2WMOA

Structure of the complex between dock9 and cdc42.
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
423
structure length
403
Chain Sequence
STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEAHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVAGPLAYARAFLDDPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
total genus 149
structure length 403
sequence length 423
ec nomenclature
pdb deposition date 2009-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wmoA03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wmoA01
2WMOA 2WM9A 3B13A 3VHLA 2YINA 2WMNA
chains in the Genus database with same CATH superfamily
3Q5WA 3FTXA 4IDQA 4JA7A 3HRAA 4FJYA 3CVYA 1UN9A 5KJKA 3QK6A 4X64T 2H6IA 3JYSA 5EDSA 3SI5A 4JI2T 5IYZE 2B0OE 5ABFB 4LEUA 2UXBT 3BG0B 5KJNA 5ENRD 3CVNA 3O4XE 2VGYA 2EHOD 3FB2A 3TLTA 3WAKA 5JDMA 5EZYE 3QWWA 2BG9E 3QB5K 1NAFA 2BG9B 3JC6D 3BQLA 5EK4A 2KZ7B 1BR1A 2WXQA 2NTXA 4DI4A 3DEPA 1SA0E 1HZ4A 3M65A 1WY6A 2MAWA 1BPOA 5ITZF 1MYOA 2EILE 5KDMC 3HXEA 3KVBA 2Y4UA 4X66T 3ZEFA 3ZW3A 1E7PA 3R9MA 4QH5A 4I50E 1E7VA 4X20E 1HFAA 3AEDA 1TNOA 1KLXA 5JJTA 3QK0A 4AEZC 4LF8T 2VWAA 1HR0T 2VJ8A 2XAHB 3PZ2A 4TUYE 3SFYA 3AJIA 3QB5A 4EB6E 5CECB 3BQOA 3MKDA 4YVQC 4OFZA 2MPKA 3WG7E 3HKEE 3SY2A 5L4HA 2EIME 4EBAA 3G06A 2YEVC 4CDNA 2WDVA 2FBWA 3EDUA 3PJAJ 3CVPA 4YTNA 3Q75A 3AS4A 5KBAA 3PEUB 3E08A 4ZXLA 3HDXA 2Q9QC 2F8YA 4UXNB 5HQ8A 4HI8A 3FFLA 3PUGA 3PUXF 4GA0A 2WXKA 4GMLA 4AKLA 1IQRA 2CHWA 2LXMA 2W0GA 3P2BA 3E4BA 4U0UA 5HWYA 4L9IA 4MBGA 4V1Av 1BD8A 4HWCA 2AXVA 1TEZA 1V9DA 2M63A 3MACA 2CE7A 5FQ6A 4MHCA 3NZUA 3SNXA 2Y6XA 4KMOA 3CX7B 3AXJB 3CHSA 2H7OA 1N33T 4B3TT 4Z91A 3SBSA 3RJVA 2K9AA 4QHOA 2SPCA 3FWVA 4BT8A 3LSVA 3ZC1A 4U0ZA 2I6HA 2PJQA 1UCUA 3E22E 3P7IA 1XNFA 4NIKA 4AV7A 2XS8A 3PUJA 3UU4A 4AY5A 3ZT5A 3D9PA 4HFHA 1Y64B 3I1AA 4JI4T 3FTYA 1KT0A 3U78A 4RG9A 3OBVE 4J6IA 3TKLB 2GRLA 2WSSV 3RKOA 3Q15A 2E9XC 2P58C 2IU1A 2XEVA 3KBTA 2JABA 4CXYA 3VLFA 3RPUA 4HOTA 3V31A 4I6JA 4ISSA 3ISMC 3PUZF 5GONE 4BTAA 2LT3A 5L3EB 1BR2A 5EKQD 3W9FA 2XQAA 5KMGP 3GN5B 1KEYA 2V26A 2ODVA 2XEHA 1H7CA 2WXIA 3V30A 2M67A 3ZYQA 4KBMB 3EDTB 4I43B 4IN3B 3SO8A 3CK8A 1FEWA 3FH8A 1JCRA 2LAHA 1JUQA 4LG6A 4TNVA 3PZ3A 3KVAA 5L3CB 5FVKA 4AXPA 2FBNA 2LEHA 3VU7H 4JVSA 3AB3B 4H9PC 4DIDB 5HRYA 4XEIG 4C0MA 4RSYA 2L3LA 3L39A 1V54E 2XEEA 3HXFA 4Z90A 1TNUA 5AQVB 3D9LA 4RG6A 3O1IA 2KWHA 4N3CA 1YCSB 4Q69A 3HG0D 3CKDA 1SZAA 3SFZA 2DHRA 4ACKA 4U3CA 3FZKB 2WS3A 1QNFA 1HX1B 2DZOA 2ZGGA 2LSJA 3FHNA 3ESKA 4ME2A 1IBKT 3L9TA 3RIUC 5H6RB 4C91A 3D3MA 4HRNA 5LOVE 3SOLA 2J07A 3HXBA 3G2SA 2VSOE 4UF0B 3ZYKA 5L3BB 2V8SV 4NURA 2CHNA 4XE0A 2FO7A 2L6BA 2DNXA 3PZ4A 4ZS3A 3JAEA 3C4XA 3ETUA 4TN7B 1OCRE 2V8SE 3UTKA 4YSZA 1K8KG 3B7TA 3HIZA 4DPRA 4B94A 4DK5A 2DI4A 2N1GA 3FEYA 1ELKA 5D0QD 4I9EA 2VL0A 4TV8E 4E85A 2N9DA 1E7UA 2C0MA 2C5KT 5AIJA 4C48B 3HKCE 4DV6T 4CDRA 2ZM0A 5LG4A 4BAYB 3Q5DA 1FT2A 4PK4A 2NYJA 4GZDA 2JQHA 2X66A 2PL2A 3SWHA 4TV9E 2P9PG 1JNRA 2A2FX 3C4WA 2DWGA 1NP7A 4CDMA 4HWIB 3B7BA 4P1NA 5JDFA 5AQPB 2L9QA 4HGAA 4F6RC 3PUYF 4GK0E 1W0BA 2XQ7A 3SFEA 4ADZA 4HE8A 3GZSA 4A5XA 4I1AA 3D9NA 2CM0A 2LKGA 4GK5E 2WQHA 2XGMA 3X2QE 3L09A 3UU8A 1QQEA 1N54A 5C1DA 4GCNA 4YDWA 2XQ9A 5LGNB 4ILUA 1EPUA 2V6YA 3UQ3A 3ZT6A 3BQKA 4JI8T 4GPKA 3J7Yq 2FO1E 3C98B 4JBWF 3Q5XA 4DMWA 4O6FA 1T72A 4KUMB 2DCFA 2X6JA 5IWAT 3TWQA 5JJ6A 4A55A 1R8IA 3MXZA 5J2TE 2KCKA 1HO8A 4CXXA 2XQ5A 5T8IA 1T8BA 4GTPA 2K3WA 3AE7A 4B93B 3HR0A 4O4HE 2LNIA 5LYJE 3L3PA 4HWDA 4FC8A 3RRNB 5AQQB 1MX4A 3L22A 4U07A 1W0AA 3EHZA 1FMVA 2JLBA 3HVEA 1HF8A 4DV4T 1NEKA 3H37A 3X1DA 5DQVA 2LM2A 2D0TA 3P8CD 4TWHA 5FXXA 3APCA 2ACXA 4G8LA 5HKPA 5KJMA 2L0IA 4HOQA 5FKYA 4N2QA 2P9KG 5FINA 2XCCA 4TUMA 4UI9J 2A5UA 4LMKA 2Q9QA 4GZCA 5DIZA 2Y69E 3C3RA 4PNIA 3FXDB 3FZMB 4U7YA 2VQET 1MX6A 5IY5E 2Q9QB 2W00A 4MLKA 3FUMA 3I0OA 3AG3E 4CZ2D 1OWMA 1OEDE 1E8ZA 4UELA 3HXCA 4PS8A 4IDZA 4TV3A 4LSZE 2DYSE 2VQ2A 5CJ5A 4GU5A 3O48A 1SHZC 4CN1A 1S63A 2I1KA 2M6IA 2UXCT 5EYPF 4I55E 4EQFA 2E5LT 2NW7A 5JDQA 4DRXE 3F57A 1AJ3A 3EABA 3OPCA 4FHKA 2L0TB 5G04J 4EZKA 2G0UA 4X65T 2XUEA 3M3ZB 4H7YA 3C72A 4XIFA 5FQ8A 4AXHA 3ZSTA 5A23A 4QH1A 2BEDA 1DCEA 4AM9A 4DV5T 2BDEA 2RPAA 3ZMTB 5FP3A 3PS6A 1B89A 2V6XA 2KXPC 2QA7A 5A1LA 1KZPA 4D10C 4JEUA 1HE8A 4K0KT 4ZOLE 5G2NA 3SHFA 4HLLA 5HEHA 3L8RA 4HBDA 1Z8UA 5ENSD 2H7VC 2CHOA 2W61A 4LRZA 2HM8A 2J9QA 4WAFA 2LHNA 3B13A 4P0AA 1LKXA 3ZMUB 2IUBA 3AAAC 4ZI2D 2F8XK 3MJXA 4TRQA 2P9UG 4KYOB 4CGVA 3AEAA 4MFRA 5CHEE 1KF6A 3ENEA 4H9RC 3RLFF 2OCCE 4UVBB 5CFBA 3IEEA 2X9WA 4GYWA 3TXMA 2DWZA 3L6AA 4KT6B 1S94A 2C0LA 3HKBE 2X0LB 2JQ9A 3QB2A 2VSXE 5CEAA 5AQJB 3PV0F 2VKHA 4B8CB 3I9WA 4CCAA 1UX4A 4WWOA 2WQYA 3E37A 5HXCA 4Z8XA 3SFXA 4G2VA 4M3OA 4L9PA 2K48A 3LJCA 3QNKA 4AY6A 3RYCE 1N4QA 1T98A 4KVMA 1OCOE 2CXLA 5AQOB 2NW9A 4ILAA 4YVOA 3QAQA 1NL4A 2FJBA 3PE0A 2W62A 3VR9A 2LHRA 1D9SA 2BKNA 4JEUB 1P5QA 2LSKA 2KWIB 3BEEA 3FY4A 4Y6WA 4ZEYA 3TWXA 2BVLA 4O2BE 5BXOA 3N71A 4NUVA 1MZCA 5L2LA 2WMNA 3FZHB 2VL8A 4LNBA 3U3WA 3TWRA 1XDPA 3S2AA 1NI1A 4GYOA 2X9HA 2I59A 3ZFWA 2QRXA 3E33A 1CHUA 4QH4A 4GTVA 5HI7A 4EPZA 3U3IA 4UV8B 3CHMA 4FA6A 4TX5A 4CI1B 3OAWA 3D9KA 3E0ZA 4JI3T 4MS6A 2V7KA 4ANWA 4BT9A 4L23A 2RFMA 2XHEB 4WWNA 3NQPA 3UM1A 4B8AA 1XWMA 2VVNA 4GTSA 1N0QA 4I2WA 4DMVA 4G8KA 2HN2A 3CPZA 3N9LA 4AJWA 3UUXA 3SRZA 3GA8A 1U5PA 3GMIA 4YDYA 3RRWA 2LM9A 3T8OA 2NSZA 3LS8A 5FL0A 5HEUA 4I43A 2BKPA 3UKUG 1IBMT 4O1PA 5B1AE 5LBMA 4OHFA 2XQ0A 1JWFA 4JI0T 3Q47B 3L13A 5KWDA 5IHYA 2WPVA 1E96B 4FLHA 4NIQA 2PQNA 4CRWA 4GTRA 4K5CA 4WNEA 3R9AB 3TXNA 4AI6A 3PRZA 4CYMD 2LSVA 2AVPA 2NTYA 4XBFB 2ZM8A 1HS7A 3NKZA 2WXNA 4HS2A 1LRZA 4ANUA 4N2SA 5AQUB 4DBRA 2E2EA 3VR8A 1W09A 3ZCJA 3FTSA 2V5FA 4LUNU 4BEPA 4UVAB 4ISTA 4QWNB 3AEBA 3QWVA 1MNDA 3AE5A 1PY1A 1E8YA 4U8YD 3QC9A 4HRLA 1OEDC 2IONA 2QVAA 2HPLA 2GRRB 2C5IT 4NUUA 3ZUVB 3AECA 4YTMA 1YXRA 1WYBA 1L5JA 5JHAA 3RGLA 3IBPA 3UINC 3Q79A 5F3JA 1JPLA 3D0TA 3ML9A 4AIUA 3SF4A 4PFOA 3RC3A 3NOGD 4YNDA 1U2VG 1OWOA 3ZPJA 5ABEA 4J8DA 2CMRA 5ADXL 3FTWA 2A72A 5J2UE 3UM2A 2A3DA 2RP4A 1SUMB 4PH4B 2UY1B 1NFIE 3V79K 3MK7C 5C3JA 3UXGA 5FT9A 3RIFA 5AARA 2YDSA 2DIWA 3U64A 2MOZA 2FULA 3EUVA 3ZN1B 5ABHA 3FP3A 3PUAA 3MEKA 4K0UA 3UU5A 5AQNB 4OYJA 2KLQA 2I0MA 1JNZA 3CEQA 4ILCA 3IHRA 1ZV4X 4OVUA 2A9UA 3J5PA 5M4YA 2WDRA 4XKCA 2XQYA 3EDVA 3LXUX 5CEDB 1UGOA 2XZDG 4ATGA 3TLWA 2FEZA 1X79A 3N2KE 4OK0A 1UG3A 2XAJB 3K3OA 5AQFB 2NP9A 1FCHA 4LFAT 1OWLA 4ANVA 4O8SA 2BKKB 3MKQA 3OTOT 2XPKA 4NPPA 4B3MT 2E9XA 4HFBA 4HB5A 3RX6A 4PJNA 4CGWA 1X81A 4FULA 3HKDE 1V55E 1I6ZA 2IAKA 4G2AA 3NRXA 5KXJA 2BS4A 3K3NA 4JA9A 4KXKB 1FVFA 1OY3D 2AXUA 4GYSA 5L3DB 1KPSB 4ANJA 3PE4A 2P9SG 1DVPA 3LCAA 5EIBE 5CA0E 1LD7A 1J1JA 2KINB 5E76A 4N5CA 4GYRA 2BUGA 3GYZA 2RA1A 3ZN3A 2J1DG 4WUYA 3EU9A 3UUXB 2VKJA 4DVDA 2HE0A 2X6FA 1E2AA 2VYIA 4RLYA 4WYVA 2CPTA 1T7SA 2DBAA 3U9WA 2P9LG 3CQGB 3EU5A 2DYRE 2GW1A 4NXNT 4L2LA 3CK9A 2PM6A 1IJ6A 4UIGA 2EHOA 3MKQB 5JTGA 3PVLA 5CCMA 3EIQC 4U96D 4WNFA 2LJLA 1MMDA 3CQXC 2OLTA 3WAJA 1N0RA 3N2GE 4LF5T 4C90A 4UWGA 4I2ZA 3H3MA 2X9XA 4JEHB 1EZ3A 4UQYA 4F1SA 5D66A 1N9AA 4F6RD 3OXGA 1IQUA 5EX0A 2XM2A 3PZ1A 1BU9A 5CBOA 2HPJA 3P4QA 3W9GA 5BMVE 4AKIA 3VLDA 5AQ9A 3OTNA 1BI8B 2WZIA 3FU0A 3ABLE 3PUVF 1BI7B 3MV3B 1SVXA 4WBNE 3QWPA 2NC9A 1RW2A 3OJAA 2P9BA 2RD0A 1UUSA 2M6BA 3RKGA 2WXOA 1JCSA 1X5BA 1E1HB 1OXJA 2YDQA 3ONJA 5C8YE 2B6CA 1J5WA 3JAFA 3RSEG 2WWUA 1QLBA 4GTMA 5EIDA 3FZFB 4LF4T 3AA6B 2VB6A 3AEEA 3FHEA 5EK2A 4N3AA 1TJCA 5JA4D 5T3RA 1M62A 4BESA 2WCAA 3TG5A 1X9BA 3FH7A 3LFMA 3CQCB 4G1TA 5JVDE 5JDHA 2IO3C 3C3QA 4EZ4A 3TG4A 4TZ4C 4J7WA 2CCQA 5AQGB 2WXHA 2DLRA 5AENA 2VTBA 2NR4A 4B3RT 3G2WA 1YW0A 4UWKA 3W15B 3EIJA 1I94T 2R59A 3NZQA 3VKHA 1XNRT 3GZ1A 4F7AA 4APFA 3R84B 3KSQA 2H89A 3CX6B 4XAXB 3PNLB 3CR3A 2FJAA 2ILRA 3D9HA 2QY7A 5FL1A 3OKQA 1YQ3A 4U33A 2D0UA 2JPFA 5LMNT 2GRNB 3HHMA 4UR9A 3ZYMA 3DSUA 1YQ4A 2YU2A 2VKOA 5G05J 3LPZA 2KT9A 3KDSE 3CVWA 2J8SD 1S35A 3S7FA 1NZNA 1UX5A 2I2OA 5T4YA 3B7SA 2OVFA 3KV4A 1S0PA 1BR0A 3U66A 2ETBA 3K3QC 3ANWB 4B6XA 4AKHA 3KSLA 2PNNA 4EGWA 2J4BA 1XMQT 3LK2B 2ZMAA 5LBQB 5BR8T 1Y8MA 3N9NA 1US7B 2CLYB 2IW5B 3G2UA 4DX2A 2GRMA 1KNZA 4HVBA 3AAEB 2J49A 4O60A 4XI9A 5J1GA 1N36T 3RK6A 4GYYA 2X0HA 3NBNB 5E75A 4I6EA 3IHYA 4WBOA 3UT5E 5JHBA 2YKSA 4W9RA 3RH3A 5B3SE 4APOA 2X0YA 3NZPA 3SZ7A 1LVKA 4HN9A 3TLVA 3UMVA 3H3AA 4OYKA 2HYZA 4PUCA 2WMOA 5FYMA 3L16A 1HH8A 4B89A 5LMUT 3AU4A 3V5SA 2H88A 1U3CA 3DWLG 3FH5A 1W3BA 1H19A 2BF0X 1UURA 4JI6T 2UUAT 2AE9A 4JHRA 2BG9A 3ZC0A 1GW6A 4KVOA 5JR9A 3VHLA 2OV9A 5A6CA 3I4RB 4BJNA 2QYWA 4KMCA 2P9NG 3IHVA 5LHIB 3UUNA 4MALA 1JCQA 3HA4A 1BLXB 5JJ7A 3TLUA 3LDQB 1N11A 2RG8A 2UUCT 3AE6A 4ILBA 3CVQA 4NRHB 4ZHQE 3ZKJA 4EXTA 3C5RA 3NZSA 3QDNA 3P50A 4U8HA 2IQCA 3ASOE 5HEGA 1O1TA 2VGEA 1D1BA 4HTEA 4FLBA 4CZZB 4A63B 3JC6C 5IUXA 2IC9A 1K3ZD 4DX7D 2KMFA 2NW8A 