2WMOB

Structure of the complex between dock9 and cdc42.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
HMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
total genus 58
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wmoB00
2RMKA 5KU1A 3D8BA 3HWSA 4Q02A 4DXAA 1VCIA 4IKEA 3L0OA 2QP9X 2CVHA 3EPKA 4D0NA 4ITRC 1E4VA 5C4GB 1E6CA 3B8HA 1RYHA 3RVBA 5CDFA 4JL5A 3L0IB 4BWYA 5KO2A 4Q1FA 3MD0A 1W7AA 2NOAA 1CS4C 2H5EA 4QM7A 1I4TD 1TAGA 3UXMA 5JWRA 2IW3A 3EZFA 2J0VA 5FPKA 3K8YA 5L3VA 2RAPA 2W2TA 1Q1BA 1OJLA 1P9RA 1RJ9A 1XU4A 4B73A 1IN5A 1GWNA 2VO1A 1W5TA 4OI0A 3GLHA 5EQTA 3REFA 1E2GA 1ZD8A 1ZINA 1DBSA 1XTJA 2QAGB 2WJYA 4KI0A 4DSOA 4JVLA 4L8GA 3C16C 4YXWD 2BKEA 1L4UA 5KDLA 4JLPA 4BE7B 4IXNA 3TIFA 2YOHA 3T5GA 1W0JA 3HR8A 3U3OA 3TLXA 4B47A 1XNJA 1N5JA 4Q9LA 2IYRA 3FMFA 4HLDA 4AC9A 2GVZC 2QY9A 1ANKA 2KBFA 4LHYA 1J99A 4KSBA 1RW4A 4BRWA 2VQSA 4IOKA 4KBFA 3TK1A 2V3CC 2R6DA 2ZSAA 4W5JA 721PA 4E09A 4II7A 4LJAA 2ZRGA 2OZEA 2BM1A 4E07A 5JI2E 4RD1A 2QMOA 3U5ZB 1II0A 1GP2A 4EIWA 5FFMA 1XZQA 4PPFA 3GLGB 2PZFA 1UM8A 3BH0A 3DO6A 1QHYA 2C03A 4EPVA 3KQNA 1OB2A 1TUIA 5DGXA 521PA 4IW3B 2XAUA 1OYYA 3B1YA 3NKVA 2V6JA 3FKSA 4GBMA 1G3RA 4U00A 5FPSA 3RS2A 2E87A 3BOSA 5AUPB 2IL1A 4JT4A 3FHOA 5AJVB 1R0WA 2QGZA 1SVLA 4MKHA 1T0HB 4TYNA 4LV5B 1QDEA 5EJEA 2BBWA 2BBSA 3QXCA 1DG1G 3GJXC 4D2IA 1OFTA 2EFGA 3AEZA 2ZR7A 3MJHA 2ZRKA 4DSNA 4CT5A 4HAVA 4I4LA 4PZYA 1YZTA 1W36D 4IDQA 4XOIA 4P33A 4D4KA 3C7KA 3IQWA 2DFNA 4KFTA 2F3TA 2XSZA 3R7WB 2W0SA 1WA5A 2ZRDA 4EQ6B 1Q44A 5C46F 4QBHA 3A58B 1MRNA 4HAZA 3KJGA 1XTKA 4AIIA 1ZD9A 3PV0A 1US8B 5P21A 4CEHB 3QXXA 4Q1EA 1Z29A 4C0HA 1W4CA 1AQUA 3DZDA 1ZU4A 2HF8A 1NRJB 5CJPA 2DFLA 5AR1A 2X19A 1ZUIA 1GUAA 3EA0A 3EZ9A 4LJYA 1XEXB 4BFSA 5L3QA 3TW8B 1J8YF 4GOKA 1OKKA 1RKBA 3K70D 1NLYA 2REXB 1NVVQ 2QAGA 3PIRA 4HZUB 1QHHB 3QOFA 2R6CA 2JJ1A 3A1WA 1CR0A 1JPJA 1Z63A 2OM2A 4AYTA 1EGAA 1Z83A 1CR2A 1G8HA 4TMTA 4CF7A 