJ6 A;  2E9X C;  4JXT A;  4Y6W A;  3ZNG A;  2JQQ A;  3NOC D;  4DV2 T;  2JEK A;  5H6Q B;  5ETW A;  1N52 A;  4J2C A;  3G06 A;  3IBP A;  2XZD G;  5CBO A;  5C8Y E;  3IV0 A;  5HI7 A;  3FFL A;  3CVX A;  3LG7 A;  4QFV A;  3M65 A;  4AQF A;  4DI3 A;  5CJ5 A;  5AYW D;  1W09 A;  5JJ7 A;  3CX7 B;  1D0X A;  2WXF A;  3ZKJ A;  5FT9 A;  3MXZ A;  5ENO D;  2H3R A;  4BES A;  5JR9 C;  1HNW T;  2Y3A A;  4HOS A;  5IY5 E;  3HG0 D;  5JQG E;  4CEM A;  1ELW A;  4I50 E;  1AP7 A;  3B13 A;  2XQ8 A;  4JUY A;  3TWS A;  4OAV B;  3N9P A;  1XNR T;  3C64 A;  2DWK A;  3RHW A;  3DSS A;  4BTB A;  3FZF B;  4UV8 B;  1T7S A;  4ILI A;  1W0B A;  3QUJ A;  2YHC A;  2CCQ A;  5G05 C;  4EZK A;  3AAE B;  2XPZ A;  3NBX X;  4XKB A;  2UY1 A;  1N54 A;  3RIU C;  5EK3 A;  1OWO A;  3PUR A;  1ZHC A;  4HWD A;  3RYI E;  3TAX A;  3IHY A;  5CFB A;  3GN5 B;  2Y4U A;  3ASD A;  3WAK A;  3QNK A;  4TUM A;  2DIW A;  2OLT A;  3K1S A;  2OND A;  3T9K A;  2VSN A;  5HYA A;  1FIO A;  4UWH A;  5JA4 D;  1LVF A;  3GWH A;  1KT0 A;  4A55 A;  2ZM0 A;  1NA3 A;  1GQE A;  1BR1 A;  1UG3 A;  2Q7F A;  3UIN C;  5LMN T;  2KSR A;  2X9X A;  2LAI A;  5KJM A;  4CT0 A;  2IEJ A;  4O8S A;  1UCU A;  4GZ5 A;  1WYC A;  4NUV A;  1LF8 A;  1AJ3 A;  4LER A;  5LJN A;  2XAQ B;  2ETB A;  3MKR A;  1XDP A;  4J8F A;  3R6N A;  5KCM A;  2FO1 E;  3JCF A;  2HN1 A;  3AE9 A;  3LK4 2;  2IJG X;  3B57 A;  2VGX B;  4ERR A;  4LSZ E;  4PS3 A;  5F5W A;  1X79 A;  1YYH A;  4B3M T;  3EVY A;  1FJG T;  1N0R A;  2CG3 A;  2CHX A;  4MLP A;  4UVA B;  4OYJ A;  3PUQ A;  4HTE A;  1SQM A;  1FCH A;  4JV5 T;  2QGS A;  3PV0 F;  2LXM A;  2LKG A;  4I55 E;  5KXJ A;  5LNK A;  3L17 A;  3X2Q E;  2CG2 A;  5AQP B;  5D66 A;  1H7C A;  2KLQ A;  3X1D A;  3P4R A;  4MKT A;  4ILU A;  4NIK A;  3PUK A;  4U72 A;  1V54 E;  3ZHE A;  1HG5 A;  4U96 D;  2KM4 A;  3UUX A;  1N4S A;  4L5G A;  3K3Q C;  2UUA T;  4N39 A;  3JUI A;  2LHR A;  5EIL A;  3Q5E A;  3ML8 A;  4DMW A;  3BQO A;  4I2Z A;  2WS3 A;  2MAW A;  3CML A;  4PUC A;  4U8Y D;  3VKG A;  1H6O A;  1YA0 A;  5LHI B;  2LSJ A;  5BUZ A;  2LSU A;  4GK0 E;  4OYK A;  4EZH A;  1BR0 A;  2R03 A;  3MEK A;  3MCX A;  3NOG D;  3E37 A;  3O4Z A;  4C0M A;  4PK6 A;  4ISS A;  1OED E;  2WDV A;  2IC6 A;  1VRB A;  4LUN U;  2K5B B;  3AA6 B;  2E2E A;  2A5E A;  1IBM T;  4A97 A;  1WG0 A;  4QX8 B;  3ZN1 B;  5LGU B;  4BJN A;  2BS3 A;  2CHZ A;  2OVF A;  3EU9 A;  5CCM A;  2CA5 A;  2Y4T A;  3VTX A;  4DVD A;  3DJB A;  2HO1 A;  5LBQ B;  5BPP A;  3DBS A;  1OCZ E;  4J6I A;  2FJB A;  2XEH A;  3ONJ A;  2NXP A;  2IQC A;  4GA1 A;  4GTT A;  2YKS A;  3ULE G;  1TN8 A;  5FZR A;  3HHM A;  2L9Q A;  2LE8 A;  5TAO A;  2YNQ A;  4K0R A;  3UI2 A;  4CDM A;  5LX8 A;  4NXN T;  4C9B B;  2HE0 A;  1OXZ A;  3CVN A;  3UMV A;  2BKP A;  3KEA A;  3CQG B;  4LNB A;  5HKP A;  2AWI A;  3TKL B;  2E9X D;  5FL0 A;  3TLU A;  2VGY A;  5AQN B;  4EBA A;  3B7B A;  4DR6 T;  4C91 A;  2VAS A;  4EGW A;  4IE4 A;  1DU2 A;  1OED B;  2L3L A;  1HE8 A;  3RU0 A;  3PJA J;  2CLY C;  4DRX E;  3AE4 A;  3KV6 A;  3C51 A;  5EX3 A;  3MKQ B;  1LD8 A;  1HU3 A;  4ACL A;  5J08 A;  5JR9 A;  4CZ2 D;  4UXN B;  1ZEE A;  4YJ2 E;  3O1J A;  2ZU6 B;  4GKK T;  2ILR A;  3PNT B;  4KBQ A;  2WB5 A;  3B5M A;  3TWQ A;  3ZYK A;  5HXS A;  2X38 A;  3OYX A;  5HXE A;  1NZN A;  2F0Y A;  3ABK E;  3AEA A;  4L0R A;  3JQ1 A;  4A56 A;  4UWK A;  3G2W A;  2JRK A;  4AJW A;  3AG1 E;  3N2K E;  4AIU