2WMOB

Structure of the complex between dock9 and cdc42.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
b'HMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 58
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wmoB00
1CULC 2YZ2A 4TZ6A 3QVVA 5LBIA 2DBYA 4FMDB 1DELA 1X8JA 1KI6A 4LI0A 4EPYA 2XGJA 4TLAA 3TUIC 2F9LA 4P32A 2QSZA 5B2ZA 3I32A 5FR2A 2AX4A 4A15A 4FN5A 2CLDX 1KJYA 4TYWA 5A5GA 2XOKD 1QVAA 5IK2A 5L3RA 4JL8A 4MRPA 3B13B 4M1KA 2VBCA 4CRWB 4CEJB 1F60A 4EJSA 3C41J 2C2HA 1H8HD 3QIAA 2X19A 4Y0AA 2RB4A 2ORVA 3FWYA 3A36A 4RD0A 1L7VC 1E9DA 4G1UC 5JJLA 2IS2A 1TQDA 3UMFA 1AS3A 1HUQA 1IY0A 3MWJA 1YR6A 4Q7LA 4QGFA 5UKDA 1F2TB 2WWIA 3H1TA 1HY3A 3FGNA 3VMFA 2RHDA 2ZRMA 4ZKEA 4D81A 3SQXA 1Q12A 1C9KA 3KJHA 1XTRA 3RRMA 3TKLA 3CM0A 1G5PA 5HCNA 3SYNA 3VR4A 4P4UA 1CBUA 1CJUC 1IBRA 6Q21A 3TUZC 1QBKC 2W0SA 1G3UA 3NIBA 3NHAA 4OQXA 4WBSA 1IN6A 1JAHA 1XP8A 4WZAE 3UIEA 2E9SA 4LBYA 1W1WA 3GPLA 1EFTA 2CMKA 5CDFA 2HT1A 3S1AB 3OIUA 1QHSA 2O52A 3OEED 3TQFA 2VSXA 3U3KA 4Q1AA 2HLDD 4DWJA 1XCPA 2O8DB 4R7ZA 3NTUA 1U8YA 2VLIA 5FR1A 1XXHE 1G291 5L3VA 2Q3FA 4HUQB 2GXQA 2ZI5A 2IA5A 3GJ3A 4RY2A 1BMFA 4D4LA 1TADA 1TQ6A 1SXJE 2WKQA 4Q4HB 3N2EA 2H18A 1XEXA 5TV2A 1SKQA 3QNUA 4IOMA 2QPOA 3D31A 3EZFA 3SHFA 5DIFA 2QM8A 2R2AA 3AP3A 3FKSA 3CZPA 3ZD7A 2JJ2D 2G88A 2F43B 2V7QA 2DCUA 4D80A 4FW9A 3R7WB 4BFVA 1JI0A 1UKZA 5JWHA 3B1ZA 2XTZA 2Z43A 4GRAA 4LJ6A 3WYFA 1F3OA 1KMHA 1Q20A 4HAXA 1FP6A 2OCYC 2W83A 4JKYA 5EZ6B 2GBLA 4PC7A 1GDDA 4Q19A 4CZ2A 2YVUA 1PV4A 3LNCA 1VG1A 1CXZA 4TTRA 2NMVA 1IY2A 2G1KA 4DSTA 3KL4A 1OF1A 3A1TA 3K1JA 4LDJA 4AC9A 2OFXA 1NMXA 1CKEA 2XSZA 3P4YA 3LLMA 3I61A 3A6PC 4Q48A 5FBVB 2FU5C 4AG5A 1GOTA 4NTZA 3MD0A 1N6HA 1G9XA 1E9FA 2IBMA 4A0GA 1KK1A 3B1XA 5EE1A 1F2UA 2VHCA 1R5NA 4FCVA 5C46F 4AI6A 3RSOA 1KY2A 2XNSA 2F3RA 2H8KA 1OIWA 5IK2D 3TR0A 1WBBA 2IC5A 3B9PA 3FYHA 3WP0A 1SZPA 3GFOA 4C7OA 1AQUA 2QM7A 3THWA 4KI0A 4TL7A 121PA 5C4GB 3CONA 3TMKA 4RCZA 4AYTA 3QBTA 3H84A 3GLIA 3ADBA 3GLGA 3AM1A 2B8WA 3E2IA 1T91A 5JWRA 3GLHB 4CEHA 1GRRA 1VYVA 4X8HA 2ZRCA 2AD5A 2RGNA 4B34A 2PZEA 1UKEA 1GZSA 1NJFA 3L0OA 4D4JA 1UAAA 4OI1A 2OLJA 1JNYA 2O0KA 2A9KA 4Q1EA 2GK7A 1NKTA 4I1UA 2P3SA 4XOIA 2OEPA 3VFDA 3AV0B 2P2LA 1QHYA 2P65A 5KOYA 1KYIA 2XTMA 2EQBA 4YMTA 3KTAA 4Q9HA 3IIMA 1Q3HA 4BZQA 4FMCF 2QT1A 1TTTA 2QAGA 5AUNB 4DLUA 2KB0A 2XXAA 4WAUA 5AJYA 3VKHA 1ZINA 2JGNA 1YVDA 2I1VB 5HPYB 3LV8A 4M1SA 1DAMA 2QMEA 4BFXA 4LJ8A 3Q85A 1HT2E 1BMFD 2OCAA 3ZZUA 4XWKA 1UDXA 1G4UR 1HQCA 1TU3A 1XXHB 5KNBA 1E9RA 1Z08A 1XTQA 4PQYA 3R9IA 2CE7A 1OXTA 2ZS9A 4RFVA 2OXRA 1EFRA 2VYFA 4ZIRA 3B1YA 4HLCA 4NDZA 1N6LA 3FKSD 2IWRA 2C04A 3L82B 4GL2A 4G3XA 2V7QD 4PSKA 4EFNA 2QTHA 4PTLA 4PHHA 4QOSA 3WRXC 3W6NA 1IOZA 2IYTA 1YQTA 5KU1A 3PENA 2ZJYA 4P31A 4LJAA 3T15A 1KZ7B 1RRFA 2H7VA 4GPTA 1RRGA 4HAZA 1RJ9A 1E32A 4OK5A 4DBLC 2O8BA 3SFVA 2VF7A 5D3QA 5HR5A 1B0UA 421PA 4WZBE 4YMWA 1E2JA 1QHXA 1QZXA 1SVMA 2V9PA 3IKJA 1TX4B 2YNMA 4D82A 2XSZD 5KDDA 3BFKA 2WWXA 5FPYA 1WQ1R 2YC2C 4UXJA 3EARA 1U94A 4GT1A 2FOLA 1Z83A 2IXFA 2OBNA 1VIAA 4D0LB 2ZTSA 4DRZA 4C0KA 1YR8A 1MO4A 5CK4A 2R6DA 5B64A 1JR6A 2YOGA 3TAHA 1S4QA 3AP2A 3SJAA 1E0SA 1WBDA 4NH0A 1SULA 2C77A 2JDIA 3ZVLA 2AD1A 3GEEA 5FTLA 1DO0A 2P5TB 1COWA 1XMJA 5HCIA 3NKVA 3QVUA 2YKGA 1ZIOA 5FBLB 2WOOA 5FL7A 1HURA 1I4LD 1G20E 4IOKA 5FBWB 5CIQA 2ZVPX 2WBLC 3CX6A 5GJWC 1XB2A 2K5UA 1NIJA 2ZYVX 3BS4A 3IBGA 1UKYA 2GJ8A 2ZI7A 1NY6A 4Y0VA 4M9ZA 5JWOA 4KXFB 4NCJA 2QBYA 2D06A 3T34A 4C4PA 1L4YA 1P60A 5TARA 2OZEA 3RS7A 3KQNA 4TLEA 3QUSA 4JL5A 4O0MA 2F1RA 3I73A 3L0IB 3LX8A 4A8JA 1BS1A 1EFUA 2PZGA 4OHXA 1JR3E 2VP6A 3PXGA 3LWNA 1Z2AA 5JBQA 1DG3A 4C0HA 2R6CA 1BKDR 3FDIA 3BAFA 3LBHA 3CRW1 4GMDA 3REGA 2VP4A 2IF2A 3GEHA 4I81A 3GFTA 3ZH9B 3X2SA 1RIFA 4BEBA 1YZNA 2HT6A 4Q4JA 2GZDA 5ELXA 1XTIA 5J4VA 4HB3A 5EJEA 2D7CA 1M7GA 4KSCA 4ZCMA 3AVXA 4OI0A 2WMNB 2I1QA 1XPUA 1SGWA 1Y63A 3FMFA 3EPJA 3W5IA 3VKWA 3B2EA 3I3SR 5FH9A 4JVMA 2IYUA 5CB8A 1XPRA 1EFRD 4YDSA 2W58A 3EW9A 4R98A 1G17A 1S96A 5K8UA 5AJVB 5KNCA 5B57C 2BJVA 3E1SA 5JJKA 2ZREA 5JHHB 3L2OB 1AK2A 2WVJA 1SHZA 1ZD9A 3NC0C 1Q0UA 1TEXA 2RGXA 3AVVA 1ESNA 1OPXA 3MFYA 4IEIA 4M0LA 5JZVA 3PJRA 2P6NA 2GZAA 5KUTA 4HLUA 1D6JA 2VIIA 4DVGA 1Q1BA 2JLQA 2P5SA 3IQWA 5FOXA 4EPVA 3D6TB 3BK7A 2EFCB 1KK2A 3GJXC 1T5IA 4BZXA 2R9VA 1YZQA 5DO9A 3KZ1E 4URVR 2WAXA 1SQ5A 3A8TA 3WMFA 1N6KA 3PR1A 4U00A 3EPHA 1CP2A 1PLJA 3IO3A 3U44B 1X6VA 3F5FA 2DWPA 4URXR 2ZI4A 1U9IC 3WYAA 5B30A 1HE1C 1VTKA 4C0BA 2ZRKA 1M2OB 1NMYA 4TMKA 2ZRPA 3MGCA 2ZM5A 3ZZ0A 4ZV4A 1I2MA 2C96A 3VHXA 3THOA 2Z6VA 4Q9KA 1R7RA 3KQHA 2JDID 4RJLA 4Q02A 1W4CA 2A5JA 1X1RA 3F3YA 1TPZA 5H8WA 4NONA 1R6BX 1COWD 3RRYA 1NNEA 1US8A 3THYA 3CBQA 4B6FA 4L5BA 1NN0A 4EQ6A 1NY5A 5FL7D 3GQBA 3QF4B 5A4JA 1T6NA 3GLFB 3PEUA 3I8XA 3RC3A 1II0A 3T5DA 3LBNA 2Q3MA 5JI2E 1E9EA 3BH7A 3O8DA 4GP7A 3ZS9A 221PA 2OV2A 4Q18A 5TXGA 4HI0E 1X86B 2CLCX 2ZRNA 1GFIA 1GILA 1ZU4A 3MRSA 1QRAA 2WWWA 3UWOA 4KYIB 2OILA 4CEIA 4LBVA 3W6OA 1XD2A 1NBME 4KVGA 3CR8A 3AVQA 4GZLA 4ZO4A 2CCGA 3U2QA 1OV4A 4TL6A 4B3XA 4QBGB 4HDOB 