2WMOA

Structure of the complex between dock9 and cdc42.
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
423
structure length
403
Chain Sequence
STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEAHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVAGPLAYARAFLDDPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 149
structure length 403
sequence length 423
ec nomenclature
pdb deposition date 2009-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wmoA03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wmoA01
3B13A 3VHLA 2WMNA 2WMOA 2WM9A 2YINA
chains in the Genus database with same CATH superfamily
3X1DA 2AE9A 2HPJA 1AP7A 2V6YA 4JC8A 2D9DA 5LGUB 4PH4B 2VYIA 4ISSA 1OCRE 1LRZA 2JQQA 3HRAA 3J5PA 3HL6A 2XTLA 2IFUA 1VRBA 3UULA 2G0UA 1TNYA 4J6IA 4B6XA 4TXPA 3EDVA 3ZYKA 3DWLG 4BJMA 2JLBA 1HG5A 3JC6D 2NC9A 4JI6T 4A1SA 5ENPD 4PJMA 3AE1A 3EDTB 3ASNE 4I1OB 1Y01A 2RG8A 4NUVA 1MQSA 2IMLA 4UF0B 4X20E 1E7VA 3AJIA 3LKUA 4QQIA 3VLEA 4JI8T 1VOMA 2X51A 2Y4TA 2V26A 1W9RA 2LE8A 3VKHA 2LSVA 5KX5E 1W3BA 3OAWA 3D9LA 3B95A 1NP7A 1YQ3A 4I43A 3E08A 1HF8A 2WSSV 4CGVA 3ZHEA 2J1DG 2LAIA 2CXLA 2J4DA 3ZMUB 2C0MA 3DSXA 3E4BA 4TZ4C 3V5SA 4Q69A 2A72A 2N2NA 2NXPA 4FU3A 2OOEA 5BV1A 2I1KA 5EIBE 3A8YC 4PJJA 3LY7A 3PREA 2C5JA 2PZIA 4N2SA 4EAHA 2W2UA 3AA7B 1MIVA 1N4RA 1N4SA 4HNAD 5CGMA 4GMJA 4L0RA 2K24A 4OHFA 3I4GA 3Q5XA 5C2TA 1I94T 4YDOA 3RIAA 4I55E 2WZHA 1WCRA 2CLYB 4FC8A 5DQWA 3EUHA 4HOUA 3NZPA 3HYMB 4YNDA 5ABEA 1UOHA 4IDZA 4G8LA 5LHIB 5M72A 5JDHA 3OKQA 3JAFA 4PK6A 4X8QA 4ACLA 2ES0A 3OPCA 4IGUA 5DIZA 5LOZA 2R17C 3C98B 5J08A 2YDQA 2X9YA 2WB2A 2IUBA 2W00A 1E2AA 1JCRA 3JADA 4B94A 3CSTA 2HPLA 2XM1A 3FFLA 3L13A 4I6JA 4FI5A 2C5IT 4O1PA 2ACZA 1N36T 3PUGA 5JVDE 5BMVE 1LF8A 1X9BA 4AIUA 1OT8A 4IYPA 2PNNA 4DNDA 5FY7A 4IHJE 2VTBB 1PC2A 3BK9A 4AV7A 3FUJA 4NACA 4PJLA 3T8OA 2ZLYA 2CHXA 5L3CB 5FINA 3NWIA 4I1MA 1SVXA 1ZBPA 3ZXSA 5JDFA 1B89A 3LXUX 3B7RL 3AS8A 3G2SA 3ZLIA 4YTNA 4O2BE 4JL0A 2JRKA 1N94A 2F8YA 1Z8UA 3PUWF 3LEWA 4NXMT 4DI4A 2C0LA 2IDOB 4N3AA 5LCWC 4QFVA 5G04J 2WCAA 2YDRA 4UWFA 4JI4T 1HZ4A 1DNPA 3ZFWA 5HKPA 2FBNA 1AWCB 5HXCA 1QUUA 4X1KE 4U8YD 2BUGA 2GRMA 3LYAA 3Q5MA 5FT9A 1K8KG 3M65A 4LF7T 2K48A 3O48A 4F1SA 3SZ7A 3CR3A 1US7B 4DBQA 2YHEA 2WXLA 3L22A 3AAAB 5CEAA 3Q49B 5KBAA 3Q73A 3HKEE 2VVSA 3EVYA 2WPVA 3N2KE 1TNOA 4DUZT 3JYSA 2WDRA 2P9NG 1ELKA 2VL0A 3DSUA 3CX6B 5JRCB 2VKJA 2H3RA 4RG9A 3AEGA 4ZS3A 1NEKA 3FULA 3LJ3A 3PZ2A 4Z91A 1ZU2A 1S94A 3DTOA 1XZYA 2EHOA 4Z90A 3RIBA 1WG0A 3F2EA 5D2MC 3EU9A 5LG3A 3ULYA 4DUYT 5EILA 4AP2A 1KEYA 3HXEA 1YKEB 2VKOA 3ZN0B 3K3OA 3TAXA 2VQ2A 3C51A 3VRAA 2MYSA 4NRHB 3CHSA 2IQCA 2BVMA 4ILHB 3T1YT 4FLHA 2PQRA 3KSQA 2YNQA 3CKBA 4AQYT 2EINE 3NZUA 1IQUA 3ISMC 2CWYA 2OEWA 3W9FA 5EYPF 4A55A 2IC9A 3LY8A 3T9KA 3LK42 3HVEA 2KATA 5LJNA 3CHQA 4ILUA 4YLHA 1YCSB 1WM5A 4UVCB 4HOQA 4L5GA 5C1DA 4NIKA 1EZ3A 3FZKB 4U0ZA 2PL2A 3V79K 4PK5A 5AQSB 2ODVA 5ANRA 5FZRA 4IREA 1DU2A 2A2FX 5IWAT 4FHJA 4OAVB 5CJ5A 3K3NA 3PNLB 1B7TA 3MK7C 4JI2T 3QWVA 2LAHA 3K1SA 3CKDA 1MMDA 2BKOA 3C4ZA 1BD8A 2R02A 4U8HA 2NOXA 4O4LE 2KC7A 1OEDB 3RC8A 3D9OA 4XX5A 2CBIA 4PAGA 3UUMA 1OEDE 2DZOA 3TG5A 4F53A 5CA1E 3ABME 3PUQA 5JDNA 4I6GA 3BUAA 5AQBA 4JI0T 5JR9B 4GIWA 3KS2A 4UF0A 2QYWA 1M7KA 5L4EA 2H6IA 4BY6A 3PE0A 4GKJT 3T8KA 2KNDA 4GU5A 2X0LB 3Q9DA 5HEGA 1ZV4X 2Y3AA 4PK4A 4JXTA 2QY7A 2ZM6T 2WDVA 4ZFHA 3QKYA 3ZMTB 3ONLC 4ZZCA 3AE2A 2UUCT 2X6IA 4LSZE 3CLJA 4F1PA 3N2GE 3FUEA 4BESA 2UUBT 2A5EA 2FO7A 1NI1A 1FVHA 3FTVA 1S0PA 4DX1A 4UVAB 4PS8A 2ZXWE 3Q9UC 3OVUA 3ZYMA 2QGSA 5KDMC 1MMAA 4KBMB 3B7TA 3ABVA 4FJYA 3TWQA 3UT8A 2WAUA 2AXVA 4TXQA 3SFDA 1WFDA 4Q25A 2H7VC 4GKKT 4LFBT 2IJGX 4TUMA 3SBTB 5FJYA 5CCLA 3V30A 3ML8A 3I5PA 4FP7A 4TUUA 3Q5DA 4H9QC 2HR2A 3CGHA 1ELRA 3TLTA 4CT0A 3ZKJA 5CERB 2C5KT 1U4QA 5FQ8A 2XAGB 3FZLB 3R7QA 2VGYA 1JNRA 3C50A 5CB4E 3OTNA 2XQ9A 3ZT6A 3FTWA 5L47A 5AQUB 4XKBA 4MKTA 1RZ4A 2ETAA 5J1GA 3JUIA 3G06A 3D9IA 1OWAA 4CRWA 3R9MA 3U3WA 3P4RA 4C90A 4UVBB 3F31A 1FMVA 2EQXA 2R05A 2Y1LE 3ZMZB 5ABFB 2P58C 5GONE 4L2LA 4UV8B 3JC6C 4JZYA 4UI9J 4YSYA 1NL4A 2CMRA 4I6EA 2P2CP 2V7LA 4HWHA 1WYBA 3MA9A 1JCSA 3VKGA 3QWPA 2YK0A 1UX5A 2EIKE 3RYCE 3WXXA 5E76A 1E8ZA 3HXCA 2RD0A 5CRUA 2VB6A 1FPPA 5JJ7A 2LKGA 3URZA 1YA0A 1D8EA 3TG4A 4TX5A 3E37A 2CHNA 4YJ2E 4I2ZA 2R6GF 4JEUB 4HFGA 4N5CA 2CHOA 5A23A 3LDZA 1DC2A 1IYGA 4I2WA 3SFXA 3X2QE 1XGWA 2LSIA 4ILCA 2QRXA 5ANLA 1TNZA 3ZYQA 2FJEA 5AJLA 5J0ZA 1H19A 1ZB1A 5AIJA 2DI4A 4LMKA 1S64A 4BTBA 1OXJA 3LFMA 2VK9A 5JRCA 3MXZA 1N0RA 3RHWA 2CG2A 2GGFA 3N9LA 3FTXA 5B1BE 4XI0A 2XPIA 3V2XA 3NKZA 5LP6E 1T7SA 1KPSB 2WZIA 2IO3C 2Q9QB 2BG9C 1HNXT 4X1IE 4DUIA 4CZ2D 3ASHA 5C8YE 5HEJA 3D3MA 5CCMA 3SFZA 3H37A 1N0QA 3CVVA 4P0BA 5AQOB 3Q5EA 2I1JA 2BS4A 3PJAJ 2SPCA 1IAPA 2DZNA 4YSXA 4ANWA 4A98A 4DX5D 3EHRA 3QNKA 4DR7T 4RLYA 3UPVA 5BV0A 5KJLA 3V2OA 5ARFA 5EK3A 1ZOYA 2X0YA 3EI0A 4JEHA 3PDNA 2KBXA 3ANWA 4HEAA 2NW8A 3ZEFA 4J8FA 4QXCB 3ZJ1A 3GN5A 3LPZA 4ZI2D 2L0IA 2P9BA 2V0PA 1FEWA 3KDSE 4J8DA 2LSGA 4LF4T 4RG6A 4HKAA 5AQMB 3D9MA 4GTSA 3SRZA 1EPUA 2I9CA 3ASFA 4ME2A 5DBKA 3RRMB 4A5XA 2AXUA 1MIWA 5EN5D 4CDRA 4GPKA 2NP9A 3UINC 2WDQA 4LF9T 5ENTD 2ZM2A 2WXMA 1YQ4A 1E8YA 4ANXA 3KBTA 1TN7A 3RO2A 1N9AA 3AE3A 3S4UA 5C3JA 2Y4UA 3FZMB 3MV2B 3MKQA 4YY3T 3LJCA 4G2VA 2VWAA 3PUVF 3FDHA 3O4ZA 3PJAA 2A5UA 5G05J 1XWMA 1XMQT 3PURA 3MYVA 4KMCA 2LLYA 4ANVA 4ZI7E 5CFBA 4YTPA 3LY9A 4QX7B 1LKXA 3ONKA 3V5UA 3TL5A 1IKND 2WVIA 3N71A 2ETBA 5JH7E 1WR0A 1TN6A 5EYLA 4DX7D 2JQHA 3DXMG 1UG3A 3ZKRA 5JREA 1NA0A 4A1GA 3DSSA 3LVQE 4JI5T 4EQFA 2R5SA 3FZHB 2BBJA 2NSZA 1D1AA 3CX8B 5AQVB 2LM2A 4C48B 3UQ3A 2L9BA 5IY5E 4UIGA 3UT7A 3PRZA 2BF0X 2V7KA 4HWCA 5FVKA 4DV7T 4P1NA 1OWLA 4AKIA 5HYAA 5H6RB 3RYFE 5FZSA 2AVPA 2XQ6A 3ULQA 2CHWA 3OXLA 4EECA 2XQ4A 4H63V 1LTXA 3G2VA 1NAFA 2Q9QD 1OXZA 5HWYA 4XZCA 3EU5A 3AEEA 2KWIB 1ZKEA 4MLPA 4BA9A 2V7MA 4HFDA 5HEOA 3ENEA 4DR1T 3JUEA 3LDQB 5FXVA 4U3CA 2CWOA 5AQFB 3Q79A 3PUYF 2KM4A 3AAIA 5CECB 2XUEA 4UQZA 4H9PC 4EZLA 4TXRA 5LMNT 2H7OA 3U3IA 5G55A 3LK2B 4WBOA 1OWNA 3FHEA 4JPSA 2M6IA 5AQRB 1KT0A 4X64T 4FA6A 3ZSSA 1FCHA 2KSRA 4B8AA 2F8XK 1MNEA 3G2WA 2PBIA 2VQET 3MA5A 3B7SA 2BDEA 3ZSTA 1ZHCA 4CCAA 1KT1A 1O1SA 4A3VA 3AEFA 2GRLA 4UI9K 1V55E 5FY0A 3RYIE 3LCAA 4KI0F 4U33A 2YU1A 1UURA 2OLTA 4BEPA 5AQIB 3GW4A 3N9OA 4COFA 4IE7A 5AQKB 1BU9A 3AU4A 4L9IA 3LJNA 3PDYA 1DCQA 2KZTB 4G24A 3HKDE 1SQMA 4JA7A 5FKYA 3PE4A 4HRLA 3TXMA 5FQ7A 3AG4E 4IDNA 4XE0A 4UWKA 4BWRA 3UUNA 1HX8A 3MZLB 4JB8P 5FYMA 5D66A 2DWGA 5AQ9A 2B76A 2WXGA 2I6HA 2L3LA 3EDUA 3AAAC 4U2ZA 1QQEA 1K1AA 3FUKA 3I1AA 4JEUA 2CHZA 4WWOA 2OVBA 2GRPB 2XZEA 3P7IA 3RYHE 4B3ST 1WDYA 1O3XA 3FBLA 3TLVA 4EZKA 1X79A 1TJCA 3PU8A 3CQGB 3FTYA 4NPPA 3AE9A 2HYZA 4QH5A 1D1CA 4O8SA 3PUAA 5IUXA 5FL0A 4LFAT 5KXJA 4AKRB 1L5JA 2CG3A 3B7UX 4D10C 3J7Yq 4UUCA 3RRCA 3FTZA 5D0OD 4X5TA 3CHMA 4WNGA 3ZN3A 1JUQA 3DSWA 5A6CA 2A3DA 1IJ5A 5KNHD 5BR8T 2X9WA 1W0BA 3SO8A 5F8PA 3APCA 4J0UA 4WNEA 2D0TA 3NQPA 4KVMA 5HQ8A 3O9XA 4EB6E 2XEVA 4DO0A 3APDA 1E7UA 3I9WA 1I6ZA 3U66A 1IQRA 1TYQG 1UJJA 3RQWA 4WAFA 4N39A 2XZTG 3N9PA 4B3MT 2HM8A 5IHYA 2DCPA 2XQ5A 3FU0A 3CHOA 3FH5A 3UTMA 1E7PA 5KCMA 4URKA 2C0SA 2XCCA 3UU5A 3NRYA 2PFVA 2AXZA 5CRVA 2IO2C 4U8VD 3FTSA 2E9XB 4AVXA 1M62A 1Z6TA 3APFA 4UELA 3ZU7B 1ZEEA 3QB5A 3OBVE 5C2YA 4ANUA 4KHZF 3VHLA 3VLDA 5L3FB 2PM6A 3EIQC 1OEDC 2JIWA 1U3DA 1T8BA 3NF1A 4AY5A 2K3WA 4O2AE 4MALA 1N95A 4O4IE 2XQ8A 2OVFA 5JR9C 3SFEA 1KZPA 2FEZA 3PU3A 3TWVA 3OTOT 3ZPOA 2J07A 3FEXA 3JXJA 2UU9T 2IW5B 2K5BB 3U4TA 2UY1A 4YDWA 4DV0T 4EYYR 1J1JA 5AENA 2KINB 3ZT7A 2D2SA 2V5QC 5HCJA 4WNFA 1P5QA 4A63B 3H3MA 2E2AA 1DCEA 2X0HA 3BQKA 4E7SA 5F3JA 3NZQA 5ABGA 4HRMB 2DHRA 4OK0A 3FZFB 2KCKA 4AY6A 2J4BA 5E0OA 2GW1A 4HVBA 5FL1A 5JTGA 1U3CA 4DX2A 3DP7A 4HTEA 4DV1T 4RQIA 4LNGA 3P4PA 2XGMA 3ZGQA 3SBSA 3LVRE 4HBDA 4TNVA 5ADXL 1H6OA 4U0UA 4EPZA 3AEAA 2H88A 2GK9A 4B3RT 2XY8B 1Z5SC 4G11A 1SA4A 3S2AA 1Z0PA 3NOCD 4LMLA 2X6JA 5ENQD 3MKRA 5CA0E 3NBNB 1QYMA 5AQGB 5LBMA 2NW9A 4IE4A 2LHNA 3ABLE 3SY2A 5T8IA 1H7CA 2FBWA 1KNZA 2BG9A 2JEKA 4HI9A 4ZI2C 2V5CA 1KLXA 5FP3A 3F57A 1UW4B 2RFMA 3LBXB 1H2VC 3DXKG 1OY3D 5L2LA 3PEUB 2H6FA 4AKHA 1HX1B 2XAQB 4DR2T 4U04A 3VR8A 2JMHA 4KT6B 3RU0A 3RRWA 4LF6T 4GTTA 3UMVA 4JV5T 5ETWA 4K0KT 3PUJA 5JJ6A 4A56A 1D1BA 2NYJA 3CIRA 3FUDA 3T5XA 4KP3C 2VGXB 3FUMA 4UEMA 4N3CA 1UCUA 3FY4A 5ENNA 4HWDA 2RKKA 1N54A 4LCTA 1MMNA 3Q4AB 5LGTB 3FUIA 2WQYA 3UM0A 1T98A 4UQYA 4DI3A 4DJAA 3K9IA 4IDOA 5DJQC 3P2BA 1Y6IA 4OVVA 1G8XA 4ISTA 3N9MA 2BKGA 3UM2A 4OAUC 1HU3A 1UK5A 4GTOA 2WWUA 3C5RA 3PZ3A 4BETA 1FMWA 1WRDA 3Q5WA 2X6HA 5EK4A 3MJWA 3CPZA 2YDSA 4E85A 2IAKA 4FHKA 3BQLA 4LG6A 4AIFA 3W9GA 3RO3A 3W15B 4HFCA 4DMVA 3JQ1A 5EX0A 2J62A 2J49A 1D9SA 4UR9A 3RF1A 1EF1C 1H2TC 3AVRA 3PS6A 2Q9QC 4UWHA 4N5QA 4C0EA 3LK3B 3RAUA 3CVUA 1FVFA 4J7WA 4HI8A 4GZ3A 4PDXA 4EZ4A 4IRUA 2RA1A 