A;  3PJA A;  4D10 C;  2NW9 A;  2C0S A;  4WWN A;  3QB5 K;  3LS8 A;  4BWR A;  3ZSS A;  3ZJ1 A;  3QK6 A;  3SGH A;  3QWP A;  4N5Q A;  3HL6 A;  3EHN A;  5BR8 T;  4H7Y A;  3AEC A;  2ODV A;  3AEG A;  2CHO A;  4QX7 B;  3AG4 E;  4ILH B;  3JC6 C;  5JHB A;  3AG3 E;  2WXG A;  3ONL C;  4CQI A;  3Q15 A;  3W9G A;  4UR9 A;  3EIJ A;  2OCC E;  4FJO A;  4X66 T;  3QKY A;  1W0A A;  4LRZ A;  2D2S A;  3BG0 B;  1VDY A;  3FUD A;  4DMV A;  2X9Y A;  3IEE A;  3ULY A;  3GA8 A;  3FUJ A;  4YXD A;  1HH8 A;  1Z3Y A;  4O4I E;  3LDZ A;  4JI8 T;  1D1A A;  3CK6 A;  5ADX L;  2XSB A;  2YDR A;  2PJQ A;  1OY3 D;  3KAE A;  2A9U A;  1A17 A;  4GCO A;  5KJL A;  5AQA A;  2R17 C;  1UOH A;  4MHC A;  3PE4 A;  2IF4 A;  1T8B A;  4ANV A;  2BED A;  4I6E A;  2CEA A;  2V8S V;  3CHS A;  1T98 A;  4MAL A;  3W9F A;  4UEL A;  5BT1 A;  3JXJ A;  4H63 H;  2V7L A;  4BET A;  3CK8 A;  4GKJ T;  4PJL A;  5HXH A;  3UM3 A;  4H63 V;  4BTA A;  3KV9 A;  3QB5 A;  2QA7 A;  5DBK A;  2P9N G;  2AJA A;  2DZN A;  2L9B A;  3TLV A;  1H2V C;  4U0Z A;  3RQW A;  4H7X A;  4PJN A;  3PDN A;  5EK2 A;  4DPR A;  4L9I A;  3CHO A;  2XQ3 A;  3H3A A;  2F4V T;  3C98 A;  3PE0 A;  3GMI A;  1DCE A;  1FPP A;  3AE7 A;  4HQD A;  1VCS A;  1ZP0 A;  2LM2 A;  4L23 A;  5EDS A;  2C5J A;  2N9D A;  3FUN A;  3FEX A;  3JUE A;  4TXR A;  4UUC A;  4JYA T;  3AEB A;  2ES0 A;  4KVM A;  2A72 A;  4WZX A;  3KV4 A;  3G2V A;  2WQ6 A;  4HBD A;  4U31 A;  4JHJ A;  5ARF A;  5JRC B;  3FTZ A;  4TV9 E;  4DR7 T;  2QZA A;  3CVL A;  3TWX A;  2DI4 A;  2IAK A;  4DR3 T;  4N3C A;  1VOM A;  4IL4 A;  3HKB E;  4O4L E;  1KT1 A;  5LCY A;  1OWL A;  4V3I A;  2XQ4 A;  3CX6 B;  5AJD A;  1FVH A;  2GRR B;  1N33 T;  1QQE A;  1TEZ A;  3D3M A;  4WW0 A;  4DO0 A;  3WAJ A;  3KSL A;  1HX1 B;  2X66 A;  5FL1 A;  1NA0 A;  2I0M A;  3UIP C;  4UI9 C;  2XAH B;  3LJC A;  1KF6 A;  5AJL A;  1HS7 A;  5CEC B;  3E0Z A;  3QWV A;  1HR0 T;  5FIN A;  4A63 B;  2L0I A;  2CXD A;  4J8S A;  4APO A;  1UUR A;  5BMV E;  2ION A;  2V6Y B;  4AV7 A;  4MBQ A;  3UUB A;  1Y6I A;  2VSY A;  2X51 A;  4B89 A;  4A5X A;  3F57 A;  3ZUV B;  3RF1 A;  3IKO B;  2P58 C;  4HEA A;  2JIW A;  3WG7 E;  3D9J A;  5AQ9 A;  5FZS A;  3AEF A;  3P50 A;  3FXD B;  4BA9 A;  3TWV A;  3MJW A;  3VU7 H;  3V79 K;  2LSI A;  3PZ1 A;  2WWU A;  1AWC B;  4JVS A;  2GRP B;  2IO2 C;  2BTD A;  3L82 A;  4I6G A;  1Y8M A;  4ZFH A;  4JEH A;  5AQV B;  3FUK A;  4FHJ A;  1BI7 B;  3NRY A;  3UUN A;  4H9Q C;  1XMQ T;  3AU5 A;  3C72 A;  4YJ3 E;  2YQ8 A;  3ASN E;  3AA0 B;  3ETU A;  3LY7 A;  4URK A;  5LGN B;  2VWA A;  1D8E A;  3V2O A;  3ZCJ A;  4CRW A;  2D0T A;  3KDS E;  3DPD A;  3PS6 A;  2LHN A;  4XAX B;  2LOP A;  2P9K G;  5HAX A;  2W62 A;  5BW8 C;  3APD A;  1D0Z A;  1US7 B;  4ZI3 D;  2DYR E;  2XTL A;  1HZ4 A;  3DPY A;  5JVD E;  3HXB A;  2KND A;  1SW6 A;  2XUE A;  3PTR B;  3SBT B;  3UKR G;  4YSZ A;  3RK6 A;  5DQV A;  4DI4 A;  1WDY A;  1M62 A;  4IDQ A;  3JXI A;  4ILB A;  5ABF B;  3U3W A;  3R7R A;  5HEU A;  3ANW B;  3FU0 A;  3JC6 D;  2DWG A;  2DCP A;  1TJC A;  4F1S A;  5AQS B;  3A7M A;  2NC9 A;  2XPY A;  1HXI A;  4GOU A;  3Q73 A;  5BV0 A;  3UT4 A;  5HQ8 A;  2YU2 A;  1OCC E;  4JI2 T;  4WWO A;  5EX0 A;  4FA6 A;  4HVB A;  2KIN B;  1H6K A;  4QWN B;  4L9P A;  2V4L A;  4MLK A;  3ABV A;  3UT5 E;  4GMR A;  1BLX B;  1MX2 A;  2MHK A;  5IHY A;  3ZT5 A;  5C2T A;  5LG3 A;  3R9M A;  1QNF A;  2BS2 A;  2NSZ A;  5CHE E;  3ZRH