2WDQA 4L7TA 2QYUA 3UQ7A 2V6YB 4N78D 2LSYA 4HFGA 3RO3A 3ONXA 4DR5T 3D9IA 4CN6A 3N2OA 2XTLA 3GW4A 3LEWA 2XZEA 2J09A 4IHJE 4YLHA 4FI5A 1UK5A 2IHR1 2NWBA 4GZ5A 2WZHA 1SW6A 4ERRA 2XZTG 2XJ7A 3TL5A 1U4QA 3FUNA 3ML8A 1DNPA 5HS0A 3P4WA 4ABNA 3UU3A 5LG3A 3T9KA 2XGOA 4CXWA 1Z5SC 1OWPA 4EBAG 1WG0A 4UEMA 2LSIA 1AP7A 4YHJA 3EJNA 4F3VA 4ACLA 4O2AE 3EI0A 3ULQA 3K1SA 4J8FA 2FJEA 4JHJA 3QC1A 3P4RA 1XGWA 3PUSA 2VSNA 3DEOA 4LF7T 2WXGA 3ZKRA 5HEJA 1TN7A 4DR6T 1WRDA 2BTDA 3LDZA 1NA0A 4HLEA 5JR9C 1OT8A 5C2YA 3VTYA 2CA5A 2MYSA 2N2NA 2XSAA 4X1YE 4YJ2E 1H0AA 4P29A 3MX3A 2I1JA 3ANWA 2E9XB 3ZN0B 3N9MA 3ZCIA 4AKRB 1IHBA 3NBXX 3AA1B 5FZRA 2X6KA 4IRUA 5EN5D 2W63A 3NOCD 2FF4A 3EUHA 1WCRA 4H9NC 5EK3A 4ZI2C 4Q25A 4UF0A 5LJNA 3NAWA 3ZIMA 5BUZA 3KEZA 3EHMA 4F8HA 2DL1A 1G8XA 3A7MA 4KBQA 4MLPA 2D2SA 3Q7FA 1IYGA 3I3NA 5LXTE 1UN8A 3LG7A 4LMLA 1TN6A 4XZCA 4J8YA 4H9OC 4AQFC 4HWHA 1H6KA 4K0RA 3C51A 1HNXT 2WU2A 1A5EA 4WWPA 4I0UA 5CRVA 3QARA 4DR3T 1WR0A 2EINE 2ZISA 5HXRA 1IXVA 4G63A 1HG5A 1ZP0A 2BKGA 3ASGA 4U95D 2R2LA 4DX5D 4I17A 3NWIA 2B1EA 5BV0A 5FXVA 3LVQE 2Y3AA 3PUKA 3EHRA 4FHJA 3PNTB 5ANLA 2JJ9A 4PW8A 2VTBB 2F4VT 2WXFA 3FUIA 5CMYA 5F8PA 4DUIA 2XQ4A 4WNKA 2BG9C 3FBLA 4EYUA 2XSBA 3C98A 2F37A 2V7MA 3SQVA 4AP2A 2WQ7A 3JQ1A 3R6NA 3RRUA 1J5ET 4CN4A 4KHPT 4BETA 1KNRA 1XMOT 4ZFHA 2PFVA 1Y6IA 3GN5A 2CFZA 3D9MA 5M72A 2CG3A 3UT4A 3KS2A 3FU6A 5DJQC 5L4EA 3ZMVB 2QGSA 1N52A 4IT4A 4I1MA 1S64A 3QJZA 1LVFA 3DSTA 4H9SE 4DLOA 4JB8P 3CGHA 3HXDA 3U4TA 3ZSSA 2KM4A 4GOUA 4X1IE 3CV0A 3ZMZB 4XX5A 3RYIE 2KSRA 2VASA 1WAO1 4M7CA 4ZS2A 2CXDA 3WI3A 2EIKE 3TGOA 2VVSA 4A1GA 3S7DA 2IF4A 3L17A 4IDNA 5JREA 2HN1A 4GMJA 4TWDA 3DP7A 2ZM2A 3GZ2A 5LP0A 1D8DA 2BKOA 3RIAA 3AXJA 5FXWA 1ZEEA 3PURA 5HCJA 3AA0B 3JUEA 2W2UA 4DV3T 4X1KE 3CHOA 4G26A 2XCBA 3DSWA 5BPPA 3O9XA 3URZA 5AYWD 4OAUC 3APDA 3PEVB 3ASNE 3ZEFB 4OVVA 2P2CP 2CBJA 5JDNA 1MMAA 5AQIB 3CVXA 4FADA 2V1DB 1TNBA 4L2YA 3Q9NC 2R5SA 3RO2A 4YHHT 4ZHBA 2L8KA 3LJ3A 5G55A 2A5EA 5EILA 2E5VA 4HOUA 1UOHA 2XPZA 1ZB1A 4JW1A 3TWUA 3SD5A 4DO0A 2E2AA 5E0OA 2EQXA 3AS8A 1D8EA 3I5PA 2XGSA 1HS6A 1MQSA 2K5BB 3OVUA 5LP6E 4EECA 3T5XA 2XQ6A 3HL6A 3FEXA 1B7TA 2V5QC 4IDPA 1S70B 2CFUA 2MOWA 1HX8A 2R05A 2W4XA 2XPYA 2JQQA 2VGXB 2J62A 1A17A 1FJGT 2PZIA 3TAXA 5CERB 3ASDA 3FZLB 3N9OA 2UXNB 3F31A 4X62T 4I9CA 4HWFA 2XAFB 3CKCA 3LJNA 4TXQA 3HI2A 4K5AB 2DZNA 4UV9B 4KX6A 4P0BA 4A3TA 2B76A 5CRUA 4FU3A 2MTQA 1HG2A 4CQIA 4YXDA 4JD2G 4RVBA 3ZHEA 3UIPC 4LERA 3UFEA 1OUVA 3G2VA 1FT1A 2X67A 1ELWA 3OXFA 2YN6A 4HFDA 2XPIA 3ZXSA 2AXDS 3LBXA 5L3FB 4C9BB 2WQ6A 4A3VA 3T5VA 2L9BA 3PREA 5AFUL 2GRPB 2HR2A 3QOUA 3F6QA 1TYQG 3QUJA 4AQYT 3CSFA 4E7SA 2PTFA 3C50A 1VRBA 4Q96A 2LUHA 4Y6CA 3FUJA 1OEDA 1N34T 2C5JA 4MKTA 3TWWA 3CIAA 3JXIA 1ZHCA 4J0UA 2AWIA 3TWVA 2LOPA 1E90A 4E7ZA 1LD8A 3V2OA 3KV6A 2LRKA 4HORA 2YK0A 3TJPA 4H63V 1AWCB 3FUDA 2IEJA 2XQ3A 3T8MA 3L82A 1O5MA 4EEDA 4DUZT 3IF8B 4AVXA 2WB2A 4YSYA 5JDLA 4K03A 4ZZBA 3ASHA 3ABVA 4J2CA 2CWYA 2DWKA 1H2VC 2AXZA 1Y01A 1FMWA 3N9QA 3E30A 3MZKB 5AJDA 3DSSA 5FTPA 3TWSA 2HH7A 5JRCB 2BS3A 3PJAA 3UULA 4UUCA 3UT8A 4N3BA 3IBEA 4KP3C 3ASFA 3MKRA 4O4JE 1OCCE 3KD7A 5AQTB 3UM3A 5CCLA 5FNVE 4ASKA 5TAOA 3LK42 3NB2A 3OYXA 3LVRE 5B1BE 4YSXA 3I4GA 2IDOB 3CK7A 1UW4B 4TXRA 3ZMSB 5AQSB 4UQZA 1K1BA 1D1CA 4G11A 3RYHE 4AQFA 1NWMX 2RFAA 2X6HA 2C0SA 4DI3A 2UUBT 3FUKA 3AE9A 3F2EA 3CVLA 3ULYA 5FJYA 2CWOA 3PUWF 1NENA 4OAVB 2V4HC 3PDYA 4A56A 4NACA 1D0XA 4JUYA 5LNKA 5G04C 4EZJA 3CHPA 1WR6A 3AA7B 2IJGX 2KCLA 1DC2A 5ENQD 2V5DA 3ZJ1A 3RQWA 4XKBA 3L08A 3BK9A 3PU3A 4F1PA 2ONDA 5AAOA 1N95A 4YTPA 4BX8A 4DUYT 2ZXWE 5HXHA 2ZIRA 3P4SA 2LLYA 3Q5MA 3HVEB 2KCVA 5KJLA 3CHQA 2JQKA 3KINB 1IHGA 2ZM6T 1TN8A 3IKOB 4G24A 3ZGQA 3O4ZA 2WBLA 1U3DA 1IZNB 2IOLA 4B0ZA 5ABFA 2LO6A 3UX4A 1YMPA 3AEFA 3ZJ2A 2XS1A 3SFDA 4NXMT 4LNGA 2X3MA 4HOSA 2YU1A 4V3IA 5FIOA 4U72A 3DXKG 2DCPA 1ZKEA 4HEAA 1H6PA 4DV1T 3JCFA 4GPMA 2WB5A 4GZ3A 3EHQA 3AE8A 5ARGA 3TWTA 2QYJA 3FU3A 3CMLA 3FULA 2ZGDA 5HAXA 3CWZB 3DJBA 4O4LE 3J9X1 3BG1B 4I4TE 2W66A 2XY8B 1QSDA 4O1OA 3A8YC 3FUHA 3Q78A 1MHQA 2PG8A 4GTTA 2L6JA 5HXSA 3HYMB 5LCWJ 3LYAA 2LAIA 3CVRA 2JRKA 2CXFA 2LRLA 1ELRA 2Y1LE 4ANXA 5AQBA 4JI5T 3UPVA 4EZHA 1CUNA 2CRBA 2HO1A 1FVHA 4GKKT 3RF1A 5BXUA 3ONKA 3LKUA 3PUQA 3Q9DA 3KV5A 4U0SA 4IDOA 1YKHB 2BVMA 3Q49B 4GZ6A 3MGBA 5CB4E 4O4IE 3UM0A 1MMGA 2Y0BG 4DR1T 2V7IA 2WXPA 1XDOA 5DQWA 2CLYC 2Q7FA 4TUUA 1WM5A 4IREA 3UUBA 5JR9B 1O1SA 4Q94A 1OWAA 3B57A 2WXRA 3ZNGA 4TXPA 2YOEA 4IE6A 2H6GA 3T1HT 4DX1A 2AW6A 4U74A 1JWGA 1K1AA 2VURA 5LHGB 3C3OA 5AJLA 3CX8B 3ZYLA 1N32T 1E8WA 2ODUA 3RQUA 5AQHB 2GRQB 3CK6A 3O1HA 2FI7A 4HFEA 4JYAT 5FY1A 3CHRA 3AVRA 3LBXB 5HWXA 4PS7A 5D0OD 2QZAA 3C4ZA 2WVIA 4PK6A 2WP9A 1HTJF 4C0EA 1HNZT 1G73A 5FVLA 3S4UA 4AIFA 3LY9A 4JEHA 1N4PA 1KT1A 3RC8A 3Q7AA 2D9DA 4YT0A 3MCXA 4KHZF 1VDYA 2Y8DA 4AQGA 1H2UA 4UWHA 4U04A 3FDHA 4HRMB 2IMLA 4XZ4A 4U7IA 4I6GA 1EF1C 2OA5A 1FPPA 1SZ9A 2WXLA 3JQ0A 5FXZA 4ILIA 3ETVA 3AG4E 3FU5A 2CG2A 4IULA 4WZXA 2VGXA 2WY2A 2YQ8A 4PJLA 2J47A 1Q2ZA 5C2TA 3FTUA 3Q73A 4JXTA 5HEOA 2J08A 3BU8A 1L0VA 3UFGA 1LTXA 3FTVA 2OV8A 3RU0A 3S7BA 3JCKC 2C2LA 2XAGB 4I1OB 5BV1A 1OXZA 4COFA 4FP7A 4JLEA 4OYSA 2ZU6B 5L3GB 2A4ZA 3SBTB 3UI2A 5JQGE 5BNWA 4L1BA 3C64A 4BY6A 2LSGA 1YKEB 3DXMG 4PFPA 3UIOC 4M1PA 4P09A 3B95A 5FWQA 4DX6D 4ILGA 5JMND 1QYMA 3G2TA 5HXEA 1H6OA 3CVVA 5LA6E 2KNDA 2WAUA 3APFA 2KZTA 4H7XA 2PBIA 1MIYA 4JHKA 1MIVA 1D0YA 3N5LA 3ZPOA 2LE8A 1IKND 1N4SA 4ZI3D 4GA2A 3I0QA 3RHWA 2H6HA 4JL0A 2XAQB 3IXEA 5AQ7A 1HU3A 2R02A 2GROB 4BWRA 5J08A 3DSXA 4BERA 2JEKA 4HQDA 3T8KA 4QX8B 2J4GA 3UQ4A 3RAUA 4ILHB 2Y48B 3D9OA 4L5GA 5LB7B 5AQRB 3MV2B 4GCOA 1VCSA 3FTZA 1LF8A 4URKA 3J5QB 5CA1E 4HFVA 1QZ2A 4BJMA 4Z68A 3IA3A 5CMWA 4DR7T 4NQ0A 2D5UA 2IIUA 1QBQA 3VKGA 2MHKA 4TWFA 1Z0PA 3KAEA 4DLQA 4L0RA 3Q4AB 4GTQA 4OX9T 2F0YA 3AU5A 1DCQA 4WW0A 2UXDT 3LY8A 2UY1A 4LF6T 1MJ0A 1SE7A 4IE0A 4DNDA 4PK5A 2IC6A 5DBKA 2YHEA 2LSUA 4GB9A 2XRZA 2MYOA 3R7RA 2JMHA 3K8PC 4BX9A 4IL9A 4ZZCA 5FQ7A 3PTRB 2ZLYA 3EAMA 3JUIA 2R6GF 1H2TC 3FUFA 3IV0A 5FZSA 2IOSA 1TR4A 5BW8C 3CIRA 2BBHA 2FUPA 2H6FA 2CHZA 4HI9A 3V2XA 1RZ4A 2X38A 4LNUD 4N39A 1SA4A 5AN8A 2KZTB 4JI7T 4U63A 2W67A 3ZLIA 4UWLA 2V7LA 3B7UX 4J8EA 3RRMB 5LCWC 3D9JA 2OEWA 3ZVVA 3UUMA 3B7RL 4N5QA 2EIJE 3SS1A 5ENNA 1YA0A 5ABGA 2WXMA 3ABME 1N94A 3ONLC 3PU8A 5BT1A 5KCMA 3V5UA 5LOZA 5AQMB 2PM7A 4MRUA 1MIWA 4EIWA 4BSXA 4QFVA 2X68A 3Q5EA 1KK7A 3LK3B 4GAAA 2MRIA 4YJ3E 4WNDA 2BS2A 3UTMA 5FY0A 3ZU7B 2WU5A 1G3NB 3OXLA 3SGHA 3DPYA 2NXPA 1PC2A 4XI0A 2AJAA 5ENOD 3OYZA 4DV2T 4QKNA 4J8SA 5LCYA 3BQIA 1FIOA 3PZDA 3EHNA 4JC8A 4GTOA 3P4PA 5J0ZA 3MA9A 2EHOB 5D2MC 3MZLB 3FUEA 2YNQA 5LHHB 3FXEB 3LY7A 4TNWA 1INZA 4KI0F 5FQ4A 1O1RA 4R7LA 1W9RA 4IYPA 2E8IA 5J90A 2R17C 4IIJE 5AQAA 3I9YA 3Q2MA 4IGUA 4GKJT 1OWNA 2GGFA 4H9QC 3QOFA 4GA1A 3KV9A 2UXXB 2NOXA 5AQKB 2RKKA 2J4DA 3AE2A 2UWJG 4ATZD 3NVOA 2ETAA 3AS5A 5KX5E 4LCTA 3RIBA 1SQMA 1SA5A 2MBGA 3WXXA 1KNPA 5EX3A 3ESLA 4LFCT 4ZI3C 3O1JA 4HNAD 2Y4TA 4PAGA 1O3XA 3K9IA 3CVUA 5H7PA 4QXHB 2IY0C 2JMKA 4PJJA 2ETCA 4EOZB 4LFBT 1IAPA 4IE4A 4BFRA 4H63H 4IE5A 5LGUB 4U8VD 3AG2E 3DBSA 2WXJA 1TNYA 2OOEA 2X6IA 2CHXA 4AKGA 1Z3YA 3N9PA 2KATA 2QFCA 4HXIA 1TJFA 5ENPD 3DPDA 4IL4A 1WYCA 4PS3A 4HFCA 5LGTB 1HXIA 1E8XA 2LOSA 1HCIA 1MX2A 3PE3A 3PDNA 5FZQA 5KNHD 2ES0A 4U7EB 1MMNA 3AAAB 4AOFA 2X9YA 4KZCA 4UI9K 3RRCA 2V0PA 4BSZB 2R03A 4CT0A 5A7DB 2XM1A 3DTOA 4U2ZA 1N4RA 4ZI7E 1WLXA 3L54A 4FJZA 4PJMA 3AE3A 1WFDA 4QQIA 5H6QB 2K24A 5ARFA 4UWFA 3VTXA 1QUUA 5CGMA 4JPSA 1KZOA 5G05C 3BUAA 5LJMA 4QXCB 4AISA 4EEBA 4EV6A 3VRBA 3MJWA 2IO2C 4DJAA 5LFAA 4X8QA 4EYYR 3KFWX 1XNQT 2LXLA 4DR2T 3UKRG 1GQEA 5DABA 4WNGA 2E0IA 2EHOC 2V5CA 5ETWA 2WM9A 5L47A 5HCMA 2XENA 3QKYA 3UT7A 3RKVA 5LX8A 2P9IG 4QXBB 5KNGA 4GIWA 1EYHA 3S7JA 2ACZA 4DV0T 5CBNA 2YINA 3MYVA 2VK9A 3PH0C 2XHEA 3KBUA 3NRYA 2BBJA 3DRAA 1TNZA 4KZ0A 4G23A 1MNEA 4RQIA 1KFYA 4X5TA 2KC7A 1D0ZA 4CEMA 3ABKE 1ZBPA 4A97A 3P1UA 5HYAA 3B5MA 4JZYA 3JXJA 2HHHT 3AAIA 2KBXA 4YY3T 2X51A 3MA5A 2V4LA 2H3RA 1IJ5A 5F5WA 2VSYA 3ULEG 3QNUA 2XQ8A 3E32A 3R7QA 3A5XA 2VQFT 5FY7A 4DBQA 4HKAA 1ZU2A 1UJJA 3CKBA 1OCZE 2Q9QD 1VOMA 4BTBA 3RIUA 2BZBA 3RYFE 3AE4A 3ZT7A 1Z3XA 5AQLB 4BA9A 4FJOA 1HNWT 3NF1A 1XZYA 1EDUA 5EYLA 3FBZA 2UU9T 4MBQA 5ENTD 4IE7A 2I9CA 1ZOYA 3GWHA 2CBIA 1VCTA 3IEGA 4CI3B 3Q9UC 4UQXA 2V7JA 1D1AA 2LKHA 4YFSA 1YD8G 1PAQA 4DV7T 4YDOA 1NA3A 2GK9A 3AG1E 2KXPB 5JRCA 4U31A 3VLEA 3ZXPA 2YHCA 4EAHA 1IBLT 2OEVA 2CEAA 3VRAA 3E34A 4LF9T 4E6HA 4PDXA 1WDYA 4UI9C 4JI1T 4EHMA 4A1SA 2XASB 4UVCB 4HFIA 1Z6TA 2YDRA 4A98A 2E9XD 4K5BA 3ZRHA 4CI2B 3RI5A 4EZLA 2XRYA 5FMNA 3ZHEB 3TLSA 4GMRA 3AE1A 2OVBA 3CLJA 3DSVA 3CSTA 4YDEA 4G25A 2PQRA 2JIWA 2WWVA 4CT4A 4B3ST 2FJDA 2Z6EA 3AVSA 4F53A 3ONLA 1BR4A 1YYHA 4U2YA 3UU6A 4JV5T 5ANRA 5JDGA 4DR4T 3T1YT 1OEDB 3AEGA 5JH7E 1DU2A 3JADA 4QX7B 2VKDA 2QC9A 2DVWA 1UJKA 4LMJA 2IFUA 1M7KA 3EVYA 3KEAA