5FUVA 3QKSB 3SI7A 2BV3A 3WBKA 3VNUA 2J45A 5J4KA 3TR5A 1FQKA 3CNLA 3QOFA 5FOVA 2RGCA 4C2TA 3KDSE 4G01B 3PUZA 4FXPA 1CTQA 3E70C 2RGBA 1CRPA 4H1UA 2J0UA 4JVSB 1CS4C 4ESHA 2IYVA 1FTNA 1MABB 1UPTA 3MMPA 4JLDA 3WXMA 4JLAA 2WMOB 4MDFA 4KFRA 4EJSB 4C0JA 2ZXUA 1WF3A 1E2LA 5L3SA 4IXMA 2A3RA 1T0JB 4PFSA 3P20A 1OJLA 1GKIA 1T8TA 2PBRA 1DARA 3LVRE 4GOXA 4HSEA 1YHNA 1SXJA 4M1YA 1ZNZA 3MSXA 3SOPA 4F4IA 1R5BA 5KNDA 3HR7A 3ADKA 1G64A 4DLRA 5EE9A 3A1VA 4KHZA 5GADl 2OM2A 1VG8A 4MKIA 4DCSA 3LVQE 2C99A 4ZDIA 3RLFA 3THXA 1TMKA 4D0GA 2JATA 1R0YA 3T1VA 1FFHA 3ZVMA 3WP1B 5FBQB 2NQ2C 4B3BA 1IONA 1MO6A 2P0EA 4UNNA 2PEZA 4DLVA 5FPKA 5DYGA 1J8MF 3DMDA 2ZJ5A 5SZJA 1VIYA 3W8RA 1ZNWA 3Q9LA 3KXIA 5FL3A 5C18A 1IN5A 4H1VA 3EIEA 1ZBDA 1JPJA 3EASA 3DKVA 5KSPA 2C03A 2QMHA 2PLRA 1E6CA 3ETLA 4EUNA 2Q21A 2A5DA 3IEVA 4Q00A 4MKHA 3C16C 3RRZA 2YWHA 2N42A 3BRWD 1KO8A 4OJKA 3DM9B 3AKDA 1T0HB 3MJRA 3K70D 2FWRA 2XEXA 5CM9C 1ZC3A 1FOEB 4KJZA 8OHMA 1O3YA 2ZAOA 3DPUA 5HTKA 4PZLA 4MKGA 2OUKA 4H9GA 2QP4A 2AXNA 3PVSA 2IHYA 4M2LA 5FTNA 3SNHA 1KMHB 2HF9A 3GJ5A 2RCNA 2ZYUX 3RS5A 2DWQA 2IEYA 2J9RA 3I4LA 1FTSA 4TQAA 1XTSA 2J87A 5C1BA 1CJTC 2QEQA 4LYAA 1VECA 2ODBA 3FTQA 5HKKA 4P4SB 2ZR7A 3VR6A 2V6JA 3PIRA 3G5UA 3ZS8A 2GWHA 4BE7B 3EX7C 4ZCIA 5HZHA 4NCHA 4NYIQ 1E2HA 4DHEA 4A92A 4CT4B 2WOJA 2QROA 2WIAA 1QG4A 3CNNA 4N1AA 3GJ6A 1KDRA 2ZE5A 3TQCA 5KSYA 4LC1A 3WBJA 1F2UB 4IKEA 3B7GA 1YU9A 3CZQA 3U7EB 4KLNA 1IN8A 4MYUA 4IDPA 1P4SA 3ZQ6A 2R8RA 1K8RA 3TRFA 2RGAA 1OLOA 5LDDC 4KBGA 5L3QA 3QKTA 5TMPA 1XPOA 1OXXK 2B21A 2ZETA 5KHOC 3EZ9A 2WZQA 1CR4A 5FUWA 2WWYA 1MO3A 1XD8A 1I2DA 5BWMA 1HTWA 5FTMA 1AZTA 1GAJA 1QDEA 4Q01A 3AH8A 4R2HA 2B92A 3FMOB 4GP6A 1R8SA 2VSFA 1TF7A 3UKDA 4A0RA 1YZUA 4DDUA 3EZ6A 3THWB 5M04A 3SBEA 2YWFA 1FL9A 1TF2A 3TLXA 2GEVA 4GOJA 4EPWA 4HAUA 3GLGB 4QNRA 1OFUX 1AKYA 2PLFA 1BO6A 3TAUA 4CEHB 1NLFA 2J41A 1SXJD 1QHNA 3DVLA 3MG9A 4OQLA 3HU1A 1M7BA 3EXAA 4B3FX 1J2JA 3AF4A 5DHFA 5EZ5A 2GHIA 2AK2A 4C9BA 4IDQA 2H5EA 1R0ZA 3SS8A 5EP2A 1JJVA 1KNQA 1TF5A 2OG2A 4FWTA 1J70A 3B8HA 5F98A 2GZHA 4DSOA 4Q9LA 2AKAB 4LYFA 1J99A 3PCRB 4ZCLA 1JJ7A 3ZQJA 5DGXA 2JJ2A 3LD9A 4U02A 3NXSA 2IK8A 5EP4A 4GDFA 2BEKA 4BLRA 1IQPA 2KWIA 4A0HA 3QXHA 1C1YA 3I92A 1ETUA 4ARZA 2NG1A 3FMIA 2F55A 5BXQC 2XAUA 1M7HA 4JVLA 4KITB 1J90A 2CXXA 4A2WA 2FGKA 2G0TA 2ZJZA 2OE2A 4JBXA 4HB4A 1ZVQA 4Q4AA 3T61A 2ONKA 4US0R 4WA7A 2MSDB 2VHTA 1Z6XA 2YJTD 2GILA 3DEFA 4A36A 2CCKA 5CITA 3CLVA 3KX2A 2QRZA 3NHBA 3CX8A 3SBDA 1L4UA 1U99A 4X8LA 5F9HA 3MAAC 1G8HA 1XJCA 3EC1A 1NF3A 3RANA 1AKEA 4JLPA 821PA 4B48A 1GP2A 4F93B 4L9WA 5HKKD 2O8BB 4AURA 1TAGA 1XTKA 4PAOA 4QKQA 1BH2A 2RMKA 3FB4A 4HAVA 4FI3C 2YINC 5TY0A 3TH5A 3H4MA 1OH8A 5SZIA 3LBIA 3PEVA 4URUR 4W7SA 1OYYA 5EXTA 1II8A 2JLVA 3K0CC 1JBKA 1OB5A 4WW0A 1KDPA 1P9RA 1GL6A 4F7WA 3SJCA 1EK0A 1NVXQ 4JYBA 4QXAA 3K0AA 3TSZA 1KO7A 3GLHE 2HCJB 1FPMA 1Z0KA 2CJWA 1S3SA 4GOKA 1EWQA 3L43A 1OFTA 2G6BA 2GF0A 3VR3A 3I5XA 3QEJA 1CR0A 2V8OA 4Q1DA 1KZGB 1N5IA 1PZNA 1ZRHA 2GEDA 1GTVA 1GUAA 4J0QA 3KKQA 3DMNA 1W36D 1QHIA 3P27A 1N0UA 3QQ5A 4RFSB 4G5QA 3LXXA 3ADCA 2J59A 4M9QA 3I1FA 1IN4A 2VH5R 4BEJA 2FA9A 1N6OA 2D62A 2EVWX 3K0FB 2OCPA 1HEIA 4B6EA 4D26A 2Q9CA 2VSOA 4UNQA 4DIEA 3VKGA 1FX0B 1W46A 4PC1A 3W9YA 3K9NA 2F1JA 4JLVA 5C2JB 3RC8A 1X3SA 3Q7QA 4LCBA 3TK1A 1X8LA 2P6RA 1MT0A 2BEJA 3AF0A 4D4KA 1QHHB 3B85A 3TVTA 1I4TD 3KJGA 3PQCA 2DY1A 2ZITA 4IVPA 4S35A 1EGAA 1MRNA 2FSIA 2ZROA 4OK3A 2ANCA 5D3MB 2FZ4A 1EX7A 3IPXA 1JEEA 1Q22A 1JECA 2BBWA 4PHTA 3UATA 4BFZA 5CB6A 1P75A 4JMPA 5J4LA 1KOFA 1G18A 3BJIC 4MUAA 4NL4H 3TGPA 1VG0B 4URWR 5DI3B 2XZLA 3LY5A 1YE8A 3WMGA 4XWAA 4FINA 4Q4JB 4AKEA 4Q5IA 2YHSA 4EJSC 3UMRA 4OHWA 4KBFA 2IYLD 1E2EA 4AKIA 3CRMA 4N3NA 3EA0A 3NVAA 4V0ME 3CRQA 2VTKA 4LJ9A 3ZLJA 2ODWA 1G6HA 4LPKA 1VYTA 2WAYA 4BQSA 2MMGA 2ORIA 3OEHD 1KNXA 2XB4A 5K8TA 5F9FA 3WNDA 2O8EB 4KFTA 1ZM7A 3A1WA 1OIXA 2FDCA 4O3MA 2ZRIA 3AKYA 2R62A 1KKMA 2ZJ8A 2FSHA 3ZVRA 1CJMA 5E95A 4MDEA 2QL6A 2HF8A 3ICQB 4RD6A 4FMCB 3T1TA 4OQFA 1YR7A 4CDGA 1Y3AA 2VF8A 2ZI9A 2WV9A 4W9MC 3KFXA 4BLQA 3KXKA 3AP1A 3R8CA 4DT1A 2OO7A 4BPBA 3K9GA 4EKDA 3QG5A 3UG6A 1P2TA 1X8KA 3OESA 4A1FA 1DAIA 1MRSA 3R9XA 3VNVA 1SVOA 5FOWA 4KFUA 2FPLA 4NCKA 5CJ2A 2J0SA 1S1CA 3EG5A 2JLZA 2V54A 2FH5B 4MRVA 3SEAA 1E99A 3BB1A 2CVHA 1UKVY 2OCBA 4RZUA 1WRBA 3I72A 1JR3D 4MKFA 1KDTA 1ZUIA 4MITA 2PZFA 1US8B 2PMKA 1ZCAA 5HZKA 2GVZC 2GBLC 4B3CA 4JLOA 3GJ7A 3R9WA 4CW7A 3VTKA 1MOZA 3BOSA 2QQ0A 1TL7C 3VR1A 2FF7A 3C7KA 4DLTA 5GVSA 4UXHA 4JBWA 1W2HA 3AUYA 1E2PA 2BBTA 2N46A 2LCFA 4QFMA 4NHOA 2PX3A 4LJ5A 2GESA 1P7CA 3JVUA 1CF4A 4C0LA 3NH6A 2WSSA 4RSGA 2ZR0A 1DE0A 4KV9A 3HU3A 5KSZA 1UDWA 3B60A 3HR8A 1U0HC 4I99A 2IXEA 2ZE8A 1FMLA 1M34E 2QQEA 4MYTA 3M1IA 1AGRA 2CNWA 1EX6A 3OAAA 1JXOA 4ILEA 3ZIAA 4B2LA 5AUOB 4PC6A 3RRNA 2H16A 1P62B 1V43A 1FW6A 1JXMA 2W6JA 2IUTA 3SDZA 1XDBA 2GCOA 3PUXA 2FSGA 5CJPA 1R0WA 2AR7A 2WWHA 4GMXA 4MGKR 1N5KA 1G7SA 5CLLA 1YR9A 4YMUA 1UM8A 1YRBA 2GA8A 4PHFA 2C9CA 2V1XA 2KE5A 3UPUA 3AF1A 4AKHA 3WNBA 2QUZA 1VDZA 1AM4D 1XBTA 3GJ4A 2RGNC 5JRJA 1U8AA 2BMEA 