A;  2WY2 A;  3OTN A;  3I3N A;  2AXU A;  4K5B A;  2V7M A;  4B0Z A;  2JJ9 A;  3SFY A;  4RQI A;  2WPV A;  2ZM2 A;  2X9H A;  4AI6 A;  1UGO A;  4LEU A;  4DX2 A;  1IJ5 A;  2Y69 E;  2VVN A;  3PE3 A;  2WU2 A;  3ONK A;  4JBW F;  3E32 A;  4G26 A;  3J7Y q;  4BT9 A;  1X5B A;  3MV2 B;  2ACX A;  4QXC B;  4NAC A;  4PFP A;  5ARG A;  3WXX A;  4UI9 K;  5AFU L;  4IRU A;  5HWY A;  4IHJ E;  4J8Y A;  5EKQ D;  5G04 J;  1HCI A;  4ADZ A;  4YSY A;  4P1N A;  2M6I A;  4DK5 A;  3MZL B;  4CT4 A;  1N94 A;  2YIN A;  4EEB A;  2GRN B;  5HS0 A;  2BUG A;  3SNX A;  2V7K A;  2QYJ A;  4KZC A;  1OWP A;  1J1J A;  2FJA A;  1XNQ T;  1SHZ C;  5CA0 E;  5ENS D;  2DWZ A;  4WNK A;  3AVR A;  5FY7 A;  3WI3 A;  4ATZ D;  4HFB A;  3P4S A;  1Y01 A;  4WYV A;  3C50 A;  3FTX A;  2XAG B;  1E90 A;  3IF8 B;  2H6F A;  3QC1 A;  5HRY A;  4KZ0 A;  5FJY A;  2L8K A;  4IDN A;  4UEM A;  4ZZB A;  1KNZ A;  3VKH A;  2VKD A;  2BVM A;  2D0U A;  1UJK A;  1D8D A;  2XEV A;  4GZD A;  2XZT G;  2QYW A;  1WYB A;  1UJJ A;  3VLF A;  5LBM A;  3CSF A;  4QKN A;  3K9I A;  3HXC A;  3FZM B;  4ATG A;  5HEJ A;  5AQQ B;  5BNW A;  1XDO A;  3CKB A;  1S63 A;  1BR2 A;  4CI2 B;  4B3S T;  2XHE A;  3EUH A;  3RSE G;  2D5U A;  2Q9Q A;  2X68 A;  3PUA A;  1N32 T;  3EIQ C;  5AQB A;  3V30 A;  3HXF A;  2LSV A;  2AXD S;  2J08 A;  3D9I A;  3OAW A;  3NB2 A;  1NAF A;  2M67 A;  1S0P A;  1J5W A;  4CZZ B;  4GIW A;  3PRE A;  4JPS A;  3U64 A;  3CVR A;  4CDN A;  5ABG A;  3KS2 A;  5AQJ B;  4PNI A;  3CIA A;  5ABE A;  2UU9 T;  2XEE A;  1XNF A;  1IYG A;  3CVP A;  1XZY A;  3K3N A;  3TXN A;  4WND A;  4TN7 B;  3G2U A;  4G63 A;  2J47 A;  2AW6 A;  5HEO A;  1K1B A;  3MV3 B;  2ODU A;  4PDX A;  4CN4 A;  2F8Y A;  4WNF A;  2VTB B;  2BG9 A;  4YTP A;  5ANL A;  1MX6 A;  3B7S A;  3KSQ A;  3GZS A;  5FKY A;  4XIF A;  4BER A;  4IDZ A;  4YHH T;  3S2A A;  4ZEY A;  5FP3 A;  3LJN A;  4R7L A;  2CWO A;  4ZI2 C;  2IU1 A;  3ZPJ A;  2PZI A;  1QLB A;  5DQW A;  3CGH A;  1IHG A;  2WM9 A;  3SBS A;  4Q96 A;  2VQF T;  4AP2 A;  2MTQ A;  2V26 A;  3QNU A;  1O5M A;  2IML A;  2XRY A;  5AIJ A;  4E7S A;  4X1Y E;  4EB6 E;  4GZC A;  3TLW A;  5LOV E;  4PS7 A;  2GRO B;  3C3O A;  2HR2 A;  3CVQ A;  1KPS B;  5FY1 A;  3FHN A;  4DV7 T;  4GU5 A;  4HWI B;  2C2L A;  3UIO C;  1WFD A;  4AIF A;  3L22 A;  2FBW A;  5AQU B;  5F8P A;  3KIN B;  3W15 B;  3ZN3 A;  5AQH B;  1WAO 1;  1FMW A;  1QUU A;  2CE7 A;  5FWQ A;  1W3B A;  5JDM A;  1HG2 A;  2FJE A;  3AAA B;  3ULQ A;  2K24 A;  4U7E B;  3D9N A;  5B1B E;  2XQ6 A;  4A3V A;  2EIN E;  3MA9 A;  4QH4 A;  4EYU A;  3CK9 A;  3Q2M A;  3O48 A;  1Y64 B;  4JLE A;  4K0U A;  3AXJ B;  1JWF A;  3L08 A;  2LSK A;  4DLO A;  4I43 A;  3B7U X;  5LOZ A;  5T4Y A;  4UQY A;  2BKK B;  3AE5 A;  3Q5X A;  3RIB A;  4GTR A;  2DHR A;  3U66 A;  4DID B;  3P4P A;  3ZMS B;  4HLL A;  3NZP A;  3PDY A;  4AKI A;  3SF4 A;  5L47 A;  4ANW A;  4HE8 A;  3TJP A;  3OYZ A;  3T8O A;  5ANR A;  4AKR B;  3RLF F;  5EYL A;  3UM2 A;  3LY9 A;  4CCA A;  1MIV A;  5ABH A;  4DR2 T;  1V55 E;  3L8R A;  3LCA A;  4PJM A;  2ZMA A;  2XQ0 A;  2KZT A;  3ABL E;  3ZJ2 A;  2K48 A;  2VL0 A;  4Q25 A;  4X1I E;  3D9K A;  3Q78 A;  4XBF B;  3HXE A;  2CHW A;  1O3X A;  2IHR 1;  1E8W A;  3V5S A;  5AQL B;  5CRV A;  2J1D G;  1E1H B;  2UXX B;  4JI1 T;  4A1S A;  4AOF A;  4HFG A;  2ACZ A;  5G2N A;  1DCQ A;  3MGB A;  3D9P A;  4N2Q A;  1UX5 A;  4IST A;  4PFO A;  4CN6 A;  5L3E B;  