chains in the Genus database with same CATH topology
3Q5WA 3FTXA 4JA7A 4FJYA 3CVYA 1UN9A 5KJKA 3QK6A 3JYSA 5EDSA 3SI5A 5IYZE 4LEUA 5KJNA 3BG0B 3CVNA 3O4XE 2VGYA 2EHOD 3FB2A 3WAKA 5JDMA 5EZYE 3QWWA 1NAFA 3JC6D 3BQLA 5EK4A 2KZ7B 1BR1A 2WXQA 2NTXA 4DI4A 1SA0E 1HZ4A 3M65A 1WY6A 1BPOA 5KDMC 3KVBA 2Y4UA 3ZEFA 3ZW3A 4I50E 1E7VA 4X20E 1HFAA 1KLXA 5JJTA 3QK0A 4AEZC 2VWAA 2VJ8A 2XAHB 4TUYE 4EB6E 3MKDA 4YVQC 4OFZA 3HKEE 4EBAA 2YEVC 4CDNA 3EDUA 3CVPA 3AS4A 3PEUB 3E08A 3HDXA 2Q9QC 4UXNB 5HQ8A 3FFLA 3PUGA 4GA0A 2WXKA 4GMLA 4AKLA 1IQRA 2CHWA 2W0GA 3P2BA 3E4BA 4U0UA 5HWYA 4L9IA 4V1Av 2AXVA 1TEZA 1V9DA 2M63A 3MACA 2CE7A 5FQ6A 4MHCA 3NZUA 3SNXA 2Y6XA 4KMOA 3CX7B 3CHSA 2H7OA 3SBSA 3RJVA 2K9AA 4QHOA 2SPCA 3FWVA 4BT8A 3ZC1A 4U0ZA 2PJQA 2I6HA 1UCUA 3E22E 3P7IA 1XNFA 4AV7A 3PUJA 4AY5A 3D9PA 3FTYA 1Y64B 3I1AA 1KT0A 3U78A 4RG9A 3OBVE 4J6IA 3TKLB 2GRLA 2WSSV 3RKOA 3Q15A 2E9XC 2P58C 2IU1A 2XEVA 3KBTA 4CXYA 3VLFA 3RPUA 4HOTA 4I6JA 4ISSA 5GONE 4BTAA 2LT3A 5L3EB 1BR2A 5EKQD 5KMGP 3GN5B 2V26A 2ODVA 1H7CA 2WXIA 2M67A 3ZYQA 4KBMB 3EDTB 4I43B 4IN3B 3CK8A 1FEWA 3FH8A 2LAHA 1JUQA 3KVAA 5L3CB 4AXPA 2FBNA 2LEHA 3VU7H 4JVSA 3AB3B 4H9PC 4C0MA 4RSYA 2L3LA 3D9LA 4RG6A 3O1IA 2KWHA 4N3CA 4Q69A 3CKDA 1SZAA 3SFZA 2DHRA 4ACKA 1QNFA 2LSJA 3FHNA 3ESKA 4ME2A 5H6RB 4C91A 3D3MA 5LOVE 3SOLA 2J07A 3G2SA 2VSOE 4UF0B 3ZYKA 5L3BB 4NURA 4XE0A 2FO7A 2DNXA 4ZS3A 3C4XA 3ETUA 4TN7B 2V8SE 3UTKA 3B7TA 3HIZA 4DPRA 4B94A 4DK5A 2DI4A 2N1GA 3FEYA 1ELKA 5D0QD 4I9EA 4TV8E 4E85A 2N9DA 1E7UA 2C0MA 2C5KT 5AIJA 3HKCE 4CDRA 2ZM0A 5LG4A 4BAYB 4PK4A 4GZDA 2X66A 2PL2A 3SWHA 4TV9E 2A2FX 3C4WA 2DWGA 1NP7A 4CDMA 5JDFA 2L9QA 4HGAA 4F6RC 4GK0E 4ADZA 4HE8A 3GZSA 4I1AA 3D9NA 2CM0A 4GK5E 2WQHA 2XGMA 3L09A 1QQEA 1N54A 5C1DA 4GCNA 5LGNB 4ILUA 1EPUA 3UQ3A 3BQKA 4GPKA 3J7Yq 3C98B 3Q5XA 4DMWA 4O6FA 4KUMB 2DCFA 2X6JA 5JJ6A 4A55A 5J2TE 3MXZA 2KCKA 1HO8A 4CXXA 5T8IA 3HR0A 4O4HE 2LNIA 5LYJE 3L3PA 4FC8A 3RRNB 3L22A 4U07A 1FMVA 2JLBA 3HVEA 1HF8A 3H37A 5DQVA 2D0TA 3P8CD 5FXXA 3APCA 2ACXA 5KJMA 2L0IA 4HOQA 4N2QA 2XCCA 4UI9J 2A5UA 2Q9QA 4GZCA 5DIZA 4PNIA 3FXDB 2Q9QB 2W00A 4MLKA 3FUMA 3I0OA 1OWMA 1E8ZA 4UELA 4PS8A 4IDZA 4TV3A 4GU5A 2VQ2A 3O48A 1SHZC 2I1KA 4I55E 4EQFA 2NW7A 5JDQA 3F57A 1AJ3A 4FHKA 2L0TB 5G04J 4EZKA 2G0UA 2XUEA 4H7YA 4XIFA 5FQ8A 4AXHA 5A23A 4AM9A 2BDEA 3ZMTB 5FP3A 3PS6A 1B89A 4D10C 2QA7A 5A1LA 4JEUA 1HE8A 4ZOLE 5G2NA 3SHFA 2H7VC 2W61A 4LRZA 2HM8A 2J9QA 4WAFA 2LHNA 3B13A 3ZMUB 1LKXA 4P0AA 4ZI2D 3MJXA 4TRQA 4KYOB 4CGVA 4MFRA 5CHEE 3ENEA 4H9RC 4UVBB 3IEEA 2X9WA 4GYWA 3TXMA 3L6AA 4KT6B 1S94A 2C0LA 3HKBE 2X0LB 3QB2A 2VSXE 2VKHA 4B8CB 3I9WA 4CCAA 1UX4A 4WWOA 5HXCA 4Z8XA 4G2VA 4M3OA 2K48A 3LJCA 3QNKA 4AY6A 3RYCE 1T98A 4KVMA 2CXLA 2NW9A 4YVOA 3QAQA 3PE0A 2W62A 2LHRA 1P5QA 4JEUB 3BEEA 2LSKA 2KWIB 3FY4A 4Y6WA 2BVLA 4O2BE 3N71A 4NUVA 5L2LA 2WMNA 2VL8A 3U3WA 3S2AA 4GYOA 2X9HA 2I59A 3ZFWA 5HI7A 4EPZA 3U3IA 4UV8B 3CHMA 4FA6A 4TX5A 4CI1B 3OAWA 3D9KA 3E0ZA 4MS6A 2V7KA 4ANWA 4BT9A 4L23A 2XHEB 4WWNA 3NQPA 4B8AA 4I2WA 4DMVA 3CPZA 3N9LA 4AJWA 3UUXA 3SRZA 3GA8A 1U5PA 3GMIA 3RRWA 2LM9A 3T8OA 2NSZA 3LS8A 4I43A 5LBMA 4OHFA 2XQ0A 1JWFA 3Q47B 3L13A 5IHYA 2WPVA 1E96B 4FLHA 2PQNA 4CRWA 4WNEA 3R9AB 3TXNA 4AI6A 3PRZA 2LSVA 2AVPA 2NTYA 4XBFB 2ZM8A 1HS7A 2WXNA 4HS2A 1LRZA 4ANUA 4N2SA 4DBRA 2E2EA 3FTSA 3ZCJA 2V5FA 4LUNU 4QWNB 4ISTA 4UVAB 3QWVA 1MNDA 1PY1A 1E8YA 3QC9A 2IONA 2HPLA 2C5IT 4NUUA 1WYBA 1L5JA 5JHAA 3IBPA 5F3JA 1JPLA 3D0TA 3ML9A 3SF4A 4PFOA 3RC3A 4YNDA 1OWOA 3ZPJA 4J8DA 2CMRA 5ADXL 3FTWA 2A72A 5J2UE 2A3DA 2RP4A 4PH4B 2UY1B 3MK7C 5FT9A 2DIWA 3U64A 2MOZA 2FULA 3ZN1B 3FP3A 3PUAA 3MEKA 4K0UA 4OYJA 2KLQA 3CEQA 3IHRA 1ZV4X 4OVUA 5M4YA 4XKCA 2XQYA 3EDVA 3LXUX 4ATGA 2FEZA 1X79A 3N2KE 4OK0A 1UG3A 2XAJB 3K3OA 2NP9A 1FCHA 1OWLA 4ANVA 4O8SA 3MKQA 2E9XA 3RX6A 4PJNA 4CGWA 4FULA 3HKDE 2IAKA 4G2AA 3NRXA 4JA9A 3K3NA 4KXKB 1FVFA 2AXUA 4GYSA 5L3DB 4ANJA 3PE4A 1DVPA 3LCAA 5CA0E 2KINB 5E76A 4N5CA 4GYRA 2BUGA 3GYZA 2RA1A 3ZN3A 2J1DG 4WUYA 3UUXB 2VKJA 4DVDA 2X6FA 2VYIA 2DBAA 3U9WA 3CQGB 2GW1A 4L2LA 3CK9A 2PM6A 1IJ6A 4UIGA 2EHOA 3MKQB 3PVLA 5CCMA 3EIQC 4WNFA 2LJLA 1MMDA 3CQXC 3WAJA 3N2GE 4C90A 4UWGA 4I2ZA 2X9XA 4JEHB 1EZ3A 4UQYA 4F1SA 3OXGA 1IQUA 5EX0A 2HPJA 5BMVE 4AKIA 3VLDA 3OTNA 3FU0A 3MV3B 4WBNE 3QWPA 2NC9A 3OJAA 2P9BA 2RD0A 2WXOA 1X5BA 1E1HB 5C8YE 2WWUA 3AA6B 2VB6A 3FHEA 5EK2A 4N3AA 1TJCA 5T3RA 3TG5A 3FH7A 3LFMA 3CQCB 4G1TA 5JVDE 5JDHA 4EZ4A 3TG4A 4TZ4C 2WXHA 2CCQA 2DLRA 5AENA 2VTBA 3G2WA 1YW0A 4UWKA 3W15B 3EIJA 2R59A 3NZQA 3VKHA 3GZ1A 4F7AA 4APFA 3R84B 3PNLB 3CX6B 4XAXB 3CR3A 2ILRA 2QY7A 3OKQA 2D0UA 2JPFA 3HHMA 3ZYMA 2YU2A 2VKOA 5G05J 3LPZA 2KT9A 3KDSE 3CVWA 1S35A 3S7FA 1NZNA 1UX5A 2I2OA 5T4YA 3B7SA 2OVFA 3KV4A 1S0PA 1BR0A 3U66A 3K3QC 3ANWB 4B6XA 4AKHA 2J4BA 3LK2B 2ZMAA 5LBQB 1Y8MA 3N9NA 1US7B 2CLYB 2IW5B 3G2UA 2GRMA 1KNZA 4HVBA 3AAEB 2J49A 4XI9A 5J1GA 3RK6A 4GYYA 5E75A 4I6EA 3IHYA 4WBOA 3UT5E 5JHBA 4W9RA 3RH3A 4APOA 3NZPA 3SZ7A 1LVKA 4HN9A 3UMVA 3H3AA 4OYKA 2HYZA 4PUCA 2WMOA 5FYMA 3L16A 1HH8A 4B89A 3AU4A 3V5SA 1U3CA 3FH5A 1W3BA 1H19A 4JHRA 2BF0X 3ZC0A 1GW6A 4KVOA 5JR9A 3VHLA 5A6CA 3I4RB 4BJNA 4KMCA 3IHVA 5LHIB 3UUNA 4MALA 3HA4A 5JJ7A 2RG8A 3CVQA 4NRHB 4ZHQE 4EXTA 3NZSA 3QDNA 4U8HA 2IQCA 1D1BA 4HTEA 4FLBA 4CZZB 3JC6C 2IC9A 2KMFA 2NW8A 4L7TA 4N78D 2LSYA 4HFGA 3RO3A 3ONXA 3D9IA 3N2OA 2XTLA 3GW4A 3LEWA 2J09A 4IHJE 4YLHA 4FI5A 2NWBA 4GZ5A 4ERRA 3TL5A 1U4QA 3FUNA 3ML8A 1DNPA 4ABNA 2XGOA 4CXWA 4EBAG 1OWPA 4UEMA 2LSIA 4YHJA 3EJNA 4F3VA 4ACLA 4O2AE 3ULQA 4J8FA 4JHJA 3QC1A 1XGWA 3PUSA 2VSNA 2WXGA 1WRDA 2BTDA 3LDZA 1NA0A 4HLEA 5JR9C 5C2YA 3VTYA 2CA5A 2MYSA 2N2NA 4X1YE 4YJ2E 1H0AA 4P29A 3MX3A 2I1JA 3ANWA 2E9XB 3ZN0B 3N9MA 3ZCIA 4AKRB 3NBXX 3AA1B 5FZRA 2X6KA 4IRUA 2W63A 2FF4A 3EUHA 4H9NC 5EK3A 4ZI2C 4UF0A 5LJNA 3ZIMA 5BUZA 3KEZA 3EHMA 1G8XA 4KBQA 4MLPA 2D2SA 1IYGA 3I3NA 5LXTE 1UN8A 3LG7A 4XZCA 4H9OC 4AQFC 1H6KA 4K0RA 3C51A 4WWPA 3QARA 5HXRA 4G63A 1HG5A 3ASGA 4I17A 2B1EA 5BV0A 5FXVA 3LVQE 2Y3AA 3PUKA 4FHJA 3PNTB 5ANLA 2JJ9A 4PW8A 2VTBB 2WXFA 3FUIA 5CMYA 5F8PA 4WNKA 3FBLA 4EYUA 3C98A 2V7MA 4AP2A 2WQ7A 3JQ1A 3R6NA 3RRUA 2PFVA 1Y6IA 3GN5A 2CFZA 3D9MA 5M72A 2CG3A 3UT4A 3KS2A 3FU6A 5DJQC 3ZMVB 2QGSA 1N52A 4I1MA 3QJZA 1LVFA 4H9SE 4DLOA 3CGHA 3U4TA 2KM4A 4GOUA 4X1IE 3CV0A 3ZMZB 4XX5A 3RYIE 2VASA 1WAO1 4ZS2A 2CXDA 3WI3A 3TGOA 4A1GA 3S7DA 2IF4A 3L17A 5JREA 4GMJA 3DP7A 2ZM2A 3GZ2A 5LP0A 5FXWA 1ZEEA 3PURA 3AA0B 4X1KE 3CHOA 4G26A 2XCBA 5BPPA 3O9XA 3URZA 5AYWD 3APDA 3PEVB 3ZEFB 4OVVA 5JDNA 1MMAA 3CVXA 4FADA 2V1DB 4L2YA 2R5SA 3RO2A 2L8KA 3LJ3A 5G55A 4HOUA 2XPZA 4JW1A 3SD5A 4DO0A 5E0OA 2EQXA 3AS8A 3I5PA 2XGSA 1HS6A 1MQSA 2K5BB 5LP6E 4EECA 3T5XA 3HL6A 3FEXA 1B7TA 2CFUA 2MOWA 1HX8A 2XPYA 2JQQA 2VGXB 1A17A 2PZIA 3TAXA 3ASDA 3N9OA 2UXNB 3F31A 4I9CA 2XAFB 3CKCA 3HI2A 4UV9B 4P0BA 4A3TA 4FU3A 2MTQA 1HG2A 4CQIA 4RVBA 3ZHEA 4LERA 3UFEA 1OUVA 3G2VA 2X67A 1ELWA 3OXFA 2XPIA 3ZXSA 3LBXA 5L3FB 4C9BB 2WQ6A 4A3VA 3T5VA 2L9BA 3PREA 5AFUL 2HR2A 3QOUA 3QUJA 3CSFA 4E7SA 3C50A 1VRBA 4Q96A 4Y6CA 3FUJA 2C5JA 4MKTA 3CIAA 1ZHCA 4J0UA 2AWIA 2LOPA 1E90A 4E7ZA 3KV6A 4HORA 2YK0A 3TJPA 4H63V 3FUDA 3T8MA 3IF8B 4AVXA 2WB2A 5JDLA 4K03A 3ASHA 4J2CA 2CWYA 2DWKA 1H2VC 2AXZA 1FMWA 3N9QA 3MZKB 5AJDA 5FTPA 2HH7A 5JRCB 3UULA 3UT8A 4N3BA 3IBEA 4KP3C 3ASFA 3MKRA 4O4JE 3KD7A 5CCLA 5FNVE 4ASKA 5TAOA 3LK42 3OYXA 3LVRE 3I4GA 3CK7A 1UW4B 3ZMSB 4UQZA 4G11A 1D1CA 3RYHE 4AQFA 1NWMX 4DI3A 2X6HA 2C0SA 3FUKA 3F2EA 3CVLA 5FJYA 2CWOA 3PDYA 4A56A 4NACA 1D0XA 4JUYA 5LNKA 5G04C 4EZJA 3CHPA 1WR6A 3AA7B 2IJGX 2KCLA 3ZJ1A 4XKBA 3L08A 3BK9A 3PU3A 2ONDA 4BX8A 5HXHA 3Q5MA 3HVEB 2KCVA 5KJLA 3CHQA 3KINB 1IHGA 3IKOB 3ZGQA 4G24A 3O4ZA 2WBLA 1U3DA 1IZNB 2IOLA 4B0ZA 2LO6A 3UX4A 3ZJ2A 4HOSA 2X3MA 2YU1A 4V3IA 4U72A 2DCPA 1ZKEA 4HEAA 4GZ3A 5ARGA 3FU3A 3CMLA 3FULA 5HAXA 3CWZB 3DJBA 4O4LE 3J9X1 3BG1B 4I4TE 1QSDA 3FUHA 1MHQA 2PG8A 2L6JA 5HXSA 3HYMB 5LCWJ 3LYAA 2LAIA 3CVRA 2JRKA 2CXFA 1ELRA 4ANXA 3UPVA 4EZHA 1CUNA 2HO1A 1FVHA 3ONKA 3LKUA 3PUQA 3Q9DA 3KV5A 4U0SA 1YKHB 2BVMA 3Q49B 4GZ6A 3MGBA 5CB4E 4O4IE 1MMGA 2V7IA 2WXPA 5DQWA 2CLYC 2Q7FA 4TUUA 1WM5A 5JR9B 4Q94A 1OWAA 3B57A 2WXRA 4IE6A 2AW6A 4U74A 1JWGA 5LHGB 5AJLA 3CX8B 3ZYLA 1E8WA 2ODUA 3O1HA 2FI7A 5FY1A 3CHRA 3AVRA 3LBXB 5HWXA 4PS7A 5D0OD 3C4ZA 2WVIA 4PK6A 1HTJF 4C0EA 1G73A 3S4UA 4AIFA 3LY9A 4JEHA 1KT1A 3RC8A 3MCXA 1VDYA 2Y8DA 4AQGA 1H2UA 4UWHA 4U04A 3FDHA 4XZ4A 4I6GA 1EF1C 2OA5A 1SZ9A 2WXLA 3JQ0A 5FXZA 4ILIA 3ETVA 3FU5A 2CG2A 4IULA 2VGXA 2YQ8A 4PJLA 3FTUA 4JXTA 2J08A 3FTVA 2OV8A 3RU0A 3S7BA 3JCKC 2C2LA 2XAGB 4I1OB 5BV1A 1OXZA 4FP7A 4JLEA 4OYSA 2ZU6B 5L3GB 2A4ZA 3SBTB 5JQGE 5BNWA 4L1BA 3C64A 4BY6A 2LSGA 1YKEB 4PFPA 4M1PA 4P09A 5FWQA 4ILGA 3G2TA 5HXEA 3CVVA 5LA6E 2KNDA 2WAUA 3APFA 2KZTA 4H7XA 2PBIA 1MIYA 4JHKA 1MIVA 1D0YA 3N5LA 3ZPOA 2LE8A 4ZI3D 4GA2A 