3A37A 1XEFA 1E2IA 1KI1A 2ATVA 3W90A 4K46A 4DCTA 3U61B 5AR1A 3KKOA 1Z47A 1HT1E 4LPSA 1A4RA 3MCAA 2A7QA 4DUGD 2E87A 2ZE7A 1I4DD 5IDVA 4X8MA 3QPVA 4IRUB 2ZQ5A 2QAGC 1D9XA 4KYUA 4Z8YA 3U3JA 4EIWA 4XWOA 3QI2A 1E9BA 1OT3A 2ANBA 3THXB 3DZDA 5L8VA 5FOSA 4MYHA 3LA6A 1ONBA 2A5YB 1PUIA 5F3WB 2QORA 3QEOA 4U5XA 3AVWA 2O0HA 4JSYA 2O5VA 3B9QA 3UANA 2ZRJA 2IF0A 2LKDA 3RS4A 4DCUA 3U3OA 1A2KC 4HB0A 4ZKDA 5G40A 5JSZB 1LFDB 1NG9A 3VU9A 1D2MA 1G8YA 4LHXA 5GVRA 1N6RA 2C5LA 2XX3A 4ZDKA 2DFKB 1WA5A 4AYWA 3GLFE 3SHWA 2OT3B 3ZVNA 4NYIR 2VP0A 3CB4A 4A4DA 2ZRDA 2VP5A 3GMTA 1ZMXA 3L0SA 2QENA 1JALA 1XWIA 1NBMD 4CEJA 3CPHA 2BWJA 4Z1MA 3FE2A 3CKLA 2YOFA 1OKKA 4B3DA 5BQ5A 3T35A 5IT5A 4TTQA 2WTUA 2JJ1A 4R2IA 1G7CA 4XTRA 4BRUA 3BFXA 3K09A 1W4RA 2JCSA 4NYJQ 3C5CA 5DN6A 4G5RA 4OBEA 5CLQA 1YRAA 3U6BA 1T8UA 1M1YE 3LDAA 3FHCB 4LJ7A 1QG2A 4I1OA 5AJWA 2QSYA 1P9WA 4AY2A 4KU4A 2Q9AA 4OI4A 5CM8B 2XZOA 2FSFA 2ODNA 4XD7A 1XTJA 1KSHA 1ZNXA 3B6EA 1KSFX 1W0KD 2IXGA 2WSSD 3BB3A 3W6PA 4TYQA 2NZJA 3DDCA 3QF7A 3FHOA 3S1AA 3K8YA 3L0PA 2ZUDA 4LJ4A 3U7FB 3F8TA 2OESA 4US2R 2O8DA 2CNWD 4W5HA 3OAAD 3RYTC 4HUQA 3IQXA 4JLMA 1R0XA 1ELOA 3ZIAD 3QKRA 2GXUA 4NPHA 4XVRA 2ZJ2A 3Q8XB 4POAA 4BFWA 2EFHB 2W6JD 2JEOA 4Q4HA 5BYJA 4DZZA 1E2KA 1LB1B 2PJZA 2QGNA 2UZIR 2DHRA 4O25A 3FOZA 2F1IA 3AGPA 2HXYA 4IDNA 2GETA 1FUUA 2F43A 2DWOA 1UADA 1P9NA 3R7WA 1KI2A 3PEYA 1DAGA 2HYIC 1RPZA 1GKUB 3NBYC 4IFEA 4RD2A 1T3SA 4XSHA 3ICEA 3AKCA 4LC0A 4A8JC 4DLXA 1AGPA 4Q7JB 4D6PA 1TQ4A 4PANA 1F48A 2QA5A 2ZRAA 4JBYA 2O8CB 4PC3A 4HZUB 2WJGA 3VX3A 1XNJA 4E09A 1OH7A 4DKXA 3LH5A 4LJYA 3RABA 1A1VA 3WNCA 3CNOA 1QF9A 4BFTA 2MSEB 3GCGA 4MUBA 2IYYA 2BBSA 5SZKB 4WVFA 4BFUA 1WXQA 1LS1A 4XJXA 5B58C 5IHPA 3DZ8A 3WMEA 4L15A 1AIPA 2QT0A 4PSVA 1E2QA 1E1QA 2AFIE 3B78A 1JQLB 1NN1A 2X2FA 2RGDA 3TSOA 2DFNA 2JA1A 4X8OA 1JAIA 1ZUHA 5CYPA 3ONWA 2EWVA 3IILA 2QMUA 2ZSAA 3H0KA 4Q66C 4UNPA 3FFAA 1W48A 3QJYA 4W5WA 5EXSA 4IDOA 3IHWA 1E79A 2C78A 4Z1MD 2BBOA 2GNOA 1OKKD 3MLEA 2QN6A 3G0HA 1XF9A 2D2EA 3JZAA 5JCZA 1E94E 2JJ1D 3HPQA 4B76A 4A2PA 5KTYA 1GRNA 4HLUC 3UXMA 2EFGA 5DN6D 1Z28A 5BN4A 4OYHA 4V0LA 3GLHA 2L0XA 4DIDA 4CIDA 1KI6B 4BASA 3TNFA 1E0AA 4TYNA 4XD7D 1YZTA 1ZYUA 3CH4B 2D74A 2C8VA 2UKDA 3ZDQA 2FEMA 1RFLA 1A2BA 4BFYA 1Z0JA 2IS6A 2AHOA 4I1VA 2NPFA 4MQBA 2FZLA 4AIIA 2CEAA 2A2ZA 5KO2A 4YDHB 1HE8B 2GXAA 2WKRA 3CR7A 3GLGE 4TL9A 1YZLA 2WICA 4TSFA 1KAGA 2HV8A 3M4YA 1FNNA 3ND9A 2C9YA 3OIVA 1PUJA 1Q57A 4NKRA 3DL0A 3K70C 3A4NA 2B7BA 3R20A 1XXHA 4DEYA 5BYKA 1XCMA 1Z6AA 3LX5A 1DS6A 4L16A 5EE5B 3SJBA 1UEIA 3KB2A 1ANKA 2V3CC 1AJEA 3MWKA 2G77B 4PXAA 2ZS8A 3TSWA 2Z0MA 1G6OA 4WZ6A 3SQWA 3AVPA 2EYUA 2NZ8A 4QHYA 4TYYA 2X2EA 4G5GA 3W5JA 2IYQA 4QBFA 4JT2A 2ZU0C 2ZEJA 3JVVA 2OSBA 4NBSA 1EWRA 3LAWA 4Q1FA 1TUIA 2Y8EA 2VHUA 2FPMA 4V0MA 2PL3A 3M0EA 1FQJA 1L8QA 4B43A 3FHTA 2BMFA 3V00A 5AJZA 3TE6A 1UFQA 4HZIA 1E2GA 3P26A 3AGQA 5ANRB 4IJMA 3NDBB 4UNSA 1IXRC 1CU1A 1U2RA 2VL7A 4EDHA 2V1UA 2HDNB 1DVRA 4RD4A 1GM5A 3OZXA 2VO1A 1P73A 1FUKA 3D7MA 2HXSA 1IXSB 1XEXB 3QENA 1E1RA 2WHXA 5E4FA 1SVLA 4M8NE 3B82A 2ERYA 1D2EA 2F7SA 3LLUA 2QY9A 4GZMA 4R71A 2VEDA 1E1QD 1K5GA 3P1JA 4TYPA 4C0QC 3C14C 3I5YA 2EWWA 2PJRA 5HE9A 4QJ4A 2D2FA 4QHTA 4MA4A 1NG1A 1ZM2A 5AUPB 1PLKA 3W3ZB 1Z63A 1P2VA 5E7MA 1OXSC 2W2VA 1E79D 1Q1QA 3HP1A 1SXJC 1TEVA 2C9OA 5KDOA 1VYUA 3U7HB 3N5CA 2CBZA 2ZJOA 5FOTA 2Z5FA 4UXIA 1P3JA 1NVUQ 1XMIA 1ZAKA 2FEOA 2TMKA 2ZSEA 1ZCBA 1G8GA 1R2QA 3OF5A 3QG1A 1OSNA 5E7JA 3TW8B 1Z29A 5JECA 2RHMA 1KO5A 1CIPA 3N2IA 1Q1ZA 1N2CE 2C95A 4XSGA 3DM5A 1AN0A 4EPRA 1NN3A 3E5HA 2HEIA 2ZE6A 3Q7PA 1OXUA 1W0JA 2W00A 3NH9A 1D9ZA 3IBYA 1W5SA 3AF3A 4NCIA 1XEWY 1KIMA 4URZR 2B8TA 5JRZA 3CF6R 4LUCA 2ZU6A 2VHJA 4DCVA 1N5JA 3BERA 3EIHA 4JJKA 4QNMA 3QSYA 3D3QA 4N0DA 5EP1A 1IM2A 4Q47A 1A82A 3EPLA 2WKPA 1LV7A 2IUUA 4B35A 1TNDA 3EZ2A 5JEDA 4HLDA 4LBWA 2JLRA 2A78A 4LRWA 3X1YA 2NPIA 1UBEA 3BE4A 4EPTA 4TSFD 4C7OB 2GVDC 3CIOA 1EG7A 4QM6A 3U4QA 1NJGA 2BC9A 4Q03A 4WIAA 3ZGXA 4RCYA 1S9HA 3V4FA 2H17A 4WXRA 1ZNYA 2IYZA 4BLPA 3GLIB 3Q5DA 3ZZTA 4QBHA 1OH5A 1N5LA 1WB9A 1CEEA 2IS1A 4Q9JA 1E9SA 2ZRFA 3TIFA 4BLTA 1N25A 2AWOA 3A1SA 3J81k 3SYKA 3QXXA 3O47A 2AN9A 3LFUA 4E07A 2N1BA 3U3MA 2FMXA 2W2XA 3KTAB 4XVQA 3I62A 1NLZA 2RH5A 2VRWA 2YC4C 3WHLA 2FV8A 4ON9A 4C30A 3EA5A 1GKYA 2ZUBA 2DR3A 2QAGB 1R4AA 2ZYWX 3K9HA 2XXAB 1P72A 4LGMA 1NSFA 2OAP1 5FI1B 4P3YA 3CW2A 4KVAA 3QE0A 3U6KA 1XMVA 2CLSA 1Z06A 4HLQB 1DG1G 3RS2A 2MSCB 4JJZA 1YZKA 5BN3A 4OJQA 2BCJQ 4PZZA 5G3YA 2J46A 1K6MA 721PA 3U44A 3FPAA 3A1UA 4URYR 2JLUA 1E1RD 5H70A 4M1OA 3LXRA 4JLKA 1XU4A 2CDNA 2NIPA 4ZIRB 1KSGA 4TMTA 4CT5A 1W36C 3OEHA 4Q7MB 5AJXA 4A82A 5JEEA 2GDJA 2HYDA 1Q21A 4PZYA 5CYOA 2ORWA 3QY0A 1QVRA 4M4SA 4E03A 3UG7A 3SE0A 2GJKA 4DDVA 2EFEB 5EXXA 2VA8A 1E0JA 3IUYA 3UK6A 2PEYA 1NVVQ 1G3QA 1OHHA 4JS0A 1GWNA 2QU8A 2NOAA 5J5CA 1GITA 3QF4A 4FCTA 4PPQA 2P6UA 1DADA 1RJ9B 2OBLA 3L8ZA 5G41A 4Q7KA 1H8EA 2ZUCA 1S9DA 5EUQB 3SFZA 5JLJA 2W0MA 5AK0A 3T06B 2GKSA 3NDPA 2CL6X 3AVTA 4ZDWA 3L8YA 4OKSA 5FBRB 1QHGA 3SZRA 1W0JD 1WE2A 4NYJR 4JLJA 4US1R 2PCJA 3W34A 