1ELR A;  2YN6 A;  4EOZ B;  3T8K A;  4H9R C;  4MBG A;  3RX6 A;  4PK4 A;  3UUM A;  4O2A E;  3IEG A;  3RKG A;  2ZGD A;  3ZVV A;  1ZBP A;  2JQK A;  3MAC A;  2V5D A;  1HF8 A;  3G2S A;  1QZ2 A;  3FH7 A;  4FJY A;  4QH1 A;  4ZXL A;  1S70 B;  1V9D A;  2EHO B;  3N9N A;  4F3V A;  2LOS A;  2WXH A;  3FBZ A;  4UF0 B;  4KI0 F;  1TNZ A;  2C0M A;  2IDO B;  3OPC A;  3SY2 A;  3DSU A;  5LHH B;  2KMF A;  3CVU A;  1H0A A;  1UW4 B;  5FVK A;  2J49 A;  4EBA G;  2V0P A;  2WXO A;  4BAY B;  1O1T A;  3RAU A;  5IYZ E;  4DV6 T;  5D2M C;  4BJM A;  2X0Y A;  1E7U A;  3DEO A;  3OVU A;  2WXI A;  4RVB A;  4DLQ A;  2VQE T;  3HVE A;  2E9X A;  4B8C B;  2X6F A;  3V5U A; 
#chains in the Genus database with same CATH homology
 2GGF A;  4KYO B;  5E75 A;  4JL0 A;  3ZEF A;  3CVV A;  3UQ3 A;  4IE6 A;  4F53 A;  2HH7 A;  3FUE A;  3ML9 A;  4J0U A;  2DCF A;  3I0Q A;  5G05 J;  3N5L A;  2VQ2 A;  4ZI2 D;  4ASK A;  1LVK A;  1L5J A;  3BQK A;  2GW1 A;  4U63 A;  2NW7 A;  5FQ4 A;  5A23 A;  4YVO A;  1MIY A;  2I1K A;  2KCL A;  4ZI3 C;  1D0Y A;  5M72 A;  3S7B A;  1JUQ A;  4OVV A;  1OWN A;  4GK5 E;  2XGM A;  4U07 A;  4HOQ A;  3BG1 B;  4JEU B;  2WXL A;  4GPK A;  3NZU A;  2A3D A;  2WXJ A;  4BFR A;  1PC2 A;  4F6R C;  2W63 A;  1S94 A;  4H9O C;  3UT8 A;  4NUR A;  3N2G E;  4X20 E;  3UPV A;  3KVA A;  4KVO A;  4E6H A;  4XX5 A;  1E8Y A;  2EHO C;  4WNG A;  4HLE A;  3GYZ A;  4H9P C;  5A1L A;  3TG5 A;  3ZLI A;  2OV8 A;  4CXX A;  3ZYM A;  3S7F A;  3B7T A;  1Z0P A;  4DND A;  5FQ7 A;  4GML A;  3IHV A;  4WAF A;  3KVB A;  5LYJ E;  4GYO A;  1FVF A;  3LBX A;  3ZPO A;  4BT8 A;  2YK0 A;  1EDU A;  3HKE E;  3ZYL A;  4YND A;  3SOL A;  5LCW C;  3FUH A;  3CPZ A;  4CXW A;  1SA0 E;  4C90 A;  5EK4 A;  4KMC A;  4M3O A;  2Y6X A;  2LSG A;  5LXT E;  2LT3 A;  2DNX A;  2C5K T;  4WBN E;  2WXK A;  1MQS A;  1BPO A;  4B6X A;  2HPJ A;  4JC8 A;  1IQR A;  4KP3 C;  2A4Z A;  3QAQ A;  2VKH A;  3CQX C;  4XZ4 A;  3FTW A;  3QAR A;  4MRU A;  4OK0 A;  3ZYQ A;  4EAH A;  4IE7 A;  1D1B A;  5DJQ C;  5M4Y A;  2V7I A;  5KDM C;  1ZV4 X;  2R5S A;  3OXF A;  2NTY A;  2C0L A;  4Q69 A;  2XGO A;  2UY1 B;  3MK7 C;  3AU4 A;  2CM0 A;  4UQZ A;  3MKD A;  3RYC E;  2Y48 B;  4E7Z A;  4J8D A;  2JMK A;  4EPZ A;  3APC A;  3QC9 A;  3APF A;  2VYI A;  3ZN0 B;  2VGX A;  2FUL A;  4B94 A;  3FTS A;  5JDN A;  4UWL A;  3FBL A;  3J9X 1;  3PEV B;  4KXK B;  4XE0 A;  3RO3 A;  4EQF A;  1FEW A;  1Z6T A;  1WLX A;  3LY8 A;  2HPL A;  2EQX A;  2VJ8 A;  5J2U E;  4IUL A;  4GZ6 A;  4DJA A;  1IAP A;  3NQP A;  4DBQ A;  2WAU A;  4H9N C;  5JJT A;  2I1J A;  2VSX E;  5J1G A;  1DVP A;  4Z8X A;  3U78 A;  4XI0 A;  5FY0 A;  2J4D A;  4JZY A;  5CMW A;  4ANX A;  4AQF C;  2XAF B;  5JDL A;  3ZHE B;  1WRD A;  3UUX B;  3AS4 A;  2PFV A;  3I5P A;  3N2O A;  2MYS A;  4UWG A;  2VK9 A;  4PS8 A;  3ZC0 A;  4FHK A;  5LFA A;  2E0I A;  3A5X A;  3FUF A;  2I6H A;  3AA1 B;  4G25 A;  2X9W A;  2G0U A;  3KV5 A;  4EXT A;  3UTK A;  5JH7 E;  3R7Q A;  5KJK A;  1NWM X;  2N1G A;  2JLB A;  3MYV A;  3ONL A;  1EF1 C;  4JW1 A;  2NW8 A;  1B7T A;  3QDN A;  2DBA A;  3RC3 A;  1BR4 A;  4YFS A;  2ZM8 A;  3RRU A;  3P1U A;  2EHO D;  3RC8 A;  2X6H A;  3DP7 A;  3LEW A;  3D0T A;  4P29 A;  3FDH A;  4GYW A;  3T5V A;  2KWI B;  3ZC1 A;  2WMN A;  3FUL A;  2CXF A;  2JMH A;  2X67 A;  5CB4 E;  3FEY A;  3FH5 A;  3HDX A;  4GZ3 A;  3PNL B;  2NP9 A;  3SFZ A;  4U0S A;  5HWX A;  4WWP A;  1OWM