3TKLB 5FMNA 1MJ0A 2X6KA 3EHZA 3UUXB 1LVKA 3Q2MA 3O4XE 1SW6A 5HRYA 3T1HT 1KK7A 2MAWA 3NBXX 1NWMX 5LJMA 3VLFA 2KCVA 3GWHA 4YT0A 3C3RA 4CDNA 2WU5A 2XAHB 5LX8A 2IOLA 5CMWA 2YINA 2OEVA 5LOVE 3CQXC 3I4RB 4XKCA 3B57A 1UUSA 3RSEG 1S35A 2DYRE 3ZUVB 2KLQA 1EDUA 3D9JA 3QARA 2E8IA 3UU8A 3ASOE 1R8IA 2NTYA 3ESLA 2VSNA 4DV2T 2I0MA 3C98A 3AG1E 1TN8A 3TWUA 1HCIA 3UXGA 3EABA 4XBFB 1HS7A 2R03A 2XRZA 2OA5A 5E75A 2AW6A 3AA1B 1OCCE 4M3OA 3AE5A 4QX8B 4IDQA 4HXIA 3UM1A 4X1YE 3PUSA 3FP3A 2VTBA 2XGOA 4AM9A 2VGEA 3AA6B 4CGWA 2WXKA 2ONDA 4GMRA 2WQHA 5KJKA 2FI7A 1VCSA 3LSVA 5AQAA 2ETCA 1G73A 2VKDA 4KBQA 1U2VG 5LMUT 2ZM8A 2VQFT 5BW8C 4EEDA 1UGOA 3KV9A 3FUNA 2XPYA 5KNGA 3VTXA 5FY1A 4N78D 3EIJA 1Y64B 5AQPB 4B93B 2ZGGA 2UXCT 2WWVA 2IY0C 2D5UA 4FADA 5FXXA 4HWFA 3AXJB 1IBMT 4HFVA 4E7ZA 4OYSA 4CEMA 4B8CB 2WXJA 2C2LA 4NUUA 2V6YB 1AJ3A 1EYHA 2F0YA 1MYOA 1N4PA 2PJQA 2XENA 3OXFA 3AAEB 3ASDA 3N2OA 4ZXLA 4GA0A 3FBZA 4O6FA 3IBEA 4NQ0A 1MIYA 4DIDB 3ZMVB 1XNRT 3QUJA 3HHMA 4I9CA 2LT3A 2PM7A 3C4WA 2ODUA 2XS8A 4BX9A 3C3OA 2LSYA 4JI3T 2FJAA 2IC6A 2V4LA 1K3ZD 1V9DA 5CBNA 3CQCB 2CE7A 2X3MA 4I50E 2HHHT 2UUAT 4Q96A 4WYVA 2RPAA 4LEUA 1H2UA 4JBWF 3ML9A 3ZVVA 4K5BA 3QDNA 5JJTA 2CCQA 1IHGA 4TWFA 2Y0BG 3UI2A 4XZ4A 3ZN1B 3DSTA 1GW6A 2M63A 4OYKA 4I43B 3C4XA 2KMFA 1ZP0A 2GROB 1S63A 3HXFA 3ZJ2A 3ZHEB 2LJLA 4V3IA 3SI5A 2XQYA 4NURA 4QHOA 4HB5A 2UXXB 4XAXB 3PUZF 3WAJA 5G04C 1BR0A 3FH8A 2VSXE 3UQ4A 5JDQA 3DSVA 5BXUA 2J8SD 4Y6WA 3MACA 5HAXA 4YHHT 1QNFA 3HKCE 3Q78A 4G25A 3R9AB 3TWWA 3UKUG 3FU3A 1D8DA 1CHUA 5JHBA 2YN6A 5LCWJ 5BUZA 3ZPJA 4BAYB 2WXNA 3AEDA 5EIDA 1FT2A 3EHNA 5FNVE 1YYHA 4KX6A 4I0UA 3SNXA 1O5MA 2V8SE 2B1EA 5J90A 2PG8A 3KVBA 3P4SA 4I17A 2UXNB 5FWQA 5LHHB 2MBGA 1OEDA 2MOZA 4RSYA 4EOZB 4AQFC 4PNIA 3NZSA 3CEQA 1UN9A 3UU4A 3IEEA 5EZYE 3AA0B 3JCFA 4PFOA 3PNTB 3T8MA 2JMKA 4APFA 1SUMB 4DBRA 2L8KA 1QZ2A 2J4GA 1NFIE 4DVDA 2W66A 2DIWA 2RFAA 3IHVA 5JR9A 4FLBA 1HFAA 1SHZC 3OJAA 4GTVA 5BT1A 1SZ9A 3MCXA 2W61A 4O1OA 5L3EB 2QC9A 3P1UA 4TRQA 2V5DA 5JDMA 4F8HA 3AE8A 3P8CD 1XNQT 4DPRA 2QFCA 1N52A 3RRUA 2XAJB 3KV5A 3I0QA 2D0UA 4XEIG 2XQ3A 5LP0A 2ZGDA 3ZW3A 5LHGB 5DABA 1MX6A 2J08A 3RKGA 4LFCT 2R59A 4F7AA 3HXBA 3U78A 3CVLA 2HH7A 1S70B 2VSOE 2PQNA 2BS3A 2WXIA 2LXMA 4APOA 3EJNA 3MGBA 3VU7H 2MTQA 5F5WA 1NA3A 4ADZA 3T5VA 1FT1A 2XAFB 3L09A 2QYUA 2YHCA 2Y8DA 2EIME 1JWFA 2WM9A 3E30A 1V54E 1D0YA 3SQVA 2X38A 2XPZA 3Q7FA 4HWIB 3RK6A 2IIUA 2E9XC 3RGLA 3AG2E 3UFEA 1J5ET 3RI5A 4EBAG 4P29A 4ZZBA 4L7TA 2IU1A 2X9HA 5HEUA 2WBLA 4H9OC 4WZXA 2BKPA 3EHMA 5BNWA 4FULA 1MX2A 4GYWA 5LB7B 3ZIMA 2XHEB 4ILAA 2XGSA 3E34A 4YSZA 3BQIA 1OCOE 4JHRA 2YU2A 3FWVA 5ABHA 1HG2A 4TNWA 3VRBA 3MZKB 4P09A 2WQ6A 2EHOB 3J9X1 5EX3A 2B6CA 4OX9T 2WXRA 5AQJB 2X6FA 3V31A 3QC9A 3F6QA 5FVLA 5FQ6A 2OCCE 3TJPA 2P9IG 3NAWA 5ABFA 2DYSE 5LG4A 3SHFA 3OYZA 2LUHA 2KCLA 3KSLA 4L2YA 3MKDA 2QA7A 4HQDA 4XIFA 4WWPA 1HH8A 5B1AE 3S7DA 1E1HB 4KUMB 4IE0A 5LYJE 1KNRA 4JYAT 1LVFA 2VKHA 5HXSA 2XASB 3KV4A 5HI7A 2WY2A 2Y6XA 3IBPA 1ELWA 1SZAA 1YW0A 5LCYA 3UT5E 1FIOA 3HVEB 3CHRA 4WNKA 1N4QA 3E33A 1CUNA 3Q15A 2CBJA 3ZRHA 4U72A 3NB2A 4B3TT 3QNUA 2E5LT 4HFHA 4EV6A 2ACXA 2IONA 3MJXA 2YKSA 5BXOA 3PZDA 4TN7B 5HEHA 3JCKC 3GZ1A 5G2NA 2V1DB 2VURA 4ZS2A 4N2QA 4AOFA 3TLSA 3S7FA 2W67A 1O1TA 2QZAA 4AXHA 4HOSA 4Y6CA 1JWGA 2XRYA 2L0TB 2LM9A 4PS3A 4EBAA 1PY1A 2J9QA 4J8EA 3NOGD 4GTPA 3DPYA 3CIAA 1X81A 1A17A 2P9PG 3B5MA 2E2EA 4WW0A 5LA6E 3L39A 2XCBA 3QOUA 4DR6T 2A4ZA 3ONLA 2Q9QA 3IHRA 1H6KA 2KXPC 1QLBA 1TR4A 3ETUA 3IF8B 3TLUA 3HDXA 4YTMA 4JLEA 3KD7A 4CDMA 3DJBA 4HRNA 2LRKA 3DEOA 4UI9C 2F37A 4DLQA 4ERRA 4U7YA 3E32A 2LNIA 4HS2A 1H6PA 5CMYA 4IE6A 5AYWD 2FO1E 4DLOA 1A5EA 5M4YA 1HXIA 3PEVB 2LRLA 4CXXA 1G3NB 4ABNA 2CPTA 4AXPA 4M7CA 3PVLA 2I2OA 3RQUA 5HCMA 3S7BA 3I0OA 3RIFA 3VTYA 3S7JA 4GZ5A 3TWTA 1H0AA 2NWBA 2ILRA 4YVOA 4AEZC 4JA9A 1NZNA 4V1Av 4ILBA 4GTMA 4ILGA 3UTKA 5CHEE 2EHOD 2W0GA 4H9SE 2XM2A 4TUYE 3ZCIA 2XZDG 4U07A 5AN8A 2Y69E 4BFRA 3TWSA 5KJNA 3R84B 5J2UE 2JQ9A 4YHJA 1E8XA 2YOEA 4FJOA 2MOWA 3HXDA 2WMOA 2V7JA 1OWPA 2LSUA 1J5WA 5CEDB 5FIOA 1N11A 4PW8A 4DR3T 4C9BB 4QXHB 4IE5A 4U0SA 3R6NA 3UIPC 4C91A 2W63A 4BT9A 4TV9E 3RH3A 4U95D 2DWKA 2X67A 5D0QD 2XQ7A 3O1HA 4ZHQE 2CFUA 1O1RA 1SA0E 5AQHB 1DVPA 3AE7A 2XPKA 5AQ7A 4ANJA 3MEKA 5JMND 2L9QA 4HLLA 2OV9A 4K5AB 4J8YA 2KZ7B 2DL1A 4O4HE 4U7EB 3DBSA 4MLKA 4XI9A 4GMLA 1MNDA 3NVOA 2AJAA 4YFSA 2LSJA 1KFYA 1MX4A 5LGNB 2GRNB 4MFRA 1HNWT 2AWIA 2YQ8A 3CVXA 1IBKT 5AQTB 2DBAA 4EZJA 3IA3A 2R2LA 4JW1A 1WYCA 4I4TE 3RKOA 4GCOA 5T3RA 4ACKA 3J5QB 2WXHA 3D0TA 4H7XA 5JDLA 1JNZA 4M1PA 2VSYA 2RP4A 4GZCA 3B13A 3HR0A 5T4YA 3RX6A 2Y48B 4BTAA 4CI2B 3CV0A 5AJDA 3FUFA 4JHJA 3ASGA 2ZISA 3AS4A 4AKGA 3CK9A 3MV3B 4BT8A 4U74A 3QOFA 1SE7A 2KT9A 3CHPA 3EHQA 4OYJA 2IOSA 3UKRG 3RIUC 2Q7FA 4B89A 4J2CA 4H9NC 4KYOB 3AU5A 2L6BA 2FJBA 2FJDA 1WLXA 4EGWA 1WAO1 4H7YA 3UQ7A 4A3TA 3SFYA 3O1JA 2ZU6B 3WAKA 3GZ2A 1IZNB 3ZNGA 4DRXE 2XHEA 3L17A 3HI2A 2P9SG 4F6RC 5KMGP 4ZI3D 4GA1A 4WUYA 4HFBA 5G05C 2A9UA 2KXPB 4YJ3E 3PE3A 4GTRA 3PUXF 5J2TE 3L8RA 3D9NA 3AG3E 2E9XD 3AE6A 3AS5A 4HE8A 3AECA 3GMIA 2X9XA 3N9NA 5AAOA 3QK6A 3GA8A 5FXZA 1HNZT 4HLEA 4JVSA 3L08A 4GYRA 2DVWA 1HR0T 3UX4A 4QKNA 1U5PA 1JCQA 4H63H 4HN9A 3O1IA 4NXNT 4OVUA 2LOPA 1VDYA 3QAQA 2XSAA 4DV6T 4UWLA 2ZM0A 1W09A 3ZCJA 4EYUA 2J47A 3UT4A 2CA5A 3NRXA 1JPLA 4QWNB 4KXKB 4GCNA 4EEBA 1OWOA 2CM0A 2H6HA 4IIJE 2BBHA 2KZTA 5CBOA 1UN8A 5LFAA 3RC3A 2P9UG 3JAEA 1BR4A 2CEAA 4HFIA 4CZZB 4JEHB 3CVWA 2ZMAA 3OYXA 4KVOA 3ANWB 2DNXA 2WS3A 3E22E 3ZEFB 1K1BA 2MHKA 2W4XA 1KNPA 3GN5B 5A1LA 4U2YA 4CN6A 5IYZE 2I59A 2XJ7A 4AISA 4G1TA 4AQFA 5LNKA 3CK8A 3U9WA 3P4QA 1HO8A 4GK0E 2HO1A 4GYSA 3JQ0A 3QB5K 2MRIA 5JHAA 3AE4A 1IHBA 2LKHA 4CQIA 2V4HC 5AFUL 4IL4A 4LMJA 4AQGA 4CI3B 1TNBA 3D9PA 3C72A 2WXFA 3MKQB 1BI8B 3ONXA 2K9AA 3K8PC 4IL9A 4GB9A 1T72A 4U31A 3ZYLA 1MZCA 3R7RA 1IJ6A 1Z3XA 3QB2A 3G2UA 1QSDA 2BKNA 2Z6EA 2XEHA 1RW2A 4H9RC 4LNBA 3KEZA 4DR4T 3RKVA 2WMNA 1N32T 3WG7E 3PZ4A 3IXEA 4K0UA 3FU5A 4HFEA 4QH4A 4MHCA 1N33T 4G63A 5LXTE 1TJFA 2CXDA 3FEYA 4TWDA 4EZHA 4LUNU 4YVQC 3KINB 4CYMD 2KWHA 4GOUA 4K0RA 2QYJA 4CT4A 2FF4A 4E6HA 4A97A 4HOTA 4GZDA 4W9RA 3L9TA 2PTFA 4GTQA 4G26A 2CXFA 2E9XA 4WNDA 3UU3A 5EK2A 3IEGA 3UU6A 4KZ0A 3OXGA 2EILE 3G2TA 3UM3A 3QJZA 1LD8A 1Z3YA 2BZBA 4R7LA 1INZA 3PZ1A 4Z68A 4DK5A 3TLWA 1XMOT 1BLXB 3ZC1A 2UWJG 4YDEA 2LHRA 3ZT5A 3ZXPA 2LOSA 4EHMA 2WXPA 4PS7A 3AVSA 4TV8E 4LF8T 3DRAA 4N3BA 1OUVA 5L3BB 1GQEA 2X68A 4CXWA 3CK6A 4OFZA 4IULA 2W62A 1L0VA 2P9LG 4LF5T 2QVAA 4DR5T 1QBQA 3FXEB 2GRRB 4ATZD 4DV3T 4B0ZA 4L9PA 2VJ8A 4X62T 1BPOA 5L4HA 2CRBA 5AQLB 2M67A 3L82A 4JI1T 4ILIA 5BPPA 4IT4A 3KEAA 3C64A 5JQGE 3DEPA 4F3VA 4KHPT 3PTRB 3GYZA 5HWXA 3LG7A 5ENSD 2LXLA 2BKKB 2WU2A 4CN4A 3FTUA 4CXYA 3AB3B 4EIWA 4MS6A 3RRNB 5ITZF 2X66A 1HS6A 1YMPA 3I9YA 4GK5E 2OV8A 1N34T 5A7DB 3HA4A 2LSKA 2VVNA 2JABA 2XQ0A 3BU8A 3CWZB 2YEVC 3ESKA 4JHKA 2JQKA 3CVPA 2BS2A 2N9DA 2WXQA 4BSXA 3TWRA 3CVYA 5AQNB 2AXDS 3KV6A 2FULA 2DCFA 4L1BA 4YDYA 1XNFA 4PUCA 3FU6A 3TGOA 3D9KA 3K3QC 1UX4A 4U96D 5FXWA 4RVBA 4Z8XA 4X66T 1Q2ZA 1PAQA 1SA5A 4KZCA 1Y8MA 3N5LA 1KF6A 1IXVA 1MHQA 4G2AA 4JUYA 3EUVA 4WWNA 2E0IA 4EXTA 5L3DB 2NR4A 5EDSA 1VCTA 3B7BA 2EHOC 3E0ZA 2XEEA 1FJGT 1MMGA 3FHNA 1D0XA 4LERA 3PUKA 3SF4A 1WR6A 3LBXA 3FUHA 4Q94A 2IEJA 3ULEG 1X5BA 4J8SA 2V8SV 1W0AA 3HIZA 4LNUD 4JD2G 5LBQB 4CN1A 2JPFA 2V5FA 2N1GA 3QK0A 3MX3A 5HXEA 4DV4T 2FUPA 1LD7A 1BR1A 1E96B 3A5XA 2VGXA 4F6RD 3RJVA 3ZC0A 1TEZA 2HE0A 3BG0B 5JDGA 3IKOB 5FTPA 3LS8A 1HTJF 4G23A 4IN3B 2HN1A 3Q9NC 3TWXA 2F4VT 3PH0C 2L6JA 4TV3A 3FH7A 4IDPA 1E90A 3DPDA 4NIQA 2JJ9A 4K5CA 2V7IA 3CMLA 3SS1A 3CK7A 3L6AA 1BR2A 2B0OE 2NW7A 2CFZA 2WXOA 3C3QA 1E8WA 2XSBA 3VR9A 4AI6A 3SWHA 3FXDB 2DWZA 4GA2A 1YD8G 1XDOA 3HKBE 3IHYA 2BTDA 3CVRA 1YKHB 2GRQB 4UWGA 5AARA 3U64A 4K03A 1BI7B 3JXIA 2NTXA 3GZSA 4GPMA 2UXDT 4FJZA 4PFPA 4QH1A 5AQQB 1OWMA 5H7PA 2WB5A 1XDPA 1YXRA 2H6GA 3PV0F 3QWWA 4O60A 4P0AA 1NENA 2E5VA 2EIJE 3CX7B 4MBGA 4UQXA 2VASA 3P4WA 2UY1B 4JI7T 2UXBT 3KAEA 3SD5A 3ZMSB 2XQAA 3UUBA 1KZOA 1OCZE 2V6XA 3UFGA 2XS1A 3UUXA 5DQVA 5H6QB 3ABKE 3P50A 4BX8A 3KBUA 4BERA 4UXNB 4ATGA 2MPKA 4I1AA 4ZI3C 4MBQA 3QC1A 4DV5T 5JA4D 3EAMA 3M3ZB 5HXRA 4O4JE 4G8KA 4ZEYA 3CVQA 3L3PA 3CKCA 3WI3A 2LEHA 4I9EA 4PJNA 4C0MA 4LRZA 2MYOA 5TAOA 5ENOD 2BEDA 5KJMA 3RIUA 2VL8A 2BVLA 2CLYC 4GZ6A 5B3SE 2WP9A 3KFWX 4X65T 3Q47B 1TNUA 1WY6A 1UJKA 3CVNA 4HORA 4UV9B 2IHR1 2HN2A 4YXDA 4AKLA 3BEEA 3UIOC 4L23A 3ETVA 2J09A 4MRUA 3A7MA 4ASKA 3IV0A 3I3NA 3Q75A 3D9HA 2LO6A 4DX6D 5KWDA 3ONJA 3RLFF 2H89A 5FZQA 3RPUA 3TXNA 2M6BA 3BQOA 4GYYA 4U7IA 2IF4A 3N9QA 4BJNA 4KMOA 2DLRA 5FQ4A 5ARGA 2WQ7A 4HGAA 4QXBB 3CSFA 3FB2A 2BG9B 4U63A 2P9KG 3HG0D 4BSZB 1IBLT 2BG9E 5HXHA 4DMWA 3L54A 4AJWA 5EKQD 4ZHBA 3BG1B 3SGHA 5ENRD 5L3GB 3SOLA 3H3AA 3AEBA 4TWHA 4GYOA 3L16A 4WBNE 3KVAA 4CI1B 4GAAA 5HS0A 3Q7AA 1HE8A 1D0ZA 3AXJA 4ZOLE 2ZIRA