4XTCS 1E2MA 2Q9BA 1OFIA 3IDQA 1OB2A 1N0VC 4D2IA 3KQKA 1NL3A 5FUXA 4V0KA 1VMAA 1HQYE 2OFOA 2QTFA 4KAXA 2BHRA 2ZVQX 3DO6A 4IVRA 4D4MA 1S8FA 3QKSA 3A58B 4TMXA 3CWZA 1ZW6A 3VU9B 3MJHA 4WXPA 4PPGA 1N3BA 1SVSA 1JR3A 1WDTA 2G9NA 3AVYA 3UWKA 3GEIA 4EAQA 1E9AA 1GG2A 1VCNA 4LZZA 2W6IA 1GVNB 3PEWA 2IX3A 1IJEA 2F9MA 3RSLA 1E3MA 2CL0X 5DSZA 1MABA 4OHVA 2BMDA 2ODEA 4LV6A 2HJGA 1G16A 2V55B 1E2DA 2FE4A 1SVIA 1LS6A 1M6NA 1IN7A 1D2NA 4Q9IA 1P2UA 1B23P 2AKYA 2Z83A 2CVFA 2D3WA 2ZSFA 4JLBA 3NBFA 4RD1A 1HV8A 1MKYA 2VP2A 4F92B 2F3TA 4HDQB 2IHBA 1W7AA 1DAHA 4UQOA 4LBZA 4LK2A 2ATXA 1EESA 4IDHA 4A8JB 4Z54A 4C0SA 3CX7A 1KGDA 2QPTA 4M21A 3TW4A 1XX6A 4PO9A 2Q6TA 2R65A 4DEXA 1ZUNB 1E98A 3IIJA 1FZQA 2NO6A 4FD2A 4NU0A 2BDTA 4FMDF 5CK5A 1UBFA 1Q1EA 1PVOA 3P32A 5KDLA 1NRJB 1KI3A 2Q3HA 4Z51A 3TVDA 1XMSA 3GP8A 2G83A 4IEEA 4KSBA 1DTSA 2ZRLA 3PUWA 1BYUA 4IW3B 1F5NA 4JYCA 5J40A 3BXZA 3KKMA 2BIFA 2CCJA 1DAEA 3QKRB 1E96A 4LX0A 1X1SA 2X77A 1CLUA 1G1MA 4NP6A 2YV5A 4XVUA 3RHFA 1AZSC 2BCGY 2CL7X 2J7PA 2JASA 2E1RA 5G3ZA 4NMMA 3P4XA 4QC2A 4DUGA 4QJ5A 2ZPTX 3MUFA 3KQLA 2WJYA 1T4GA 2CHGA 2ZIAA 1OHHD 2ECKA 3QXSA 2I3BA 2J1LA 2FFAA 3PITA 4B2IA 1Z22A 4F4CA 2GJAA 3HWSA 3VX4A 3H2YA 1XCGB 4IXNA 2Z4SA 4ACAA 1OE0A 1H8ED 2IYXA 3VAAA 3EWSA 4A6XA 3C8UA 3G82C 4LOAA 2EW1A 3C4JA 4P4SA 4A0FA 1R8QA 4YQFA 2A30A 4KCGA 1KSJA 4E22A 3SU8A 2XJ9A 3OIYA 1DBSA 1HH4A 4V0NA 5LB4A 5TB5A 1HYQA 3DOFA 3OIWA 4ABYA 3ZYCA 4EFMA 3TUJC 5AUQA 4G5OA 1ESMA 4PX9A 4B44A 1RW4A 1JQJC 4PO8A 1NBMA 2IYSA 4UJ3A 4XH9B 2J5XA 1TQ2A 1WMSA 1KO1A 2J3EA 2QG6A 4HEJA 4TMVA 4LSGA 4I1SA 4UJ5A 2BOVA 1KKLA 1G19A 1RRCA 1W47A 3RWMB 3K70B 4B33A 3THYB 1NKSA 1OIVA 2W6ID 2B6HA 4PQFA 3OFNA 2AFHE 4NYMQ 4TLDA 4TL8A 4EQ6B 4W5JA 1RVDA 2G0NA 2IYRA 5GJCA 2GXSA 2UVQA 4Q1BA 4BLOA 1J8YF 1C4OA 3KKNA 4DCNA 3AB3A 3NEJA 2QI9C 4WOPA 3VHLB 4V0OA 4ASUA 3O8RA 2O8FA 1S1MA 2XB2A 3CPJB 2IW3A 3QPWA 3FMPB 1NIPA 3TBKA 2O0JA 1MR3F 1W0KA 2H92A 1E4VA 2XZPA 4IOJA 4CEIB 4P33A 2FX3A 2OXCA 1XD2B 4ZPXA 2NTYC 1BOFA 1UEJA 2GEUA 3U5ZB 5JS7A 2FFBA 1T5LA 4F38A 4C3ZA 3B1WA 2GK6A 4GI7A 3BH6A 1OFHA 1JPNA 4FWIB 5EXPA 1U98A 2P67A 4AKGA 1D5CA 4DLYA 3NWJA 3CRVA 3JZMA 5AWFC 2YWGA 1U81A 4HATA 5EQTA 4FCWA 3OHMA 4Z8XA 1S2MA 3CUEF 1VG9B 2WWFA 2J0UB 2V6IA 4LV8B 4AG6A 3HDTA 1T3LA 3LQQA 4ESVA 1P2SA 4I4LA 2PH1A 4TWZA 2QZ4A 5HE8A 4S2EA 2ONJA 5K8LA 2OFWA 4FMBB 5L3SB 1N6NA 1LVGA 2BJWA 2BVNA 3RAPR 4RVCA 4MRRA 3SC3A 2ZSBA 2FGJA 1G3MA 4DLSA 4L4UA 4MH0R 2J7PD 1BIFA 1KI7A 1SXJB 4C2UA 1VKJA 4OQMA 4TZ0A 5EE0A 4MGIR 3T5GA 2FG5A 3SN6A 3KJIA 1ZU5A 2D4HA 4GFDA 1RRPA 4ERNA 2J7KA 3HYRA 521PA 1A5TA 1Z3IX 2NO9A 2NO7A 1SHKA 1W4AA 5EE3A 4OHYA 3SJZA 1LW7A 2KBFA 1G21E 4EFLA 1N0WA 3F0TA 3X1ZA 4DLZA 4LV5B 4N0EA 4OQNA 4B47A 5KSOA 2OBMA 3AVUA 4M1WA 3HU2A 2WJJA 2ZYTX 2QAJA 2YYZA 4NZYA 4O2LA 4R9UC 4YMSA 1T3HA 2QGZA 3KUCA 5LD2B 1IY1A 3KB1A 4ZDJA 4OI2A 1Z0FA 4HDCA 1DEKA 1E0KA 1DAFA 5KPJA 5LB2A 2R6FA 4YMVA 1VCMA 4TQUS 4CYMA 5DE3A 1E2NA 3O8CA 1ZJ6A 5SZHB 2IUSA 2BM0A 5G53C 4B73A 4M1TA 3EWAA 3OFND 4P0TA 4XIGS 1E9CA 3DHWC 1F2TA 3U7GA 3WY9A 1Z6TA 2HUPA 1K5DA 4YONB 4NE2A 4DSNA 1E4YA 2X8AA 2YWEA 1BYIA 1GSIA 3X1DA 5BW8A 2ZAMA 1MV5A 1VCOA 2EFDB 1XJ0A 3GJ0A 4M53A 4ASUD 4RFSA 1G5RA 3ASYA 3WHKA 2CK3A 3MWYW 3C5HA 4QM7A 1YKSA 3K0FA 1U90A 3MWLA 5FOUA 5K8IA 2QP3A 4BFSA 3PV0A 1FX0A 4D25A 1NP6A 4JL6A 3Q3JB 1Z07A 2IWHA 5FPTA 1EFHA 1G3RA 1YZGA 1CJKC 2R6GA 3BC1A 5BN5A 2OLKA 3LW8A 1KMQA 1Q44A 1QHHA 1LF5A 3BIFA 4KLZA 2Z4RA 5D3MA 1DOAA 4G0NA 2PMDA 3HYTA 4PR0A 2FFQA 4DSUA 5FFMA 5L3QB 2QTVB 2IYWA 3IHLA 1PJRA 3RS3A 1U9IA 2FN4A 4JIMA 5DI3A 3QPUA 1IJFA 2PT7A 1HA3A 2WJVA 1SKYE 1OW3B 1RE0A 1NVWQ 2WJIA 1N6PA 3IGFA 2GCNA 3BB4A 4K81B 4ACBA 2XNDA 4A9AA 1KI9A 2RAPA 1XZQA 1W36B 3IPYA 2XTNA 4PPNA 1E2FA 1YJ5A 4MYCA 4OHZA 3U4QB 5CDFE 2BM1A 1IAQA 1IHUA 2LKCA 1Z8FA 3K09C 2H57A 2J0VA 5DLQC 1G3IA 5FTJA 4B75A 2QMOA 1RYFA 4CVNA 1XD9A 1UF9A 2BMJA 1DAKA 1S0UA 4AD8A 3R8FA 5JHGB 2OHFA 4JVNA 5IRCD 1KAOA 2EYQA 3DOEA 2O8EA 3DKPA 3IEUA 3RWOA 3GD7A 5P21A 3ASZA 5IF9A 2FJUA 3UMSA 5JFGA 2JLSA 1NVVR 4JLNA 2QE7A 5KYKA 3B1VA 2MMCA 2HCBA 4UKDA 4EPXA 3FFBA 1A7JA 4LHVA 1H65A 2QNRA 3EZ7A 3BWDD 4MGZR 4RZXA 3BGWA 4YLGA 1II9A 3V9PA 1ODFA 2AWNA 2OAQ1 3PUYA 4P4TA 4B32A 5J4YA 4DB2A 3EPKA 4LYJA 4Q1CA 4ARZB 3RS0A 1Z0DA 1P61B 1G7TA 1ZP6A 1OXVA 2UZ3A 4AYXA 2IS4A 2ZANA 2GJSA 2RKOA 1SVKA 2WSMA 1NLYA 1WCV1 4HYYA 1GL9B 3T1OA 4K8OA 2J0QA 4AWXA 4Q4AB 4DC9A 3AF2A 4M1MA 4O2RA 4TTPA 4G5SA 1W4BA 1R5OA 1RYHA 3GFPA 4CGZA 1KK0A 5C4MA 1G8PA 4QJ3A 2CHQA 1G41A 2RGGA 1GIAA 1Z6YA 1FMJA 1M74A 1VPLA 1KY3A 2ZS7A 2ZRGA 1AA9A 4CF7A 4M22A 1M8PA 1RKBA 2B7CA 2CK3D 2VPPA 2JLYA 4TMZA 4C0AC 1KJZA 2JAQA 1CJVC 4RKFA 2A5GA 5LPNA 3SYLA 4PC2A 4DDTA 2W2TA 4YXWA 1RZ3A 3IIKA 3A4LA 1FNMA 4BGDA 1VHTA 1F6BA 5JMTA 4B71A 5H68A 4LHWA 3QKUA 3B5JA 3VR2A 4PQRA 4LHZA 1II8B 4KO8A 2DFLA 3NC1C 1AS0A 3GLIE 4PPFA 1ZM9A 2AK3A 3O8BA 3BH0A 3RDPA 3K0AB 2GRJA 4F91B 4YC7A 1P5ZB 2SHKA 2CJWB 4AK9A 1NSTA 1G4AE 2GJ9A 4GBMA 2A5FA 2F6RA 1AS2A 3VQTA 3T12A 4BLSA 2EU8A 1NN5A 3KXLA 2ZSDA 2FFHA 2CE2X 2HJVA 1TU4A 1CR1A 4MGYR 1G8FA 