A;  2CXL A;  4N2S A;  4UVB B;  5JRE A;  4Q94 A;  3U9W A;  4C0E A;  4EZ4 A;  2J07 A;  1LKX A;  2FF4 A;  2WBL A;  1HO8 A;  1U3C A;  5G55 A;  4EZL A;  4AEZ C;  4O2B E;  5FZQ A;  1OWA A;  3ESL A;  3P8C D;  3R9A B;  3L16 A;  3E22 E;  3ZEF B;  3BK9 A;  3O9X A;  2YEV C;  3MKQ A;  3ETV A;  1D1C A;  4KBM B;  4MFR A;  2RG8 A;  5H6R B;  2OOE A;  1YD8 G;  2A2F X;  3UT7 A;  4UV9 B;  4GCN A;  1SZ9 A;  2XAS B;  3FTY A;  1IQU A;  5LHG B;  5JR9 B;  3RKO A;  3LK2 B;  4AXP A;  3ZMT B;  2XCC A;  4HN9 A;  4UI9 J;  4I1M A;  4JHK A;  5FXX A;  3HYM B;  3CVW A;  3OBV E;  4AQG A;  4CI3 B;  2FO7 A;  2CMR A;  3ZXS A;  3SS1 A;  2WQH A;  3UFE A;  5A7D B;  5JDG A;  1HX8 A;  4FI5 A;  3G2T A;  2KWH A;  3RYF E;  2XAJ B;  4ABN A;  4HFV A;  4B8A A;  2BF0 X;  3AA7 B;  5KMG P;  4I17 A;  3CX8 B;  2IW5 B;  3KD7 A;  3EDT B;  2JPF A;  3ZIM A;  3RO2 A;  2I59 A;  2NTX A;  2KZ7 B;  4N3A A;  2HM8 A;  4OVU A;  1P5Q A;  5D0O D;  3SI5 A;  4YLH A;  3FU6 A;  3CWZ B;  3HIZ A;  4WNE A;  4N78 D;  3ZMZ B;  2WXN A;  4APF A;  2KCK A;  5CCL A;  4GYY A;  2DLR A;  3PRZ A;  2Z6E A;  3L09 A;  4KT6 B;  2X6J A;  2UWJ G;  3I9Y A;  3F31 A;  3FXE B;  2LNI A;  2WSS V;  5D0Q D;  3RJV A;  3OXG A;  4L2Y A;  4AVX A;  4TUY E;  4NUU A;  3FUI A;  5FQ6 A;  2SPC A;  2GRL A;  3S4U A;  4O4J E;  1MMG A;  2PM6 A;  5ENN A;  1HTJ F;  2NOX A;  3CQC B;  1H2T C;  2N2N A;  5KX5 E;  2AVP A;  5L3D B;  4BX8 A;  1U5P A;  3C4X A;  2PQN A;  2WMO A;  2FBN A;  4L7T A;  4L2L A;  3O1H A;  2VSO E;  1E96 B;  4L1B A;  2K9A A;  4I9E A;  3C98 B;  2BDE A;  4OHF A;  2L6J A;  5JRC A;  1H2U A;  5GON E;  3O1I A;  4FC8 A;  3FH8 A;  3RRM B;  3ZW3 A;  4ANJ A;  3QJZ A;  4WBO A;  4IE0 A;  3KBT A;  3LVR E;  4IN3 B;  3ENE A;  4FLB A;  3DTO A;  3AS8 A;  4HOR A;  3C4Z A;  5LP0 A;  3EJN A;  4IIJ E;  5KJN A;  3ZCI A;  3NRX A;  2NWB A;  2LO6 A;  4AM9 A;  1EPU A;  4MS6 A;  3E4B A;  3PEU B;  4RG9 A;  2IOL A;  4PK5 A;  3RYH E;  3L13 A;  5L3G B;  4PH4 B;  3AAI A;  3RPU A;  5CA1 E;  3JCK C;  1WM5 A;  2V1D B;  3FTV A;  3FWV A;  3KFW X;  3FUM A;  2E8I A;  3BQL A;  4HXI A;  2W0G A;  1UX4 A;  3N9L A;  1ZU2 A;  4AKG A;  2MOZ A;  3OXL A;  4ME2 A;  2CLY B;  2YHE A;  2WVI A;  4N3B A;  2PG8 A;  4JEH B;  1PAQ A;  3VTY A;  4P0B A;  3CEQ A;  3PUJ A;  3QOU A;  4UQX A;  5FNV E;  1KK7 A;  4I1A A;  1JPL A;  2QY7 A;  2KC7 A;  1HS6 A;  4O4H E;  4NRH B;  4ZHQ E;  3RH3 A;  2PBI A;  3GZ1 A;  1U3D A;  4G11 A;  3ONX A;  5LP6 E;  2LEH A;  3TL5 A;  2ZLY A;  5CMY A;  2W00 A;  4X1K E;  4CI1 B;  4OFZ A;  1TJF A;  3ANW A;  2WQ7 A;  3R84 B;  2R59 A;  4NQ0 A;  2V8S E;  2OA5 A;  5F3J A;  2XRZ A;  3SHF A;  3VLD A;  1SZA A;  3HKC E;  4IGU A;  4TUU A;  3Q49 B;  4DBR A;  5DAB A;  4EIW A;  2X6I A;  1ELK A;  2WXQ A;  3ZFW A;  2CWY A;  2VB6 A;  5JDQ A;  5FXW A;  5T3R A;  4EZJ A;  4ANU A;  2J9Q A;  2MBG A;  1E7V A;  3T8M A;  5AEN A;  5FMN A;  4U8H A;  3LYA A;  2KAT A;  4GB9 A;  1LRZ A;  2P9B A;  3LVQ E;  3FTU A;  2VKJ A;  2KXP B;  2VL8 A;  2FEZ A;  3D9L A;  3URZ A;  1MMA A;  2H7O A;  1DNP A;  3RRC A;  4ZOL E;  2WXP A;  2UXN B;  2PL2 A;  3P2B A;  4QXH B;  1IZN B;  2OVB A;  3LK3 B;  3L54 A;  3TG4 A;  4KUM B;  1KLX A;  3N9O A;  1PY1 A;  2MRI A;  4HKA A;  3RRW A;  3U4T A;  1E8Z A;  4KMO A;  3D9O A;  4OYS A;  3MZK B;  1GW6 A;  2AXV A;  5L2L A;  1EZ3 A;  2X6K A;  1OUV A;  1MMN A;  3MX3 A;  3ZGQ A;  5FTP A;  3K3O A;  3HA4 A;  4P0A A;  