chains in the Genus database with same CATH topology
2HPJA 4JC8A 5LGUB 4PH4B 2VYIA 4ISSA 1LRZA 2JQQA 3HL6A 2XTLA 2IFUA 1VRBA 3UULA 2G0UA 4J6IA 4B6XA 3EDVA 3ZYKA 4BJMA 2JLBA 1HG5A 3JC6D 2NC9A 4A1SA 4PJMA 3EDTB 4I1OB 2RG8A 4NUVA 1MQSA 4UF0B 4X20E 1E7VA 3LKUA 3VLEA 1VOMA 2X51A 2Y4TA 2V26A 2LE8A 3VKHA 2LSVA 5KX5E 1W3BA 3OAWA 3D9LA 1NP7A 4I43A 3E08A 1HF8A 2WSSV 4CGVA 3ZHEA 2J1DG 2LAIA 2CXLA 2J4DA 3ZMUB 2C0MA 3E4BA 4TZ4C 3V5SA 4Q69A 2A72A 2N2NA 2NXPA 4FU3A 2OOEA 5BV1A 2I1KA 4PJJA 3LY7A 3PREA 2C5JA 2PZIA 4N2SA 4EAHA 3AA7B 1MIVA 4GMJA 4L0RA 2K24A 4OHFA 3I4GA 3Q5XA 4I55E 2CLYB 4FC8A 5DQWA 3EUHA 4HOUA 3NZPA 3HYMB 4YNDA 4IDZA 5LHIB 5M72A 5JDHA 3OKQA 4PK6A 4ACLA 2ES0A 4IGUA 5DIZA 5LOZA 2R17C 3C98B 5J08A 2X9YA 2WB2A 2W00A 4B94A 3CSTA 2HPLA 3FFLA 3L13A 4I6JA 4FI5A 2C5IT 3PUGA 5JVDE 5BMVE 1LF8A 4IYPA 4DNDA 5FY7A 4IHJE 2VTBB 1PC2A 3BK9A 4AV7A 3FUJA 4NACA 4PJLA 3T8OA 2ZLYA 2CHXA 5L3CB 4I1MA 1ZBPA 3ZXSA 5JDFA 1B89A 3LXUX 3B7RL 3AS8A 3G2SA 3ZLIA 4O2BE 4JL0A 2JRKA 3LEWA 4DI4A 2C0LA 4N3AA 5LCWC 4QFVA 5G04J 4UWFA 1HZ4A 1DNPA 3ZFWA 2FBNA 5HXCA 1QUUA 4X1KE 2BUGA 2GRMA 3LYAA 3Q5MA 5FT9A 3M65A 2K48A 3O48A 4F1SA 3SZ7A 3CR3A 1US7B 4DBQA 2YHEA 2WXLA 3L22A 3AAAB 3Q49B 3HKEE 3EVYA 2WPVA 3N2KE 3JYSA 1ELKA 3CX6B 5JRCB 2VKJA 2H3RA 4RG9A 4ZS3A 3FULA 3LJ3A 1ZU2A 1S94A 3DTOA 2EHOA 3RIBA 3F2EA 4AP2A 1YKEB 2VKOA 3ZN0B 3K3OA 3TAXA 2VQ2A 3C51A 2MYSA 4NRHB 3CHSA 2IQCA 2BVMA 4ILHB 4FLHA 2PQRA 2YNQA 3CKBA 3NZUA 1IQUA 2CWYA 4A55A 2IC9A 3LY8A 3LK42 3HVEA 2KATA 5LJNA 3CHQA 4ILUA 4YLHA 1WM5A 4UVCB 4HOQA 4L5GA 5C1DA 1EZ3A 4U0ZA 2PL2A 4PK5A 2ODVA 5ANRA 5FZRA 2A2FX 4FHJA 3K3NA 3PNLB 1B7TA 3MK7C 3QWVA 2LAHA 3CKDA 1MMDA 3C4ZA 4U8HA 2NOXA 4O4LE 2KC7A 3RC8A 3D9OA 4XX5A 4PAGA 3UUMA 3TG5A 4F53A 5CA1E 3PUQA 5JDNA 4I6GA 5JR9B 4GIWA 3KS2A 4UF0A 4BY6A 3PE0A 2KNDA 4GU5A 2X0LB 3Q9DA 1ZV4X 2Y3AA 4PK4A 4JXTA 2QY7A 3QKYA 3ZMTB 2X6IA 3CLJA 3N2GE 3FUEA 2FO7A 1FVHA 3FTVA 1S0PA 4UVAB 4PS8A 3ZYMA 2QGSA 5KDMC 1MMAA 4KBMB 3B7TA 4FJYA 3UT8A 2WAUA 2AXVA 2H7VC 2IJGX 3SBTB 5FJYA 5CCLA 3ML8A 3I5PA 4FP7A 4TUUA 4H9QC 2HR2A 3CGHA 1ELRA 4CT0A 2C5KT 1U4QA 5FQ8A 2XAGB 3R7QA 2VGYA 3C50A 5CB4E 3OTNA 3FTWA 4XKBA 4MKTA 5J1GA 3JUIA 3D9IA 1OWAA 4CRWA 3U3WA 4C90A 4UVBB 3F31A 1FMVA 2EQXA 3ZMZB 2P58C 5GONE 4L2LA 4UV8B 3JC6C 4JZYA 4UI9J 2CMRA 4I6EA 2V7LA 1WYBA 3MA9A 3VKGA 3QWPA 2YK0A 1UX5A 3RYCE 3WXXA 5E76A 1E8ZA 2RD0A 2VB6A 5JJ7A 3URZA 1YA0A 3TG4A 4TX5A 4YJ2E 4I2ZA 5A23A 4JEUB 4HFGA 4N5CA 3LDZA 1IYGA 4I2WA 1XGWA 2LSIA 5ANLA 3ZYQA 5AJLA 1H19A 5AIJA 2DI4A 4BTBA 3LFMA 2VK9A 5JRCA 3MXZA 2CG2A 2GGFA 3N9LA 3FTXA 4XI0A 2XPIA 5LP6E 2Q9QB 4X1IE 3ASHA 5C8YE 3D3MA 5CCMA 3SFZA 3H37A 3CVVA 4P0BA 2I1JA 2SPCA 1IAPA 4ANWA 3QNKA 3UPVA 5BV0A 5KJLA 5ARFA 5EK3A 4JEHA 3PDNA 3ANWA 4HEAA 2NW8A 3ZEFA 4J8FA 4QXCB 3ZJ1A 3GN5A 3LPZA 4ZI2D 2L0IA 2P9BA 2V0PA 1FEWA 3KDSE 4J8DA 2LSGA 4RG6A 4HKAA 3D9MA 3SRZA 1EPUA 2I9CA 3ASFA 4ME2A 5DBKA 3RRMB 4CDRA 2AXUA 1MIWA 4GPKA 2NP9A 2ZM2A 2WXMA 1E8YA 4ANXA 3KBTA 3RO2A 3S4UA 2Y4UA 3MV2B 3MKQA 3LJCA 4G2VA 2VWAA 3FDHA 3O4ZA 2A5UA 5G05J 3MYVA 3PURA 4KMCA 4ANVA 4ZI7E 3LY9A 4QX7B 1LKXA 3ONKA 3V5UA 3TL5A 2WVIA 3N71A 5JH7E 1UG3A 5JREA 1NA0A 4A1GA 3LVQE 4EQFA 2R5SA 2NSZA 1D1AA 3CX8B 3UQ3A 2L9BA 4UIGA 3UT7A 3PRZA 2BF0X 2V7KA 1OWLA 4AKIA 5HYAA 5H6RB 3RYFE 5FZSA 2AVPA 3ULQA 2CHWA 3OXLA 4EECA 4H63V 3G2VA 1NAFA 2Q9QD 1OXZA 5HWYA 4XZCA 2KWIB 1ZKEA 4MLPA 4BA9A 2V7MA 3ENEA 5FXVA 2CWOA 2KM4A 3AAIA 2XUEA 4UQZA 4H9PC 4EZLA 2H7OA 3U3IA 5G55A 3LK2B 4WBOA 1OWNA 3FHEA 4JPSA 1KT0A 4FA6A 1FCHA 4B8AA 1MNEA 3G2WA 2PBIA 3MA5A 3B7SA 2BDEA 1ZHCA 4CCAA 1KT1A 4A3VA 2GRLA 4UI9K 5FY0A 3RYIE 3LCAA 2YU1A 3GW4A 3N9OA 4IE7A 3AU4A 4L9IA 3PDYA 2KZTB 4G24A 3HKDE 1SQMA 4JA7A 3PE4A 3TXMA 5FQ7A 4XE0A 4UWKA 4BWRA 3UUNA 1HX8A 3MZLB 5FYMA 2DWGA 2WXGA 2I6HA 2L3LA 3EDUA 1QQEA 3FUKA 3I1AA 4JEUA 2CHZA 4WWOA 2OVBA 3P7IA 3RYHE 1O3XA 3FBLA 4EZKA 1X79A 1TJCA 3PU8A 3CQGB 3FTYA 2HYZA 1D1CA 4O8SA 3PUAA 4AKRB 1L5JA 2CG3A 3B7UX 4D10C 3J7Yq 3RRCA 3FTZA 5D0OD 3CHMA 4WNGA 3ZN3A 1JUQA 5A6CA 2A3DA 1IJ5A 2X9WA 5F8PA 3APCA 4J0UA 4WNEA 2D0TA 3NQPA 4KVMA 5HQ8A 3O9XA 4EB6E 2XEVA 4DO0A 3APDA 1E7UA 3I9WA 3U66A 1IQRA 1UJJA 4WAFA 4N39A 3N9PA 2HM8A 5IHYA 2DCPA 3FU0A 3CHOA 3FH5A 5KCMA 4URKA 2C0SA 2XCCA 3NRYA 2PFVA 2AXZA 3FTSA 2E9XB 4AVXA 1Z6TA 3APFA 4UELA 1ZEEA 3OBVE 5C2YA 4ANUA 3VHLA 3VLDA 5L3FB 2PM6A 3EIQC 1U3DA 3NF1A 4AY5A 4O2AE 4MALA 4O4IE 2OVFA 5JR9C 2FEZA 3PU3A 3ZPOA 2J07A 3FEXA 2IW5B 2K5BB 3U4TA 2UY1A 4EYYR 5AENA 2KINB 2D2SA 4WNFA 1P5QA 3BQKA 4E7SA 5F3JA 3NZQA 2DHRA 4OK0A 2KCKA 4AY6A 2J4BA 5E0OA 2GW1A 4HVBA 1U3CA 3DP7A 4HTEA 2XGMA 3ZGQA 3SBSA 3LVRE 5ADXL 4U0UA 4EPZA 2GK9A 4G11A 3S2AA 1Z0PA 2X6JA 3MKRA 5CA0E 5LBMA 2NW9A 4IE4A 2LHNA 5T8IA 1H7CA 1KNZA 2JEKA 4ZI2C 1KLXA 5FP3A 3F57A 1UW4B 3LBXB 1H2VC 5L2LA 3PEUB 4AKHA 2XAQB 4U04A 2JMHA 4KT6B 3RU0A 3RRWA 3UMVA 5ETWA 3PUJA 5JJ6A 4A56A 1D1BA 3FUDA 3T5XA 4KP3C 2VGXB 3FUMA 4UEMA 4N3CA 1UCUA 3FY4A 5ENNA 1N54A 4LCTA 1MMNA 3Q4AB 5LGTB 3FUIA 1T98A 4UQYA 4DI3A 4DJAA 3K9IA 5DJQC 3P2BA 1Y6IA 4OVVA 1G8XA 4ISTA 3N9MA 1HU3A 2WWUA 1FMWA 1WRDA 3Q5WA 2X6HA 5EK4A 3MJWA 3CPZA 4E85A 2IAKA 4FHKA 3BQLA 4AIFA 3RO3A 3W15B 4DMVA 3JQ1A 5EX0A 2J49A 1EF1C 1H2TC 3AVRA 3PS6A 2Q9QC 4UWHA 4C0EA 3LK3B 3CVUA 1FVFA 4GZ3A 4PDXA 4EZ4A 4IRUA 2RA1A 3TKLB 5FMNA 2X6KA 3UUXB 1LVKA 3Q2MA 3O4XE 1KK7A 3NBXX 1NWMX 5LJMA 3VLFA 2KCVA 3GWHA 5LX8A 4CDNA 2XAHB 2IOLA 5CMWA 2YINA 5LOVE 3CQXC 3I4RB 4XKCA 3B57A 1S35A 2KLQA 1EDUA 3D9JA 3QARA 2E8IA 2NTYA 3ESLA 2VSNA 3C98A 1HCIA 4XBFB 1HS7A 2XRZA 2OA5A 5E75A 2AW6A 3AA1B 4M3OA 4QX8B 4HXIA 4X1YE 3PUSA 3FP3A 2VTBA 2XGOA 4AM9A 3AA6B 4CGWA 2WXKA 2ONDA 2WQHA 5KJKA 2FI7A 1G73A 2VKDA 4KBQA 2ZM8A 5BW8C 3KV9A 3FUNA 2XPYA 3VTXA 5FY1A 4N78D 3EIJA 1Y64B 2D5UA 4FADA 5FXXA 4HFVA 4E7ZA 4OYSA 4CEMA 4B8CB 2WXJA 2C2LA 4NUUA 1AJ3A 1EYHA 2PJQA 3OXFA 3AAEB 3ASDA 3N2OA 4GA0A 3FBZA 4O6FA 3IBEA 4NQ0A 1MIYA 3ZMVB 3QUJA 3HHMA 4I9CA 2LT3A 2PM7A 3C4WA 2ODUA 4BX9A 2LSYA 2IC6A 2V4LA 1V9DA 3CQCB 2CE7A 2X3MA 4I50E 4Q96A 4LEUA 1H2UA 3ML9A 3ZVVA 3QDNA 5JJTA 2CCQA 1IHGA 4XZ4A 3ZN1B 1GW6A 2M63A 4OYKA 4I43B 3C4XA 2KMFA 3ZJ2A 3ZHEB 2LJLA 4V3IA 3SI5A 2XQYA 4NURA 4QHOA 2UXXB 4XAXB 5G04C 3WAJA 1BR0A 3FH8A 2VSXE 5JDQA 4Y6WA 3MACA 5HAXA 1QNFA 3HKCE 4G25A 3R9AB 3FU3A 5JHBA 5LCWJ 5BUZA 3ZPJA 4BAYB 2WXNA 3EHNA 5FNVE 3SNXA 2V8SE 2B1EA 5J90A 2PG8A 3KVBA 4I17A 2UXNB 5FWQA 5LHHB 2MBGA 2MOZA 4RSYA 4EOZB 4AQFC 4PNIA 3NZSA 3CEQA 1UN9A 3IEEA 5EZYE 3AA0B 4PFOA 3PNTB 3T8MA 2JMKA 4APFA 4DBRA 2L8KA 1QZ2A 2DIWA 4FLBA 4DVDA 3IHVA 5JR9A 1HFAA 1SHZC 3OJAA 5BT1A 1SZ9A 3MCXA 2W61A 5L3EB 3P1UA 4TRQA 5JDMA 3P8CD 4DPRA 2QFCA 1N52A 3RRUA 2XAJB 3KV5A 3I0QA 2D0UA 5LP0A 3ZW3A 5LHGB 5DABA 2J08A 2R59A 4F7AA 3U78A 3CVLA 2HH7A 2VSOE 2PQNA 2WXIA 4APOA 3EJNA 3MGBA 3VU7H 2MTQA 1NA3A 4ADZA 3T5VA 2XAFB 3L09A 2YHCA 2Y8DA 1JWFA 2WM9A 1D0YA 2X38A 2XPZA 3RK6A 2E9XC 3UFEA 4EBAG 4P29A 4L7TA 2IU1A 2X9HA 2WBLA 4H9OC 3EHMA 5BNWA 4FULA 4GYWA 3ZIMA 2XHEB 2XGSA 3BQIA 4JHRA 2YU2A 3FWVA 1HG2A 3MZKB 4P09A 2WQ6A 2EHOB 3J9X1 5EX3A 2WXRA 2X6FA 3QC9A 5FQ6A 3TJPA 5LG4A 3SHFA 3OYZA 2KCLA 4L2YA 3MKDA 2QA7A 4XIFA 4WWPA 1HH8A 3S7DA 1E1HB 4KUMB 4IE0A 5LYJE 1LVFA 2VKHA 5HXSA 2XASB 3KV4A 5HI7A 2Y6XA 3IBPA 1ELWA 1SZAA 1YW0A 5LCYA 3UT5E 1FIOA 3HVEB 3CHRA 4WNKA 1CUNA 3Q15A 3ZRHA 4U72A 2ACXA 2IONA 3MJXA 3PZDA 4TN7B 3JCKC 3GZ1A 5G2NA 2V1DB 4ZS2A 4N2QA 4AOFA 3S7FA 4AXHA 4HOSA 4Y6CA 1JWGA 2XRYA 2L0TB 2LM9A 4PS3A 4EBAA 1PY1A 2J9QA 4J8EA 3CIAA 1A17A 2E2EA 4WW0A 5LA6E 2XCBA 3QOUA 2A4ZA 3ONLA 2Q9QA 3IHRA 1H6KA 3ETUA 3IF8B 3HDXA 4JLEA 3KD7A 4CDMA 3DJBA 4UI9C 4DLQA 4ERRA 2LNIA 4HS2A 5CMYA 4IE6A 5AYWD 4DLOA 5M4YA 1HXIA 3PEVB 4ABNA 4CXXA 4AXPA 3PVLA 2I2OA 3S7BA 3I0OA 3VTYA 3S7JA 4GZ5A 1H0AA 2NWBA 2ILRA 4YVOA 4AEZC 4JA9A 1NZNA 4V1Av 4ILGA 5CHEE 3UTKA 2EHOD 2W0GA 4H9SE 4TUYE 3ZCIA 4U07A 4BFRA 5KJNA 3R84B 5J2UE 4YHJA 1E8XA 4FJOA 2MOWA 2WMOA 2V7JA 1OWPA 2LSUA 4PW8A 4C9BB 4QXHB 4IE5A 4U0SA 3R6NA 4C91A 2W63A 4BT9A 4TV9E 3RH3A 2DWKA 2X67A 5D0QD 3O1HA 4ZHQE 2CFUA 1SA0E 1DVPA 4ANJA 3MEKA 2L9QA 2KZ7B 4O4HE 3DBSA 4MLKA 4XI9A 4GMLA 1MNDA 4YFSA 2LSJA 5LGNB 2YQ8A 4MFRA 2AWIA 3CVXA 2DBAA 4EZJA 4JW1A 1WYCA 4I4TE 3RKOA 4GCOA 5T3RA 4ACKA 2WXHA 3D0TA 4H7XA 5JDLA 4M1PA 2VSYA 2RP4A 4GZCA 3B13A 3HR0A 5T4YA 3RX6A 2Y48B 4BTAA 4CI2B 3CV0A 5AJDA 3FUFA 4JHJA 3ASGA 3AS4A 3CK9A 4AKGA 3MV3B 4BT8A 4U74A 2KT9A 3CHPA 4OYJA 2IOSA 2Q7FA 4B89A 4J2CA 4H9NC 4KYOB 3AU5A 1WLXA 1WAO1 4H7YA 4A3TA 3O1JA 2ZU6B 3WAKA 3GZ2A 1IZNB 2XHEA 3L17A 3HI2A 4F6RC 5KMGP 4ZI3D 4GA1A 4WUYA 5G05C 2KXPB 4YJ3E 3PE3A 5J2TE 3D9NA 2E9XD 3AS5A 4HE8A 3GMIA 2X9XA 3N9NA 3QK6A 3GA8A 5FXZA 4HLEA 4JVSA 3L08A 4GYRA 3UX4A 4QKNA 1U5PA 4H63H 4HN9A 3O1IA 4OVUA 2LOPA 1VDYA 3QAQA 4UWLA 2ZM0A 3ZCJA 4EYUA 3UT4A 2CA5A 3NRXA 1JPLA 4QWNB 4KXKB 4GCNA 1OWOA 2CM0A 4IIJE 2KZTA 1UN8A 5LFAA 3RC3A 1BR4A 