2H1LA 2XNDD 1JEDA 2IT1A 5E7IA 2IEZA 1KJWA 1NMZA 1GNRA 4V02A 3K53A 1MO5A 1SKYB 2RGEA 2X1VA 5DISB 3AUXA 1UBGA 3Q5EA 4Q4LA 4DXAA 5DI9A 1GNQA 2WPDA 3X1WA 2REXB 2WM9B 4DLWA 3SR0A 5KPDA 3BFVA 1VCIA 2WIBA 5JJIA 1N6IA 3X1XA 2KSQA 2ZJBA 1T9HA 5J4HA 4BZPA 1KHTA 2AXPA 4QRHA 3KFVA 2ZRBA 1ZM3A 3W3AA 4TT3A 5H1YA 4BWYA 3T1QA 1LY1A 1G7RA 4D0NA 1XJQA 2JLXA 4QL3A 2GCPA 2NO1A 2KJQA 2IL1A 2I4IA 4JSTA 4DDWA 1CR2A 2ASEA 5A0FA 2QE7D 2JIZA 4TN1A 4KODA 5FUYA 2F1HA 4JZKA 1LNZA 1CRQA 2KBEA 3N70A 4IFBA 3GJ8A 3H86A 2NO0A 2REBA 1DO2A 4PAQA 5JSZA 2ZJAA 4PHGA 1MH1A 1U8ZA 1LF0A 3NG1A 3RVBA 3FVQA 2QRNA 2VQSA 4HUTA 4PAMA 4Q21A 3ADDA 1FP7A 2FNAA 2PCLA 3BD9A 1S3GA 3WRYC 2WWGA 3KQUA 4QGGA 4FIDA 1OH6A 4GNKA 5FTKA 4DJTA 4JT4A 4MRNA 4MRSA 3EAQA 3OE7A 5FPHA 5GJVC 3A4MA 4UNRA 4ZI2A 1W5TA 3K9LA 4F4JA 1UBCA 5TDHA 4B3GA 4ZI3A 2DPXA 4JKIA 4B74A 1GNPA 3D8BA 1W49A 2GAAA 4RZ2A 4IHQA 2DYKA 2YOHA 4RKEA 2XITA 4NYMR 4TLBA 1XFAA 4ITRC 1ZIPA 2QBYB 1XZPA 4M9XA 5TVKA 2ERXA 1Z0AA 3PUVA 4L9SA 5CIWA 1KI8A 3V4RA 1Q3TA 2GAOA 4L8GA 5JI3E 1D8TA 3LQRA 4QBIA 3U3RA 4YXWD 4LY6A 4DT1B 2DFTA 1KI4A 5LD2C 2Q0HA 3U60B 2GF9A 3LO5A 3KUDA 1L2TA 1U0LA 2XOKA 4PSAA 2DB3A 3C15C 4V03A 1RC8A 1KTVA 2QP9X 3VR5A 3CWQA 5GJBA 1AQYA 3AVOA 4BECA 3NBXX 1IXZA 5FI0B 1XRJA 1ZD1A 3LW7A 1ZM4A 2BKEA 2C98A 1P6XA 1H8HA 3BORA 5J47A 1E69A 2NGRA 2JLWA 4QHSA 3PFIA 3BBPA 2R44A 4HB2A 4RD3A 1NI3A 4U7DA 4M9SA 3QXCA 1W2GA 1Z5ZA 4BRWA 2D7DA 2PX0A 1W44A 1G5TA 1LTQA 4LWZA 4OL0A 3IO5A 2VHQA 1EFCA 2ZI6A 1DPFA 1Z2CA 2O8FB 3KKPA 4QGHA 3EC2A 4RZ3A 2QPAA 2CHVA 3M6AA 4LYHA 2WPDD 4KFSA 4BUJA 2G3YA 1ZC4A 2G1JA 5DYIA 5EUMA 1ZD8A 2VP9A 1U0JA 1KO4A 2FPKA 3EIQA 3OEEA 2ZI3A 1V5WA 4TT3D 4LHYA 3NBZC 3WYGA 2HLDA 3CPEA 1J7KA 4E5UA 2O8CA 2PT5A 5DHAA 5FPSA 1KK3A 2R6AA 2WJHA 5DNYB 4HZUA 4IOLA 3I8SA 3AEZA 2KI5A 4A6PA 4HAWA 2XJ4A 1SVWA 2JIZD 3QXJA 2ZRHA 1Z0IA 4IVQA 3ZJYA 1GL7A 3PG5A 2GCOB 1XEWX 3NEYA 3K0CA 3REFA 3TJZA 3HJNA 2V4ZA 4OK6A 1OYWA 2ZR9A 4HAYA 3W8NA 3ZD6A 3HPRA 5JCPA 3CF2A 1PLLA 4A2QA 1KDOA 2JJ8A 3CH5A 3QBVA 2GTPA 621PA 5DH9A 4NCNA 3AKEA 4PO1A 4DB4A 4TLCA 1WP9A 3K0EA 1O87A 1TUEA 1JB1A 2BKUA 3AQ4A 5F2EA 4QG7A 1VHLA 4GSYA 3RNLA 5E3HA 3GLFA 3CO5A 4QGAA 1EXMA 3OE7D 2LWIA 3ECCA 3FKQA 2AL7A 3KJEA 2REOA 5JS8A 3K0SA 3LRPA 3ND8A 4B2PA 4II7A 1UJ2A 5EP3A 1GRQA 3CRRA 3CF0A 3Q72A 1Z6GA 4TQ9A 4TMWA 1R10A
chains in the Genus database with same CATH superfamily
1QKKA 1PL8A 2YZ2A 1U1DA 1WF6A 1MJFA 4E1BA 3V8NA 2DBYA 3AEYA 1QIDA 1QAMA 2PV0A 1KI6A 3EUEA 4EPYA 4OFXA 4DYDA 2A58A 2F3PA 4TLAA 2JD1A 5A4KA 5EESA 4YIHA 4H1WA 2VPYA 1Q15A 4IIUA 3NC4A 5FR2A 2AX4A 2CLDX 1VKHA 2C2OA 1K92A 1KJYA 3ZWOA 1IXYA 4TYWA 4HEQA 5A5GA 1RXWA 4FFOA 5EQDA 1QVAA 4YMHA 5D6OA 2HMYB 2OD2A 4C1BA 1TW2A 4JL8A 5TQ2A 3B13B 4CIYA 4CRWB 2PS1A 2ORED 3ABOB 5JZ9A 1JQAA 2P2CA 3C41J 1ACJA 1N1EA 5MGBA 1OASA 3LT1A 2VUHB 1IC6A 2ORVA 2RB4A 2EKBA 4MUIA 3A36A 1MJGA 3EDRA 4F72A 4ZCRA 4WNAA 1L7VC 1B6GA 2RKBA 3D3WA 1P45A 2M2IA 1EX9A 1LBSA 1HUQA 4NBKA 4P7BA 4Q7LA 4JWTA 3BL5A 2WWIA 3FRJA 3H1TA 2FRXA 2PKWA 1HY3A 4Q4CA 1NUHA 3KXPA 7REQB 2BSQA 1WW2A 2ZRMA 4D81A 3RRMA 3TKLA 3E9ZA 1CBUA 1G8SA 4WVLA 3TUZC 3RVJA 4QOIA 5ARBA 3NHAA 1E66A 2L42A 3H3XA 3TLKA 3UIEA 3GYBA 3QY9A 1AZLA 2Y1KA 4Z9BA 4R0NA 3OIUA 2O52A 4MW7A 2QVZX 1TK2A 4KDFA 2O7RA 4Q1AA 4FB5A 4XUCA 5AOCA 2OD7A 3NNNA 3W1EA 4TTJA 4P35A 3KQTA 4PG4A 3E5MA 5DW0A 2B3DA 4ZT3A 3JQ9C 4FKBA 1YR1A 2E6KA 5L3VA 2R79A 2Q3FA 4HUQB 2GK3A 2GXQA 2ZI5A 4UU0A 1SRRA 1V6SA 4R51A 3CF4G 3WLFA 4A8TA 4HDSA 3ZWMA 1TADA 2Z6QA 4E21A 3MJVA 4B6RA 3UH0A 2WKQA 3KEGA 5DK6A 5CD9A 2H18A 3WLOA 5A2GA 4YNBA 4N0PA 5D1HA 3UKOA 3BZBA 2QPOA 1NQOA 3C6XA 4WADA 5IDYA 2QRJA 2Q50A 3GLSA 4JT8A 3SHFA 4BP8A 1B3RA 3ZD7A 3MZ0A 4F96A 3ZDCA 2GRUA 3P94A 4GYYA 1ZL0A 3QE4A 4FW9A 2AFIA 5JWHA 3WYFA 3IJ5A 4B6GA 1DCTA 2DPLA 1Q20A 3M83A 3ORFA 5EKXA 4L28A 1Y7PA 4ZZ2A 3HG7A 3QNMA 4G56A 4P2BA 1UBKS 5AYVA 5KQMA 3TJMA 1Y6FA 1DHTA 1MB2A 2QL5A 1JKJA 4L08A 4UD2A 5D5QA 4CZ2A 5AFSA 5IYZF 3LNCA 1E63A 3TW8A 2NMVA 1CYEA 2W2NA 2NXWA 3R44A 3A1TA 2X4LA 2D0OB 3EVAA 2OFXA 5F1YA 1ULAA 1B23P 3CG0A 4IQFA 1AF7A 3NGLA 3I61A 1ZXBA 3TQSA 5CCEA 2Q1TA 1JTVA 1GZ4A 4GVLA 1FP4B 3B3FA 4YP9A 4H4EA 4AG5A 2VTDA 4ND2A 2PUWA 5AT1A 1N6HA 2Y0BA 3I2KA 2Q5CA 5DB4A 1TXGA 2VYNA 4MW9A 2O2HA 4O33A 4RF4A 2JRLA 3H05A 3ORQA 3GJSA 3P97A 4EUKA 1H4QA 3DFIA 4UBOA 1LFAA 4H3HB 4M0KA 1K4MA 2H8KA 4DRXA 1QG6A 4YJGA 1P9LA 1E18A 1BEZA 1WBBA 3B9PA 4TVKA 1RJEA 3FYHA 2H1WA 1A76A 2AUMA 3L18A 3LDHA 1P3DA 3I1IA 2DY0A 4WCDA 1I3OA 1KAHA 1TM1E 1PDWA 2I80A 4PQGA 1JMVA 4HVCA 3THWA 4BN0A 1W25A 1M72A 121PA 1XYGA 4X71A 3EDYA 2VDWA 1T5DX 1M83A 1TDJA 3R0XA 1MJGM 4JENA 5F2KA 3GLIA 1V25A 5B2EA 3E2IA 1OD6A 1T91A 4GMHA 5C8VA 3PL1A 4MEJA 2RGNA 4WECA 4PR3A 5F12A 2PZEA 3MJSA 1NJFA 1UCFA 5I7WA 1K97A 3ZCRA 5IUKC 1S01A 3CEJA 5HIAA 1X7WA 1JNYA 1OX6A 4HNVA 2O0KA 5JZMA 2BFFA 4RENA 5IKMA 1NKTA 3LS2A 1NUQA 4KV7A 4NOLA 4YVFA 2P2LA 2IXDA 2P65A 2OA0A 1KYIA 5A9RA 2EQBA 4AT1A 4WNIA 4YMTA 4F2WA 5KOYA 3WMRA 2M6KA 4PX2A 2MSKA 3VO8A 2VOJA 3FETA 5IBPA 5CNIA 3LP6A 3QHQA 2DF8A 3CMMA 2I4TA 3B36A 