3I0QA 4JL0A 2XAQB 1HU3A 4BWRA 5J08A 2JEKA 4QX8B 4ILHB 2Y48B 3D9OA 4L5GA 3MV2B 4GCOA 3FTZA 1LF8A 4URKA 4HFVA 5CA1E 1QZ2A 4BJMA 5CMWA 4NQ0A 2D5UA 2MHKA 3VKGA 1Z0PA 3KAEA 4DLQA 4L0RA 3Q4AB 3AU5A 4WW0A 3LY8A 2UY1A 4IE0A 4DNDA 4PK5A 2IC6A 5DBKA 2YHEA 2LSUA 4GB9A 2XRZA 3R7RA 2JMHA 3K8PC 4BX9A 5FQ7A 3PTRB 2ZLYA 3JUIA 1H2TC 3FUFA 3IV0A 5FZSA 2IOSA 5BW8C 2CHZA 2X38A 4N39A 2KZTB 4U63A 3ZLIA 4UWLA 2V7LA 3B7UX 4J8EA 3RRMB 5LCWC 3D9JA 3ZVVA 3UUMA 3B7RL 3SS1A 5ENNA 1YA0A 2WXMA 3PU8A 5BT1A 5KCMA 3V5UA 5LOZA 2PM7A 4MRUA 1MIWA 4EIWA 4BSXA 4QFVA 2X68A 1KK7A 3LK3B 4GAAA 2MRIA 4YJ3E 4WNDA 5FY0A 3OXLA 3SGHA 2NXPA 1PC2A 4XI0A 3OYZA 4QKNA 4J8SA 5LCYA 3BQIA 1FIOA 3PZDA 3EHNA 4JC8A 3MA9A 2EHOB 3MZLB 3FUEA 2YNQA 5LHHB 3FXEB 3LY7A 1INZA 5FQ4A 4R7LA 4IYPA 2E8IA 5J90A 2R17C 4IIJE 3I9YA 3Q2MA 4IGUA 1OWNA 2GGFA 4H9QC 4GA1A 3KV9A 2UXXB 2NOXA 2J4DA 2UWJG 3AS5A 5KX5E 4LCTA 3RIBA 1SQMA 2MBGA 3WXXA 5EX3A 3ESLA 4ZI3C 3O1JA 2Y4TA 4PAGA 1O3XA 3K9IA 3CVUA 4QXHB 2JMKA 4PJJA 4EOZB 1IAPA 4IE4A 4BFRA 4H63H 4IE5A 5LGUB 3DBSA 2WXJA 2OOEA 2X6IA 2CHXA 4AKGA 1Z3YA 3N9PA 2KATA 2QFCA 4HXIA 1TJFA 3DPDA 1WYCA 4PS3A 5LGTB 1HXIA 1E8XA 2LOSA 1HCIA 3PE3A 3PDNA 5FZQA 2ES0A 1MMNA 3AAAB 4AOFA 2X9YA 4KZCA 4UI9K 3RRCA 2V0PA 4CT0A 5A7DB 3DTOA 4ZI7E 1WLXA 3L54A 4FJZA 4PJMA 5H6QB 2K24A 5ARFA 4UWFA 3VTXA 1QUUA 4JPSA 5G05C 5LJMA 4QXCB 3MJWA 4DJAA 5LFAA 4EYYR 3KFWX 5DABA 4WNGA 2E0IA 2EHOC 5ETWA 2WM9A 3UT7A 3QKYA 3RKVA 5LX8A 4QXBB 4GIWA 1EYHA 3S7JA 2YINA 3MYVA 2VK9A 3PH0C 2XHEA 3KBUA 3NRYA 4KZ0A 4G23A 1MNEA 2KC7A 1D0ZA 4CEMA 1ZBPA 3P1UA 5HYAA 4JZYA 3AAIA 2X51A 3MA5A 2V4LA 2H3RA 1IJ5A 2VSYA 3R7QA 3A5XA 5FY7A 4DBQA 4HKAA 1ZU2A 1UJJA 3CKBA 2Q9QD 1VOMA 4BTBA 2BZBA 3RYFE 1Z3XA 4BA9A 4FJOA 3NF1A 1EDUA 3FBZA 4MBQA 4IE7A 2I9CA 3GWHA 3IEGA 4CI3B 4UQXA 2V7JA 1D1AA 4YFSA 1YD8G 1PAQA 1NA3A 2GK9A 2KXPB 5JRCA 3VLEA 2YHCA 4EAHA 2CEAA 4E6HA 4PDXA 4UI9C 4A1SA 2XASB 4UVCB 1Z6TA 2E9XD 3ZRHA 4CI2B 4EZLA 2XRYA 5FMNA 3ZHEB 2OVBA 3CLJA 3CSTA 4G25A 2PQRA 4CT4A 2Z6EA 3AVSA 4F53A 3ONLA 1BR4A 5ANRA 5JDGA 5JH7E 4QX7B 2VKDA 1UJKA 2IFUA 3EVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMO A;  2WM9 A;  3B13 A;  3VHL A;  2YIN A;  2WMN A; 
#chains in the Genus database with same CATH topology
 3Q5W A;  3FTX A;  4IDQ A;  4JA7 A;  3HRA A;  4FJY A;  3CVY A;  1UN9 A;  5KJK A;  3QK6 A;  4X64 T;  2H6I A;  3JYS A;  5EDS A;  3SI5 A;  4JI2 T;  5IYZ E;  2B0O E;  5ABF B;  4LEU A;  2UXB T;  3BG0 B;  5KJN A;  5ENR D;  3CVN A;  3O4X E;  2VGY A;  2EHO D;  3FB2 A;  3TLT A;  3WAK A;  5JDM A;  5EZY E;  3QWW A;  2BG9 E;  3QB5 K;  1NAF A;  2BG9 B;  3JC6 D;  3BQL A;  5EK4 A;  2KZ7 B;  1BR1 A;  2WXQ A;  2NTX A;  4DI4 A;  3DEP A;  1SA0 E;  1HZ4 A;  3M65 A;  1WY6 A;  2MAW A;  1BPO A;  5ITZ F;  1MYO A;  2EIL E;  5KDM C;  3HXE A;  3KVB A;  2Y4U A;  4X66 T;  3ZEF A;  3ZW3 A;  1E7P A;  3R9M A;  4QH5 A;  4I50 E;  1E7V A;  4X20 E;  1HFA A;  3AED A;  1TNO A;  1KLX A;  5JJT A;  3QK0 A;  4AEZ C;  4LF8 T;  2VWA A;  1HR0 T;  2VJ8 A;  2XAH B;  3PZ2 A;  4TUY E;  3SFY A;  3AJI A;  3QB5 A;  4EB6 E;  5CEC B;  3BQO A;  3MKD A;  4YVQ C;  4OFZ A;  2MPK A;  3WG7 E;  3HKE E;  3SY2 A;  5L4H A;  2EIM E;  4EBA A;  3G06 A;  2YEV C;  4CDN A;  2WDV A;  2FBW A;  3EDU A;  3PJA J;  3CVP A;  4YTN A;  3Q75 A;  3AS4 A;  5KBA A;  3PEU B;  3E08 A;  4ZXL A;  3HDX A;  2Q9Q C;  2F8Y A;  4UXN B;  5HQ8 A;  4HI8 A;  3FFL A;  3PUG A;  3PUX F;  4GA0 A;  2WXK A;  4GML A;  4AKL A;  1IQR A;  2CHW A;  2LXM A;  2W0G A;  3P2B A;  3E4B A;  4U0U A;  5HWY A;  4L9I A;  4MBG A;  4V1A v;  1BD8 A;  4HWC A;  2AXV A;  1TEZ A;  1V9D A;  2M63 A;  3MAC A;  2CE7 A;  5FQ6 A;  4MHC A;  3NZU A;  3SNX A;  2Y6X A;  4KMO A;  3CX7 B;  3AXJ B;  3CHS A;  2H7O A;  1N33 T;  4B3T T;  4Z91 A;  3SBS A;  3RJV A;  2K9A A;  4QHO A;  2SPC A;  3FWV A;  4BT8 A;  3LSV A;  3ZC1 A;  4U0Z A;  2I6H A;  2PJQ A;  1UCU A;  3E22 E;  3P7I A;  1XNF A;  4NIK A;  4AV7 A;  2XS8 A;  3PUJ A;  3UU4 A;  4AY5 A;  3ZT5 A;  3D9P A;  4HFH A;  1Y64 B;  3I1A A;  4JI4 T;  3FTY A;  1KT0 A;  3U78 A;  4RG9 A;  3OBV E;  4J6I A;  3TKL B;  2GRL A;  2WSS V;  3RKO A;  3Q15 A;  2E9X C;  2P58 C;  2IU1 A;  2XEV A;  3KBT A;  2JAB A;  4CXY A;  3VLF A;  3RPU A;  4HOT A;  3V31 A;  4I6J A;  4ISS A;  3ISM C;  3PUZ F;  5GON E;  4BTA A;  2LT3 A;  5L3E B;  1BR2 A;  5EKQ D;  3W9F A;  2XQA A;  5KMG P;  3GN5 B;  1KEY A;  2V26 A;  2ODV A;  2XEH A;  1H7C A;  2WXI A;  3V30 A;  2M67 A;  3ZYQ A;  4KBM B;  3EDT B;  4I43 B;  4IN3 B;  3SO8 A;  3CK8 A;  1FEW A;  3FH8 A;  1JCR A;  2LAH A;  1JUQ A;  4LG6 A;  4TNV A;  3PZ3 A;  3KVA A;  5L3C B;  5FVK A;  4AXP A;  2FBN A;  2LEH A;  3VU7 H;  4JVS A;  3AB3 B;  4H9P C;  4DID B;  5HRY A;  4XEI G;  4C0M A;  4RSY A;  2L3L A;  3L39 A;  1V54 E;  2XEE A;  3HXF A;  4Z90 A;  1TNU A;  5AQV B;  3D9L A;  4RG6 A;  3O1I A;  2KWH A;  4N3C A;  1YCS B;  4Q69 A;  3HG0 D;  3CKD A;  1SZA A;  3SFZ A;  2DHR A;  4ACK A;  4U3C A;  3FZK B;  2WS3 A;  1QNF A;  1HX1 B;  2DZO A;  2ZGG A;  2LSJ A;  3FHN A;  3ESK A;  4ME2 A;  1IBK T;  3L9T A;  3RIU C;  5H6R B;  4C91 A;  3D3M A;  4HRN A;  5LOV E;  3SOL A;  2J07 A;  3HXB A;  3G2S A;  2VSO E;  4UF0 B;  3ZYK A;  5L3B B;  2V8S V;  4NUR A;  2CHN A;  4XE0 A;  2FO7 A;  2L6B A;  2DNX A;  3PZ4 A;  4ZS3 A;  3JAE A;  3C4X A;  3ETU A;  4TN7 B;  1OCR E;  2V8S E;  3UTK A;  4YSZ A;  1K8K G;  3B7T A;  3HIZ A;  4DPR A;  4B94 A;  4DK5 A;  2DI4 A;  2N1G A;  3FEY A;  1ELK A;  5D0Q D;  4I9E A;  2VL0 A;  4TV8 E;  4E85 A;  2N9D A;  1E7U A;  2C0M A;  2C5K T;  5AIJ A;  4C48 B;  3HKC E;  4DV6 T;  4CDR A;  2ZM0 A;  5LG4 A;  4BAY B;  3Q5D A;  1FT2 A;  4PK4 A;  2NYJ A;  4GZD A;  2JQH A;  2X66 A;  2PL2 A;  3SWH A;  4TV9 E;  2P9P G;  1JNR A;  2A2F X;  3C4W A;  2DWG A;  1NP7 A;  4CDM A;  4HWI B;  3B7B A;  4P1N A;  5JDF A;  5AQP B;  2L9Q A;  4HGA A;  4F6R C;  3PUY F;  4GK0 E;  1W0B A;  2XQ7 A;  3SFE A;  4ADZ A;  4HE8 A;  3GZS A;  4A5X A;  4I1A A;  3D9N A;  2CM0 A;  2LKG A;  4GK5 E;  2WQH A;  2XGM A;  3X2Q E;  3L09 A;  3UU8 A;  1QQE A;  1N54 A;  5C1D A;  4GCN A;  4YDW A;  2XQ9 A;  5LGN B;  4ILU A;  1EPU A;  2V6Y A;  3UQ3 A;  3ZT6 A;  3BQK A;  4JI8 T;  4GPK A;  3J7Y q;  2FO1 E;  3C98 B;  4JBW F;  3Q5X A;  4DMW A;  4O6F A;  1T72 A;  4KUM B;  2DCF A;  2X6J A;  5IWA T;  3TWQ A;  5JJ6 A;  4A55 A;  1R8I A;  3MXZ A;  5J2T E;  2KCK A;  1HO8 A;  4CXX A;  2XQ5 A;  5T8I A;  1T8B A;  4GTP A;  2K3W A;  3AE7 A;  4B93 B;  3HR0 A;  4O4H E;  2LNI A;  5LYJ E;  3L3P A;  4HWD A;  4FC8 A;  3RRN B;  5AQQ B;  1MX4 A;  3L22 A;  4U07 A;  1W0A A;  3EHZ A;  1FMV A;  2JLB A;  3HVE A;  1HF8 A;  4DV4 T;  1NEK A;  3H37 A;  3X1D A;  5DQV A;  2LM2 A;  2D0T A;  3P8C D;  4TWH A;  5FXX A;  3APC A;  2ACX A;  4G8L A;  5HKP A;  5KJM A;  2L0I A;  4HOQ A;  5FKY A;  4N2Q A;  2P9K G;  5FIN A;  2XCC A;  4TUM A;  4UI9 J;  2A5U A;  4LMK A;  2Q9Q A;  4GZC A;  5DIZ A;  2Y69 E;  3C3R A;  4PNI A;  3FXD B;  3FZM B;  4U7Y A;  2VQE T;  1MX6 A;  5IY5 E;  2Q9Q B;  2W00 A;  4MLK A;  3FUM A;  3I0O A;  3AG3 E;  4CZ2 D;  1OWM A;  1OED E;  1E8Z A;  4UEL A;  3HXC A;  4PS8 A;  4IDZ A;  4TV3 A;  4LSZ E;  2DYS E;  2VQ2 A;  5CJ5 A;  4GU5 A;  3O48 A;  1SHZ C;  4CN1 A;  1S63 A;  2I1K A;  2M6I A;  2UXC T;  5EYP F;  4I55 E;  4EQF A;  2E5L T;  2NW7 A;  5JDQ A;  4DRX E;  3F57 A;  1AJ3 A;  3EAB A;  3OPC A;  4FHK A;  2L0T B;  5G04 J;  4EZK A;  2G0U A;  4X65 T;  2XUE A;  3M3Z B;  4H7Y A;  3C72 A;  4XIF A;  5FQ8 A;  4AXH A;  3ZST A;  5A23 A;  4QH1 A;  2BED A;  1DCE A;  4AM9 A;  4DV5 T;  2BDE A;  2RPA A;  3ZMT B;  5FP3 A;  3PS6 A;  1B89 A;  2V6X A;  2KXP C;  2QA7 A;  5A1L A;  1KZP A;  4D10 C;  4JEU A;  1HE8 A;  4K0K T;  4ZOL E;  5G2N A;  3SHF A;  4HLL A;  5HEH A;  3L8R A;  4HBD A;  1Z8U A;  5ENS D;  2H7V C;  2CHO A;  2W61 A;  4LRZ A;  2HM8 A;  2J9Q A;  4WAF A;  2LHN A;  3B13 A;  4P0A A;  1LKX A;  3ZMU B;  2IUB A;  3AAA C;  4ZI2 D;  2F8X K;  3MJX A;  4TRQ A;  2P9U G;  4KYO B;  4CGV A;  3AEA A;  4MFR A;  5CHE E;  1KF6 A;  3ENE A;  4H9R C;  3RLF F;  2OCC E;  4UVB B;  5CFB A;  3IEE A;  2X9W A;  4GYW A;  3TXM A;  2DWZ A;  3L6A A;  4KT6 B;  1S94 A;  2C0L A;  3HKB E;  2X0L B;  2JQ9 A;  3QB2 A;  2VSX E;  5CEA A;  5AQJ B;  3PV0 F;  2VKH A;  4B8C B;  3I9W A;  4CCA A;  1UX4 A;  4WWO A;  2WQY A;  3E37 A;  5HXC A;  4Z8X A;  3SFX A;  4G2V A;  4M3O A;  4L9P A;  2K48 A;  3LJC A;  3QNK A;  4AY6 A;  3RYC E;  1N4Q A;  1T98 A;  4KVM A;  1OCO E;  2CXL A;  5AQO B;  2NW9 A;  4ILA A;  4YVO A;  3QAQ A;  1NL4 A;  2FJB A;  3PE0 A;  2W62 A;  3VR9 A;  2LHR A;  1D9S A;  2BKN A;  4JEU B;  1P5Q A;  2LSK A;  2KWI B;  3BEE A;  3FY4 A;  4Y6W A;  4ZEY A;  3TWX A;  2BVL A;  4O2B E;  5BXO A;  3N71 A;  4NUV A;  1MZC A;  5L2L A;  2WMN A;  3FZH B;  2VL8 A;  4LNB A;  3U3W A;  3TWR A;  1XDP A;  3S2A A;  1NI1 A;  4GYO A;  2X9H A;  2I59 