2CEAA 4CZZB 4JEHB 3CVWA 2ZMAA 3OYXA 4KVOA 3ANWB 2DNXA 3E22E 3ZEFB 2MHKA 3GN5B 5A1LA 5IYZE 2I59A 4G1TA 4AQFA 5LNKA 3CK8A 3U9WA 1HO8A 4GK0E 2HO1A 4GYSA 3JQ0A 2MRIA 5JHAA 4CQIA 5AFUL 4AQGA 4CI3B 3D9PA 2WXFA 3MKQB 3ONXA 2K9AA 3K8PC 4GB9A 3ZYLA 3R7RA 1IJ6A 1Z3XA 3QB2A 3G2UA 1QSDA 2Z6EA 4H9RC 3KEZA 3RKVA 2WMNA 4K0UA 3FU5A 4MHCA 4G63A 5LXTE 1TJFA 2CXDA 3FEYA 4EZHA 4LUNU 4YVQC 3KINB 2KWHA 4GOUA 4K0RA 4CT4A 2FF4A 4E6HA 4HOTA 4GZDA 4W9RA 4G26A 2CXFA 2E9XA 4WNDA 5EK2A 3IEGA 4KZ0A 3OXGA 3G2TA 3QJZA 1Z3YA 2BZBA 4R7LA 1INZA 4DK5A 3ZC1A 2UWJG 2LHRA 2LOSA 2WXPA 4PS7A 3AVSA 4TV8E 4N3BA 1OUVA 5L3BB 2X68A 4CXWA 4OFZA 4IULA 2W62A 3FXEB 4B0ZA 2VJ8A 1BPOA 2M67A 4ILIA 5BPPA 3C64A 5JQGE 4F3VA 3PTRB 3GYZA 5HWXA 3LG7A 3FTUA 4CXYA 3AB3B 4EIWA 4MS6A 3RRNB 2X66A 1HS6A 3I9YA 4GK5E 2OV8A 5A7DB 3HA4A 2LSKA 2XQ0A 3CWZB 2YEVC 3ESKA 4JHKA 3CVPA 2N9DA 2WXQA 4BSXA 3CVYA 3KV6A 2FULA 2DCFA 4L1BA 1XNFA 4PUCA 3FU6A 3TGOA 3D9KA 3K3QC 1UX4A 5FXWA 4RVBA 4Z8XA 1PAQA 4KZCA 1Y8MA 3N5LA 1MHQA 4G2AA 4JUYA 4WWNA 2E0IA 4EXTA 5L3DB 5EDSA 2EHOC 3E0ZA 1MMGA 3FHNA 1D0XA 4LERA 3PUKA 3SF4A 1WR6A 3LBXA 3FUHA 4Q94A 1X5BA 4J8SA 3HIZA 5LBQB 2JPFA 2V5FA 2N1GA 3QK0A 3MX3A 5HXEA 1BR1A 1E96B 3A5XA 2VGXA 3RJVA 3ZC0A 1TEZA 3BG0B 5JDGA 3IKOB 5FTPA 3LS8A 1HTJF 4G23A 4IN3B 3PH0C 2L6JA 4TV3A 3FH7A 1E90A 3DPDA 2JJ9A 2V7IA 3CMLA 3SS1A 3CK7A 3L6AA 1BR2A 2NW7A 2CFZA 2WXOA 1E8WA 4AI6A 3SWHA 3FXDB 4GA2A 1YD8G 3HKBE 3IHYA 2BTDA 3CVRA 1YKHB 4UWGA 3U64A 4K03A 2NTXA 3GZSA 4FJZA 4PFPA 1OWMA 3QWWA 4P0AA 3CX7B 4UQXA 2VASA 2UY1B 3KAEA 3SD5A 3ZMSB 3UUXA 5DQVA 5H6QB 4BX8A 3KBUA 4UXNB 4ATGA 4I1AA 4ZI3C 4MBQA 3QC1A 5HXRA 4O4JE 3CVQA 3L3PA 3CKCA 3WI3A 2LEHA 4I9EA 4PJNA 4C0MA 4LRZA 5TAOA 5KJMA 2VL8A 2BVLA 2CLYC 4GZ6A 3KFWX 3Q47B 1WY6A 1UJKA 3CVNA 4HORA 4UV9B 4AKLA 3BEEA 4L23A 3ETVA 2J09A 4MRUA 4ASKA 3IV0A 3I3NA 2LO6A 5FZQA 3RPUA 3TXNA 4GYYA 2IF4A 3N9QA 4BJNA 4KMOA 2DLRA 5FQ4A 5ARGA 2WQ7A 4HGAA 4QXBB 3CSFA 3FB2A 4U63A 5HXHA 4DMWA 3L54A 4AJWA 5EKQD 3BG1B 3SGHA 5L3GB 3SOLA 3H3AA 4GYOA 3L16A 4WBNE 3KVAA 4CI1B 4GAAA 1HE8A 1D0ZA 4ZOLE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B13 A;  3VHL A;  2WMN A;  2WMO A;  2WM9 A;  2YIN A; 
#chains in the Genus database with same CATH topology
 3X1D A;  2AE9 A;  2HPJ A;  1AP7 A;  2V6Y A;  4JC8 A;  2D9D A;  5LGU B;  4PH4 B;  2VYI A;  4ISS A;  1OCR E;  1LRZ A;  2JQQ A;  3HRA A;  3J5P A;  3HL6 A;  2XTL A;  2IFU A;  1VRB A;  3UUL A;  2G0U A;  1TNY A;  4J6I A;  4B6X A;  4TXP A;  3EDV A;  3ZYK A;  3DWL G;  4BJM A;  2JLB A;  1HG5 A;  3JC6 D;  2NC9 A;  4JI6 T;  4A1S A;  5ENP D;  4PJM A;  3AE1 A;  3EDT B;  3ASN E;  4I1O B;  1Y01 A;  2RG8 A;  4NUV A;  1MQS A;  2IML A;  4UF0 B;  4X20 E;  1E7V A;  3AJI A;  3LKU A;  4QQI A;  3VLE A;  4JI8 T;  1VOM A;  2X51 A;  2Y4T A;  2V26 A;  1W9R A;  2LE8 A;  3VKH A;  2LSV A;  5KX5 E;  1W3B A;  3OAW A;  3D9L A;  3B95 A;  1NP7 A;  1YQ3 A;  4I43 A;  3E08 A;  1HF8 A;  2WSS V;  4CGV A;  3ZHE A;  2J1D G;  2LAI A;  2CXL A;  2J4D A;  3ZMU B;  2C0M A;  3DSX A;  3E4B A;  4TZ4 C;  3V5S A;  4Q69 A;  2A72 A;  2N2N A;  2NXP A;  4FU3 A;  2OOE A;  5BV1 A;  2I1K A;  5EIB E;  3A8Y C;  4PJJ A;  3LY7 A;  3PRE A;  2C5J A;  2PZI A;  4N2S A;  4EAH A;  2W2U A;  3AA7 B;  1MIV A;  1N4R A;  1N4S A;  4HNA D;  5CGM A;  4GMJ A;  4L0R A;  2K24 A;  4OHF A;  3I4G A;  3Q5X A;  5C2T A;  1I94 T;  4YDO A;  3RIA A;  4I55 E;  2WZH A;  1WCR A;  2CLY B;  4FC8 A;  5DQW A;  3EUH A;  4HOU A;  3NZP A;  3HYM B;  4YND A;  5ABE A;  1UOH A;  4IDZ A;  4G8L A;  5LHI B;  5M72 A;  5JDH A;  3OKQ A;  3JAF A;  4PK6 A;  4X8Q A;  4ACL A;  2ES0 A;  3OPC A;  4IGU A;  5DIZ A;  5LOZ A;  2R17 C;  3C98 B;  5J08 A;  2YDQ A;  2X9Y A;  2WB2 A;  2IUB A;  2W00 A;  1E2A A;  1JCR A;  3JAD A;  4B94 A;  3CST A;  2HPL A;  2XM1 A;  3FFL A;  3L13 A;  4I6J A;  4FI5 A;  2C5I T;  4O1P A;  2ACZ A;  1N36 T;  3PUG A;  5JVD E;  5BMV E;  1LF8 A;  1X9B A;  4AIU A;  1OT8 A;  4IYP A;  2PNN A;  4DND A;  5FY7 A;  4IHJ E;  2VTB B;  1PC2 A;  3BK9 A;  4AV7 A;  3FUJ A;  4NAC A;  4PJL A;  3T8O A;  2ZLY A;  2CHX A;  5L3C B;  5FIN A;  3NWI A;  4I1M A;  1SVX A;  1ZBP A;  3ZXS A;  5JDF A;  1B89 A;  3LXU X;  3B7R L;  3AS8 A;  3G2S A;  3ZLI A;  4YTN A;  4O2B E;  4JL0 A;  2JRK A;  1N94 A;  2F8Y A;  1Z8U A;  3PUW F;  3LEW A;  4NXM T;  4DI4 A;  2C0L A;  2IDO B;  4N3A A;  5LCW C;  4QFV A;  5G04 J;  2WCA A;  2YDR A;  4UWF A;  4JI4 T;  1HZ4 A;  1DNP A;  3ZFW A;  5HKP A;  2FBN A;  1AWC B;  5HXC A;  1QUU A;  4X1K E;  4U8Y D;  2BUG A;  2GRM A;  3LYA A;  3Q5M A;  5FT9 A;  1K8K G;  3M65 A;  4LF7 T;  2K48 A;  3O48 A;  4F1S A;  3SZ7 A;  3CR3 A;  1US7 B;  4DBQ A;  2YHE A;  2WXL A;  3L22 A;  3AAA B;  5CEA A;  3Q49 B;  5KBA A;  3Q73 A;  3HKE E;  2VVS A;  3EVY A;  2WPV A;  3N2K E;  1TNO A;  4DUZ T;  3JYS A;  2WDR A;  2P9N G;  1ELK A;  2VL0 A;  3DSU A;  3CX6 B;  5JRC B;  2VKJ A;  2H3R A;  4RG9 A;  3AEG A;  4ZS3 A;  1NEK A;  3FUL A;  3LJ3 A;  3PZ2 A;  4Z91 A;  1ZU2 A;  1S94 A;  3DTO A;  1XZY A;  2EHO A;  4Z90 A;  3RIB A;  1WG0 A;  3F2E A;  5D2M C;  3EU9 A;  5LG3 A;  3ULY A;  4DUY T;  5EIL A;  4AP2 A;  1KEY A;  3HXE A;  1YKE B;  2VKO A;  3ZN0 B;  3K3O A;  3TAX A;  2VQ2 A;  3C51 A;  3VRA A;  2MYS A;  4NRH B;  3CHS A;  2IQC A;  2BVM A;  4ILH B;  3T1Y T;  4FLH A;  2PQR A;  3KSQ A;  2YNQ A;  3CKB A;  4AQY T;  2EIN E;  3NZU A;  1IQU A;  3ISM C;  2CWY A;  2OEW A;  3W9F A;  5EYP F;  4A55 A;  2IC9 A;  3LY8 A;  3T9K A;  3LK4 2;  3HVE A;  2KAT A;  5LJN A;  3CHQ A;  4ILU A;  4YLH A;  1YCS B;  1WM5 A;  4UVC B;  4HOQ A;  4L5G A;  5C1D A;  4NIK A;  1EZ3 A;  3FZK B;  4U0Z A;  2PL2 A;  3V79 K;  4PK5 A;  5AQS B;  2ODV A;  5ANR A;  5FZR A;  4IRE A;  1DU2 A;  2A2F X;  5IWA T;  4FHJ A;  4OAV B;  5CJ5 A;  3K3N A;  3PNL B;  1B7T A;  3MK7 C;  4JI2 T;  3QWV A;  2LAH A;  3K1S A;  3CKD A;  1MMD A;  2BKO A;  3C4Z A;  1BD8 A;  2R02 A;  4U8H A;  2NOX A;  4O4L E;  2KC7 A;  1OED B;  3RC8 A;  3D9O A;  4XX5 A;  2CBI A;  4PAG A;  3UUM A;  1OED E;  2DZO A;  3TG5 A;  4F53 A;  5CA1 E;  3ABM E;  3PUQ A;  5JDN A;  4I6G A;  3BUA A;  5AQB A;  4JI0 T;  5JR9 B;  4GIW A;  3KS2 A;  4UF0 A;  2QYW A;  1M7K A;  5L4E A;  2H6I A;  4BY6 A;  3PE0 A;  4GKJ T;  3T8K A;  2KND A;  4GU5 A;  2X0L B;  3Q9D A;  5HEG A;  1ZV4 X;  2Y3A A;  4PK4 A;  4JXT A;  2QY7 A;  2ZM6 T;  2WDV A;  4ZFH A;  3QKY A;  3ZMT B;  3ONL C;  4ZZC A;  3AE2 A;  2UUC T;  2X6I A;  4LSZ E;  3CLJ A;  4F1P A;  3N2G E;  3FUE A;  4BES A;  2UUB T;  2A5E A;  2FO7 A;  1NI1 A;  1FVH A;  3FTV A;  1S0P A;  4DX1 A;  4UVA B;  4PS8 A;  2ZXW E;  3Q9U C;  3OVU A;  3ZYM A;  2QGS A;  5KDM C;  1MMA A;  4KBM B;  3B7T A;  3ABV A;  4FJY A;  3TWQ A;  3UT8 A;  2WAU A;  2AXV A;  4TXQ A;  3SFD A;  1WFD A;  4Q25 A;  2H7V C;  4GKK T;  4LFB T;  2IJG X;  4TUM A;  3SBT B;  5FJY A;  5CCL A;  3V30 A;  3ML8 A;  3I5P A;  4FP7 A;  4TUU A;  3Q5D A;  4H9Q C;  2HR2 A;  3CGH A;  1ELR A;  3TLT A;  4CT0 A;  3ZKJ A;  5CER B;  2C5K T;  1U4Q A;  5FQ8 A;  2XAG B;  3FZL B;  3R7Q A;  2VGY A;  1JNR A;  3C50 A;  5CB4 E;  3OTN A;  2XQ9 A;  3ZT6 A;  3FTW A;  5L47 A;  5AQU B;  4XKB A;  4MKT A;  1RZ4 A;  2ETA A;  5J1G A;  3JUI A;  3G06 A;  3D9I A;  1OWA A;  4CRW A;  3R9M A;  3U3W A;  3P4R A;  4C90 A;  4UVB B;  3F31 A;  1FMV A;  2EQX A;  2R05 A;  2Y1L E;  3ZMZ B;  5ABF B;  2P58 C;  5GON E;  4L2L A;  4UV8 B;  3JC6 C;  4JZY A;  4UI9 J;  4YSY A;  1NL4 A;  2CMR A;  4I6E A;  2P2C P;  2V7L A;  4HWH A;  1WYB A;  3MA9 A;  1JCS A;  3VKG A;  3QWP A;  2YK0 A;  1UX5 A;  2EIK E;  3RYC E;  3WXX A;  5E76 A;  1E8Z A;  3HXC A;  2RD0 A;  5CRU A;  2VB6 A;  1FPP A;  5JJ7 A;  2LKG A;  3URZ A;  1YA0 A;  1D8E A;  3TG4 A;  4TX5 A;  3E37 A;  2CHN A;  4YJ2 E;  4I2Z A;  2R6G F;  4JEU B;  4HFG A;  4N5C A;  2CHO A;  5A23 A;  3LDZ A;  1DC2 A;  1IYG A;  4I2W A;  3SFX A;  3X2Q E;  1XGW A;  2LSI A;  4ILC A;  2QRX A;  5ANL A;  1TNZ A;  3ZYQ A;  2FJE A;  5AJL A;  5J0Z A;  1H19 A;  1ZB1 A;  5AIJ A;  2DI4 A;  4LMK A;  1S64 A;  4BTB A;  1OXJ A;  3LFM A;  2VK9 A;  5JRC A;  3MXZ A;  1N0R A;  3RHW A;  2CG2 A;  2GGF A;  3N9L A;  3FTX A;  5B1B E;  4XI0 A;  2XPI A;  3V2X A;  3NKZ A;  5LP6 E;  1T7S A;  1KPS B;  2WZI A;  2IO3 C;  2Q9Q B;  2BG9 C;  1HNX T;  4X1I E;  4DUI A;  4CZ2 D;  3ASH A;  5C8Y E;  5HEJ A;  3D3M A;  5CCM A;  3SFZ A;  3H37 A;  1N0Q A;  3CVV A;  4P0B A;  5AQO B;  3Q5E A;  2I1J A;  2BS4 A;  3PJA J;  2SPC A;  1IAP A;  2DZN A;  4YSX A;  4ANW A;  4A98 A;  4DX5 D;  3EHR A;  3QNK A;  4DR7 T;  4RLY A;  3UPV A;  5BV0 A;  5KJL A;  3V2O A;  5ARF A;  5EK3 A;  1ZOY A;  2X0Y A;  3EI0 A;  4JEH A;  3PDN A;  2KBX A;  3ANW A;  4HEA A;  2NW8 A;  3ZEF A;  4J8F A;  4QXC B;  3ZJ1 A;  3GN5 A;  3LPZ A;  4ZI2 D;  2L0I A;  2P9B A;  2V0P A;  1FEW A;  3KDS E;  4J8D A;  2LSG A;  4LF4 T;  4RG6 A;  4HKA A;  5AQM B;  3D9M A;  4GTS A;  