1MMD A;  3NF1 A;  4XKC A;  3LPZ A;  1YKH B;  4ILG A;  4BY6 A;  4I2W A;  4ACK A;  5C2Y A;  3FP3 A;  1QSD A;  1NP7 A;  2YU1 A;  1MHQ A;  2J4B A;  5C1D A;  4CGV A;  4JHR A;  4CXY A;  4I6J A;  3RKV A;  3SRZ A;  2XHE B;  3UX4 A;  3S7J A;  4RG6 A;  3CR3 A;  1EYH A;  2Q9Q B;  4RSY A;  3ASF A;  1U4Q A;  5T8I A;  3HI2 A;  4QHO A;  4G23 A;  2HYZ A;  4BX9 A;  4FP7 A;  1WY6 A;  3PVL A;  3PU3 A;  2AXZ A;  4ZI7 E;  3TGO A;  4FLH A;  2GK9 A;  3HR0 A;  3SZ7 A;  4FAD A;  3UUL A;  1UN8 A;  2C5I T;  2VTB A;  3O4X E;  3E08 A;  2V5F A;  4GAA A;  4BSX A;  3JYS A;  2XGS A;  5FXZ A;  3PH0 C;  3I0O A;  4YVQ C;  1CUN A;  2L0T B;  4AXH A;  4P09 A;  3KEZ A;  5A6C A;  4LCT A;  4XZC A;  3Q9D A;  2CFZ A;  3B7R L;  4G2V A;  2Y8D A;  1YKE B;  4PJJ A;  2A5U A;  4JA9 A;  3I4R B;  4J8E A;  1JWG A;  2XPI A;  2KT9 A;  4F7A A;  4I1O B;  2BVL A;  3LJ3 A;  2RP4 A;  1YW0 A;  2XQY A;  3JQ0 A;  3GN5 A;  4O6F A;  2WXM A;  5G04 C;  4E85 A;  4M1P A;  1B89 A;  3ZMV B;  3FB2 A;  3T5X A;  2IOS A;  5L3C B;  2LJL A;  3OJA A;  2LAH A;  4I9C A;  3CKD A;  3QB2 A;  3CHR A;  3NZQ A;  4HGA A;  4WUY A;  3CLJ A;  4U74 A;  3EDV A;  5L3B B;  3CHP A;  1G8X A;  2PQR A;  4CDR A;  3N9M A;  2XCB A;  2Q9Q C;  3K8P C;  3AVS A;  4AY5 A;  4IE5 A;  5FYM A;  4A1G A;  4G24 A;  1Z3X A;  2PM7 A;  3H37 A;  2QFC A;  3I9W A;  4I43 B;  5J90 A;  1G73 A;  4TZ4 C;  5HXC A;  1MIW A;  3S7D A;  3I1A A;  4UIG A;  3Q5M A;  3VHL A;  3RRN B;  3OKQ A;  1HFA A;  3I4G A;  2W61 A;  5E0O A;  4QXB B;  3Q5W A;  3BEE A;  4U04 A;  3QWW A;  4V1A v;  4HS2 A;  1WR6 A;  2KZT B;  4H9S E;  3GW4 A;  4Y6C A;  4EEC A;  3TXM A;  3CST A;  4G2A A;  4TV8 E;  3ZMU B;  3SWH A;  1FMV A;  5LA6 E;  5JHA A;  4PAG A;  1S35 A;  3C4W A;  2GRM A;  3D9M A;  3EDU A;  3CVY A;  5E76 A;  1INZ A;  4PW8 A;  5J2T E;  3PZD A;  2RA1 A;  3KBU A;  2BZB A;  2J09 A;  1MNE A;  3CK7 A;  4FUL A;  2EHO A;  4AKL A;  2B1E A;  2IFU A;  3AS5 A;  3N71 A;  2KCV A;  4UF0 A;  5LCW J;  1MND A;  2LSY A;  3F2E A;  3IBE A;  3QK0 A;  4UWF A;  3GZ2 A;  3CKC A;  3VLE A;  2VKO A;  4GA0 A;  2FI7 A;  3FHE A;  3IHR A;  1ZKE A;  5JDF A;  3BQI A;  3CHQ A;  4GYS A;  3LKU A;  4ZS2 A;  2I2O A;  3HVE B;  2E9X B;  4FJZ A;  1UN9 A;  4U0U A;  5HXR A;  4HOU A;  2V7J A;  2RD0 A;  3FU5 A;  5LG4 A;  2LM9 A;  4GYR A;  4EYY R;  5LJM A;  2I9C A;  3EHM A;  3L6A A;  1H19 A;  3LFM A;  2X3M A;  4GMJ A;  4AKH A;  3NZS A;  3LXU X;  4AY6 A;  4GA2 A;  3FU3 A;  5LGT B;  2WB2 A;  1IJ6 A;  3HKD E;  5EZY E;  4HOT A;  3Q4A B;  3U3I A;  4JEU A;  1E8X A;  4K03 A;  4G1T A;  2X0L B;  4A3T A;  3ASG A;  4CGW A;  2IC9 A;  3PUG A;  3Q47 B;  4IYP A;  5L3F B;  4FU3 A;  5FQ8 A;  2CFU A;  4TX5 A;  3SD5 A;  4UVC B;  5FXV A;  4XI9 A;  3MA5 A;  4W9R A;  4I4T E;  4YHJ A;  4ZS3 A;  4N5C A;  5JDH A;  4TV3 A;  3ASH A;  3CV0 A;  3PU8 A;  3MJX A;  5BV1 A;  2H7V C;  3AB3 B;  2Q9Q D;  3FY4 A;  4JA7 A;  3PUS A;  3N9Q A;  1XGW A;  2WXR A;  2M63 A;  3P7I A;  2MOW A;  3ESK A;  3LBX B;  4TRQ A;  5DIZ A;  3CHM A;  3L3P A;  5JJ6 A;  2E9X C;  4JXT A;  4Y6W A;  2JQQ A;  2JEK A;  5H6Q B;  5ETW A;  1N52 A;  4J2C A;  3IBP A;  5C8Y E;  3IV0 A;  5HI7 A;  3FFL A;  3CVX A;  3LG7 A;  4QFV A;  3M65 A;  4AQF A;  4DI3 A;  5AYW D;  5JJ7 A;  3CX7 B;  1D0X A;  2WXF A;  5FT9 A;  3MXZ A;  2H3R A;  5JR9 C;  2Y3A A;  4HOS A;  5JQG E;  4CEM A;  1ELW A;  4I50 E;  3B13 A;  4JUY A;  3N9P A;  3C64 A;  2DWK