2GZMA 2ZTHA 4WAUA 1OXMA 3BGVA 3ZHRA 3QOYA 1ZINA 2BFDB 1VBFA 4K2HA 1YOVA 1GPLA 1RYDA 2FPPB 4JQSA 1SUBA 1DAMA 2QMEA 1ECBA 3UICA 4W9NC 3Q85A 1HT2E 2OCAA 4N8EA 2B4RO 4UC0A 4EKYA 3ZI4A 1HGXA 2XT6A 1C9EA 4XWKA 4NZNA 1OLXB 1SBTA 1U7WA 2PRZA 2W2LD 3BEDA 1XXHB 4YREA 5KNBA 1E9RA 1JFLA 1Y9ZA 2ZJ7A 4PQYA 1E8NA 2N1MA 5I9LA 3TAXA 3UJBA 3U5TA 5TPZD 1OXTA 4W63A 4EARA 2O07A 5MDHA 3BMXA 1KEEA 2YHUA 5JC8A 3JQ8A 1N6LA 4NDZA 4UHBA 5LU9A 1P4AA 3TSYA 1FVFA 4F06A 4ZYVA 4P80A 4GL2A 1KARA 4KWIA 1GN9A 2V7QD 3UN1A 3WZMA 4KR0A 2W9XA 3V6LA 3HBMA 4F2GA 4PHHA 3OD1A 3HR4A 1TYBE 3R7BA 5EYPA 4AO7A 4EYGA 2SNIE 3FCOA 4MV4A 3UV7A 1WS6A 1YQTA 4HG2A 3U7QB 4P36A 1QYDA 4EA8A 3NTOA 3EQ6A 4NJEA 3LBFA 2VTVA 3C70A 1JQEA 4GPTA 4PYKA 5EMKA 2I7CA 3FPSA 1S6YA 2WHQA 1RJ9A 1E32A 3V4OA 4DBLC 4NIMA 2O8BA 1PGOA 3COWA 4AP5A 1OAAA 1V45E 1N9GA 2UYYA 2Q3EA 1TA9A 1RI1A 3HFJA 1TX4B 2YNMA 4OB6A 2FMFA 1J7JA 4IYRA 4KQKA 3ZLVA 5KDDA 3FNHA 1BDHA 5FPYA 1P5RA 3DZIA 2HF2A 3EARA 4JJFA 1ZGCA 2FPWA 3FCCA 4L0CA 4RMHA 4KTTE 4XQGA 1KDVA 3PX7A 5B7PA 3T4EA 3P2KA 4ZOLB 1DKNA 2GSDA 4M9UA 2OBNA 2R7AA 2VT6A 1VIAA 2PWBA 3SIPA 4EKGA 1RAFA 1YR8A 4IIJA 1X15A 1MO4A 1PR9A 3D5TA 3N6VA 4AS3A 2YOGA 2HO5A 2A33A 2RHJA 2II6A 3TAHA 3R5HA 3GPIA 1U9CA 2RBKA 1G1AA 3HKBB 4NH0A 2X3YA 2C7VA 3T7IA 2GS9A 3OICA 2DHCA 4MB2A 4GPBA 3RG8A 4ER7A 3P19A 3MT0A 1L5FA 4PZ0A 3SF8B 3UJHA 4DTIA 2PUBA 1GG5A 2YUTA 4XW2A 5EKTA 2HA0A 3RVRA 3RUHA 3VU3A 4JP1A 1NXOA 1BXGA 1COWA 4TTTS 4X92A 1G63A 3ILSA 3QVUA 4MDYA 1Y6ZA 5HCIA 1KBZA 4CKEA 4POOA 1W4ZA 5IAOA 1HURA 2XRYA 4WY2A 2XCRB 1G20E 1FJGB 2HFJA 1L8LA 2NU8B 1M5TA 1U8CB 2WBLC 3CX6A 1XB2A 3IAUA 1O89A 1FVXA 1NIJA 1U63A 2NU7A 1EK2A 2JCGA 1WJGA 3ZHCA 3IBGA 1UKYA 2CL5A 2ZI7A 3DL4A 3FR7A 4H4CA 2PBLA 3FTCA 4Y0VA 4LISA 5LNK6 1DC8A 2CVQA 3KBOA 5JWOA 4I55A 4KXFB 4HDKA 1YK1A 2R5FA 4C4PA 1XGKA 2OV4A 2H59A 3CUVA 3FDZB 2OZEA 2PU7A 2UYGA 3OX3A 4KBYA 4TLEA 3SXPA 3UFXB 1DQNA 2GYVA 4HNTA 3RO7A 5D87A 4Z9FA 3GGDA 4G9GA 4O0MA 4XASA 1UXJA 1HKHA 1ZSYA 2G07A 3L0IB 2B8JA 4H7HA 1VSTA 2C0PA 1BS1A 4A8JA 3NS7A 4CCYB 1JR3E 1V2HE 1H4SA 5CXSA 3RC2A 4W5NA 1GGNA 2C2WA 3LWNA 1Z2AA 4ER0A 4CKWA 5IZCA 2HHAA 2JIRA 1BKDR 2WD8A 3BAFA 3FLEA 3F4BA 3LBHA 1GEGA 3OLWA 3M3DA 3GEHA 3QVGB 1M2NA 2QV0A 3OU2A 4JK3A 4TVBA 2IBSA 3NM4A 3I6ZA 1RIFA 1WXDA 2BEWB 1Q1NA 2TMDA 4ALIA 1JDTA 2HT6A 3AJDA 4Z4HA 4RKWA 1WU7A 2GFHA 5BW4A 5LP1A 2EERA 2JLBA 1M7GA 4KLRA 1Y63A 2C8LA 5H9VA 4XXHA 5IN4A 4GMGA 1D5WA 5A1JA 5JD4A 3CUKA 4ZEOA 1YIAA 2D1SA 2V6FA 3B2EA 3D59A 4XFDA 4L8YA 4Y8VA 2EEPA 3AUTA 4JVMA 4ER6A 1O08A 3GNSA 4TSKA 1EFRD 1C7ZA 2X8WA 4R98A 1A95A 5KYUA 4O2AB 3ZUGA 1WQ4A 1JHZA 1R4MA 1S96A 5AJVB 5KJEA 3E1SA 4F2DA 1YH3A 1KQOA 4A73A 1PG2A 3UV6A 1JGTA 3RUIA 3PCXA 1Q0UA 3LM8A 3O0DA 4PYLA 2Z08A 3COYA 5BSWA 1X7ZB 4DPKA 2O4UX 5JZVA 1PRYA 2OBYA 2O2IA 3X1KA 1NT4A 5K05A 2IV2X 3LOUA 2FLVA 1WMEA 3GFQA 1JBEA 4HMPA 2A88A 5FA5A 4DVGA 5AMXA 2QU7A 1T6BY 2FPXA 2O20A 2RDMA 3CH6A 3PA6A 3QFTA 5ERYA 4UOEA 5A4AA 1NHGA 1GD1O 2EFCB 4QAJA 1KK2A 1E2UA 4MQMA 4O4JB 3GJXC 4U5QA 3C39A 4X62B 1IBMB 1UMBB 4PXYA 1V8OA 1YTLA 1BVYF 5G0WA 3A8TA 3WMFA 3L0YA 2PLWA 1CP2A 2IUEA 3AHEA 4M3NA 4W7IA 3CX3A 2VCEA 1MOSA 3ZWWA 4OV6B 3V7FA 3WYAA 4B4UA 1XZJA 1C2YA 5B30A 4DMMA 2Y1XA 3OUUA 1ESZA 1X13A 1NMYA 2FR8A 2ZRPA 1RYNA 4BKMA 3WGIA 2C96A 3LXUX 4MJLA 2RH8A 3FPEA 3THOA 2KHZA 2I3AA 4ZJPA 2P2SA 1OX4A 4I1RA 1K89A 1R7RA 4RJLA 2IHUA 2CGEA 2F8LA 2J3LA 4UPEA 1W4CA 2A5JA 4IV8A 1X1RA 1MEOA 4O2AF 4P9NA 1TPZA 2BGNA 4M60A 4NONA 5H8WA 3OPMA 1JEYA 4MTCA 2QR2A 3BSWA 1NPTO 3CLRD 5TGZA 4WXHA 5U1PA 1MW9X 2DQ4A 5EAIA 2WUWE 3GQBA 5FL7D 3DJYA 3V9AA 5H4GA 2R8PA 4DAEA 4HS9A 1F8UA 3PEUA 3HBNA 1II0A 2Q3MA 1E9EA 3S2IA 3BH7A 221PA 1O5TA 3FWZA 4JAVC 2VWQA 4LRXA 4X54A 1X86B 2ZRNA 3H3FA 3PNSA 4P58A 4GKJB 1SCNE 1QQ7A 3EF1A 5H3LA 3TKYA 1N2XA 2ZR8A 1WXIA 2PMBA 1NBME 4WZZA 2CSXA 1BCRB 2JAHA 2PKCA 3L6RA 1GLVA 1NNSA 3LF2A 4TLLB 4ZO4A 5B37A 1KP2A 1QOPB 3ZJ4A 4PBRA 5HZMA 1J5EB 2PLAA 4M0FA 4RPGA 1V3TA 1Z73A 4FI3F 4ZQEA 1Z88A 2BMVA 1DIGA 2XZTA 1UWKA 5FUVA 1DV2A 2Y0EA 3PQ4A 3WBKA 2J45A 1JPUA 3V4PB 4X6YA 3CZMA 2PX5A 5FOVA 4C2TA 1KQPA 3V2UA 1C29B 3I39X 3OHSX 4KJXA 4EGFA 3JZFA 4QTYA 3VC2A 3KAPA 4RTKA 1I30A 4HMQA 2J8ZA 5LL6P 4JVSB 2B36A 1RHUA 5TSDA 4ESHA 2Z5LA 1XQ9A 1OU4A 1FTNA 1MABB 1JMYA 3V2HA 3V3KA 1NZJA 5KJFA 1G0NA 4KQXA 4JLDA 1C8VB 4RETA 5BSVA 3TB4A 4YRTA 1MRZA 4Z7OB 2ZXUA 4FE3A 4YFVA 5L3SA 4IRXA 1SURA 4IXMA 1CF2O 1NTRA 2ZBVA 3EXEB 5E1MA 5JH7A 3W2FA 1YWGO 2AC4A 1ZGBA 2YMMA 3U3XA 4AJ9A 3ZEIA 5D6NA 2QUBA 1RWVA 1ZN7A 2ZYHA 1T8TA 2XGGA 1EE2A 3B38A 2FHSA 1LX6A 1REQA 4LA4A 4GOXA 4QDUA 1X7HA 3UPTA 2AZXA 3FD8A 1ISFA 2H3EA 4HSEA 4E33A 4MA0A 1SXJA 4IH9A 4M1YA 1UT5A 1ADBA 1YI8A 2A5LA 4CMEA 3VZQA 2F3QA 5FQNA 4ZN6A 2G5CA 4BRZA 1JDUA 3TDNA 1FDWA 2FRDA 1B8OA 2OM2A 3KPWA 4MKIA 4QASA 3LVQE 3O8QB 3NUZA 4ZDIA 1IH8A 2OVBA 1TMKA 3M49A 4N5DA 2JATA 4YJ3A 4B9AA 5JV5A 2I6UA 5I7FA 2WHYA 4YB8A 5ITWA 1X1QA 1E4OA 1XA4A 3GOQA 4H6PA 2P0EA 4KR9A 2JKVA 5DJ5A 4LOJA 3VNAA 4EITA 1J8MF 3DMDA 1KZYC 5HMMA 1IRIA 5ITVA 1UDRA 2FMKA 2G72A 2ZJ5A 3QTBA 3LCVB 2W98A 