3SRZ A;  1EPU A;  2I9C A;  3ASF A;  4ME2 A;  5DBK A;  3RRM B;  4A5X A;  2AXU A;  1MIW A;  5EN5 D;  4CDR A;  4GPK A;  2NP9 A;  3UIN C;  2WDQ A;  4LF9 T;  5ENT D;  2ZM2 A;  2WXM A;  1YQ4 A;  1E8Y A;  4ANX A;  3KBT A;  1TN7 A;  3RO2 A;  1N9A A;  3AE3 A;  3S4U A;  5C3J A;  2Y4U A;  3FZM B;  3MV2 B;  3MKQ A;  4YY3 T;  3LJC A;  4G2V A;  2VWA A;  3PUV F;  3FDH A;  3O4Z A;  3PJA A;  2A5U A;  5G05 J;  1XWM A;  1XMQ T;  3PUR A;  3MYV A;  4KMC A;  2LLY A;  4ANV A;  4ZI7 E;  5CFB A;  4YTP A;  3LY9 A;  4QX7 B;  1LKX A;  3ONK A;  3V5U A;  3TL5 A;  1IKN D;  2WVI A;  3N71 A;  2ETB A;  5JH7 E;  1WR0 A;  1TN6 A;  5EYL A;  4DX7 D;  2JQH A;  3DXM G;  1UG3 A;  3ZKR A;  5JRE A;  1NA0 A;  4A1G A;  3DSS A;  3LVQ E;  4JI5 T;  4EQF A;  2R5S A;  3FZH B;  2BBJ A;  2NSZ A;  1D1A A;  3CX8 B;  5AQV B;  2LM2 A;  4C48 B;  3UQ3 A;  2L9B A;  5IY5 E;  4UIG A;  3UT7 A;  3PRZ A;  2BF0 X;  2V7K A;  4HWC A;  5FVK A;  4DV7 T;  4P1N A;  1OWL A;  4AKI A;  5HYA A;  5H6R B;  3RYF E;  5FZS A;  2AVP A;  2XQ6 A;  3ULQ A;  2CHW A;  3OXL A;  4EEC A;  2XQ4 A;  4H63 V;  1LTX A;  3G2V A;  1NAF A;  2Q9Q D;  1OXZ A;  5HWY A;  4XZC A;  3EU5 A;  3AEE A;  2KWI B;  1ZKE A;  4MLP A;  4BA9 A;  2V7M A;  4HFD A;  5HEO A;  3ENE A;  4DR1 T;  3JUE A;  3LDQ B;  5FXV A;  4U3C A;  2CWO A;  5AQF B;  3Q79 A;  3PUY F;  2KM4 A;  3AAI A;  5CEC B;  2XUE A;  4UQZ A;  4H9P C;  4EZL A;  4TXR A;  5LMN T;  2H7O A;  3U3I A;  5G55 A;  3LK2 B;  4WBO A;  1OWN A;  3FHE A;  4JPS A;  2M6I A;  5AQR B;  1KT0 A;  4X64 T;  4FA6 A;  3ZSS A;  1FCH A;  2KSR A;  4B8A A;  2F8X K;  1MNE A;  3G2W A;  2PBI A;  2VQE T;  3MA5 A;  3B7S A;  2BDE A;  3ZST A;  1ZHC A;  4CCA A;  1KT1 A;  1O1S A;  4A3V A;  3AEF A;  2GRL A;  4UI9 K;  1V55 E;  5FY0 A;  3RYI E;  3LCA A;  4KI0 F;  4U33 A;  2YU1 A;  1UUR A;  2OLT A;  4BEP A;  5AQI B;  3GW4 A;  3N9O A;  4COF A;  4IE7 A;  5AQK B;  1BU9 A;  3AU4 A;  4L9I A;  3LJN A;  3PDY A;  1DCQ A;  2KZT B;  4G24 A;  3HKD E;  1SQM A;  4JA7 A;  5FKY A;  3PE4 A;  4HRL A;  3TXM A;  5FQ7 A;  3AG4 E;  4IDN A;  4XE0 A;  4UWK A;  4BWR A;  3UUN A;  1HX8 A;  3MZL B;  4JB8 P;  5FYM A;  5D66 A;  2DWG A;  5AQ9 A;  2B76 A;  2WXG A;  2I6H A;  2L3L A;  3EDU A;  3AAA C;  4U2Z A;  1QQE A;  1K1A A;  3FUK A;  3I1A A;  4JEU A;  2CHZ A;  4WWO A;  2OVB A;  2GRP B;  2XZE A;  3P7I A;  3RYH E;  4B3S T;  1WDY A;  1O3X A;  3FBL A;  3TLV A;  4EZK A;  1X79 A;  1TJC A;  3PU8 A;  3CQG B;  3FTY A;  4NPP A;  3AE9 A;  2HYZ A;  4QH5 A;  1D1C A;  4O8S A;  3PUA A;  5IUX A;  5FL0 A;  4LFA T;  5KXJ A;  4AKR B;  1L5J A;  2CG3 A;  3B7U X;  4D10 C;  3J7Y q;  4UUC A;  3RRC A;  3FTZ A;  5D0O D;  4X5T A;  3CHM A;  4WNG A;  3ZN3 A;  1JUQ A;  3DSW A;  5A6C A;  2A3D A;  1IJ5 A;  5KNH D;  5BR8 T;  2X9W A;  1W0B A;  3SO8 A;  5F8P A;  3APC A;  4J0U A;  4WNE A;  2D0T A;  3NQP A;  4KVM A;  5HQ8 A;  3O9X A;  4EB6 E;  2XEV A;  4DO0 A;  3APD A;  1E7U A;  3I9W A;  1I6Z A;  3U66 A;  1IQR A;  1TYQ G;  1UJJ A;  3RQW A;  4WAF A;  4N39 A;  2XZT G;  3N9P A;  4B3M T;  2HM8 A;  5IHY A;  2DCP A;  2XQ5 A;  3FU0 A;  3CHO A;  3FH5 A;  3UTM A;  1E7P A;  5KCM A;  4URK A;  2C0S A;  2XCC A;  3UU5 A;  3NRY A;  2PFV A;  2AXZ A;  5CRV A;  2IO2 C;  4U8V D;  3FTS A;  2E9X B;  4AVX A;  1M62 A;  1Z6T A;  3APF A;  4UEL A;  3ZU7 B;  1ZEE A;  3QB5 A;  3OBV E;  5C2Y A;  4ANU A;  4KHZ F;  3VHL A;  3VLD A;  5L3F B;  2PM6 A;  3EIQ C;  1OED C;  2JIW A;  1U3D A;  1T8B A;  3NF1 A;  4AY5 A;  2K3W A;  4O2A E;  4MAL A;  1N95 A;  4O4I E;  2XQ8 A;  2OVF A;  5JR9 C;  3SFE A;  1KZP A;  2FEZ A;  3PU3 A;  3TWV A;  3OTO T;  3ZPO A;  2J07 A;  3FEX A;  3JXJ A;  2UU9 T;  2IW5 B;  2K5B B;  3U4T A;  2UY1 A;  4YDW A;  4DV0 T;  4EYY R;  1J1J A;  5AEN A;  2KIN B;  3ZT7 A;  2D2S A;  2V5Q C;  5HCJ A;  4WNF A;  1P5Q A;  4A63 B;  3H3M A;  2E2A A;  1DCE A;  2X0H A;  3BQK A;  4E7S A;  5F3J A;  3NZQ A;  5ABG A;  4HRM B;  2DHR A;  4OK0 A;  3FZF B;  2KCK A;  4AY6 A;  2J4B A;  5E0O A;  2GW1 A;  4HVB A;  5FL1 A;  5JTG A;  1U3C A;  4DX2 A;  3DP7 A;  4HTE A;  4DV1 T;  4RQI A;  4LNG A;  3P4P A;  2XGM A;  3ZGQ A;  3SBS A;  3LVR E;  4HBD A;  4TNV A;  5ADX L;  1H6O A;  4U0U A;  4EPZ A;  3AEA A;  2H88 A;  2GK9 A;  4B3R T;  2XY8 B;  1Z5S C;  4G11 A;  1SA4 A;  3S2A A;  1Z0P A;  3NOC D;  4LML A;  2X6J A;  5ENQ D;  3MKR A;  5CA0 E;  3NBN B;  1QYM A;  5AQG B;  5LBM A;  2NW9 A;  4IE4 A;  2LHN A;  3ABL E;  3SY2 A;  5T8I A;  1H7C A;  2FBW A;  1KNZ A;  2BG9 A;  2JEK A;  4HI9 A;  4ZI2 C;  2V5C A;  1KLX A;  5FP3 A;  3F57 A;  1UW4 B;  2RFM A;  3LBX B;  1H2V C;  3DXK G;  1OY3 D;  5L2L A;  3PEU B;  2H6F A;  4AKH A;  1HX1 B;  2XAQ B;  4DR2 T;  4U04 A;  3VR8 A;  2JMH A;  4KT6 B;  3RU0 A;  3RRW A;  4LF6 T;  4GTT A;  3UMV A;  4JV5 T;  5ETW A;  4K0K T;  3PUJ A;  5JJ6 A;  4A56 A;  1D1B A;  2NYJ A;  3CIR A;  3FUD A;  3T5X A;  4KP3 C;  2VGX B;  3FUM A;  4UEM A;  4N3C A;  1UCU A;  3FY4 A;  5ENN A;  4HWD A;  2RKK A;  1N54 A;  4LCT A;  1MMN A;  3Q4A B;  5LGT B;  3FUI A;  2WQY A;  3UM0 A;  1T98 A;  4UQY A;  4DI3 A;  4DJA A;  3K9I A;  4IDO A;  5DJQ C;  3P2B A;  1Y6I A;  4OVV A;  1G8X A;  4IST A;  3N9M A;  2BKG A;  3UM2 A;  4OAU C;  1HU3 A;  1UK5 A;  4GTO A;  2WWU A;  3C5R A;  3PZ3 A;  4BET A;  1FMW A;  1WRD A;  3Q5W A;  2X6H A;  5EK4 A;  3MJW A;  3CPZ A;  2YDS A;  4E85 A;  2IAK A;  4FHK A;  3BQL A;  4LG6 A;  4AIF A;  3W9G A;  3RO3 A;  3W15 B;  4HFC A;  4DMV A;  3JQ1 A;  5EX0 A;  2J62 A;  2J49 A;  1D9S A;  4UR9 A;  3RF1 A;  1EF1 C;  1H2T C;  3AVR A;  3PS6 A;  2Q9Q C;  4UWH A;  4N5Q A;  4C0E A;  3LK3 B;  3RAU A;  3CVU A;  1FVF A;  4J7W A;  4HI8 A;  4GZ3 A;  4PDX A;  4EZ4 A;  4IRU A;  2RA1 A;  3TKL B;  5FMN A;  1MJ0 A;  2X6K A;  3EHZ A;  3UUX B;  1LVK A;  3Q2M A;  3O4X E;  1SW6 A;  5HRY A;  3T1H T;  1KK7 A;  2MAW A;  3NBX X;  1NWM X;  5LJM A;  3VLF A;  2KCV A;  3GWH A;  4YT0 A;  3C3R A;  4CDN A;  2WU5 A;  2XAH B;  5LX8 A;  2IOL A;  5CMW A;  2YIN A;  2OEV A;  5LOV E;  3CQX C;  3I4R B;  4XKC A;  3B57 A;  1UUS A;  3RSE G;  1S35 A;  2DYR E;  3ZUV B;  2KLQ A;  1EDU A;  3D9J A;  3QAR A;  2E8I A;  3UU8 A;  3ASO E;  1R8I A;  2NTY A;  3ESL A;  2VSN A;  4DV2 T;  2I0M A;  3C98 A;  3AG1 E;  1TN8 A;  3TWU A;  1HCI A;  3UXG A;  3EAB A;  4XBF B;  1HS7 A;  2R03 A;  2XRZ A;  2OA5 A;  5E75 A;  2AW6 A;  3AA1 B;  1OCC E;  4M3O A;  3AE5 A;  4QX8 B;  4IDQ A;  4HXI A;  3UM1 A;  4X1Y E;  3PUS A;  3FP3 A;  2VTB A;  2XGO A;  4AM9 A;  2VGE A;  3AA6 B;  4CGW A;  2WXK A;  2OND A;  4GMR A;  2WQH A;  5KJK A;  2FI7 A;  1VCS A;  3LSV A;  5AQA A;  2ETC A;  1G73 A;  2VKD A;  4KBQ A;  1U2V G;  5LMU T;  2ZM8 A;  2VQF T;  5BW8 C;  4EED A;  1UGO A;  3KV9 A;  3FUN A;  2XPY A;  5KNG A;  3VTX A;  5FY1 A;  4N78 D;  3EIJ A;  1Y64 B;  5AQP B;  4B93 B;  2ZGG A;  2UXC T;  2WWV A;  2IY0 C;  2D5U A;  4FAD A;  5FXX A;  4HWF A;  3AXJ B;  1IBM T;  4HFV A;  4E7Z A;  4OYS A;  4CEM A;  4B8C B;  2WXJ A;  2C2L A;  4NUU A;  2V6Y B;  1AJ3 A;  1EYH A;  2F0Y A;  1MYO A;  1N4P A;  2PJQ A;  2XEN A;  3OXF A;  3AAE B;  3ASD A;  3N2O A;  4ZXL A;  4GA0 A;  3FBZ A;  4O6F A;  3IBE A;  4NQ0 A;  1MIY A;  4DID B;  3ZMV B;  1XNR T;  3QUJ A;  3HHM A;  4I9C A;  2LT3 A;  2PM7 A;  3C4W A;  2ODU A;  2XS8 A;  4BX9 A;  3C3O A;  2LSY A;  4JI3 T;  2FJA A;  2IC6 A;  2V4L A;  1K3Z D;  1V9D A;  5CBN A;  3CQC B;  2CE7 A;  2X3M A;  4I50 E;  2HHH T;  2UUA T;  4Q96 A;  4WYV A;  2RPA A;  4LEU A;  1H2U A;  4JBW F;  3ML9 A;  3ZVV A;  4K5B A;  3QDN A;  5JJT A;  2CCQ A;  1IHG A;  4TWF A;  2Y0B G;  3UI2 A;  4XZ4 A;  3ZN1 B;  3DST A;  1GW6 A;  2M63 A;  4OYK A;  4I43 B;  3C4X A;  2KMF A;  1ZP0 A;  2GRO B;  1S63 A;  3HXF A;  3ZJ2 A;  3ZHE B;  2LJL A;  4V3I A;  3SI5 A;  2XQY A;  4NUR A;  4QHO A;  4HB5 A;  2UXX B;  4XAX B;  3PUZ F;  3WAJ A;  5G04 C;  1BR0 A;  3FH8 A;  2VSX E;  3UQ4 A;  5JDQ A;  3DSV A;  5BXU A;  2J8S D;  4Y6W A;  3MAC A;  5HAX A;  4YHH T;  1QNF A;  3HKC E;  3Q78 A;  4G25 A;  3R9A B;  3TWW A;  3UKU G;  3FU3 A;  1D8D A;  1CHU A;  5JHB A;  2YN6 A;  5LCW J;  5BUZ A;  3ZPJ A;  4BAY B;  2WXN A;  3AED A;  5EID A;  1FT2 A;  3EHN A;  5FNV E;  1YYH A;  4KX6 A;  4I0U A;  3SNX A;  1O5M A;  2V8S E;  2B1E A;  5J90 A;  2PG8 A;  3KVB A;  3P4S A;  4I17 A;  2UXN B;  5FWQ A;  5LHH B;  2MBG A;  1OED A;  2MOZ A;  4RSY A;  4EOZ B;  4AQF C;  4PNI A;  3NZS A;  3CEQ A;  1UN9 A;  3UU4 A;  3IEE A;  5EZY E;  3AA0 B;  3JCF A;  4PFO A;  3PNT B;  3T8M A;  2JMK A;  4APF A;  1SUM B;  4DBR A;  2L8K A;  1QZ2 A;  2J4G A;  1NFI E;  4DVD A;  2W66 A;  2DIW A;  2RFA A;  3IHV A;  5JR9 A;  4FLB A;  1HFA A;  1SHZ C;  3OJA A;  4GTV A;  5BT1 A;  1SZ9 A;  3MCX A;  2W61 A;  4O1O A;  5L3E B;  2QC9 A;  3P1U A;  4TRQ A;  2V5D A;  5JDM A;  4F8H A;  3AE8 A;  3P8C D;  1XNQ T;  4DPR A;  2QFC A;  1N52 A;  3RRU A;  2XAJ B;  3KV5 A;  3I0Q A;  2D0U A;  4XEI G;  