A;  4BTB A;  4UV8 B;  4ILI A;  3QUJ A;  2YHC A;  2CCQ A;  5G05 C;  4EZK A;  3AAE B;  2XPZ A;  3NBX X;  4XKB A;  2UY1 A;  1N54 A;  5EK3 A;  1OWO A;  3PUR A;  1ZHC A;  3RYI E;  3TAX A;  3IHY A;  3GN5 B;  2Y4U A;  3ASD A;  3WAK A;  3QNK A;  2DIW A;  2OND A;  2VSN A;  5HYA A;  1FIO A;  4UWH A;  1LVF A;  3GWH A;  1KT0 A;  4A55 A;  2ZM0 A;  1NA3 A;  1BR1 A;  1UG3 A;  2Q7F A;  2LAI A;  2X9X A;  5KJM A;  4CT0 A;  4O8S A;  1UCU A;  4GZ5 A;  1WYC A;  4NUV A;  1LF8 A;  1AJ3 A;  4LER A;  5LJN A;  2XAQ B;  3MKR A;  4J8F A;  3R6N A;  5KCM A;  3LK4 2;  2IJG X;  3B57 A;  2VGX B;  4ERR A;  4PS3 A;  1X79 A;  3EVY A;  2CG3 A;  2CHX A;  4MLP A;  4UVA B;  4OYJ A;  3PUQ A;  4HTE A;  1SQM A;  1FCH A;  2QGS A;  4I55 E;  5LNK A;  3L17 A;  2CG2 A;  1H7C A;  2KLQ A;  4MKT A;  4ILU A;  3PUK A;  4U72 A;  3ZHE A;  1HG5 A;  2KM4 A;  3UUX A;  4L5G A;  3K3Q C;  4N39 A;  3JUI A;  2LHR A;  4I2Z A;  3ML8 A;  4DMW A;  3CML A;  4PUC A;  3VKG A;  1YA0 A;  5LHI B;  2LSJ A;  5BUZ A;  2LSU A;  4GK0 E;  4OYK A;  4EZH A;  1BR0 A;  3MEK A;  3MCX A;  4C0M A;  3O4Z A;  4PK6 A;  4ISS A;  2IC6 A;  1VRB A;  4LUN U;  2K5B B;  3AA6 B;  2E2E A;  4QX8 B;  3ZN1 B;  5LGU B;  4BJN A;  2CHZ A;  2OVF A;  5CCM A;  2CA5 A;  2Y4T A;  3VTX A;  4DVD A;  3DJB A;  2HO1 A;  5LBQ B;  5BPP A;  3DBS A;  4J6I A;  2NXP A;  2IQC A;  4GA1 A;  5FZR A;  3HHM A;  2L9Q A;  2LE8 A;  5TAO A;  2YNQ A;  4K0R A;  4CDM A;  5LX8 A;  4C9B B;  1OXZ A;  3CVN A;  3UMV A;  3CQG B;  2AWI A;  3TKL B;  2E9X D;  2VGY A;  4EBA A;  4C91 A;  2VAS A;  4IE4 A;  2L3L A;  1HE8 A;  3RU0 A;  2CLY C;  3KV6 A;  3C51 A;  5EX3 A;  3MKQ B;  1HU3 A;  4ACL A;  5J08 A;  5JR9 A;  4UXN B;  1ZEE A;  4YJ2 E;  3O1J A;  2ZU6 B;  2ILR A;  3PNT B;  4KBQ A;  3ZYK A;  5HXS A;  2X38 A;  3OYX A;  5HXE A;  1NZN A;  4L0R A;  3JQ1 A;  4A56 A;  4UWK A;  3G2W A;  2JRK A;  4AJW A;  3N2K E;  4D10 C;  2NW9 A;  2C0S A;  4WWN A;  4BWR A;  3LS8 A;  3ZJ1 A;  3QK6 A;  3SGH A;  3QWP A;  3HL6 A;  3EHN A;  4H7Y A;  2ODV A;  4QX7 B;  4ILH B;  3JC6 C;  5JHB A;  2WXG A;  4CQI A;  3Q15 A;  3EIJ A;  4FJO A;  3QKY A;  4LRZ A;  2D2S A;  3BG0 B;  1VDY A;  3FUD A;  4DMV A;  2X9Y A;  3IEE A;  3GA8 A;  3FUJ A;  1HH8 A;  1Z3Y A;  4O4I E;  3LDZ A;  1D1A A;  5ADX L;  2PJQ A;  3KAE A;  1A17 A;  4GCO A;  5KJL A;  2R17 C;  4MHC A;  3PE4 A;  2IF4 A;  4ANV A;  4I6E A;  2CEA A;  3CHS A;  1T98 A;  4MAL A;  4UEL A;  5BT1 A;  4H63 H;  2V7L A;  3CK8 A;  4PJL A;  5HXH A;  4H63 V;  4BTA A;  3KV9 A;  2QA7 A;  5DBK A;  2L9B A;  1H2V C;  4U0Z A;  4H7X A;  4PJN A;  3PDN A;  5EK2 A;  4DPR A;  4L9I A;  3CHO A;  3H3A A;  3C98 A;  3PE0 A;  3GMI A;  4L23 A;  5EDS A;  2C5J A;  2N9D A;  3FUN A;  3FEX A;  2ES0 A;  4KVM A;  2A72 A;  3KV4 A;  3G2V A;  2WQ6 A;  4JHJ A;  5ARF A;  5JRC B;  3FTZ A;  4TV9 E;  3CVL A;  2DI4 A;  2IAK A;  4N3C A;  1VOM A;  3HKB E;  4O4L E;  1KT1 A;  5LCY A;  1OWL A;  4V3I A;  3CX6 B;  5AJD A;  1FVH A;  1QQE A;  1TEZ A;  3D3M A;  4WW0 A;  4DO0 A;  3WAJ A;  1NA0 A;  2X66 A;  4UI9 C;  2XAH B;  3LJC A;  5AJL A;  1HS7 A;  3E0Z A;  3QWV A;  2L0I A;  2CXD A;  4J8S A;  4APO A;  5BMV E;  2ION A;  4AV7 A;  4MBQ A;  1Y6I A;  2VSY A;  2X51 A;  4B89 A;  3F57 A;  3IKO B;  2P58 C;  4HEA A;  3D9J A;  5FZS A;  4BA9 A;  3FXD B;  3MJW A;  3VU7 H;  2LSI A;  2WWU A;  4JVS A;  2BTD A;  4I6G A;  1Y8M A;  4JEH A;  3FUK A;  4FHJ A;  3NRY A;  