A;  3ZFW A;  2QRX A;  3E33 A;  1CHU A;  4QH4 A;  4GTV A;  5HI7 A;  4EPZ A;  3U3I A;  4UV8 B;  3CHM A;  4FA6 A;  4TX5 A;  4CI1 B;  3OAW A;  3D9K A;  3E0Z A;  4JI3 T;  4MS6 A;  2V7K A;  4ANW A;  4BT9 A;  4L23 A;  2RFM A;  2XHE B;  4WWN A;  3NQP A;  3UM1 A;  4B8A A;  1XWM A;  2VVN A;  4GTS A;  1N0Q A;  4I2W A;  4DMV A;  4G8K A;  2HN2 A;  3CPZ A;  3N9L A;  4AJW A;  3UUX A;  3SRZ A;  3GA8 A;  1U5P A;  3GMI A;  4YDY A;  3RRW A;  2LM9 A;  3T8O A;  2NSZ A;  3LS8 A;  5FL0 A;  5HEU A;  4I43 A;  2BKP A;  3UKU G;  1IBM T;  4O1P A;  5B1A E;  5LBM A;  4OHF A;  2XQ0 A;  1JWF A;  4JI0 T;  3Q47 B;  3L13 A;  5KWD A;  5IHY A;  2WPV A;  1E96 B;  4FLH A;  4NIQ A;  2PQN A;  4CRW A;  4GTR A;  4K5C A;  4WNE A;  3R9A B;  3TXN A;  4AI6 A;  3PRZ A;  4CYM D;  2LSV A;  2AVP A;  2NTY A;  4XBF B;  2ZM8 A;  1HS7 A;  3NKZ A;  2WXN A;  4HS2 A;  1LRZ A;  4ANU A;  4N2S A;  5AQU B;  4DBR A;  2E2E A;  3VR8 A;  1W09 A;  3ZCJ A;  3FTS A;  2V5F A;  4LUN U;  4BEP A;  4UVA B;  4IST A;  4QWN B;  3AEB A;  3QWV A;  1MND A;  3AE5 A;  1PY1 A;  1E8Y A;  4U8Y D;  3QC9 A;  4HRL A;  1OED C;  2ION A;  2QVA A;  2HPL A;  2GRR B;  2C5I T;  4NUU A;  3ZUV B;  3AEC A;  4YTM A;  1YXR A;  1WYB A;  1L5J A;  5JHA A;  3RGL A;  3IBP A;  3UIN C;  3Q79 A;  5F3J A;  1JPL A;  3D0T A;  3ML9 A;  4AIU A;  3SF4 A;  4PFO A;  3RC3 A;  3NOG D;  4YND A;  1U2V G;  1OWO A;  3ZPJ A;  5ABE A;  4J8D A;  2CMR A;  5ADX L;  3FTW A;  2A72 A;  5J2U E;  3UM2 A;  2A3D A;  2RP4 A;  1SUM B;  4PH4 B;  2UY1 B;  1NFI E;  3V79 K;  3MK7 C;  5C3J A;  3UXG A;  5FT9 A;  3RIF A;  5AAR A;  2YDS A;  2DIW A;  3U64 A;  2MOZ A;  2FUL A;  3EUV A;  3ZN1 B;  5ABH A;  3FP3 A;  3PUA A;  3MEK A;  4K0U A;  3UU5 A;  5AQN B;  4OYJ A;  2KLQ A;  2I0M A;  1JNZ A;  3CEQ A;  4ILC A;  3IHR A;  1ZV4 X;  4OVU A;  2A9U A;  3J5P A;  5M4Y A;  2WDR A;  4XKC A;  2XQY A;  3EDV A;  3LXU X;  5CED B;  1UGO A;  2XZD G;  4ATG A;  3TLW A;  2FEZ A;  1X79 A;  3N2K E;  4OK0 A;  1UG3 A;  2XAJ B;  3K3O A;  5AQF B;  2NP9 A;  1FCH A;  4LFA T;  1OWL A;  4ANV A;  4O8S A;  2BKK B;  3MKQ A;  3OTO T;  2XPK A;  4NPP A;  4B3M T;  2E9X A;  4HFB A;  4HB5 A;  3RX6 A;  4PJN A;  4CGW A;  1X81 A;  4FUL A;  3HKD E;  1V55 E;  1I6Z A;  2IAK A;  4G2A A;  3NRX A;  5KXJ A;  2BS4 A;  3K3N A;  4JA9 A;  4KXK B;  1FVF A;  1OY3 D;  2AXU A;  4GYS A;  5L3D B;  1KPS B;  4ANJ A;  3PE4 A;  2P9S G;  1DVP A;  3LCA A;  5EIB E;  5CA0 E;  1LD7 A;  1J1J A;  2KIN B;  5E76 A;  4N5C A;  4GYR A;  2BUG A;  3GYZ A;  2RA1 A;  3ZN3 A;  2J1D G;  4WUY A;  3EU9 A;  3UUX B;  2VKJ A;  4DVD A;  2HE0 A;  2X6F A;  1E2A A;  2VYI A;  4RLY A;  4WYV A;  2CPT A;  1T7S A;  2DBA A;  3U9W A;  2P9L G;  3CQG B;  3EU5 A;  2DYR E;  2GW1 A;  4NXN T;  4L2L A;  3CK9 A;  2PM6 A;  1IJ6 A;  4UIG A;  2EHO A;  3MKQ B;  5JTG A;  3PVL A;  5CCM A;  3EIQ C;  4U96 D;  4WNF A;  2LJL A;  1MMD A;  3CQX C;  2OLT A;  3WAJ A;  1N0R A;  3N2G E;  4LF5 T;  4C90 A;  4UWG A;  4I2Z A;  3H3M A;  2X9X A;  4JEH B;  1EZ3 A;  4UQY A;  4F1S A;  5D66 A;  1N9A A;  4F6R D;  3OXG A;  1IQU A;  5EX0 A;  2XM2 A;  3PZ1 A;  1BU9 A;  5CBO A;  2HPJ A;  3P4Q A;  3W9G A;  5BMV E;  4AKI A;  3VLD A;  5AQ9 A;  3OTN A;  1BI8 B;  2WZI A;  3FU0 A;  3ABL E;  3PUV F;  1BI7 B;  3MV3 B;  1SVX A;  4WBN E;  3QWP A;  2NC9 A;  1RW2 A;  3OJA A;  2P9B A;  2RD0 A;  1UUS A;  2M6B A;  3RKG A;  2WXO A;  1JCS A;  1X5B A;  1E1H B;  1OXJ A;  2YDQ A;  3ONJ A;  5C8Y E;  2B6C A;  1J5W A;  3JAF A;  3RSE G;  2WWU A;  1QLB A;  4GTM A;  5EID A;  3FZF B;  4LF4 T;  3AA6 B;  2VB6 A;  3AEE A;  3FHE A;  5EK2 A;  4N3A A;  1TJC A;  5JA4 D;  5T3R A;  1M62 A;  4BES A;  2WCA A;  3TG5 A;  1X9B A;  3FH7 A;  3LFM A;  3CQC B;  4G1T A;  5JVD E;  5JDH A;  2IO3 C;  3C3Q A;  4EZ4 A;  3TG4 A;  4TZ4 C;  4J7W A;  2CCQ A;  5AQG B;  2WXH A;  2DLR A;  5AEN A;  2VTB A;  2NR4 A;  4B3R T;  3G2W A;  1YW0 A;  4UWK A;  3W15 B;  3EIJ A;  1I94 T;  2R59 A;  3NZQ A;  3VKH A;  1XNR T;  3GZ1 A;  4F7A A;  4APF A;  3R84 B;  3KSQ A;  2H89 A;  3CX6 B;  4XAX B;  3PNL B;  3CR3 A;  2FJA A;  2ILR A;  3D9H A;  2QY7 A;  5FL1 A;  3OKQ A;  1YQ3 A;  4U33 A;  2D0U A;  2JPF A;  5LMN T;  2GRN B;  3HHM A;  4UR9 A;  3ZYM A;  3DSU A;  1YQ4 A;  2YU2 A;  2VKO A;  5G05 J;  3LPZ A;  2KT9 A;  3KDS E;  3CVW A;  2J8S D;  1S35 A;  3S7F A;  1NZN A;  1UX5 A;  2I2O A;  5T4Y A;  3B7S A;  2OVF A;  3KV4 A;  1S0P A;  1BR0 A;  3U66 A;  2ETB A;  3K3Q C;  3ANW B;  4B6X A;  4AKH A;  3KSL A;  2PNN A;  4EGW A;  2J4B A;  1XMQ T;  3LK2 B;  2ZMA A;  5LBQ B;  5BR8 T;  1Y8M A;  3N9N A;  1US7 B;  2CLY B;  2IW5 B;  3G2U A;  4DX2 A;  2GRM A;  1KNZ A;  4HVB A;  3AAE B;  2J49 A;  4O60 A;  4XI9 A;  5J1G A;  1N36 T;  3RK6 A;  4GYY A;  2X0H A;  3NBN B;  5E75 A;  4I6E A;  3IHY A;  4WBO A;  3UT5 E;  5JHB A;  2YKS A;  4W9R A;  3RH3 A;  5B3S E;  4APO A;  2X0Y A;  3NZP A;  3SZ7 A;  1LVK A;  4HN9 A;  3TLV A;  3UMV A;  3H3A A;  4OYK A;  2HYZ A;  4PUC A;  2WMO A;  5FYM A;  3L16 A;  1HH8 A;  4B89 A;  5LMU T;  3AU4 A;  3V5S A;  2H88 A;  1U3C A;  3DWL G;  3FH5 A;  1W3B A;  1H19 A;  2BF0 X;  1UUR A;  4JI6 T;  2UUA T;  2AE9 A;  4JHR A;  2BG9 A;  3ZC0 A;  1GW6 A;  4KVO A;  5JR9 A;  3VHL A;  2OV9 A;  5A6C A;  3I4R B;  4BJN A;  2QYW A;  4KMC A;  2P9N G;  3IHV A;  5LHI B;  3UUN A;  4MAL A;  1JCQ A;  3HA4 A;  1BLX B;  5JJ7 A;  3TLU A;  3LDQ B;  1N11 A;  2RG8 A;  2UUC T;  3AE6 A;  4ILB A;  3CVQ A;  4NRH B;  4ZHQ E;  3ZKJ A;  4EXT A;  3C5R A;  3NZS A;  3QDN A;  3P50 A;  4U8H A;  2IQC A;  3ASO E;  5HEG A;  1O1T A;  2VGE A;  1D1B A;  4HTE A;  4FLB A;  4CZZ B;  4A63 B;  3JC6 C;  5IUX A;  2IC9 A;  1K3Z D;  4DX7 D;  2KMF A;  2NW8 A;  2WDQ A;  4L7T A;  2QYU A;  3UQ7 A;  2V6Y B;  4N78 D;  2LSY A;  4HFG A;  3RO3 A;  3ONX A;  4DR5 T;  3D9I A;  4CN6 A;  3N2O A;  2XTL A;  3GW4 A;  3LEW A;  2XZE A;  2J09 A;  4IHJ E;  4YLH A;  4FI5 A;  1UK5 A;  2IHR 1;  2NWB A;  4GZ5 A;  2WZH A;  1SW6 A;  4ERR A;  2XZT G;  2XJ7 A;  3TL5 A;  1U4Q A;  3FUN A;  3ML8 A;  1DNP A;  5HS0 A;  3P4W A;  4ABN A;  3UU3 A;  5LG3 A;  3T9K A;  2XGO A;  4CXW A;  1Z5S C;  1OWP A;  4EBA G;  1WG0 A;  4UEM A;  2LSI A;  1AP7 A;  4YHJ A;  3EJN A;  4F3V A;  4ACL A;  4O2A E;  3EI0 A;  3ULQ A;  3K1S A;  4J8F A;  2FJE A;  4JHJ A;  3QC1 A;  3P4R A;  1XGW A;  3PUS A;  2VSN A;  3DEO A;  4LF7 T;  2WXG A;  3ZKR A;  5HEJ A;  1TN7 A;  4DR6 T;  1WRD A;  2BTD A;  3LDZ A;  1NA0 A;  4HLE A;  5JR9 C;  1OT8 A;  5C2Y A;  3VTY A;  2CA5 A;  2MYS A;  2N2N A;  2XSA A;  4X1Y E;  4YJ2 E;  1H0A A;  4P29 A;  3MX3 A;  2I1J A;  3ANW A;  2E9X B;  3ZN0 B;  3N9M A;  3ZCI A;  4AKR B;  1IHB A;  3NBX X;  3AA1 B;  5FZR A;  2X6K A;  4IRU A;  5EN5 D;  2W63 A;  3NOC D;  2FF4 A;  3EUH A;  1WCR A;  4H9N C;  5EK3 A;  4ZI2 C;  4Q25 A;  4UF0 A;  5LJN A;  3NAW A;  3ZIM A;  5BUZ A;  3KEZ A;  3EHM A;  4F8H A;  2DL1 A;  1G8X A;  3A7M A;  4KBQ A;  4MLP A;  2D2S A;  3Q7F A;  1IYG A;  3I3N A;  5LXT E;  1UN8 A;  3LG7 A;  4LML A;  1TN6 A;  4XZC A;  4J8Y A;  4H9O C;  4AQF C;  4HWH A;  1H6K A;  4K0R A;  3C51 A;  1HNX T;  2WU2 A;  1A5E A;  4WWP A;  4I0U A;  5CRV A;  3QAR A;  4DR3 T;  1WR0 A;  2EIN E;  2ZIS A;  5HXR A;  1IXV A;  4G63 A;  1HG5 A;  1ZP0 A;  2BKG A;  3ASG A;  4U95 D;  2R2L A;  4DX5 D;  4I17 A;  3NWI A;  2B1E A;  5BV0 A;  5FXV A;  3LVQ E;  2Y3A A;  3PUK A;  3EHR A;  4FHJ A;  3PNT B;  5ANL A;  2JJ9 A;  4PW8 A;  2VTB B;  2F4V T;  2WXF A;  3FUI A;  5CMY A;  5F8P A;  4DUI A;  2XQ4 A;  4WNK A;  2BG9 C;  3FBL A;  4EYU A;  2XSB A;  3C98 A;  2F37 A;  2V7M A;  3SQV A;  4AP2 A;  2WQ7 A;  3JQ1 A;  3R6N A;  3RRU A;  1J5E T;  4CN4 A;  4KHP T;  4BET A;  1KNR A;  1XMO T;  4ZFH A;  2PFV A;  1Y6I A;  3GN5 A;  2CFZ A;  3D9M A;  5M72 A;  2CG3 A;  3UT4 A;  3KS2 A;  3FU6 A;  5DJQ C;  5L4E A;  3ZMV B;  2QGS A;  1N52 A;  4IT4 A;  4I1M A;  1S64 A;  3QJZ A;  1LVF A;  3DST A;  4H9S E;  4DLO A;  4JB8 P;  3CGH A;  3HXD A;  3U4T A;  3ZSS A;  2KM4 A;  4GOU A;  4X1I E;  3CV0 A;  3ZMZ B;  4XX5 A;  3RYI E;  2KSR A;  2VAS A;  1WAO 1;  4M7C A;  4ZS2 A;  2CXD A;  3WI3 A;  2EIK E;  3TGO A;  2VVS A;  4A1G A;  3S7D A;  2IF4 A;  3L17 A;  4IDN A;  5JRE A;  2HN1 A;  4GMJ A;  4TWD A;  3DP7 A;  2ZM2 A;  3GZ2 A;  5LP0 A;  1D8D A;  2BKO A;  3RIA A;  3AXJ A;  5FXW A;  1ZEE A;  3PUR A;  5HCJ A;  3AA0 B;  3JUE A;  2W2U A;  4DV3 T;  4X1K E;  3CHO A;  4G26 A;  2XCB A;  3DSW A;  5BPP A;  3O9X A;  3URZ A;  5AYW D;  4OAU C;  3APD A;  3PEV B;  3ASN E;  3ZEF B;  4OVV A;  2P2C P;  2CBJ A;  5JDN A;  1MMA A;  5AQI B;  3CVX A;  4FAD A;  2V1D B;  1TNB A;  4L2Y A;  3Q9N C;  2R5S A;  3RO2 A;  4YHH T;  4ZHB A;  2L8K A;  3LJ3 A;  5G55 A;  2A5E A;  5EIL A;  2E5V A;  4HOU A;  1UOH A;  2XPZ A;  1ZB1 A;  4JW1 A;  3TWU A;  3SD5 A;  4DO0 A;  2E2A A;  5E0O A;  2EQX A;  3AS8 A;  1D8E A;  3I5P A;  2XGS A;  1HS6 A;  1MQS A;  2K5B B;  3OVU