2FRVA 3W8RA 2OGSA 3C43A 3Q9LA 3ZD8A 5FL3A 5LZ2A 1K0FA 3JQGA 3OZDA 5BNFA 3QEAZ 3EIEA 1JDNA 4YFYA 4MUYA 1W4LA 3TRKA 1F2VA 4ZZ0A 1HMYA 2C03A 2QMHA 1CQIA 1E6CA 2BONA 3ETLA 3TBFA 2BKVA 1PKEA 2A5DA 3H1BA 4MYDA 3SC2A 3DXYA 3IEVA 3C7AA 4Q00A 1ONPA 3RRZA 2W43A 3ITEA 3V97A 4E5KA 2XCLA 5ECDA 2Q4RA 4OJKA 5JDCC 2V7UA 3DM9B 1YL7A 3D3KA 5LWHA 1JR4A 1SBIA 2FWRA 2YJ5A 3BGIA 2XEXA 1P17A 3RM3A 1FOEB 2DECA 2IOYA 3DUFA 5AM1A 2OTCA 8OHMA 3VYWA 1NUAA 2ZAOA 3DPUA 1AQLA 1ZK3A 2JI8A 5FTNA 5IWAB 1W76A 4BNKA 4EHIA 4M0DA 3PXAA 3RS5A 1G5FA 1W29A 2GI4A 2HU2A 1KVRA 2IEYA 3ABRB 1DC6A 5K3EA 3VJKA 5JFOA 4HGRA 3DO5A 4NG4A 3S4YA 1CEXA 2Y1CA 3FTQA 4FFLA 5HKKA 1MC1A 4AZSA 3DFFA 2ZR7A 3AR5A 4FEEA 3K30A 1C0KA 3H2HA 4G1CA 2Z30A 2GN2A 2QV7A 3EX7C 4KW7A 4RNCA 1OLSA 2PX8A 2WOJA 1D3AA 2QROA 3A2KA 3CVJA 1QG4A 4UTNA 4N1AA 3GJ6A 5BV1A 3ZTWA 1VBKA 1KDRA 4C14A 1U9ZA 2ZE5A 3TQCA 3QE2A 3PUKA 2NZ2A 4RC9A 1U2PA 1PK8A 1Y8QA 1IAVA 2IZ0A 3B7GA 4IX9A 4DKJA 3MA0A 3CLSD 1BXKA 1P4SA 4G5YA 1K8RA 1SC4A 3GHHA 1OLOA 4UDNA 4KBGA 2FZ5A 5F3RA 4ZYUA 1O95A 2QT9A 3JQPA 4M8SA 1YSCA 3RW9A 2W48A 3EZ9A 1ECLA 1UAGA 2Y1GA 5TGTA 4WE3A 5B4VA 2WWYA 1VKOA 2ZYDA 2EJCA 3IEPA 4XB2A 4L95C 4Q01A 5ICSA 5JD6A 3QYAA 3LECA 4L5AA 2B92A 5EZYB 1LNSA 2VUUA 2YVKA 1OI7A 2Z58A 4UCXA 3UKDA 1PW7A 3C85A 1ZKMA 1ZSNA 2PXAA 2I54A 3EZ6A 1Q0LA 2YWFA 5TRTA 5K9ZA 1OI2A 1TGYA 1NAIA 4RZIA 5DV9A 5BSGA 4AZ3A 2FW1A 3H11A 2BEUA 2GEVA 3B20A 1DP4A 4OJYA 1AKYA 1H2HA 2BFMA 2GN8A 1PV2A 4HDMB 4B87A 1AY0A 5JMOA 4NG5A 3WWPA 2EBWA 1VXRA 2DSNA 2J9FA 3DVLA 3CW9A 3MG9A 5AIAA 1NR5A 3PS9A 4YHBA 5KNDD 5C9ZA 4K87A 3KZKA 3T7TA 1V26A 4RPKA 5E7QA 4B3FX 3PSHA 5EZ5A 4D3XA 1P29A 4RKRA 5DYYA 4GZ3A 1TCAA 3F6EX 5JS1A 2IVFA 4C9BA 1R0ZA 3JPYA 4QPJC 1UFOA 1Z2NX 4ALKA 2VDUE 5A7GA 1TF5A 2OG2A 4A0QA 1Z5UA 2BI7A 1R4NB 1FFWA 2ODAA 3FGZA 1DC5A 1IK6A 3PCRB 4ZCLA 2D7JA 5AD1A 1PFWA 3LL7A 1ZMTA 5DGXA 1WB4A 3IAAA 4Y7CA 2FPSA 3NXSA 3E58A 2QTBA 4JB2A 4BLRA 1IQPA 5ULLA 4DDMA 4A0HA 2AR0A 3GOHA 3WJAA 3QXHA 4KUHA 4HOYA 3I92A 4DADA 3M6VA 1V4NA 1ISMA 1J23A 2Z9BA 3FGOA 1KZ9A 1F1BA 1D6SA 5BXQC 3CH7A 4YUXA 1H05A 2AQHA 3FFTA 2EKPA 5E0KB 1J90A 5DNDA 1FSZA 4DQXA 4HN2A 4G5FA 4HB4A 1YR3A 3LUAA 4Q4AA 4BGVA 3C3WA 2PPVA 4QO8A 3EFBA 4OO3A 2IQ5A 2FMTA 1M76A 2G82A 1Z6XA 4D79A 1UPXA 1I3LA 3VGPA 4QTXA 3ORSA 4QYSA 1LGYA 1KBOA 4A36A 1MIHA 1Y1PA 1SVUA 3RR2A 1PNOA 3OT5A 3AHJA 8MHTA 3CLVA 3WGGA 3NHBA 3VC7A 2W8BA 3CX8A 2AOTB 4X8LA 3SBDA 3VNQA 3W5UA 4D42A 3JPWA 4LN1A 1XJCA 3NIGB 3D64A 3BVPA 3F90A 3ZE6A 3PF9A 4GYKA 3FWNA 821PA 4MIEA 4WDQA 2AMYA 4YH1A 3T1HB 1A3CA 4QKQA 3BZWA 5H5JA 3CN9A 2GPBA 1KTIA 2YINC 5E6UB 4C4AA 1L4NA 1DSSG 2QTRA 1EZ1A 3F8SA 4XQCA 1QF6A 1RP1A 2GLXA 1ABFA 1ITZA 3C8MA 4GG1A 4YWJA 4RTJA 5E9WA 4DQVA 3QW4B 4RQUA 1EWKA 4DA0A 2ZTMA 3OC0A 1P9RA 2OZKA 2QYSA 4QELA 1HEUA 4G0XA 3SJCA 1NVXQ 2EP7A 4OKIA 2G6TA 3EQ9A 4Y2VA 1O0BA 3K0AA 3PQ8A 4N7BA 3TSZA 3LPLA 3OPQA 4W5QA 4I2VA 1U6IA 1FJXA 4Y1RB 5LLDA 2C61A 4Q12A 4CXMA 1ID8A 2ID8A 3K8QA 3L43A 4P82A 2GF0A 3OZ7A 1CR0A 3OA0A 4AF7A 3TJRA 4TVOA 1LD3A 1N5IA 5JR3A 1PZNA 4HXYA 4KWEA 5FP0A 5D8DA 3H13A 3INYA 4J0QA 3IEXA 3TNYA 1B6RA 2PGOA 5C7IO 4OH7A 1P4GA 1RHRA 2IV7A 3LG2A 2YHIB 3T5MA 1QHIA 4I9UA 4KL8S 4QU9A 4RFSB 4G5QA 1I7PA 2J59A 4M9QA 2GLTA 3IHKA 2FG6C 1IN4A 3A0UA 3U4AA 2VH5R 2FA9A 1HZJA 2P2DA 3ET5A 3QPCA 4B6EA 2ISQA 2PD6A 4PRYA 5K0TA 3MHPA 3LO8A 1P8JA 1QIEA 4DIEA 1CUEA 1PJCA 1FX0B 3IAFA 4PC1A 3VKGA 3K9NA 2C5SA 1Y7TA 2F1JA 4FUQA 3UC5A 3RC8A 3QTLA 4FNOA 3TK1A 1MV8A 1MT0A 3WFZA 3OCXA 3P52A 4EYEA 2IH4A 4FFBB 2WRZA 3JYHA 2XXBA 1VBMA 2ZGVA 3KJGA 1BMQA 3Q1LA 2ZITA 4KXYA 4LRQA 3RC9A 4B1FA 3FSGA 1LDBA 2FSIA 1BFUA 4RQBA 5EZQA 5JAOA 3H9JA 4KXNA 4L72A 2VRCA 4GPEA 4JI8B 2BBWA 4MVJF 3UATA 3UJ3X 3H1FA 2IKSA 2XQFA 3DW1X 2VH1A 4JMPA 4TXNA 2PNFA 1G18A 4EDFA 1NBIA 3BMNB 4MUAA 3ZY6A 3PXDA 4KIJA 3CUTA 3TPFA 1FRZA 1LJ8A 2AKEA 4ZT7A 1CQXA 2X2OA 1MJ5A 1RQPA 2DRIA 1OAOA 3EDQA 3X2FA 5EQJB 1XQWA 3UMRA 4MARA 4BNNA 4KBFA 1GYPA 2IYLD 5EWMB 1VE1A 2MR6A 2ZVJA 5FKJA 3HXOA 1VQ1A 1ETHA 3CRMA 3TPCA 4AO6A 4N3NA 4ZVTA 2Z09A 3OJWA 3NVAA 2QQGA 3C1OA 3RV3A 3BRCA 1LQUA 3RUPA 4GQIA 3CRQA 2J5RA 3RAJA 2VTKA 4LJ9A 4U6QA 3WC4A 3WXBA 3EMKA 3LF1A 4HADA 1VYTA 1QIGA 4DV1B 4I50B 4G4SP 4J2TA 4B6JA 1NW4A 5F35A 1FFXB 1BDIA 1FDTA 5IDXA 4FT2A 4MINA 5F9FA 3RHZA 3OFSA 4GM4A 2P0AA 5KIAA 1OFGA 4TXLA 2GT1A 2H07A 2WJPA 3IMKA 3PXEA 3UUWA 1H9AA 2Z9CA 1PR0A 4ER3A 3AKYA 4R8VA 3UHJA 3MJDA 4I8XA 3GVXA 5LCXA 3W06A 4G4JA 2ONZA 3ZE8A 4CTNA 1N8NA 4GSKA 3DOHA 3T7DA 4NLLA 4CQLA 4MDEA 4FBMA 3ICQB 2IUYA 2QLLA 3VNBA 5FAKA 1SQGA 3UT0A 1G6KA 1YAJA 1E3WA 4HEA1 5B7QA 2ATCA 2ZI9A 3HCDA 3KG2A 3T3PB 2H1OA 4TT8A 4QREA 2WV9A 2GD6A 5SY6A 3KXKA 2K2WA 4DR4B 4BPBA 3K8ZA 4IEFB 2X9LA 3K9GA 4OB7A 3CVVA 4JMLA 4FOLA 1CIVA 1CY4A 1GARA 2Q5FA 3TLAA 2BGRA 2CJYA 3LQYA 3OESA 3VNVA 1MRSA 5KOJA 1A9PA 4RIIA 5FOWA 1MTZA 3PHLA 2AEJA 4RPJA 2JF0A 4M46A 4F6LA 1WDWB 1WNFA 2JLZA 2FH5B 3SEAA 3HADA 1RTTA 3BB1A 1QH9A 2CVHA 2IHZA 3AHDA 4RZUA 3VR3D 4LQDA 4XIIA 3SE7A 1JR3D 1QB8A 4I50F 4MITA 2JAOA 2CEKA 2PZFA 2NVUA 1Z15A 2PMKA 2HX1A 4WOKA 2O23A 