3UUN A;  4H9Q C;  3AU5 A;  4YJ3 E;  2YQ8 A;  3AA0 B;  3ETU A;  3LY7 A;  4URK A;  5LGN B;  2VWA A;  3ZCJ A;  4CRW A;  2D0T A;  3KDS E;  3DPD A;  3PS6 A;  2LHN A;  4XAX B;  2LOP A;  5HAX A;  2W62 A;  5BW8 C;  3APD A;  1D0Z A;  1US7 B;  4ZI3 D;  2XTL A;  1HZ4 A;  5JVD E;  2KND A;  2XUE A;  3PTR B;  3SBT B;  3RK6 A;  5DQV A;  4DI4 A;  3U3W A;  3R7R A;  3ANW B;  3FU0 A;  3JC6 D;  2DWG A;  2DCP A;  1TJC A;  4F1S A;  2XPY A;  2NC9 A;  1HXI A;  4GOU A;  5BV0 A;  3UT4 A;  5HQ8 A;  2YU2 A;  4WWO A;  5EX0 A;  4FA6 A;  4HVB A;  2KIN B;  1H6K A;  4QWN B;  2V4L A;  4MLK A;  3UT5 E;  2MHK A;  5IHY A;  1QNF A;  2NSZ A;  5CHE E;  3ZRH A;  3OTN A;  3I3N A;  2AXU A;  2V7M A;  4B0Z A;  2JJ9 A;  2WPV A;  2ZM2 A;  2X9H A;  4AI6 A;  4LEU A;  1IJ5 A;  3PE3 A;  3ONK A;  4G26 A;  3J7Y q;  4BT9 A;  1X5B A;  3MV2 B;  2ACX A;  4QXC B;  4NAC A;  4PFP A;  5ARG A;  3WXX A;  4UI9 K;  5AFU L;  4IRU A;  5HWY A;  4IHJ E;  5G04 J;  5EKQ D;  1HCI A;  4ADZ A;  4DK5 A;  3MZL B;  4CT4 A;  2YIN A;  2BUG A;  3SNX A;  2V7K A;  4KZC A;  1OWP A;  1SHZ C;  5CA0 E;  4WNK A;  3AVR A;  5FY7 A;  3WI3 A;  3C50 A;  3FTX A;  2XAG B;  1E90 A;  3IF8 B;  3QC1 A;  4KZ0 A;  5FJY A;  2L8K A;  1KNZ A;  4UEM A;  3VKH A;  2VKD A;  2BVM A;  2D0U A;  1UJK A;  4GZD A;  2XEV A;  1WYB A;  1UJJ A;  3VLF A;  5LBM A;  3CSF A;  4QKN A;  3K9I A;  4ATG A;  5BNW A;  3CKB A;  1BR2 A;  4CI2 B;  2XHE A;  3EUH A;  2D5U A;  2Q9Q A;  2X68 A;  3PUA A;  3EIQ C;  2LSV A;  2J08 A;  3D9I A;  3OAW A;  1NAF A;  2M67 A;  1S0P A;  4CZZ B;  4GIW A;  3PRE A;  4JPS A;  3U64 A;  3CVR A;  4CDN A;  3KS2 A;  4PNI A;  3CIA A;  1XNF A;  1IYG A;  3CVP A;  3K3N A;  3TXN A;  4WND A;  4TN7 B;  3G2U A;  4G63 A;  2AW6 A;  3MV3 B;  2ODU A;  4PDX A;  4WNF A;  2VTB B;  5ANL A;  3B7S A;  3GZS A;  4XIF A;  4IDZ A;  3S2A A;  5FP3 A;  4R7L A;  2CWO A;  4ZI2 C;  2IU1 A;  3ZPJ A;  2PZI A;  5DQW A;  3CGH A;  1IHG A;  2WM9 A;  3SBS A;  4Q96 A;  4AP2 A;  2MTQ A;  2V26 A;  2XRY A;  5AIJ A;  4E7S A;  4X1Y E;  4EB6 E;  4GZC A;  5LOV E;  4PS7 A;  2HR2 A;  3CVQ A;  5FY1 A;  3FHN A;  4GU5 A;  2C2L A;  4AIF A;  3L22 A;  5F8P A;  3KIN B;  3W15 B;  3ZN3 A;  1WAO 1;  1FMW A;  1QUU A;  2CE7 A;  5FWQ A;  1W3B A;  5JDM A;  1HG2 A;  3AAA B;  3ULQ A;  2K24 A;  3D9N A;  4A3V A;  3MA9 A;  4EYU A;  3CK9 A;  3Q2M A;  3O48 A;  1Y64 B;  4JLE A;  4K0U A;  1JWF A;  3L08 A;  2LSK A;  4DLO A;  4I43 A;  3B7U X;  5LOZ A;  5T4Y A;  4UQY A;  3Q5X A;  3RIB A;  2DHR A;  3U66 A;  3ZMS B;  3NZP A;  3PDY A;  4AKI A;  3SF4 A;  4ANW A;  4HE8 A;  3TJP A;  3OYZ A;  3T8O A;  5ANR A;  4AKR B;  3LY9 A;  4CCA A;  1MIV A;  3LCA A;  4PJM A;  2ZMA A;  2XQ0 A;  2KZT A;  3ZJ2 A;  2K48 A;  4X1I E;  3D9K A;  4XBF B;  2CHW A;  1O3X A;  1E8W A;  3V5S A;  2J1D G;  1E1H B;  2UXX B;  4A1S A;  4AOF A;  4HFG A;  5G2N A;  3MGB A;  3D9P A;  4N2Q A;  1UX5 A;  4IST A;  4PFO A;  5L3E B;  1ELR A;  4EOZ B;  4H9R C;  3RX6 A;  4PK4 A;  3UUM A;  4O2A E;  3IEG A;  3ZVV A;  1ZBP A;  3MAC A;  1HF8 A;  3G2S A;  1QZ2 A;  3FH7 A;  4FJY A;  1V9D A;  2EHO B;  3N9N A;  4F3V A;  2LOS A;  2WXH A;  3FBZ A;  4UF0 B;  2C0M A;  5LHH B;  2KMF A;  3CVU A;  1H0A A;  1UW4 B;  2J49 A;  4EBA G;  2V0P A;  2WXO A;  4BAY B;  5IYZ E;  4BJM A;  1E7U A;  2WXI A;  4RVB A;  4DLQ A;  3HVE A;  2E9X A;  4B8C B;  2X6F A;  3V5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...