2XQ3 A;  5LP0 A;  2ZGD A;  3ZW3 A;  5LHG B;  5DAB A;  1MX6 A;  2J08 A;  3RKG A;  4LFC T;  2R59 A;  4F7A A;  3HXB A;  3U78 A;  3CVL A;  2HH7 A;  1S70 B;  2VSO E;  2PQN A;  2BS3 A;  2WXI A;  2LXM A;  4APO A;  3EJN A;  3MGB A;  3VU7 H;  2MTQ A;  5F5W A;  1NA3 A;  4ADZ A;  3T5V A;  1FT1 A;  2XAF B;  3L09 A;  2QYU A;  2YHC A;  2Y8D A;  2EIM E;  1JWF A;  2WM9 A;  3E30 A;  1V54 E;  1D0Y A;  3SQV A;  2X38 A;  2XPZ A;  3Q7F A;  4HWI B;  3RK6 A;  2IIU A;  2E9X C;  3RGL A;  3AG2 E;  3UFE A;  1J5E T;  3RI5 A;  4EBA G;  4P29 A;  4ZZB A;  4L7T A;  2IU1 A;  2X9H A;  5HEU A;  2WBL A;  4H9O C;  4WZX A;  2BKP A;  3EHM A;  5BNW A;  4FUL A;  1MX2 A;  4GYW A;  5LB7 B;  3ZIM A;  2XHE B;  4ILA A;  2XGS A;  3E34 A;  4YSZ A;  3BQI A;  1OCO E;  4JHR A;  2YU2 A;  3FWV A;  5ABH A;  1HG2 A;  4TNW A;  3VRB A;  3MZK B;  4P09 A;  2WQ6 A;  2EHO B;  3J9X 1;  5EX3 A;  2B6C A;  4OX9 T;  2WXR A;  5AQJ B;  2X6F A;  3V31 A;  3QC9 A;  3F6Q A;  5FVL A;  5FQ6 A;  2OCC E;  3TJP A;  2P9I G;  3NAW A;  5ABF A;  2DYS E;  5LG4 A;  3SHF A;  3OYZ A;  2LUH A;  2KCL A;  3KSL A;  4L2Y A;  3MKD A;  2QA7 A;  4HQD A;  4XIF A;  4WWP A;  1HH8 A;  5B1A E;  3S7D A;  1E1H B;  4KUM B;  4IE0 A;  5LYJ E;  1KNR A;  4JYA T;  1LVF A;  2VKH A;  5HXS A;  2XAS B;  3KV4 A;  5HI7 A;  2WY2 A;  2Y6X A;  3IBP A;  1ELW A;  1SZA A;  1YW0 A;  5LCY A;  3UT5 E;  1FIO A;  3HVE B;  3CHR A;  4WNK A;  1N4Q A;  3E33 A;  1CUN A;  3Q15 A;  2CBJ A;  3ZRH A;  4U72 A;  3NB2 A;  4B3T T;  3QNU A;  2E5L T;  4HFH A;  4EV6 A;  2ACX A;  2ION A;  3MJX A;  2YKS A;  5BXO A;  3PZD A;  4TN7 B;  5HEH A;  3JCK C;  3GZ1 A;  5G2N A;  2V1D B;  2VUR A;  4ZS2 A;  4N2Q A;  4AOF A;  3TLS A;  3S7F A;  2W67 A;  1O1T A;  2QZA A;  4AXH A;  4HOS A;  4Y6C A;  1JWG A;  2XRY A;  2L0T B;  2LM9 A;  4PS3 A;  4EBA A;  1PY1 A;  2J9Q A;  4J8E A;  3NOG D;  4GTP A;  3DPY A;  3CIA A;  1X81 A;  1A17 A;  2P9P G;  3B5M A;  2E2E A;  4WW0 A;  5LA6 E;  3L39 A;  2XCB A;  3QOU A;  4DR6 T;  2A4Z A;  3ONL A;  2Q9Q A;  3IHR A;  1H6K A;  2KXP C;  1QLB A;  1TR4 A;  3ETU A;  3IF8 B;  3TLU A;  3HDX A;  4YTM A;  4JLE A;  3KD7 A;  4CDM A;  3DJB A;  4HRN A;  2LRK A;  3DEO A;  4UI9 C;  2F37 A;  4DLQ A;  4ERR A;  4U7Y A;  3E32 A;  2LNI A;  4HS2 A;  1H6P A;  5CMY A;  4IE6 A;  5AYW D;  2FO1 E;  4DLO A;  1A5E A;  5M4Y A;  1HXI A;  3PEV B;  2LRL A;  4CXX A;  1G3N B;  4ABN A;  2CPT A;  4AXP A;  4M7C A;  3PVL A;  2I2O A;  3RQU A;  5HCM A;  3S7B A;  3I0O A;  3RIF A;  3VTY A;  3S7J A;  4GZ5 A;  3TWT A;  1H0A A;  2NWB A;  2ILR A;  4YVO A;  4AEZ C;  4JA9 A;  1NZN A;  4V1A v;  4ILB A;  4GTM A;  4ILG A;  3UTK A;  5CHE E;  2EHO D;  2W0G A;  4H9S E;  2XM2 A;  4TUY E;  3ZCI A;  2XZD G;  4U07 A;  5AN8 A;  2Y69 E;  4BFR A;  3TWS A;  5KJN A;  3R84 B;  5J2U E;  2JQ9 A;  4YHJ A;  1E8X A;  2YOE A;  4FJO A;  2MOW A;  3HXD A;  2WMO A;  2V7J A;  1OWP A;  2LSU A;  1J5W A;  5CED B;  5FIO A;  1N11 A;  4PW8 A;  4DR3 T;  4C9B B;  4QXH B;  4IE5 A;  4U0S A;  3R6N A;  3UIP C;  4C91 A;  2W63 A;  4BT9 A;  4TV9 E;  3RH3 A;  4U95 D;  2DWK A;  2X67 A;  5D0Q D;  2XQ7 A;  3O1H A;  4ZHQ E;  2CFU A;  1O1R A;  1SA0 E;  5AQH B;  1DVP A;  3AE7 A;  2XPK A;  5AQ7 A;  4ANJ A;  3MEK A;  5JMN D;  2L9Q A;  4HLL A;  2OV9 A;  4K5A B;  4J8Y A;  2KZ7 B;  2DL1 A;  4O4H E;  4U7E B;  3DBS A;  4MLK A;  4XI9 A;  4GML A;  1MND A;  3NVO A;  2AJA A;  4YFS A;  2LSJ A;  1KFY A;  1MX4 A;  5LGN B;  2GRN B;  4MFR A;  1HNW T;  2AWI A;  2YQ8 A;  3CVX A;  1IBK T;  5AQT B;  2DBA A;  4EZJ A;  3IA3 A;  2R2L A;  4JW1 A;  1WYC A;  4I4T E;  3RKO A;  4GCO A;  5T3R A;  4ACK A;  3J5Q B;  2WXH A;  3D0T A;  4H7X A;  5JDL A;  1JNZ A;  4M1P A;  2VSY A;  2RP4 A;  4GZC A;  3B13 A;  3HR0 A;  5T4Y A;  3RX6 A;  2Y48 B;  4BTA A;  4CI2 B;  3CV0 A;  5AJD A;  3FUF A;  4JHJ A;  3ASG A;  2ZIS A;  3AS4 A;  4AKG A;  3CK9 A;  3MV3 B;  4BT8 A;  4U74 A;  3QOF A;  1SE7 A;  2KT9 A;  3CHP A;  3EHQ A;  4OYJ A;  2IOS A;  3UKR G;  3RIU C;  2Q7F A;  4B89 A;  4J2C A;  4H9N C;  4KYO B;  3AU5 A;  2L6B A;  2FJB A;  2FJD A;  1WLX A;  4EGW A;  1WAO 1;  4H7Y A;  3UQ7 A;  4A3T A;  3SFY A;  3O1J A;  2ZU6 B;  3WAK A;  3GZ2 A;  1IZN B;  3ZNG A;  4DRX E;  2XHE A;  3L17 A;  3HI2 A;  2P9S G;  4F6R C;  5KMG P;  4ZI3 D;  4GA1 A;  4WUY A;  4HFB A;  5G05 C;  2A9U A;  2KXP B;  4YJ3 E;  3PE3 A;  4GTR A;  3PUX F;  5J2T E;  3L8R A;  3D9N A;  3AG3 E;  2E9X D;  3AE6 A;  3AS5 A;  4HE8 A;  3AEC A;  3GMI A;  2X9X A;  3N9N A;  5AAO A;  3QK6 A;  3GA8 A;  5FXZ A;  1HNZ T;  4HLE A;  4JVS A;  3L08 A;  4GYR A;  2DVW A;  1HR0 T;  3UX4 A;  4QKN A;  1U5P A;  1JCQ A;  4H63 H;  4HN9 A;  3O1I A;  4NXN T;  4OVU A;  2LOP A;  1VDY A;  3QAQ A;  2XSA A;  4DV6 T;  4UWL A;  2ZM0 A;  1W09 A;  3ZCJ A;  4EYU A;  2J47 A;  3UT4 A;  2CA5 A;  3NRX A;  1JPL A;  4QWN B;  4KXK B;  4GCN A;  4EEB A;  1OWO A;  2CM0 A;  2H6H A;  4IIJ E;  2BBH A;  2KZT A;  5CBO A;  1UN8 A;  5LFA A;  3RC3 A;  2P9U G;  3JAE A;  1BR4 A;  2CEA A;  4HFI A;  4CZZ B;  4JEH B;  3CVW A;  2ZMA A;  3OYX A;  4KVO A;  3ANW B;  2DNX A;  2WS3 A;  3E22 E;  3ZEF B;  1K1B A;  2MHK A;  2W4X A;  1KNP A;  3GN5 B;  5A1L A;  4U2Y A;  4CN6 A;  5IYZ E;  2I59 A;  2XJ7 A;  4AIS A;  4G1T A;  4AQF A;  5LNK A;  3CK8 A;  3U9W A;  3P4Q A;  1HO8 A;  4GK0 E;  2HO1 A;  4GYS A;  3JQ0 A;  3QB5 K;  2MRI A;  5JHA A;  3AE4 A;  1IHB A;  2LKH A;  4CQI A;  2V4H C;  5AFU L;  4IL4 A;  4LMJ A;  4AQG A;  4CI3 B;  1TNB A;  3D9P A;  3C72 A;  2WXF A;  3MKQ B;  1BI8 B;  3ONX A;  2K9A A;  3K8P C;  4IL9 A;  4GB9 A;  1T72 A;  4U31 A;  3ZYL A;  1MZC A;  3R7R A;  1IJ6 A;  1Z3X A;  3QB2 A;  3G2U A;  1QSD A;  2BKN A;  2Z6E A;  2XEH A;  1RW2 A;  4H9R C;  4LNB A;  3KEZ A;  4DR4 T;  3RKV A;  2WMN A;  1N32 T;  3WG7 E;  3PZ4 A;  3IXE A;  4K0U A;  3FU5 A;  4HFE A;  4QH4 A;  4MHC A;  1N33 T;  4G63 A;  5LXT E;  1TJF A;  2CXD A;  3FEY A;  4TWD A;  4EZH A;  4LUN U;  4YVQ C;  3KIN B;  4CYM D;  2KWH A;  4GOU A;  4K0R A;  2QYJ A;  4CT4 A;  2FF4 A;  4E6H A;  4A97 A;  4HOT A;  4GZD A;  4W9R A;  3L9T A;  2PTF A;  4GTQ A;  4G26 A;  2CXF A;  2E9X A;  4WND A;  3UU3 A;  5EK2 A;  3IEG A;  3UU6 A;  4KZ0 A;  3OXG A;  2EIL E;  3G2T A;  3UM3 A;  3QJZ A;  1LD8 A;  1Z3Y A;  2BZB A;  4R7L A;  1INZ A;  3PZ1 A;  4Z68 A;  4DK5 A;  3TLW A;  1XMO T;  1BLX B;  3ZC1 A;  2UWJ G;  4YDE A;  2LHR A;  3ZT5 A;  3ZXP A;  2LOS A;  4EHM A;  2WXP A;  4PS7 A;  3AVS A;  4TV8 E;  4LF8 T;  3DRA A;  4N3B A;  1OUV A;  5L3B B;  1GQE A;  2X68 A;  4CXW A;  3CK6 A;  4OFZ A;  4IUL A;  2W62 A;  1L0V A;  2P9L G;  4LF5 T;  2QVA A;  4DR5 T;  1QBQ A;  3FXE B;  2GRR B;  4ATZ D;  4DV3 T;  4B0Z A;  4L9P A;  2VJ8 A;  4X62 T;  1BPO A;  5L4H A;  2CRB A;  5AQL B;  2M67 A;  3L82 A;  4JI1 T;  4ILI A;  5BPP A;  4IT4 A;  3KEA A;  3C64 A;  5JQG E;  3DEP A;  4F3V A;  4KHP T;  3PTR B;  3GYZ A;  5HWX A;  3LG7 A;  5ENS D;  2LXL A;  2BKK B;  2WU2 A;  4CN4 A;  3FTU A;  4CXY A;  3AB3 B;  4EIW A;  4MS6 A;  3RRN B;  5ITZ F;  2X66 A;  1HS6 A;  1YMP A;  3I9Y A;  4GK5 E;  2OV8 A;  1N34 T;  5A7D B;  3HA4 A;  2LSK A;  2VVN A;  2JAB A;  2XQ0 A;  3BU8 A;  3CWZ B;  2YEV C;  3ESK A;  4JHK A;  2JQK A;  3CVP A;  2BS2 A;  2N9D A;  2WXQ A;  4BSX A;  3TWR A;  3CVY A;  5AQN B;  2AXD S;  3KV6 A;  2FUL A;  2DCF A;  4L1B A;  4YDY A;  1XNF A;  4PUC A;  3FU6 A;  3TGO A;  3D9K A;  3K3Q C;  1UX4 A;  4U96 D;  5FXW A;  4RVB A;  4Z8X A;  4X66 T;  1Q2Z A;  1PAQ A;  1SA5 A;  4KZC A;  1Y8M A;  3N5L A;  1KF6 A;  1IXV A;  1MHQ A;  4G2A A;  4JUY A;  3EUV A;  4WWN A;  2E0I A;  4EXT A;  5L3D B;  2NR4 A;  5EDS A;  1VCT A;  3B7B A;  2EHO C;  3E0Z A;  2XEE A;  1FJG T;  1MMG A;  3FHN A;  1D0X A;  4LER A;  3PUK A;  3SF4 A;  1WR6 A;  3LBX A;  3FUH A;  4Q94 A;  2IEJ A;  3ULE G;  1X5B A;  4J8S A;  2V8S V;  1W0A A;  3HIZ A;  4LNU D;  4JD2 G;  5LBQ B;  4CN1 A;  2JPF A;  2V5F A;  2N1G A;  3QK0 A;  3MX3 A;  5HXE A;  4DV4 T;  2FUP A;  1LD7 A;  1BR1 A;  1E96 B;  3A5X A;  2VGX A;  4F6R D;  3RJV A;  3ZC0 A;  1TEZ A;  2HE0 A;  3BG0 B;  5JDG A;  3IKO B;  5FTP A;  3LS8 A;  1HTJ F;  4G23 A;  4IN3 B;  2HN1 A;  3Q9N C;  3TWX A;  2F4V T;  3PH0 C;  2L6J A;  4TV3 A;  3FH7 A;  4IDP A;  1E90 A;  3DPD A;  4NIQ A;  2JJ9 A;  4K5C A;  2V7I A;  3CML A;  3SS1 A;  3CK7 A;  3L6A A;  1BR2 A;  2B0O E;  2NW7 A;  2CFZ A;  2WXO A;  3C3Q A;  1E8W A;  2XSB A;  3VR9 A;  4AI6 A;  3SWH A;  3FXD B;  2DWZ A;  4GA2 A;  1YD8 G;  1XDO A;  3HKB E;  3IHY A;  2BTD A;  3CVR A;  1YKH B;  2GRQ B;  4UWG A;  5AAR A;  3U64 A;  4K03 A;  1BI7 B;  3JXI A;  2NTX A;  3GZS A;  4GPM A;  2UXD T;  4FJZ A;  4PFP A;  4QH1 A;  5AQQ B;  1OWM A;  5H7P A;  2WB5 A;  1XDP A;  1YXR A;  2H6G A;  3PV0 F;  3QWW A;  4O60 A;  4P0A A;  1NEN A;  2E5V A;  2EIJ E;  3CX7 B;  4MBG A;  4UQX A;  2VAS A;  3P4W A;  2UY1 B;  4JI7 T;  2UXB T;  3KAE A;  3SD5 A;  3ZMS B;  2XQA A;  3UUB A;  1KZO A;  1OCZ E;  2V6X A;  3UFG A;  2XS1 A;  3UUX A;  5DQV A;  5H6Q B;  3ABK E;  3P50 A;  4BX8 A;  3KBU A;  4BER A;  4UXN B;  4ATG A;  2MPK A;  4I1A A;  4ZI3 C;  4MBQ A;  3QC1 A;  4DV5 T;  5JA4 D;  3EAM A;  3M3Z B;  5HXR A;  4O4J E;  4G8K A;  4ZEY A;  3CVQ A;  3L3P A;  3CKC A;  3WI3 A;  2LEH A;  4I9E A;  4PJN A;  4C0M A;  4LRZ A;  2MYO A;  5TAO A;  5ENO D;  2BED A;  5KJM A;  3RIU A;  2VL8 A;  2BVL A;  2CLY C;  4GZ6 A;  5B3S E;  2WP9 A;  3KFW X;  4X65 T;  3Q47 B;  1TNU A;  1WY6 A;  1UJK A;  3CVN A;  4HOR A;  4UV9 B;  2IHR 1;  2HN2 A;  4YXD A;  4AKL A;  3BEE A;  3UIO C;  4L23 A;  3ETV A;  2J09 A;  4MRU A;  3A7M A;  4ASK A;  3IV0 A;  3I3N A;  3Q75 A;  3D9H A;  2LO6 A;  4DX6 D;  5KWD A;  3ONJ A;  3RLF F;  2H89 A;  5FZQ A;  3RPU A;  3TXN A;  2M6B A;  3BQO A;  4GYY A;  4U7I A;  2IF4 A;  3N9Q A;  4BJN A;  4KMO A;  2DLR A;  5FQ4 A;  5ARG A;  2WQ7 A;  4HGA A;  4QXB B;  3CSF A;  3FB2 A;  2BG9 B;  4U63 A;  2P9K G;  3HG0 D;  4BSZ B;  1IBL T;  2BG9 E;  5HXH A;  4DMW A;  3L54 A;  4AJW A;  5EKQ D;  4ZHB A;  3BG1 B;  3SGH A;  5ENR D;  5L3G B;  3SOL A;  3H3A A;  3AEB A;  4TWH A;  4GYO A;  3L16 A;  4WBN E;  3KVA A;  4CI1 B;  4GAA A;  5HS0 A;  3Q7A A;  1HE8 A;  1D0Z A;  3AXJ A;  4ZOL E;  2ZIR A; 