A;  5LP6 E;  4EEC A;  3T5X A;  2XQ6 A;  3HL6 A;  3FEX A;  1B7T A;  2V5Q C;  4IDP A;  1S70 B;  2CFU A;  2MOW A;  1HX8 A;  2R05 A;  2W4X A;  2XPY A;  2JQQ A;  2VGX B;  2J62 A;  1A17 A;  1FJG T;  2PZI A;  3TAX A;  5CER B;  3ASD A;  3FZL B;  3N9O A;  2UXN B;  3F31 A;  4X62 T;  4I9C A;  4HWF A;  2XAF B;  3CKC A;  3LJN A;  4TXQ A;  3HI2 A;  4K5A B;  2DZN A;  4UV9 B;  4KX6 A;  4P0B A;  4A3T A;  2B76 A;  5CRU A;  4FU3 A;  2MTQ A;  1HG2 A;  4CQI A;  4YXD A;  4JD2 G;  4RVB A;  3ZHE A;  3UIP C;  4LER A;  3UFE A;  1OUV A;  3G2V A;  1FT1 A;  2X67 A;  1ELW A;  3OXF A;  2YN6 A;  4HFD A;  2XPI A;  3ZXS A;  2AXD S;  3LBX A;  5L3F B;  4C9B B;  2WQ6 A;  4A3V A;  3T5V A;  2L9B A;  3PRE A;  5AFU L;  2GRP B;  2HR2 A;  3QOU A;  3F6Q A;  1TYQ G;  3QUJ A;  4AQY T;  3CSF A;  4E7S A;  2PTF A;  3C50 A;  1VRB A;  4Q96 A;  2LUH A;  4Y6C A;  3FUJ A;  1OED A;  1N34 T;  2C5J A;  4MKT A;  3TWW A;  3CIA A;  3JXI A;  1ZHC A;  4J0U A;  2AWI A;  3TWV A;  2LOP A;  1E90 A;  4E7Z A;  1LD8 A;  3V2O A;  3KV6 A;  2LRK A;  4HOR A;  2YK0 A;  3TJP A;  4H63 V;  1AWC B;  3FUD A;  2IEJ A;  2XQ3 A;  3T8M A;  3L82 A;  1O5M A;  4EED A;  4DUZ T;  3IF8 B;  4AVX A;  2WB2 A;  4YSY A;  5JDL A;  4K03 A;  4ZZB A;  3ASH A;  3ABV A;  4J2C A;  2CWY A;  2DWK A;  1H2V C;  2AXZ A;  1Y01 A;  1FMW A;  3N9Q A;  3E30 A;  3MZK B;  5AJD A;  3DSS A;  5FTP A;  3TWS A;  2HH7 A;  5JRC B;  2BS3 A;  3PJA A;  3UUL A;  4UUC A;  3UT8 A;  4N3B A;  3IBE A;  4KP3 C;  3ASF A;  3MKR A;  4O4J E;  1OCC E;  3KD7 A;  5AQT B;  3UM3 A;  5CCL A;  5FNV E;  4ASK A;  5TAO A;  3LK4 2;  3NB2 A;  3OYX A;  3LVR E;  5B1B E;  4YSX A;  3I4G A;  2IDO B;  3CK7 A;  1UW4 B;  4TXR A;  3ZMS B;  5AQS B;  4UQZ A;  1K1B A;  1D1C A;  4G11 A;  3RYH E;  4AQF A;  1NWM X;  2RFA A;  2X6H A;  2C0S A;  4DI3 A;  2UUB T;  3FUK A;  3AE9 A;  3F2E A;  3CVL A;  3ULY A;  5FJY A;  2CWO A;  3PUW F;  1NEN A;  4OAV B;  2V4H C;  3PDY A;  4A56 A;  4NAC A;  1D0X A;  4JUY A;  5LNK A;  5G04 C;  4EZJ A;  3CHP A;  1WR6 A;  3AA7 B;  2IJG X;  2KCL A;  1DC2 A;  5ENQ D;  2V5D A;  3ZJ1 A;  3RQW A;  4XKB A;  3L08 A;  3BK9 A;  3PU3 A;  4F1P A;  2OND A;  5AAO A;  1N95 A;  4YTP A;  4BX8 A;  4DUY T;  2ZXW E;  5HXH A;  2ZIR A;  3P4S A;  2LLY A;  3Q5M A;  3HVE B;  2KCV A;  5KJL A;  3CHQ A;  2JQK A;  3KIN B;  1IHG A;  2ZM6 T;  1TN8 A;  3IKO B;  4G24 A;  3ZGQ A;  3O4Z A;  2WBL A;  1U3D A;  1IZN B;  2IOL A;  4B0Z A;  5ABF A;  2LO6 A;  3UX4 A;  1YMP A;  3AEF A;  3ZJ2 A;  2XS1 A;  3SFD A;  4NXM T;  4LNG A;  2X3M A;  4HOS A;  2YU1 A;  4V3I A;  5FIO A;  4U72 A;  3DXK G;  2DCP A;  1ZKE A;  4HEA A;  1H6P A;  4DV1 T;  3JCF A;  4GPM A;  2WB5 A;  4GZ3 A;  3EHQ A;  3AE8 A;  5ARG A;  3TWT A;  2QYJ A;  3FU3 A;  3CML A;  3FUL A;  2ZGD A;  5HAX A;  3CWZ B;  3DJB A;  4O4L E;  3J9X 1;  3BG1 B;  4I4T E;  2W66 A;  2XY8 B;  1QSD A;  4O1O A;  3A8Y C;  3FUH A;  3Q78 A;  1MHQ A;  2PG8 A;  4GTT A;  2L6J A;  5HXS A;  3HYM B;  5LCW J;  3LYA A;  2LAI A;  3CVR A;  2JRK A;  2CXF A;  2LRL A;  1ELR A;  2Y1L E;  4ANX A;  5AQB A;  4JI5 T;  3UPV A;  4EZH A;  1CUN A;  2CRB A;  2HO1 A;  1FVH A;  4GKK T;  3RF1 A;  5BXU A;  3ONK A;  3LKU A;  3PUQ A;  3Q9D A;  3KV5 A;  4U0S A;  4IDO A;  1YKH B;  2BVM A;  3Q49 B;  4GZ6 A;  3MGB A;  5CB4 E;  4O4I E;  3UM0 A;  1MMG A;  2Y0B G;  4DR1 T;  2V7I A;  2WXP A;  1XDO A;  5DQW A;  2CLY C;  2Q7F A;  4TUU A;  1WM5 A;  4IRE A;  3UUB A;  5JR9 B;  1O1S A;  4Q94 A;  1OWA A;  3B57 A;  2WXR A;  3ZNG A;  4TXP A;  2YOE A;  4IE6 A;  2H6G A;  3T1H T;  4DX1 A;  2AW6 A;  4U74 A;  1JWG A;  1K1A A;  2VUR A;  5LHG B;  3C3O A;  5AJL A;  3CX8 B;  3ZYL A;  1N32 T;  1E8W A;  2ODU A;  3RQU A;  5AQH B;  2GRQ B;  3CK6 A;  3O1H A;  2FI7 A;  4HFE A;  4JYA T;  5FY1 A;  3CHR A;  3AVR A;  3LBX B;  5HWX A;  4PS7 A;  5D0O D;  2QZA A;  3C4Z A;  2WVI A;  4PK6 A;  2WP9 A;  1HTJ F;  4C0E A;  1HNZ T;  1G73 A;  5FVL A;  3S4U A;  4AIF A;  3LY9 A;  4JEH A;  1N4P A;  1KT1 A;  3RC8 A;  3Q7A A;  2D9D A;  4YT0 A;  3MCX A;  4KHZ F;  1VDY A;  2Y8D A;  4AQG A;  1H2U A;  4UWH A;  4U04 A;  3FDH A;  4HRM B;  2IML A;  4XZ4 A;  4U7I A;  4I6G A;  1EF1 C;  2OA5 A;  1FPP A;  1SZ9 A;  2WXL A;  3JQ0 A;  5FXZ A;  4ILI A;  3ETV A;  3AG4 E;  3FU5 A;  2CG2 A;  4IUL A;  4WZX A;  2VGX A;  2WY2 A;  2YQ8 A;  4PJL A;  2J47 A;  1Q2Z A;  5C2T A;  3FTU A;  3Q73 A;  4JXT A;  5HEO A;  2J08 A;  3BU8 A;  1L0V A;  3UFG A;  1LTX A;  3FTV A;  2OV8 A;  3RU0 A;  3S7B A;  3JCK C;  2C2L A;  2XAG B;  4I1O B;  5BV1 A;  1OXZ A;  4COF A;  4FP7 A;  4JLE A;  4OYS A;  2ZU6 B;  5L3G B;  2A4Z A;  3SBT B;  3UI2 A;  5JQG E;  5BNW A;  4L1B A;  3C64 A;  4BY6 A;  2LSG A;  1YKE B;  3DXM G;  4PFP A;  3UIO C;  4M1P A;  4P09 A;  3B95 A;  5FWQ A;  4DX6 D;  4ILG A;  5JMN D;  1QYM A;  3G2T A;  5HXE A;  1H6O A;  3CVV A;  5LA6 E;  2KND A;  2WAU A;  3APF A;  2KZT A;  4H7X A;  2PBI A;  1MIY A;  4JHK A;  1MIV A;  1D0Y A;  3N5L A;  3ZPO A;  2LE8 A;  1IKN D;  1N4S A;  4ZI3 D;  4GA2 A;  3I0Q A;  3RHW A;  2H6H A;  4JL0 A;  2XAQ B;  3IXE A;  5AQ7 A;  1HU3 A;  2R02 A;  2GRO B;  4BWR A;  5J08 A;  3DSX A;  4BER A;  2JEK A;  4HQD A;  3T8K A;  4QX8 B;  2J4G A;  3UQ4 A;  3RAU A;  4ILH B;  2Y48 B;  3D9O A;  4L5G A;  5LB7 B;  5AQR B;  3MV2 B;  4GCO A;  1VCS A;  3FTZ A;  1LF8 A;  4URK A;  3J5Q B;  5CA1 E;  4HFV A;  1QZ2 A;  4BJM A;  4Z68 A;  3IA3 A;  5CMW A;  4DR7 T;  4NQ0 A;  2D5U A;  2IIU A;  1QBQ A;  3VKG A;  2MHK A;  4TWF A;  1Z0P A;  3KAE A;  4DLQ A;  4L0R A;  3Q4A B;  4GTQ A;  4OX9 T;  2F0Y A;  3AU5 A;  1DCQ A;  4WW0 A;  2UXD T;  3LY8 A;  2UY1 A;  4LF6 T;  1MJ0 A;  1SE7 A;  4IE0 A;  4DND A;  4PK5 A;  2IC6 A;  5DBK A;  2YHE A;  2LSU A;  4GB9 A;  2XRZ A;  2MYO A;  3R7R A;  2JMH A;  3K8P C;  4BX9 A;  4IL9 A;  4ZZC A;  5FQ7 A;  3PTR B;  2ZLY A;  3EAM A;  3JUI A;  2R6G F;  1H2T C;  3FUF A;  3IV0 A;  5FZS A;  2IOS A;  1TR4 A;  5BW8 C;  3CIR A;  2BBH A;  2FUP A;  2H6F A;  2CHZ A;  4HI9 A;  3V2X A;  1RZ4 A;  2X38 A;  4LNU D;  4N39 A;  1SA4 A;  5AN8 A;  2KZT B;  4JI7 T;  4U63 A;  2W67 A;  3ZLI A;  4UWL A;  2V7L A;  3B7U X;  4J8E A;  3RRM B;  5LCW C;  3D9J A;  2OEW A;  3ZVV A;  3UUM A;  3B7R L;  4N5Q A;  2EIJ E;  3SS1 A;  5ENN A;  1YA0 A;  5ABG A;  2WXM A;  3ABM E;  1N94 A;  3ONL C;  3PU8 A;  5BT1 A;  5KCM A;  3V5U A;  5LOZ A;  5AQM B;  2PM7 A;  4MRU A;  1MIW A;  4EIW A;  4BSX A;  4QFV A;  2X68 A;  3Q5E A;  1KK7 A;  3LK3 B;  4GAA A;  2MRI A;  4YJ3 E;  4WND A;  2BS2 A;  3UTM A;  5FY0 A;  3ZU7 B;  2WU5 A;  1G3N B;  3OXL A;  3SGH A;  3DPY A;  2NXP A;  1PC2 A;  4XI0 A;  2AJA A;  5ENO D;  3OYZ A;  4DV2 T;  4QKN A;  4J8S A;  5LCY A;  3BQI A;  1FIO A;  3PZD A;  3EHN A;  4JC8 A;  4GTO A;  3P4P A;  5J0Z A;  3MA9 A;  2EHO B;  5D2M C;  3MZL B;  3FUE A;  2YNQ A;  5LHH B;  3FXE B;  3LY7 A;  4TNW A;  1INZ A;  4KI0 F;  5FQ4 A;  1O1R A;  4R7L A;  1W9R A;  4IYP A;  2E8I A;  5J90 A;  2R17 C;  4IIJ E;  5AQA A;  3I9Y A;  3Q2M A;  4IGU A;  4GKJ T;  1OWN A;  2GGF A;  4H9Q C;  3QOF A;  4GA1 A;  3KV9 A;  2UXX B;  2NOX A;  5AQK B;  2RKK A;  2J4D A;  3AE2 A;  2UWJ G;  4ATZ D;  3NVO A;  2ETA A;  3AS5 A;  5KX5 E;  4LCT A;  3RIB A;  1SQM A;  1SA5 A;  2MBG A;  3WXX A;  1KNP A;  5EX3 A;  3ESL A;  4LFC T;  4ZI3 C;  3O1J A;  4HNA D;  2Y4T A;  4PAG A;  1O3X A;  3K9I A;  3CVU A;  5H7P A;  4QXH B;  2IY0 C;  2JMK A;  4PJJ A;  2ETC A;  4EOZ B;  4LFB T;  1IAP A;  4IE4 A;  4BFR A;  4H63 H;  4IE5 A;  5LGU B;  4U8V D;  3AG2 E;  3DBS A;  2WXJ A;  1TNY A;  2OOE A;  2X6I A;  2CHX A;  4AKG A;  1Z3Y A;  3N9P A;  2KAT A;  2QFC A;  4HXI A;  1TJF A;  5ENP D;  3DPD A;  4IL4 A;  1WYC A;  4PS3 A;  4HFC A;  5LGT B;  1HXI A;  1E8X A;  2LOS A;  1HCI A;  1MX2 A;  3PE3 A;  3PDN A;  5FZQ A;  5KNH D;  2ES0 A;  4U7E B;  1MMN A;  3AAA B;  4AOF A;  2X9Y A;  4KZC A;  4UI9 K;  3RRC A;  2V0P A;  4BSZ B;  2R03 A;  4CT0 A;  5A7D B;  2XM1 A;  3DTO A;  4U2Z A;  1N4R A;  4ZI7 E;  1WLX A;  3L54 A;  4FJZ A;  4PJM A;  3AE3 A;  1WFD A;  4QQI A;  5H6Q B;  2K24 A;  5ARF A;  4UWF A;  3VTX A;  1QUU A;  5CGM A;  4JPS A;  1KZO A;  5G05 C;  3BUA A;  5LJM A;  4QXC B;  4AIS A;  4EEB A;  4EV6 A;  3VRB A;  3MJW A;  2IO2 C;  4DJA A;  5LFA A;  4X8Q A;  4EYY R;  3KFW X;  1XNQ T;  2LXL A;  4DR2 T;  3UKR G;  1GQE A;  5DAB A;  4WNG A;  2E0I A;  2EHO C;  2V5C A;  5ETW A;  2WM9 A;  5L47 A;  5HCM A;  2XEN A;  3QKY A;  3UT7 A;  3RKV A;  5LX8 A;  2P9I G;  4QXB B;  5KNG A;  4GIW A;  1EYH A;  3S7J A;  2ACZ A;  4DV0 T;  5CBN A;  2YIN A;  3MYV A;  2VK9 A;  3PH0 C;  2XHE A;  3KBU A;  3NRY A;  2BBJ A;  3DRA A;  1TNZ A;  4KZ0 A;  4G23 A;  1MNE A;  4RQI A;  1KFY A;  4X5T A;  2KC7 A;  1D0Z A;  4CEM A;  3ABK E;  1ZBP A;  4A97 A;  3P1U A;  5HYA A;  3B5M A;  4JZY A;  3JXJ A;  2HHH T;  3AAI A;  2KBX A;  4YY3 T;  2X51 A;  3MA5 A;  2V4L A;  2H3R A;  1IJ5 A;  5F5W A;  2VSY A;  3ULE G;  3QNU A;  2XQ8 A;  3E32 A;  3R7Q A;  3A5X A;  2VQF T;  5FY7 A;  4DBQ A;  4HKA A;  1ZU2 A;  1UJJ A;  3CKB A;  1OCZ E;  2Q9Q D;  1VOM A;  4BTB A;  3RIU A;  2BZB A;  3RYF E;  3AE4 A;  3ZT7 A;  1Z3X A;  5AQL B;  4BA9 A;  4FJO A;  1HNW T;  3NF1 A;  1XZY A;  1EDU A;  5EYL A;  3FBZ A;  2UU9 T;  4MBQ A;  5ENT D;  4IE7 A;  2I9C A;  1ZOY A;  3GWH A;  2CBI A;  1VCT A;  3IEG A;  4CI3 B;  3Q9U C;  4UQX A;  2V7J A;  1D1A A;  2LKH A;  4YFS A;  1YD8 G;  1PAQ A;  4DV7 T;  4YDO A;  1NA3 A;  2GK9 A;  3AG1 E;  2KXP B;  5JRC A;  4U31 A;  3VLE A;  3ZXP A;  2YHC A;  4EAH A;  1IBL T;  2OEV A;  2CEA A;  3VRA A;  3E34 A;  4LF9 T;  4E6H A;  4PDX A;  1WDY A;  4UI9 C;  4JI1 T;  4EHM A;  4A1S A;  2XAS B;  4UVC B;  4HFI A;  1Z6T A;  2YDR A;  4A98 A;  2E9X D;  4K5B A;  3ZRH A;  4CI2 B;  3RI5 A;  4EZL A;  2XRY A;  5FMN A;  3ZHE B;  3TLS A;  4GMR A;  3AE1 A;  2OVB A;  3CLJ A;  3DSV A;  3CST A;  4YDE A;  4G25 A;  2PQR A;  2JIW A;  2WWV A;  4CT4 A;  4B3S T;  2FJD A;  2Z6E A;  3AVS A;  4F53 A;  3ONL A;  1BR4 A;  1YYH A;  4U2Y A;  3UU6 A;  4JV5 T;  5ANR A;  5JDG A;  4DR4 T;  3T1Y T;  1OED B;  3AEG A;  5JH7 E;  1DU2 A;  3JAD A;  4QX7 B;  2VKD A;  2QC9 A;  2DVW A;  1UJK A;  4LMJ A;  2IFU A;  1M7K A;  3EVY A;  3KEA A; 