2HSDA 3SZLA 4EUSA 2IFTA 1KS2A 2Y0PA 1GUYA 3NKFA 4B3CA 3VTKA 1H93A 3BT7A 1MOZA 3BOSA 2L19A 4P3OA 3IB6A 4ZCSA 3C7KA 1CQWA 3N75A 4MVJH 2HJHA 2ALJA 5GVSA 1J8FA 4AJJA 2XF8A 2LCFA 3B1JA 4UHJA 4X1IA 2JH8A 4BQEA 1SQ6A 2JVIA 1DV1A 3HTXA 3NH6A 4ZD6A 3O03A 4KDEA 1CRWG 3GUZA 2MTBA 1BVUA 4MJ7A 5FLYA 4HNRA 3ED1A 4KUGA 1GPYA 3PNQA 1UDWA 4MWZA 4RWEA 5EIAA 3K2IA 1U0HC 4JI2B 2IXEA 3PNYA 3VDMA 4QE3A 2ZE8A 1LV8A 3K72B 4AY4A 1AGRA 4FQ5A 3KWLA 5IJAA 1EX6A 1VKZA 3GGCA 2FFRA 2ZRQA 2H1RA 3JAKA 3MCVA 3DTVD 5B3AA 4UCFA 2J67A 3I9LA 1GVHA 1P62B 4XVCA 3A9CA 3SJ7A 1U0NA 1V5FA 2HMSA 2PL5A 1E5XA 4PWYA 1GZDA 3J81A 1TC1A 2AR7A 2V7WA 2WJ3A 3F6YA 4W6QA 3C3CA 4GMXA 4JWKA 4LSMA 4LZOA 1G7SA 5CLLA 4YMUA 2R66A 1UM8A 2AVNA 4PHFA 1TT5A 3KSRA 3UPUA 1V9SA 1J0EA 5KTOA 3SC4A 2FPOA 5HS4A 2QUZA 5T4BA 2RGNC 3A37A 3JXEA 4R5HA 4DNPA 4CF4A 1E2IA 3VUFA 1QGOA 5LQRA 1Z13A 3JQEA 1X1DA 2ATVA 1PVVA 5CNKA 1FYEA 3L7YA 3P5SA 2QRVB 4JBHA 4DPLA 3MWFA 4F1WA 5AR1A 2HA7A 2WJZB 5LYYA 1TUBB 3TKAA 4GPZA 1E1YA 1Z47A 1HT1E 3FNEA 2FXVA 2COKA 1NF9A 2JGMA 3DEAA 1Y3IA 5FNVB 3PTZA 4DUGD 1Q16A 4MQLA 2G25A 3A1FA 3K71B 2IY9A 3KKLA 4Z0PA 4WACA 1Y9DA 2F9FA 4XWOA 2XNHA 1FYXA 3QI2A 3EXIA 4LC9A 3B51X 1TZBA 1O58A 4MYHA 1ONBA 1W9MA 2QQFA 1ORTA 2CMGA 2JGIA 2G7MC 4U5XA 1EJ0A 4C6SA 2O5VA 3B9QA 3ESRA 2V6MA 4KQ9A 3RS4A 1AKMA 1F1JA 4ZKDA 3RT9A 1KETA 1I13A 2EDCA 1U0FA 2FF5A 3VU9A 1GTJ1 3WWEA 4LHXA 5GVRA 1U1GA 1UOOA 5EJ8A 1CJBA 1FDSA 4RVUA 2HMAA 5B58T 1YJXA 2BFAA 1MXHA 5KTRA 3GJTA 1E3QA 2VP0A 3QM1A 1TD9A 1QSGA 1KU6A 3L5KA 4R1UA 3RLIA 1XWIA 1E5VA 2JFOA 1NBMD 5CCXA 4ZYWA 4CEJA 4Z1MA 2AE1A 4F3YA 1U5BA 2FUNB 3K2EA 1N36B 2SCUA 2B25A 2YOFA 1KORA 2IH5A 4B3DA 2VS1A 1Y81A 3T35A 5IT5A 2X7XA 4INOA 2FCRA 3R9KA 4V1CI 1XHLA 2ZYSA 4D9KA 3DB1A 1SCUB 4XTRA 5BUSA 3BFXA 3K09A 4IS2A 4PLFA 4BP3A 3ICCA 3T7JA 4G5RA 4R31A 1GGKA 5FNVF 4FSXA 2WYHA 4RLSA 1YRAA 3LZDA 3LDAA 5AKEA 3U6BA 4BFLA 4J90A 1UC5B 3I2JA 2F62A 3LE8A 2OWDA 1P9WA 3BMQA 1ZOOA 2CHFA 4OI4A 5LKRA 4K6HA 2QUAA 1H0HA 2YNMC 2YYAA 4EG7A 1Z8HA 2DPYA 3OT1B 1BE6A 4C07A 4KMMA 4DLNA 1VLHA 4B3RB 4TUYF 3WDKA 3W5DA 3THSA 1QVWA 3BB3A 3X43A 3W6PA 5CVEA 2JBAA 3HN2A 3QF7A 1SXHA 3K8YA 4GKAA 1RBQA 5BR4A 4O2BA 3BFJA 1S2IA 4V0SA 3IAS6 2QVXX 2OESA 4US2R 2O8DA 3C6MA 3VYUB 6YASA 2HGSA 5D7NA 3OO0A 3UM9A 3AVTA 1P6UA 4JLMA 4B7XA 1R0XA 4ETNA 1ELOA 2AVDA 2GXUA 2XF2A 4NPHA 4KE8A 4MUJA 4XVRA 1BGVA 4S1NA 5G02A 1E2KA 4OXQA 2GN1A 4RACA 1QGZA 1KRWA 4U7WA 2BZ0A 4LGYA 5AW7A 1YRWA 2AA3A 1PSWA 2GN9A 3QX8A 5BMVA 2FPUA 3AGPA 3I5AA 4QYXA 3TFOA 4LE0A 1I6WA 2GETA 2F43A 2WTNA 1KYTA 4Y2JA 1V1RB 4BO6A 4C7KA 2CN1A 4S1PA 3T5DA 2QXUA 3JD2A 5DM0A 3UO8B 4YV1A 4NABA 4ZMRA 2GAFA 2FX5A 4UFOA 3PEYA 2XE6A 1RPZA 2IYOA 3C74A 4QDZA 4QOFA 5A0VA 1HZZA 4OTZA 1HE3A 4XSHA 1T0IA 3AKCA 4A8JC 4D92A 2O05A 1T1RA 3JVDA 3W05A 1J8DA 1TJ5A 3A6ZA 4PANA 5JXGA 4JBYA 2RJOA 2HU5A 3FZNA 4J0EA 4PN3A 3D6UA 2EGGA 4BO4A 5IZCC 4YUYA 1XNJA 1KOLA 2PQ2A 1FVOA 3T9DA 4EVIA 3LH5A 3RABA 4Z4FA 1W85B 5JO0A 5FUBA 2VK2A 3WNCA 1A1VA 3ONNA 5EJ9A 3E81A 3JVIA 3QLVA 3W4KA 1HE4A 1L5HB 4M37A 4MUBA 1BE8A 3NTXA 5KHAA 1KFKB 1WXQA 1LS1A 4XJXA 1EWYA 3TL3A 1YBAA 2R84A 3I58A 3ILXA 4L15A 3SVZA 3TD2A 2QT0A 3SHOA 1WVIA 1NN1A 2IDMA 5BWNA 8ATCA 1Z2DA 4CMAA 4EBBA 1RHMA 1C1XA 4LF5B 2DFNA 2JA1A 4ID3A 1JAIA 5CYPA 3OTQA 5FO1A 5IJWA 1QYIA 2GN0A 3GVCA 4FEYA 1AB6A 1M3SA 1VCHA 3BWCA 1GSHA 3PXBA 3Q0TA 1NHWA 3QJYA 4DNXA 4IF4A 4G2NA 5KEIA 2I8CA 1C7RA 5BP7A 3MWDA 1LRKA 5AJHA 4BXOB 1F17A 2Q2QA 2BM9A 1WM1A 1E79A 2ZK7A 2PU5A 3MWEB 1MB3A 3TL2A 3GFRA 2VDMB 3NOVA 4DLAA 1IBCA 4QJIA 1XF9A 4BEVA 1KWKA 1E94E 3WLRA 4QX6A 4R2WA 5LMUB 3Q4GA 4LTMA 4A27A 3VOSA 1GRNA 2Q2NA 5DN6D 1BMDA 3JD0A 5BN4A 5E9QA 4X6LA 5IP5A 1P33A 3GLHA 4EHAA 3CX4A 5C7YA 2L0XA 1Y33E 2D1YA 3I2GA 3UK7A 3R74A 5KWVA 2ZIXA 1HNZB 1V3VA 3OCYA 3KKZA 3BHNA 4J4HA 3TNFA 1JDBC 2WKSA 1Q7RA 1L1EA 2ET6A 1DCMA 3BF8A 3GGGA 2DBQA 4FLEA 1M1YB 4NS4A 3CH4B 4BWGA 2QD5A 4RESA 3KKKA 5IJ0A 2G80A 2JBWA 1DBIA 3ZDQA 1O9BA 2FEMA 5CPBA 4BCBA 4DLPA 3BICA 4EUEA 3K1TA 4Z53A 3O1IC 4COOA 1Z0JA 5I7UA 2IS6A 2AHOA 4I1VA 5U4XA 2FR8C 2WFMA 3CNEA 3EXG2 5AKXA 4AIIA 5KO2A 4DGSA 1UK7A 3KB8A 2IY8A 3OZUA 3WSVA 1HE8B 4TKLA 2GXAA 1DKOA 2AFVA 5IDQA 2OV6A 5K4HA 4TL9A 4MS1A 2WICA 5I9MA 2HV8A 2VLBA 3ND9A 1JZTA 3WDSA 1PUJA 1YJBA 4TX1A 3H8SA 3DV0B 2GBCA 5AHWA 5KS2A 1K3FA 4EI9A 3LOQA 1GPNA 4RIFA 2PGXA 2ZBFA 2Z1NA 4EJFA 4N7JA 4RO0A 3VSAA 2HSZA 1H6DA 4AG3A 1JJAA 1IM5A 3KB2A 1ANKA 5HM6A 1JJBA 2BP7A 2XGMA 1C3OA 4YV7A 2CYCA 3ZDXB 2G77B 1UPBA 2OHIA 3IRVA 2ZS8A 3KAJA 4KGVA 5AM0A 2JFNA 2Z0MA 2C1EA 4J0KA 1G6OA 3ZTYA 3FLBA 2NYVA 3KAKA 1DQSA 4MQEB 3H1EA 3LFHA 3AVPA 3L8GA 1ZK0A 4LRTB 2NZ8A 4FFDA 3NMUF 2X2EA 3TWOA 1JT9A 3LUJA 3DLCA 1I24A 3JVVA 4Q1FA 3LAWA 2Y8EA 4HWGA 1FQJA 1N77A 1CS0B 3GQVA 5LBTA 2YQ4A 3FHTA 5AJZA 5CG2A 1UFQA 1N1DA 3EYWA 5D84A 2UZ4A 2YBDA 4RTQA 3AGQA 5ANRB 1GCOA 1MB4A 2XI4A 3AZOA 5EHGA 4DQKA 1K9SA 3F9IA 3O0TA 4KXWA 1NRWA 3L8MA 4RD4A 4L5YA 3PQ5A 3OZXA 2VO1A 4I4IA 2RHTA 4S05A 3KEOA 3OM8A 4TOIA 1EI9A 2WHXA 1SVLA 1CF9A 4FFVA 4IHJA 1N8KA 3W9BA 3LLUA 3CB2A 1EIZA 1NJ2A 1WHTA