2WAYA 1P62B 3PVSA 1JECA 2EYQA 3OIWA 5EE1A 4JYCA 1WXQA 3IPYA 1TEXA 2O52A 1ZM4A 4M22A 4PX9A 4YMTA 2ZRLA 2IWHA 2ZPTX 4ZI2A 1Z2AA 3KKPA 3MJRA 4PO1A 4ZCIA 2PCJA 3FHTA 2VLIA 2GXSA 4QGAA 2OE2A 5TMPA 3GJ6A 1Q57A 4PC3A 2FFAA 4UXHA 2BCJQ 1EFCA 2GEVA 6Q21A 2A7QA 1E79A 3UWKA 2XJ4A 3QG1A 1FX0B 2DB3A 4XVUA 3TRFA 1E98A 2R2AA 1F5NA 3AGQA 1KNXA 4C0KA 1HQCA 1EX7A 2MMGA 2ODWA 1JPNA 3CM0A 1CXZA 5CYOA 5F2EA 5AUOB 3NHBA 1CR4A 2GDJA 2ANBA 5EP1A 4DLXA 4GFDA 1AS2A 2QE7A 2V6IA 3ZDQA 4HUQB 3PXGA 1XPUA 1T8UA 3AUYA 2WIBA 4EJSB 1XXHB 2FGKA 1OXTA 3QKUA 1D9XA 4TMVA 3ASZA 2V55B 4A0FA 5EP3A 5IF9A 4AI6A 3A1SA 4R9UC 1OH8A 5L3RA 3F0TA 3AB3A 3T1VA 1GNRA 4JLVA 1QHSA 3THXB 4RCZA 3SN6A 4D4JA 5KOYA 3ECCA 4LV8B 5JRZA 2HXSA 2EFEB 3T06B 4EPRA 1ZD1A 2P6NA 4FMCB 5DYIA 4XWKA 1ODFA 3QF7A 3U6BA 3UMFA 2DPXA 3FPAA 2UVQA 2ZJAA 4AKEA 1ZNZA 3A1UA 1NL3A 4UNPA 1OIWA 5JHGB 1GKYA 3I32A 2ZU0C 2AHOA 2D7CA 1MT0A 1EFUA 4Z8YA 3EWAA 3MCAA 3PQCA 1KDRA 2IYYA 1NN0A 1SQ5A 4QBGB 1AKYA 4TQ9A 3B7GA 5HCIA 3VR2A 3WYFA 1NSFA 5FTLA 1FP7A 2BHRA 2DYKA 4DLYA 1FP6A 3W6OA 1AN0A 4NU0A 4HLQB 3OIYA 2ATXA 2YVUA 2H16A 4V0LA 1KI2A 1U8YA 1COWA 3KL4A 4A15A 2HDNB 1E69A 2CMKA 2X8AA 3AQ4A 4DKXA 3HR7A 1F48A 4LOAA 2B8TA 4HAXA 4A8JC 2ZYWX 3IO5A 4IDPA 1FW6A 4OKSA 3TGPA 4PAMA 4LYJA 4TTPA 1A5TA 3Q5DA 1S1CA 3NC0C 3GLFA 3DPUA 1XD9A 4GPTA 1KAOA 1W0KA 4G5SA 3KTAA 2E9SA 5FL3A 2VHCA 1MH1A 1P75A 3B60A 3HU2A 2A3RA 2F1RA 2R6AA 4EAQA 2NO6A 4A4DA 3GD7A 3W8RA 4Q7LA 2QPAA 1WBDA 1E2DA 4MRSA 5KDDA 1II9A 2Q3FA 5CB8A 3IEUA 1GL9B 3B13B 3KB1A 3LO5A 3U3MA 1S0UA 4ABYA 1W36B 2ZAOA 2FX3A 1OFUX 4AYWA 2IS2A 4PSVA 1G8FA 1QHXA 4US0R 1KI8A 2RGDA 2GBLC 2ZSBA 4Q01A 3TQCA 2HUPA 3L8ZA 4URYR 3THWB 3MWYW 3B1XA 2XB2A 2CHVA 2FDCA 1XMSA 1G16A 4QGHA 1CJUC 2FGJA 4F38A 3RRZA 2MSDB 4FMBB 121PA 1CRPA 3ZIAA 3VQTA 1IY2A 2VP0A 4GI7A 1CP2A 3QENA 4QGGA 3CUEF 3FFAA 3GMTA 3I73A 4FMDB 1OH7A 2C9OA 1Z0FA 4C4PA 5KSYA 3GLFE 1KSFX 2CDNA 1MABB 2FU5C 3QXJA 