#chains in the Genus database with same CATH homology
 3Q5W A;  3FTX A;  4JA7 A;  4FJY A;  3CVY A;  1UN9 A;  5KJK A;  3QK6 A;  3JYS A;  5EDS A;  3SI5 A;  5IYZ E;  4LEU A;  5KJN A;  3BG0 B;  3CVN A;  3O4X E;  2VGY A;  2EHO D;  3FB2 A;  3WAK A;  5JDM A;  5EZY E;  3QWW A;  1NAF A;  3JC6 D;  3BQL A;  5EK4 A;  2KZ7 B;  1BR1 A;  2WXQ A;  2NTX A;  4DI4 A;  1SA0 E;  1HZ4 A;  3M65 A;  1WY6 A;  1BPO A;  5KDM C;  3KVB A;  2Y4U A;  3ZEF A;  3ZW3 A;  4I50 E;  1E7V A;  4X20 E;  1HFA A;  1KLX A;  5JJT A;  3QK0 A;  4AEZ C;  2VWA A;  2VJ8 A;  2XAH B;  4TUY E;  4EB6 E;  3MKD A;  4YVQ C;  4OFZ A;  3HKE E;  4EBA A;  2YEV C;  4CDN A;  3EDU A;  3CVP A;  3AS4 A;  3PEU B;  3E08 A;  3HDX A;  2Q9Q C;  4UXN B;  5HQ8 A;  3FFL A;  3PUG A;  4GA0 A;  2WXK A;  4GML A;  4AKL A;  1IQR A;  2CHW A;  2W0G A;  3P2B A;  3E4B A;  4U0U A;  5HWY A;  4L9I A;  4V1A v;  2AXV A;  1TEZ A;  1V9D A;  2M63 A;  3MAC A;  2CE7 A;  5FQ6 A;  4MHC A;  3NZU A;  3SNX A;  2Y6X A;  4KMO A;  3CX7 B;  3CHS A;  2H7O A;  3SBS A;  3RJV A;  2K9A A;  4QHO A;  2SPC A;  3FWV A;  4BT8 A;  3ZC1 A;  4U0Z A;  2PJQ A;  2I6H A;  1UCU A;  3E22 E;  3P7I A;  1XNF A;  4AV7 A;  3PUJ A;  4AY5 A;  3D9P A;  3FTY A;  1Y64 B;  3I1A A;  1KT0 A;  3U78 A;  4RG9 A;  3OBV E;  4J6I A;  3TKL B;  2GRL A;  2WSS V;  3RKO A;  3Q15 A;  2E9X C;  2P58 C;  2IU1 A;  2XEV A;  3KBT A;  4CXY A;  3VLF A;  3RPU A;  4HOT A;  4I6J A;  4ISS A;  5GON E;  4BTA A;  2LT3 A;  5L3E B;  1BR2 A;  5EKQ D;  5KMG P;  3GN5 B;  2V26 A;  2ODV A;  1H7C A;  2WXI A;  2M67 A;  3ZYQ A;  4KBM B;  3EDT B;  4I43 B;  4IN3 B;  3CK8 A;  1FEW A;  3FH8 A;  2LAH A;  1JUQ A;  3KVA A;  5L3C B;  4AXP A;  2FBN A;  2LEH A;  3VU7 H;  4JVS A;  3AB3 B;  4H9P C;  4C0M A;  4RSY A;  2L3L A;  3D9L A;  4RG6 A;  3O1I A;  2KWH A;  4N3C A;  4Q69 A;  3CKD A;  1SZA A;  3SFZ A;  2DHR A;  4ACK A;  1QNF A;  2LSJ A;  3FHN A;  3ESK A;  4ME2 A;  5H6R B;  4C91 A;  3D3M A;  5LOV E;  3SOL A;  2J07 A;  3G2S A;  2VSO E;  4UF0 B;  3ZYK A;  5L3B B;  4NUR A;  4XE0 A;  2FO7 A;  2DNX A;  4ZS3 A;  3C4X A;  3ETU A;  4TN7 B;  2V8S E;  3UTK A;  3B7T A;  3HIZ A;  4DPR A;  4B94 A;  4DK5 A;  2DI4 A;  2N1G A;  3FEY A;  1ELK A;  5D0Q D;  4I9E A;  4TV8 E;  4E85 A;  2N9D A;  1E7U A;  2C0M A;  2C5K T;  5AIJ A;  3HKC E;  4CDR A;  2ZM0 A;  5LG4 A;  4BAY B;  4PK4 A;  4GZD A;  2X66 A;  2PL2 A;  3SWH A;  4TV9 E;  2A2F X;  3C4W A;  2DWG A;  1NP7 A;  4CDM A;  5JDF A;  2L9Q A;  4HGA A;  4F6R C;  4GK0 E;  4ADZ A;  4HE8 A;  3GZS A;  4I1A A;  3D9N A;  2CM0 A;  4GK5 E;  2WQH A;  2XGM A;  3L09 A;  1QQE A;  1N54 A;  5C1D A;  4GCN A;  5LGN B;  4ILU A;  1EPU A;  3UQ3 A;  3BQK A;  4GPK A;  3J7Y q;  3C98 B;  3Q5X A;  4DMW A;  4O6F A;  4KUM B;  2DCF A;  2X6J A;  5JJ6 A;  4A55 A;  5J2T E;  3MXZ A;  2KCK A;  1HO8 A;  4CXX A;  5T8I A;  3HR0 A;  4O4H E;  2LNI A;  5LYJ E;  3L3P A;  4FC8 A;  3RRN B;  3L22 A;  4U07 A;  1FMV A;  2JLB A;  3HVE A;  1HF8 A;  3H37 A;  5DQV A;  2D0T A;  3P8C D;  5FXX A;  3APC A;  2ACX A;  5KJM A;  2L0I A;  4HOQ A;  4N2Q A;  2XCC A;  4UI9 J;  2A5U A;  2Q9Q A;  4GZC A;  5DIZ A;  4PNI A;  3FXD B;  2Q9Q B;  2W00 A;  4MLK A;  3FUM A;  3I0O A;  1OWM A;  1E8Z A;  4UEL A;  4PS8 A;  4IDZ A;  4TV3 A;  4GU5 A;  2VQ2 A;  3O48 A;  1SHZ C;  2I1K A;  4I55 E;  4EQF A;  2NW7 A;  5JDQ A;  3F57 A;  1AJ3 A;  4FHK A;  2L0T B;  5G04 J;  4EZK A;  2G0U A;  2XUE A;  4H7Y A;  4XIF A;  5FQ8 A;  4AXH A;  5A23 A;  4AM9 A;  2BDE A;  3ZMT B;  5FP3 A;  3PS6 A;  1B89 A;  4D10 C;  2QA7 A;  5A1L A;  4JEU A;  1HE8 A;  4ZOL E;  5G2N A;  3SHF A;  2H7V C;  2W61 A;  4LRZ A;  2HM8 A;  2J9Q A;  4WAF A;  2LHN A;  3B13 A;  3ZMU B;  1LKX A;  4P0A A;  4ZI2 D;  3MJX A;  4TRQ A;  4KYO B;  4CGV A;  4MFR A;  5CHE E;  3ENE A;  4H9R C;  4UVB B;  3IEE A;  2X9W A;  4GYW A;  3TXM A;  3L6A A;  4KT6 B;  1S94 A;  2C0L A;  3HKB E;  2X0L B;  3QB2 A;  2VSX E;  2VKH A;  4B8C B;  3I9W A;  4CCA A;  1UX4 A;  4WWO A;  5HXC A;  4Z8X A;  4G2V A;  4M3O A;  2K48 A;  3LJC A;  3QNK A;  4AY6 A;  3RYC E;  1T98 A;  4KVM A;  2CXL A;  2NW9 A;  4YVO A;  3QAQ A;  3PE0 A;  2W62 A;  2LHR A;  1P5Q A;  4JEU B;  3BEE A;  2LSK A;  2KWI B;  3FY4 A;  4Y6W A;  2BVL A;  4O2B E;  3N71 A;  4NUV A;  5L2L A;  2WMN A;  2VL8 A;  3U3W A;  3S2A A;  4GYO A;  2X9H A;  2I59 A;  3ZFW A;  5HI7 A;  4EPZ A;  3U3I A;  4UV8 B;  3CHM A;  4FA6 A;  4TX5 A;  4CI1 B;  3OAW A;  3D9K A;  3E0Z A;  4MS6 A;  2V7K A;  4ANW A;  4BT9 A;  4L23 A;  2XHE B;  4WWN A;  3NQP A;  4B8A A;  4I2W A;  4DMV A;  3CPZ A;  3N9L A;  4AJW A;  3UUX A;  3SRZ A;  3GA8 A;  1U5P A;  3GMI A;  3RRW A;  2LM9 A;  3T8O A;  2NSZ A;  3LS8 A;  4I43 A;  5LBM A;  4OHF A;  2XQ0 A;  1JWF A;  3Q47 B;  3L13 A;  5IHY A;  2WPV A;  1E96 B;  4FLH A;  2PQN A;  4CRW A;  4WNE A;  3R9A B;  3TXN A;  4AI6 A;  3PRZ A;  2LSV A;  2AVP A;  2NTY A;  4XBF B;  2ZM8 A;  1HS7 A;  2WXN A;  4HS2 A;  1LRZ A;  4ANU A;  4N2S A;  4DBR A;  2E2E A;  3FTS A;  3ZCJ A;  2V5F A;  4LUN U;  4QWN B;  4IST A;  4UVA B;  3QWV A;  1MND A;  1PY1 A;  1E8Y A;  3QC9 A;  2ION A;  2HPL A;  2C5I T;  4NUU A;  1WYB A;  1L5J A;  5JHA A;  3IBP A;  5F3J A;  1JPL A;  3D0T A;  3ML9 A;  3SF4 A;  4PFO A;  3RC3 A;  4YND A;  1OWO A;  3ZPJ A;  4J8D A;  2CMR A;  5ADX L;  3FTW A;  2A72 A;  5J2U E;  2A3D A;  2RP4 A;  4PH4 B;  2UY1 B;  3MK7 C;  5FT9 A;  2DIW A;  3U64 A;  2MOZ A;  2FUL A;  3ZN1 B;  3FP3 A;  3PUA A;  3MEK A;  4K0U A;  4OYJ A;  2KLQ A;  3CEQ A;  3IHR A;  1ZV4 X;  4OVU A;  5M4Y A;  4XKC A;  2XQY A;  3EDV A;  3LXU X;  4ATG A;  2FEZ A;  1X79 A;  3N2K E;  4OK0 A;  1UG3 A;  2XAJ B;  3K3O A;  2NP9 A;  1FCH A;  1OWL A;  4ANV A;  4O8S A;  3MKQ A;  2E9X A;  3RX6 A;  4PJN A;  4CGW A;  4FUL A;  3HKD E;  2IAK A;  4G2A A;  3NRX A;  4JA9 A;  3K3N A;  4KXK B;  1FVF A;  2AXU A;  4GYS A;  5L3D B;  4ANJ A;  3PE4 A;  1DVP A;  3LCA A;  5CA0 E;  2KIN B;  5E76 A;  4N5C A;  4GYR A;  2BUG A;  3GYZ A;  2RA1 A;  3ZN3 A;  2J1D G;  4WUY A;  3UUX B;  2VKJ A;  4DVD A;  2X6F A;  2VYI A;  2DBA A;  3U9W A;  3CQG B;  2GW1 A;  4L2L A;  3CK9 A;  2PM6 A;  1IJ6 A;  4UIG A;  2EHO A;  3MKQ B;  3PVL A;  5CCM A;  3EIQ C;  4WNF A;  2LJL A;  1MMD A;  3CQX C;  3WAJ A;  3N2G E;  4C90 A;  4UWG A;  4I2Z A;  2X9X A;  4JEH B;  1EZ3 A;  4UQY A;  4F1S A;  3OXG A;  1IQU A;  5EX0 A;  2HPJ A;  5BMV E;  4AKI A;  3VLD A;  3OTN A;  3FU0 A;  3MV3 B;  4WBN E;  3QWP A;  2NC9 A;  3OJA A;  2P9B A;  2RD0 A;  2WXO A;  1X5B A;  1E1H B;  5C8Y E;  2WWU A;  3AA6 B;  2VB6 A;  3FHE A;  5EK2 A;  4N3A A;  1TJC A;  5T3R A;  3TG5 A;  3FH7 A;  3LFM A;  3CQC B;  4G1T A;  5JVD E;  5JDH A;  4EZ4 A;  3TG4 A;  4TZ4 C;  2WXH A;  2CCQ A;  2DLR A;  5AEN A;  2VTB A;  3G2W A;  1YW0 A;  4UWK A;  3W15 B;  3EIJ A;  2R59 A;  3NZQ A;  3VKH A;  3GZ1 A;  4F7A A;  4APF A;  3R84 B;  3PNL B;  3CX6 B;  4XAX B;  3CR3 A;  2ILR A;  2QY7 A;  3OKQ A;  2D0U A;  2JPF A;  3HHM A;  3ZYM A;  2YU2 A;  2VKO A;  5G05 J;  3LPZ A;  2KT9 A;  3KDS E;  3CVW A;  1S35 A;  3S7F A;  1NZN A;  1UX5 A;  2I2O A;  5T4Y A;  3B7S A;  2OVF A;  3KV4 A;  1S0P A;  1BR0 A;  3U66 A;  3K3Q C;  3ANW B;  4B6X A;  4AKH A;  2J4B A;  3LK2 B;  2ZMA A;  5LBQ B;  1Y8M A;  3N9N A;  1US7 B;  2CLY B;  2IW5 B;  3G2U A;  2GRM A;  1KNZ A;  4HVB A;  3AAE B;  2J49 A;  4XI9 A;  5J1G A;  3RK6 A;  4GYY A;  5E75 A;  4I6E A;  3IHY A;  4WBO A;  3UT5 E;  5JHB A;  4W9R A;  3RH3 A;  4APO A;  3NZP A;  3SZ7 A;  1LVK A;  4HN9 A;  3UMV A;  3H3A A;  4OYK A;  2HYZ A;  4PUC A;  2WMO A;  5FYM A;  3L16 A;  1HH8 A;  4B89 A;  3AU4 A;  3V5S A;  1U3C