#chains in the Genus database with same CATH homology
 2HPJ A;  4JC8 A;  5LGU B;  4PH4 B;  2VYI A;  4ISS A;  1LRZ A;  2JQQ A;  3HL6 A;  2XTL A;  2IFU A;  1VRB A;  3UUL A;  2G0U A;  4J6I A;  4B6X A;  3EDV A;  3ZYK A;  4BJM A;  2JLB A;  1HG5 A;  3JC6 D;  2NC9 A;  4A1S A;  4PJM A;  3EDT B;  4I1O B;  2RG8 A;  4NUV A;  1MQS A;  4UF0 B;  4X20 E;  1E7V A;  3LKU A;  3VLE A;  1VOM A;  2X51 A;  2Y4T A;  2V26 A;  2LE8 A;  3VKH A;  2LSV A;  5KX5 E;  1W3B A;  3OAW A;  3D9L A;  1NP7 A;  4I43 A;  3E08 A;  1HF8 A;  2WSS V;  4CGV A;  3ZHE A;  2J1D G;  2LAI A;  2CXL A;  2J4D A;  3ZMU B;  2C0M A;  3E4B A;  4TZ4 C;  3V5S A;  4Q69 A;  2A72 A;  2N2N A;  2NXP A;  4FU3 A;  2OOE A;  5BV1 A;  2I1K A;  4PJJ A;  3LY7 A;  3PRE A;  2C5J A;  2PZI A;  4N2S A;  4EAH A;  3AA7 B;  1MIV A;  4GMJ A;  4L0R A;  2K24 A;  4OHF A;  3I4G A;  3Q5X A;  4I55 E;  2CLY B;  4FC8 A;  5DQW A;  3EUH A;  4HOU A;  3NZP A;  3HYM B;  4YND A;  4IDZ A;  5LHI B;  5M72 A;  5JDH A;  3OKQ A;  4PK6 A;  4ACL A;  2ES0 A;  4IGU A;  5DIZ A;  5LOZ A;  2R17 C;  3C98 B;  5J08 A;  2X9Y A;  2WB2 A;  2W00 A;  4B94 A;  3CST A;  2HPL A;  3FFL A;  3L13 A;  4I6J A;  4FI5 A;  2C5I T;  3PUG A;  5JVD E;  5BMV E;  1LF8 A;  4IYP A;  4DND A;  5FY7 A;  4IHJ E;  2VTB B;  1PC2 A;  3BK9 A;  4AV7 A;  3FUJ A;  4NAC A;  4PJL A;  3T8O A;  2ZLY A;  2CHX A;  5L3C B;  4I1M A;  1ZBP A;  3ZXS A;  5JDF A;  1B89 A;  3LXU X;  3B7R L;  3AS8 A;  3G2S A;  3ZLI A;  4O2B E;  4JL0 A;  2JRK A;  3LEW A;  4DI4 A;  2C0L A;  4N3A A;  5LCW C;  4QFV A;  5G04 J;  4UWF A;  1HZ4 A;  1DNP A;  3ZFW A;  2FBN A;  5HXC A;  1QUU A;  4X1K E;  2BUG A;  2GRM A;  3LYA A;  3Q5M A;  5FT9 A;  3M65 A;  2K48 A;  3O48 A;  4F1S A;  3SZ7 A;  3CR3 A;  1US7 B;  4DBQ A;  2YHE A;  2WXL A;  3L22 A;  3AAA B;  3Q49 B;  3HKE E;  3EVY A;  2WPV A;  3N2K E;  3JYS A;  1ELK A;  3CX6 B;  5JRC B;  2VKJ A;  2H3R A;  4RG9 A;  4ZS3 A;  3FUL A;  3LJ3 A;  1ZU2 A;  1S94 A;  3DTO A;  2EHO A;  3RIB A;  3F2E A;  4AP2 A;  1YKE B;  2VKO A;  3ZN0 B;  3K3O A;  3TAX A;  2VQ2 A;  3C51 A;  2MYS A;  4NRH B;  3CHS A;  2IQC A;  2BVM A;  4ILH B;  4FLH A;  2PQR A;  2YNQ A;  3CKB A;  3NZU A;  1IQU A;  2CWY A;  4A55 A;  2IC9 A;  3LY8 A;  3LK4 2;  3HVE A;  2KAT A;  5LJN A;  3CHQ A;  4ILU A;  4YLH A;  1WM5 A;  4UVC B;  4HOQ A;  4L5G A;  5C1D A;  1EZ3 A;  4U0Z A;  2PL2 A;  4PK5 A;  2ODV A;  5ANR A;  5FZR A;  2A2F X;  4FHJ A;  3K3N A;  3PNL B;  1B7T A;  3MK7 C;  3QWV A;  2LAH A;  3CKD A;  1MMD A;  3C4Z A;  4U8H A;  2NOX A;  4O4L E;  2KC7 A;  3RC8 A;  3D9O A;  4XX5 A;  4PAG A;  3UUM A;  3TG5 A;  4F53 A;  5CA1 E;  3PUQ A;  5JDN A;  4I6G A;  5JR9 B;  4GIW A;  3KS2 A;  4UF0 A;  4BY6 A;  3PE0 A;  2KND A;  4GU5 A;  2X0L B;  3Q9D A;  1ZV4 X;  2Y3A A;  4PK4 A;  4JXT A;  2QY7 A;  3QKY A;  3ZMT B;  2X6I A;  3CLJ A;  3N2G E;  3FUE A;  2FO7 A;  1FVH A;  3FTV A;  1S0P A;  4UVA B;  4PS8 A;  3ZYM A;  2QGS A;  5KDM C;  1MMA A;  4KBM B;  3B7T A;  4FJY A;  3UT8 A;  2WAU A;  2AXV A;  2H7V C;  2IJG X;  3SBT B;  5FJY A;  5CCL A;  3ML8 A;  3I5P A;  4FP7 A;  4TUU A;  4H9Q C;  2HR2 A;  3CGH A;  1ELR A;  4CT0 A;  2C5K T;  1U4Q A;  5FQ8 A;  2XAG B;  3R7Q A;  2VGY A;  3C50 A;  5CB4 E;  3OTN A;  3FTW A;  4XKB A;  4MKT A;  5J1G A;  3JUI A;  3D9I A;  1OWA A;  4CRW A;  3U3W A;  4C90 A;  4UVB B;  3F31 A;  1FMV A;  2EQX A;  3ZMZ B;  2P58 C;  5GON E;  4L2L A;  4UV8 B;  3JC6 C;  4JZY A;  4UI9 J;  2CMR A;  4I6E A;  2V7L A;  1WYB A;  3MA9 A;  3VKG A;  3QWP A;  2YK0 A;  1UX5 A;  3RYC E;  3WXX A;  5E76 A;  1E8Z A;  2RD0 A;  2VB6 A;  5JJ7 A;  3URZ A;  1YA0 A;  3TG4 A;  4TX5 A;  4YJ2 E;  4I2Z A;  5A23 A;  4JEU B;  4HFG A;  4N5C A;  3LDZ A;  1IYG A;  4I2W A;  1XGW A;  2LSI A;  5ANL A;  3ZYQ A;  5AJL A;  1H19 A;  5AIJ A;  2DI4 A;  4BTB A;  3LFM A;  2VK9 A;  5JRC A;  3MXZ A;  2CG2 A;  2GGF A;  3N9L A;  3FTX A;  4XI0 A;  2XPI A;  5LP6 E;  2Q9Q B;  4X1I E;  3ASH A;  5C8Y E;  3D3M A;  5CCM A;  3SFZ A;  3H37 A;  3CVV A;  4P0B A;  2I1J A;  2SPC A;  1IAP A;  4ANW A;  3QNK A;  3UPV A;  5BV0 A;  5KJL A;  5ARF A;  5EK3 A;  4JEH A;  3PDN A;  3ANW A;  4HEA A;  2NW8 A;  3ZEF A;  4J8F A;  4QXC B;  3ZJ1 A;  3GN5 A;  3LPZ A;  4ZI2 D;  2L0I A;  2P9B A;  2V0P A;  1FEW A;  3KDS E;  4J8D A;  2LSG A;  4RG6 A;  4HKA A;  3D9M A;  3SRZ A;  1EPU A;  2I9C A;  3ASF A;  4ME2 A;  5DBK A;  3RRM B;  4CDR A;  2AXU A;  1MIW A;  4GPK A;  2NP9 A;  2ZM2 A;  2WXM A;  1E8Y A;  4ANX A;  3KBT A;  3RO2 A;  3S4U A;  2Y4U A;  3MV2 B;  3MKQ A;  3LJC A;  4G2V A;  2VWA A;  3FDH A;  3O4Z A;  2A5U A;  5G05 J;  3MYV A;  3PUR A;  4KMC A;  4ANV A;  4ZI7 E;  3LY9 A;  4QX7 B;  1LKX A;  3ONK A;  3V5U A;  3TL5 A;  2WVI A;  3N71 A;  5JH7 E;  1UG3 A;  5JRE A;  1NA0 A;  4A1G A;  3LVQ E;  4EQF A;  2R5S A;  2NSZ A;  1D1A A;  3CX8 B;  3UQ3 A;  2L9B A;  4UIG A;  3UT7 A;  3PRZ A;  2BF0 X;  2V7K A;  1OWL A;  4AKI A;  5HYA A;  5H6R B;  3RYF E;  5FZS A;  2AVP A;  3ULQ A;  2CHW A;  3OXL A;  4EEC A;  4H63 V;  3G2V A;  1NAF A;  2Q9Q D;  1OXZ A;  5HWY A;  4XZC A;  2KWI B;  1ZKE A;  4MLP A;  4BA9 A;  2V7M A;  3ENE A;  5FXV A;  2CWO A;  2KM4 A;  3AAI A;  2XUE A;  4UQZ A;  4H9P C;  4EZL A;  2H7O A;  3U3I A;  5G55 A;  3LK2 B;  4WBO A;  1OWN A;  3FHE A;  4JPS A;  1KT0 A;  4FA6 A;  1FCH A;  4B8A A;  1MNE A;  3G2W A;  2PBI A;  3MA5 A;  3B7S A;  2BDE A;  1ZHC A;  4CCA A;  1KT1 A;  4A3V A;  2GRL A;  4UI9 K;  5FY0 A;  3RYI E;  3LCA A;  2YU1 A;  3GW4 A;  3N9O A;  4IE7 A;  3AU4 A;  4L9I A;  3PDY A;  2KZT B;  4G24 A;  3HKD E;  1SQM A;  4JA7 A;  3PE4 A;  3TXM A;  5FQ7 A;  4XE0 A;  4UWK A;  4BWR A;  3UUN A;  1HX8 A;  3MZL B;  5FYM A;  2DWG A;  2WXG A;  2I6H A;  2L3L A;  3EDU A;  1QQE A;  3FUK A;  3I1A A;  4JEU A;  2CHZ A;  4WWO A;  2OVB A;  3P7I A;  3RYH E;  1O3X A;  3FBL A;  4EZK A;  1X79 A;  1TJC A;  3PU8 A;  3CQG B;  3FTY A;  2HYZ A;  1D1C A;  4O8S A;  3PUA A;  4AKR B;  1L5J A;  2CG3 A;  3B7U X;  4D10 C;  3J7Y q;  3RRC A;  3FTZ A;  5D0O D;  3CHM A;  4WNG A;  3ZN3 A;  1JUQ A;  5A6C A;  2A3D A;  1IJ5 A;  2X9W A;  5F8P A;  3APC A;  4J0U A;  4WNE A;  2D0T A;  3NQP A;  4KVM A;  5HQ8 A;  3O9X A;  4EB6 E;  2XEV A;  4DO0 A;  3APD A;  1E7U A;  3I9W A;  3U66 A;  1IQR A;  1UJJ A;  4WAF A;  4N39 A;  3N9P A;  2HM8 A;  5IHY A;  2DCP A;  3FU0 A;  3CHO A;  3FH5 A;  5KCM A;  4URK A;  2C0S A;  2XCC A;  3NRY A;  2PFV A;  2AXZ A;  3FTS A;  2E9X B;  4AVX A;  1Z6T A;  3APF A;  4UEL A;  1ZEE A;  3OBV E;  5C2Y A;  4ANU A;  3VHL A;  3VLD A;  5L3F B;  2PM6 A;  3EIQ C;  1U3D A;  3NF1 A;  4AY5 A;  4O2A E;  4MAL A;  4O4I E;  2OVF A;  5JR9 C;  2FEZ A;  3PU3 A;  3ZPO A;  2J07 A;  3FEX A;  2IW5 B;  2K5B B;  3U4T A;  2UY1 A;  4EYY R;  5AEN A;  2KIN B;  2D2S A;  4WNF A;  1P5Q A;  3BQK A;  4E7S A;  5F3J A;  3NZQ A;  2DHR A;  4OK0 A;  2KCK A;  4AY6 A;  2J4B A;  5E0O A;  2GW1 A;  4HVB A;  1U3C A;  3DP7 A;  4HTE A;  2XGM A;  3ZGQ A;  3SBS A;  3LVR E;  5ADX L;  4U0U A;  4EPZ A;  2GK9 A;  4G11 A;  3S2A A;  1Z0P A;  2X6J A;  3MKR A;  5CA0 E;  5LBM A;  2NW9 A;  4IE4 A;  2LHN A;  5T8I A;  1H7C A;  1KNZ A;  2JEK A;  4ZI2 C;  1KLX A;  5FP3 A;  3F57 A;  1UW4 B;  3LBX B;  1H2V C;  5L2L A;  3PEU B;  4AKH A;  2XAQ B;  4U04 A;  2JMH A;  4KT6 B;  3RU0 A;  3RRW A;  3UMV A;  5ETW A;  3PUJ A;  5JJ6 A;  4A56 A;  1D1B A;  3FUD A;  3T5X A;  4KP3 C;  2VGX B;  3FUM A;  4UEM A;  4N3C A;  1UCU A;  3FY4 A;  5ENN A;  1N54 A;  4LCT A;  1MMN A;  3Q4A B;  5LGT B;  3FUI A;  1T98 A;  4UQY A;  4DI3 A;  4DJA A;  3K9I A;  5DJQ C;  3P2B A;  1Y6I A;  4OVV A;  1G8X A;  4IST