A;  3FH5 A;  1W3B A;  1H19 A;  4JHR A;  2BF0 X;  3ZC0 A;  1GW6 A;  4KVO A;  5JR9 A;  3VHL A;  5A6C A;  3I4R B;  4BJN A;  4KMC A;  3IHV A;  5LHI B;  3UUN A;  4MAL A;  3HA4 A;  5JJ7 A;  2RG8 A;  3CVQ A;  4NRH B;  4ZHQ E;  4EXT A;  3NZS A;  3QDN A;  4U8H A;  2IQC A;  1D1B A;  4HTE A;  4FLB A;  4CZZ B;  3JC6 C;  2IC9 A;  2KMF A;  2NW8 A;  4L7T A;  4N78 D;  2LSY A;  4HFG A;  3RO3 A;  3ONX A;  3D9I A;  3N2O A;  2XTL A;  3GW4 A;  3LEW A;  2J09 A;  4IHJ E;  4YLH A;  4FI5 A;  2NWB A;  4GZ5 A;  4ERR A;  3TL5 A;  1U4Q A;  3FUN A;  3ML8 A;  1DNP A;  4ABN A;  2XGO A;  4CXW A;  4EBA G;  1OWP A;  4UEM A;  2LSI A;  4YHJ A;  3EJN A;  4F3V A;  4ACL A;  4O2A E;  3ULQ A;  4J8F A;  4JHJ A;  3QC1 A;  1XGW A;  3PUS A;  2VSN A;  2WXG A;  1WRD A;  2BTD A;  3LDZ A;  1NA0 A;  4HLE A;  5JR9 C;  5C2Y A;  3VTY A;  2CA5 A;  2MYS A;  2N2N A;  4X1Y E;  4YJ2 E;  1H0A A;  4P29 A;  3MX3 A;  2I1J A;  3ANW A;  2E9X B;  3ZN0 B;  3N9M A;  3ZCI A;  4AKR B;  3NBX X;  3AA1 B;  5FZR A;  2X6K A;  4IRU A;  2W63 A;  2FF4 A;  3EUH A;  4H9N C;  5EK3 A;  4ZI2 C;  4UF0 A;  5LJN A;  3ZIM A;  5BUZ A;  3KEZ A;  3EHM A;  1G8X A;  4KBQ A;  4MLP A;  2D2S A;  1IYG A;  3I3N A;  5LXT E;  1UN8 A;  3LG7 A;  4XZC A;  4H9O C;  4AQF C;  1H6K A;  4K0R A;  3C51 A;  4WWP A;  3QAR A;  5HXR A;  4G63 A;  1HG5 A;  3ASG A;  4I17 A;  2B1E A;  5BV0 A;  5FXV A;  3LVQ E;  2Y3A A;  3PUK A;  4FHJ A;  3PNT B;  5ANL A;  2JJ9 A;  4PW8 A;  2VTB B;  2WXF A;  3FUI A;  5CMY A;  5F8P A;  4WNK A;  3FBL A;  4EYU A;  3C98 A;  2V7M A;  4AP2 A;  2WQ7 A;  3JQ1 A;  3R6N A;  3RRU A;  2PFV A;  1Y6I A;  3GN5 A;  2CFZ A;  3D9M A;  5M72 A;  2CG3 A;  3UT4 A;  3KS2 A;  3FU6 A;  5DJQ C;  3ZMV B;  2QGS A;  1N52 A;  4I1M A;  3QJZ A;  1LVF A;  4H9S E;  4DLO A;  3CGH A;  3U4T A;  2KM4 A;  4GOU A;  4X1I E;  3CV0 A;  3ZMZ B;  4XX5 A;  3RYI E;  2VAS A;  1WAO 1;  4ZS2 A;  2CXD A;  3WI3 A;  3TGO A;  4A1G A;  3S7D A;  2IF4 A;  3L17 A;  5JRE A;  4GMJ A;  3DP7 A;  2ZM2 A;  3GZ2 A;  5LP0 A;  5FXW A;  1ZEE A;  3PUR A;  3AA0 B;  4X1K E;  3CHO A;  4G26 A;  2XCB A;  5BPP A;  3O9X A;  3URZ A;  5AYW D;  3APD A;  3PEV B;  3ZEF B;  4OVV A;  5JDN A;  1MMA A;  3CVX A;  4FAD A;  2V1D B;  4L2Y A;  2R5S A;  3RO2 A;  2L8K A;  3LJ3 A;  5G55 A;  4HOU A;  2XPZ A;  4JW1 A;  3SD5 A;  4DO0 A;  5E0O A;  2EQX A;  3AS8 A;  3I5P A;  2XGS A;  1HS6 A;  1MQS A;  2K5B B;  5LP6 E;  4EEC A;  3T5X A;  3HL6 A;  3FEX A;  1B7T A;  2CFU A;  2MOW A;  1HX8 A;  2XPY A;  2JQQ A;  2VGX B;  1A17 A;  2PZI A;  3TAX A;  3ASD A;  3N9O A;  2UXN B;  3F31 A;  4I9C A;  2XAF B;  3CKC A;  3HI2 A;  4UV9 B;  4P0B A;  4A3T A;  4FU3 A;  2MTQ A;  1HG2 A;  4CQI A;  4RVB A;  3ZHE A;  4LER A;  3UFE A;  1OUV A;  3G2V A;  2X67 A;  1ELW A;  3OXF A;  2XPI A;  3ZXS A;  3LBX A;  5L3F B;  4C9B B;  2WQ6 A;  4A3V A;  3T5V A;  2L9B A;  3PRE A;  5AFU L;  2HR2 A;  3QOU A;  3QUJ A;  3CSF A;  4E7S A;  3C50 A;  1VRB A;  4Q96 A;  4Y6C A;  3FUJ A;  2C5J A;  4MKT A;  3CIA A;  1ZHC A;  4J0U A;  2AWI A;  2LOP A;  1E90 A;  4E7Z A;  3KV6 A;  4HOR A;  2YK0 A;  3TJP A;  4H63 V;  3FUD A;  3T8M A;  3IF8 B;  4AVX A;  2WB2 A;  5JDL A;  4K03 A;  3ASH A;  4J2C A;  2CWY A;  2DWK A;  1H2V C;  2AXZ A;  1FMW A;  3N9Q A;  3MZK B;  5AJD A;  5FTP A;  2HH7 A;  5JRC B;  3UUL A;  3UT8 A;  4N3B A;  3IBE A;  4KP3 C;  3ASF A;  3MKR A;  4O4J E;  3KD7 A;  5CCL A;  5FNV E;  4ASK A;  5TAO A;  3LK4 2;  3OYX A;  3LVR E;  3I4G A;  3CK7 A;  1UW4 B;  3ZMS B;  4UQZ A;  4G11 A;  1D1C A;  3RYH E;  4AQF A;  1NWM X;  4DI3 A;  2X6H A;  2C0S A;  3FUK A;  3F2E A;  3CVL A;  5FJY A;  2CWO A;  3PDY A;  4A56 A;  4NAC A;  1D0X A;  4JUY A;  5LNK A;  5G04 C;  4EZJ A;  3CHP A;  1WR6 A;  3AA7 B;  2IJG X;  2KCL A;  3ZJ1 A;  4XKB A;  3L08 A;  3BK9 A;  3PU3 A;  2OND A;  4BX8 A;  5HXH A;  3Q5M A;  3HVE B;  2KCV A;  5KJL A;  3CHQ A;  3KIN B;  1IHG A;  3IKO B;  3ZGQ A;  4G24 A;  3O4Z A;  2WBL A;  1U3D A;  1IZN B;  2IOL A;  4B0Z A;  2LO6 A;  3UX4 A;  3ZJ2 A;  4HOS A;  2X3M A;  2YU1 A;  4V3I A;  4U72 A;  2DCP A;  1ZKE A;  4HEA A;  4GZ3 A;  5ARG A;  3FU3 A;  3CML A;  3FUL A;  5HAX A;  3CWZ B;  3DJB A;  4O4L E;  3J9X 1;  3BG1 B;  4I4T E;  1QSD A;  3FUH A;  1MHQ A;  2PG8 A;  2L6J A;  5HXS A;  3HYM B;  5LCW J;  3LYA A;  2LAI A;  3CVR A;  2JRK A;  2CXF A;  1ELR A;  4ANX A;  3UPV A;  4EZH A;  1CUN A;  2HO1 A;  1FVH A;  3ONK A;  3LKU A;  3PUQ A;  3Q9D A;  3KV5 A;  4U0S A;  1YKH B;  2BVM A;  3Q49 B;  4GZ6 A;  3MGB A;  5CB4 E;  4O4I E;  1MMG A;  2V7I A;  2WXP A;  5DQW A;  2CLY C;  2Q7F A;  4TUU A;  1WM5 A;  5JR9 B;  4Q94 A;  1OWA A;  3B57 A;  2WXR A;  4IE6 A;  2AW6 A;  4U74 A;  1JWG A;  5LHG B;  5AJL A;  3CX8 B;  3ZYL A;  1E8W A;  2ODU A;  3O1H A;  2FI7 A;  5FY1 A;  3CHR A;  3AVR A;  3LBX B;  5HWX A;  4PS7 A;  5D0O D;  3C4Z A;  2WVI A;  4PK6 A;  1HTJ F;  4C0E A;  1G73 A;  3S4U A;  4AIF A;  3LY9 A;  4JEH A;  1KT1 A;  3RC8 A;  3MCX A;  1VDY A;  2Y8D A;  4AQG A;  1H2U A;  4UWH A;  4U04 A;  3FDH A;  4XZ4 A;  4I6G A;  1EF1 C;  2OA5 A;  1SZ9 A;  2WXL A;  3JQ0 A;  5FXZ A;  4ILI A;  3ETV A;  3FU5 A;  2CG2 A;  4IUL A;  2VGX A;  2YQ8 A;  4PJL A;  3FTU A;  4JXT A;  2J08 A;  3FTV A;  2OV8 A;  3RU0 A;  3S7B A;  3JCK C;  2C2L A;  2XAG B;  4I1O B;  5BV1 A;  1OXZ A;  4FP7 A;  4JLE A;  4OYS A;  2ZU6 B;  5L3G B;  2A4Z A;  3SBT B;  5JQG E;  5BNW A;  4L1B A;  3C64 A;  4BY6 A;  2LSG A;  1YKE B;  4PFP A;  4M1P A;  4P09 A;  5FWQ A;  4ILG A;  3G2T A;  5HXE A;  3CVV A;  5LA6 E;  2KND A;  2WAU A;  3APF A;  2KZT A;  4H7X A;  2PBI A;  1MIY A;  4JHK A;  1MIV A;  1D0Y A;  3N5L A;  3ZPO A;  2LE8 A;  4ZI3 D;  4GA2 A;  3I0Q A;  4JL0 A;  2XAQ B;  1HU3 A;  4BWR A;  5J08 A;  2JEK A;  4QX8 B;  4ILH B;  2Y48 B;  3D9O A;  4L5G A;  3MV2 B;  4GCO A;  3FTZ A;  1LF8 A;  4URK A;  4HFV A;  5CA1 E;  1QZ2 A;  4BJM A;  5CMW A;  4NQ0 A;  2D5U A;  2MHK A;  3VKG A;  1Z0P A;  3KAE A;  4DLQ A;  4L0R A;  3Q4A B;  3AU5 A;  4WW0 A;  3LY8 A;  2UY1 A;  4IE0 A;  4DND A;  4PK5 A;  2IC6 A;  5DBK A;  2YHE A;  2LSU A;  4GB9 A;  2XRZ A;  3R7R A;  2JMH A;  3K8P C;  4BX9 A;  5FQ7 A;  3PTR B;  2ZLY A;  3JUI A;  1H2T C;  3FUF A;  3IV0 A;  5FZS A;  2IOS A;  5BW8 C;  2CHZ A;  2X38 A;  4N39 A;  2KZT B;  4U63 A;  3ZLI A;  4UWL A;  2V7L A;  3B7U X;  4J8E A;  3RRM B;  5LCW C;  3D9J A;  3ZVV A;  3UUM A;  3B7R L;  3SS1 A;  5ENN A;  1YA0 A;  2WXM A;  3PU8 A;  5BT1 A;  5KCM A;  3V5U A;  5LOZ A;  2PM7 A;  4MRU A;  1MIW A;  4EIW A;  4BSX A;  4QFV A;  2X68 A;  1KK7 A;  3LK3 B;  4GAA A;  2MRI A;  4YJ3 E;  4WND A;  5FY0 A;  3OXL A;  3SGH A;  2NXP A;  1PC2 A;  4XI0 A;  3OYZ A;  4QKN A;  4J8S A;  5LCY A;  3BQI A;  1FIO A;  3PZD A;  3EHN A;  4JC8 A;  3MA9 A;  2EHO B;  3MZL B;  3FUE A;  2YNQ A;  5LHH B;  3FXE B;  3LY7 A;  1INZ A;  5FQ4 A;  4R7L A;  4IYP A;  2E8I A;  5J90 A;  2R17 C;  4IIJ E;  3I9Y A;  3Q2M A;  4IGU A;  1OWN A;  2GGF A;  4H9Q C;  4GA1 A;  3KV9 A;  2UXX B;  2NOX A;  2J4D A;  2UWJ G;  3AS5 A;  5KX5 E;  4LCT A;  3RIB A;  1SQM A;  2MBG A;  3WXX A;  5EX3 A;  3ESL A;  4ZI3 C;  3O1J A;  2Y4T A;  4PAG A;  1O3X A;  3K9I A;  3CVU A;  4QXH B;  2JMK A;  4PJJ A;  4EOZ B;  1IAP A;  4IE4 A;  4BFR A;  4H63 H;  4IE5 A;  5LGU B;  3DBS A;  2WXJ A;  2OOE A;  2X6I A;  2CHX A;  4AKG A;  1Z3Y A;  3N9P A;  2KAT A;  2QFC A;  4HXI A;  1TJF A;  3DPD A;  1WYC A;  4PS3 A;  5LGT B;  1HXI A;  1E8X A;  2LOS A;  1HCI A;  3PE3 A;  3PDN A;  5FZQ A;  2ES0 A;  1MMN A;  3AAA B;  4AOF A;  2X9Y A;  4KZC A;  4UI9 K;  3RRC A;  2V0P A;  4CT0 A;  5A7D B;  3DTO A;  4ZI7 E;  1WLX A;  3L54 A;  4FJZ A;  4PJM A;  5H6Q B;  2K24 A;  5ARF A;  4UWF A;  3VTX A;  1QUU A;  4JPS A;  5G05 C;  5LJM A;  4QXC B;  3MJW A;  4DJA A;  5LFA A;  4EYY R;  3KFW X;  5DAB A;  4WNG A;  2E0I A;  2EHO C;  5ETW A;  2WM9 A;  3UT7 A;  3QKY A;  3RKV A;  5LX8 A;  4QXB B;  4GIW A;  1EYH A;  3S7J A;  2YIN A;  3MYV A;  2VK9 A;  3PH0 C;  2XHE A;  3KBU A;  3NRY A;  4KZ0 A;  4G23 A;  1MNE A;  2KC7 A;  1D0Z A;  4CEM A;  1ZBP A;  3P1U A;  5HYA A;  4JZY A;  3AAI A;  2X51 A;  3MA5 A;  2V4L A;  2H3R A;  1IJ5 A;  2VSY A;  3R7Q A;  3A5X A;  5FY7 A;  4DBQ A;  4HKA A;  1ZU2 A;  1UJJ A;  3CKB A;  2Q9Q D;  1VOM A;  4BTB A;  2BZB A;  3RYF E;  1Z3X A;  4BA9 A;  4FJO A;  3NF1 A;  1EDU A;  3FBZ A;  4MBQ A;  4IE7 A;  2I9C A;  3GWH A;  3IEG A;  4CI3 B;  4UQX A;  2V7J A;  1D1A A;  4YFS A;  1YD8 G;  1PAQ A;  1NA3 A;  2GK9 A;  2KXP B;  5JRC A;  3VLE A;  2YHC A;  4EAH A;  2CEA A;  4E6H A;  4PDX A;  4UI9 C;  4A1S A;  2XAS B;  4UVC B;  1Z6T A;  2E9X D;  3ZRH A;  4CI2 B;  4EZL A;  2XRY A;  5FMN A;  3ZHE B;  2OVB A;  3CLJ A;  3CST A;  4G25 A;  2PQR A;  4CT4 A;  2Z6E A;  3AVS A;  4F53 A;  3ONL A;  1BR4 A;  5ANR A;  5JDG A;  5JH7 E;  4QX7 B;  2VKD A;  1UJK A;  2IFU A;  3EVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...