A;  3N9M A;  1HU3 A;  2WWU A;  1FMW A;  1WRD A;  3Q5W A;  2X6H A;  5EK4 A;  3MJW A;  3CPZ A;  4E85 A;  2IAK A;  4FHK A;  3BQL A;  4AIF A;  3RO3 A;  3W15 B;  4DMV A;  3JQ1 A;  5EX0 A;  2J49 A;  1EF1 C;  1H2T C;  3AVR A;  3PS6 A;  2Q9Q C;  4UWH A;  4C0E A;  3LK3 B;  3CVU A;  1FVF A;  4GZ3 A;  4PDX A;  4EZ4 A;  4IRU A;  2RA1 A;  3TKL B;  5FMN A;  2X6K A;  3UUX B;  1LVK A;  3Q2M A;  3O4X E;  1KK7 A;  3NBX X;  1NWM X;  5LJM A;  3VLF A;  2KCV A;  3GWH A;  5LX8 A;  4CDN A;  2XAH B;  2IOL A;  5CMW A;  2YIN A;  5LOV E;  3CQX C;  3I4R B;  4XKC A;  3B57 A;  1S35 A;  2KLQ A;  1EDU A;  3D9J A;  3QAR A;  2E8I A;  2NTY A;  3ESL A;  2VSN A;  3C98 A;  1HCI A;  4XBF B;  1HS7 A;  2XRZ A;  2OA5 A;  5E75 A;  2AW6 A;  3AA1 B;  4M3O A;  4QX8 B;  4HXI A;  4X1Y E;  3PUS A;  3FP3 A;  2VTB A;  2XGO A;  4AM9 A;  3AA6 B;  4CGW A;  2WXK A;  2OND A;  2WQH A;  5KJK A;  2FI7 A;  1G73 A;  2VKD A;  4KBQ A;  2ZM8 A;  5BW8 C;  3KV9 A;  3FUN A;  2XPY A;  3VTX A;  5FY1 A;  4N78 D;  3EIJ A;  1Y64 B;  2D5U A;  4FAD A;  5FXX A;  4HFV A;  4E7Z A;  4OYS A;  4CEM A;  4B8C B;  2WXJ A;  2C2L A;  4NUU A;  1AJ3 A;  1EYH A;  2PJQ A;  3OXF A;  3AAE B;  3ASD A;  3N2O A;  4GA0 A;  3FBZ A;  4O6F A;  3IBE A;  4NQ0 A;  1MIY A;  3ZMV B;  3QUJ A;  3HHM A;  4I9C A;  2LT3 A;  2PM7 A;  3C4W A;  2ODU A;  4BX9 A;  2LSY A;  2IC6 A;  2V4L A;  1V9D A;  3CQC B;  2CE7 A;  2X3M A;  4I50 E;  4Q96 A;  4LEU A;  1H2U A;  3ML9 A;  3ZVV A;  3QDN A;  5JJT A;  2CCQ A;  1IHG A;  4XZ4 A;  3ZN1 B;  1GW6 A;  2M63 A;  4OYK A;  4I43 B;  3C4X A;  2KMF A;  3ZJ2 A;  3ZHE B;  2LJL A;  4V3I A;  3SI5 A;  2XQY A;  4NUR A;  4QHO A;  2UXX B;  4XAX B;  5G04 C;  3WAJ A;  1BR0 A;  3FH8 A;  2VSX E;  5JDQ A;  4Y6W A;  3MAC A;  5HAX A;  1QNF A;  3HKC E;  4G25 A;  3R9A B;  3FU3 A;  5JHB A;  5LCW J;  5BUZ A;  3ZPJ A;  4BAY B;  2WXN A;  3EHN A;  5FNV E;  3SNX A;  2V8S E;  2B1E A;  5J90 A;  2PG8 A;  3KVB A;  4I17 A;  2UXN B;  5FWQ A;  5LHH B;  2MBG A;  2MOZ A;  4RSY A;  4EOZ B;  4AQF C;  4PNI A;  3NZS A;  3CEQ A;  1UN9 A;  3IEE A;  5EZY E;  3AA0 B;  4PFO A;  3PNT B;  3T8M A;  2JMK A;  4APF A;  4DBR A;  2L8K A;  1QZ2 A;  2DIW A;  4FLB A;  4DVD A;  3IHV A;  5JR9 A;  1HFA A;  1SHZ C;  3OJA A;  5BT1 A;  1SZ9 A;  3MCX A;  2W61 A;  5L3E B;  3P1U A;  4TRQ A;  5JDM A;  3P8C D;  4DPR A;  2QFC A;  1N52 A;  3RRU A;  2XAJ B;  3KV5 A;  3I0Q A;  2D0U A;  5LP0 A;  3ZW3 A;  5LHG B;  5DAB A;  2J08 A;  2R59 A;  4F7A A;  3U78 A;  3CVL A;  2HH7 A;  2VSO E;  2PQN A;  2WXI A;  4APO A;  3EJN A;  3MGB A;  3VU7 H;  2MTQ A;  1NA3 A;  4ADZ A;  3T5V A;  2XAF B;  3L09 A;  2YHC A;  2Y8D A;  1JWF A;  2WM9 A;  1D0Y A;  2X38 A;  2XPZ A;  3RK6 A;  2E9X C;  3UFE A;  4EBA G;  4P29 A;  4L7T A;  2IU1 A;  2X9H A;  2WBL A;  4H9O C;  3EHM A;  5BNW A;  4FUL A;  4GYW A;  3ZIM A;  2XHE B;  2XGS A;  3BQI A;  4JHR A;  2YU2 A;  3FWV A;  1HG2 A;  3MZK B;  4P09 A;  2WQ6 A;  2EHO B;  3J9X 1;  5EX3 A;  2WXR A;  2X6F A;  3QC9 A;  5FQ6 A;  3TJP A;  5LG4 A;  3SHF A;  3OYZ A;  2KCL A;  4L2Y A;  3MKD A;  2QA7 A;  4XIF A;  4WWP A;  1HH8 A;  3S7D A;  1E1H B;  4KUM B;  4IE0 A;  5LYJ E;  1LVF A;  2VKH A;  5HXS A;  2XAS B;  3KV4 A;  5HI7 A;  2Y6X A;  3IBP A;  1ELW A;  1SZA A;  1YW0 A;  5LCY A;  3UT5 E;  1FIO A;  3HVE B;  3CHR A;  4WNK A;  1CUN A;  3Q15 A;  3ZRH A;  4U72 A;  2ACX A;  2ION A;  3MJX A;  3PZD A;  4TN7 B;  3JCK C;  3GZ1 A;  5G2N A;  2V1D B;  4ZS2 A;  4N2Q A;  4AOF A;  3S7F A;  4AXH A;  4HOS A;  4Y6C A;  1JWG A;  2XRY A;  2L0T B;  2LM9 A;  4PS3 A;  4EBA A;  1PY1 A;  2J9Q A;  4J8E A;  3CIA A;  1A17 A;  2E2E A;  4WW0 A;  5LA6 E;  2XCB A;  3QOU A;  2A4Z A;  3ONL A;  2Q9Q A;  3IHR A;  1H6K A;  3ETU A;  3IF8 B;  3HDX A;  4JLE A;  3KD7 A;  4CDM A;  3DJB A;  4UI9 C;  4DLQ A;  4ERR A;  2LNI A;  4HS2 A;  5CMY A;  4IE6 A;  5AYW D;  4DLO A;  5M4Y A;  1HXI A;  3PEV B;  4ABN A;  4CXX A;  4AXP A;  3PVL A;  2I2O A;  3S7B A;  3I0O A;  3VTY A;  3S7J A;  4GZ5 A;  1H0A A;  2NWB A;  2ILR A;  4YVO A;  4AEZ C;  4JA9 A;  1NZN A;  4V1A v;  4ILG A;  5CHE E;  3UTK A;  2EHO D;  2W0G A;  4H9S E;  4TUY E;  3ZCI A;  4U07 A;  4BFR A;  5KJN A;  3R84 B;  5J2U E;  4YHJ A;  1E8X A;  4FJO A;  2MOW A;  2WMO A;  2V7J A;  1OWP A;  2LSU A;  4PW8 A;  4C9B B;  4QXH B;  4IE5 A;  4U0S A;  3R6N A;  4C91 A;  2W63 A;  4BT9 A;  4TV9 E;  3RH3 A;  2DWK A;  2X67 A;  5D0Q D;  3O1H A;  4ZHQ E;  2CFU A;  1SA0 E;  1DVP A;  4ANJ A;  3MEK A;  2L9Q A;  2KZ7 B;  4O4H E;  3DBS A;  4MLK A;  4XI9 A;  4GML A;  1MND A;  4YFS A;  2LSJ A;  5LGN B;  2YQ8 A;  4MFR A;  2AWI A;  3CVX A;  2DBA A;  4EZJ A;  4JW1 A;  1WYC A;  4I4T E;  3RKO A;  4GCO A;  5T3R A;  4ACK A;  2WXH A;  3D0T A;  4H7X A;  5JDL A;  4M1P A;  2VSY A;  2RP4 A;  4GZC A;  3B13 A;  3HR0 A;  5T4Y A;  3RX6 A;  2Y48 B;  4BTA A;  4CI2 B;  3CV0 A;  5AJD A;  3FUF A;  4JHJ A;  3ASG A;  3AS4 A;  3CK9 A;  4AKG A;  3MV3 B;  4BT8 A;  4U74 A;  2KT9 A;  3CHP A;  4OYJ A;  2IOS A;  2Q7F A;  4B89 A;  4J2C A;  4H9N C;  4KYO B;  3AU5 A;  1WLX A;  1WAO 1;  4H7Y A;  4A3T A;  3O1J A;  2ZU6 B;  3WAK A;  3GZ2 A;  1IZN B;  2XHE A;  3L17 A;  3HI2 A;  4F6R C;  5KMG P;  4ZI3 D;  4GA1 A;  4WUY A;  5G05 C;  2KXP B;  4YJ3 E;  3PE3 A;  5J2T E;  3D9N A;  2E9X D;  3AS5 A;  4HE8 A;  3GMI A;  2X9X A;  3N9N A;  3QK6 A;  3GA8 A;  5FXZ A;  4HLE A;  4JVS A;  3L08 A;  4GYR A;  3UX4 A;  4QKN A;  1U5P A;  4H63 H;  4HN9 A;  3O1I A;  4OVU A;  2LOP A;  1VDY A;  3QAQ A;  4UWL A;  2ZM0 A;  3ZCJ A;  4EYU A;  3UT4 A;  2CA5 A;  3NRX A;  1JPL A;  4QWN B;  4KXK B;  4GCN A;  1OWO A;  2CM0 A;  4IIJ E;  2KZT A;  1UN8 A;  5LFA A;  3RC3 A;  1BR4 A;  2CEA A;  4CZZ B;  4JEH B;  3CVW A;  2ZMA A;  3OYX A;  4KVO A;  3ANW B;  2DNX A;  3E22 E;  3ZEF B;  2MHK A;  3GN5 B;  5A1L A;  5IYZ E;  2I59 A;  4G1T A;  4AQF A;  5LNK A;  3CK8 A;  3U9W A;  1HO8 A;  4GK0 E;  2HO1 A;  4GYS A;  3JQ0 A;  2MRI A;  5JHA A;  4CQI A;  5AFU L;  4AQG A;  4CI3 B;  3D9P A;  2WXF A;  3MKQ B;  3ONX A;  2K9A A;  3K8P C;  4GB9 A;  3ZYL A;  3R7R A;  1IJ6 A;  1Z3X A;  3QB2 A;  3G2U A;  1QSD A;  2Z6E A;  4H9R C;  3KEZ A;  3RKV A;  2WMN A;  4K0U A;  3FU5 A;  4MHC A;  4G63 A;  5LXT E;  1TJF A;  2CXD A;  3FEY A;  4EZH A;  4LUN U;  4YVQ C;  3KIN B;  2KWH A;  4GOU A;  4K0R A;  4CT4 A;  2FF4 A;  4E6H A;  4HOT A;  4GZD A;  4W9R A;  4G26 A;  2CXF A;  2E9X A;  4WND A;  5EK2 A;  3IEG A;  4KZ0 A;  3OXG A;  3G2T A;  3QJZ A;  1Z3Y A;  2BZB A;  4R7L A;  1INZ A;  4DK5 A;  3ZC1 A;  2UWJ G;  2LHR A;  2LOS A;  2WXP A;  4PS7 A;  3AVS A;  4TV8 E;  4N3B A;  1OUV A;  5L3B B;  2X68 A;  4CXW A;  4OFZ A;  4IUL A;  2W62 A;  3FXE B;  4B0Z A;  2VJ8 A;  1BPO A;  2M67 A;  4ILI A;  5BPP A;  3C64 A;  5JQG E;  4F3V A;  3PTR B;  3GYZ A;  5HWX A;  3LG7 A;  3FTU A;  4CXY A;  3AB3 B;  4EIW A;  4MS6 A;  3RRN B;  2X66 A;  1HS6 A;  3I9Y A;  4GK5 E;  2OV8 A;  5A7D B;  3HA4 A;  2LSK A;  2XQ0 A;  3CWZ B;  2YEV C;  3ESK A;  4JHK A;  3CVP A;  2N9D A;  2WXQ A;  4BSX A;  3CVY A;  3KV6 A;  2FUL A;  2DCF A;  4L1B A;  1XNF A;  4PUC A;  3FU6 A;  3TGO A;  3D9K A;  3K3Q C;  1UX4 A;  5FXW A;  4RVB A;  4Z8X A;  1PAQ A;  4KZC A;  1Y8M A;  3N5L A;  1MHQ A;  4G2A A;  4JUY A;  4WWN A;  2E0I A;  4EXT A;  5L3D B;  5EDS A;  2EHO C;  3E0Z A;  1MMG A;  3FHN A;  1D0X A;  4LER A;  3PUK A;  3SF4 A;  1WR6 A;  3LBX A;  3FUH A;  4Q94 A;  1X5B A;  4J8S A;  3HIZ A;  5LBQ B;  2JPF A;  2V5F A;  2N1G A;  3QK0 A;  3MX3 A;  5HXE A;  1BR1 A;  1E96 B;  3A5X A;  2VGX A;  3RJV A;  3ZC0 A;  1TEZ A;  3BG0 B;  5JDG A;  3IKO B;  5FTP A;  3LS8 A;  1HTJ F;  4G23 A;  4IN3 B;  3PH0 C;  2L6J A;  4TV3 A;  3FH7 A;  1E90 A;  3DPD A;  2JJ9 A;  2V7I A;  3CML A;  3SS1 A;  3CK7 A;  3L6A A;  1BR2 A;  2NW7 A;  2CFZ A;  2WXO A;  1E8W A;  4AI6 A;  3SWH A;  3FXD B;  4GA2 A;  1YD8 G;  3HKB E;  3IHY A;  2BTD A;  3CVR A;  1YKH B;  4UWG A;  3U64 A;  4K03 A;  2NTX A;  3GZS A;  4FJZ A;  4PFP A;  1OWM A;  3QWW A;  4P0A A;  3CX7 B;  4UQX A;  2VAS A;  2UY1 B;  3KAE A;  3SD5 A;  3ZMS B;  3UUX A;  5DQV A;  5H6Q B;  4BX8 A;  3KBU A;  4UXN B;  4ATG A;  4I1A A;  4ZI3 C;  4MBQ A;  3QC1 A;  5HXR A;  4O4J E;  3CVQ A;  3L3P A;  3CKC A;  3WI3 A;  2LEH A;  4I9E A;  4PJN A;  4C0M A;  4LRZ A;  5TAO A;  5KJM A;  2VL8 A;  2BVL A;  2CLY C;  4GZ6 A;  3KFW X;  3Q47 B;  1WY6 A;  1UJK A;  3CVN A;  4HOR A;  4UV9 B;  4AKL A;  3BEE A;  4L23 A;  3ETV A;  2J09 A;  4MRU A;  4ASK A;  3IV0 A;  3I3N A;  2LO6 A;  5FZQ A;  3RPU A;  3TXN A;  4GYY A;  2IF4 A;  3N9Q A;  4BJN A;  4KMO A;  2DLR A;  5FQ4 A;  5ARG A;  2WQ7 A;  4HGA A;  4QXB B;  3CSF A;  3FB2 A;  4U63 A;  5HXH A;  4DMW A;  3L54 A;  4AJW A;  5EKQ D;  3BG1 B;  3SGH A;  5L3G B;  3SOL A;  3H3A A;  4GYO A;  3L16 A;  4WBN E;  3KVA A;  4CI1 B;  4GAA A;  1HE8 A;  1D0Z A;  4ZOL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...