4TL6A 4V0OA 4DSUA 1C4OA 3S1AB 2CLDX 4JLMA 2OCPA 3B82A 2G0TA 4LJ5A 1JB1A 2F9MA 3L82B 3ZJYA 1N6OA 1U9IA 4NCJA 1NI3A 5FTJA 1P72A 2FPLA 4OJKA 1BKDR 1OXVA 1VIYA 1AK2A 4Z8XA 1WQ1R 1QBKC 4XJXA 2ZRJA 4WZBE 1VPLA 3K0FB 1OT3A 1XMJA 2HCJB 1NN1A 3SBEA 4F7WA 3BWDD 2W83A 2QM7A 1S3SA 4K81B 1EX6A 1I2MA 4CEIB 4Q4HB 3ZVRA 5HKKA 2YWFA 3BORA 4YMSA 2PX3A 3AKEA 4UNQA 2HJGA 4CRWB 4NPHA 2BJVA 1D5CA 2WBLC 4TL8A 5FUXA 3RC8A 3DM9B 3U3RA 5KNDA 3Q72A 1G7SA 4EJSC 1AS3A 1TF5A 3IHLA 4LBVA 3NDBB 4ARZA 4Q47A 4QJ5A 4HDOB 1VMAA 4RD3A 1E2MA 4PHFA 3PUVA 3ZVMA 5FOVA 3RANA 4QM6A 4M21A 3KFVA 3NBXX 4PPNA 2OBLA 4M9XA 5AUQA 4LRWA 3VU9A 1Z3IX 1LS1A 2GZHA 1BO6A 1J7KA 4JLOA 1SXJA 4D81A 3AVYA 5TV2A 3WNBA 1V43A 3F5FA 3LH5A 2VP4A 3IQXA 4KFRA 3X1XA 1L8QA 2IUTA 2OCBA 3CF6R 1NSTA 4QBFA 3WNDA 2OAP1 2O8BB 1AGRA 2AXPA 4I1OA 4OHWA 2ZE7A 3F3YA 5JMTA 3K1JA 4V0MA 3VR1A 3GLFB 1N6PA 2FF7A 1SKQA 2OBMA 4XWOA 4G5QA 4B3DA 4KBGA 5JWHA 4FCVA 1GOTA 2NGRA 3OEHD 2GJ9A 1GVNB 3FB4A 4HLUA 1Z22A 4FCTA 1CU1A 5GJVC 2HEIA 1IJEA 1EG7A 1V5WA 3FWYA 1XEWY 3I8SA 1UF9A 4PZZA 1OLOA 2O8CA 3SHFA 1E1QA 2VSFA 4ZCMA 4NYJQ 4KVGA 2Q9CA 1TNDA 3PUWA 4LY6A 1W47A 2KI5A 2VHTA 3LVQE 2VF7A 2IA5A 1PV4A 1J90A 1VTKA 2QPTA 4B75A 2ZE6A 3GJ3A 2P5SA 2ZTSA 2PJZA 1DOAA 2PCLA 1VYTA 3FOZA 2OESA 1MOZA 1G8YA 1UKYA 3LXRA 5E7MA 5FTKA 1YHNA 2N42A 4PSKA 2O0JA 1DAKA 2OFXA 3QKSB 3RWOA 1GFIA 1E9AA 2P65A 4JT2A 1F2UA 2F1IA 1D9ZA 1J8MF 1OB5A 4RFSA 3I1FA 5FPYA 1P2VA 2PX0A 3KX2A 1R0YA 2KBEA 2ZS8A 3LW7A 5JS7A 4GSYA 4KVAA 4MRNA 4DCSA 5F9HA 2F6RA 2VA8A 1RJ9B 1NF3A 3QVVA 1P2TA 5AUNB 2G3YA 2MSCB 1IN4A 1C9KA 1JEDA 1FPMA 2C9YA 4FMDF 4QJ3A 5BN4A 3ONWA 4JLNA 4YXWA 1N3BA 1QVAA 1ZMXA 3X1DA 4DLRA 1S96A 1SHZA 4H1VA 4UXJA 1MO6A 4TLCA 3SYNA 1W49A 3H86A 4AURA 2QT1A 3JZAA 1XTIA 1KY2A 4BASA 1U90A 2XXAB 4Q7JB 4B74A 3K9HA 1H8ED 1N25A 4PANA 4M9ZA 1KO4A 2GVDC 4US1R 3SJCA 3AVQA 3GJ0A 4C30A 3EW9A 1FNNA 4AKIA 2WKPA 1YR8A 4XSHA 4JJKA 2ZE8A 2WWFA 2WWYA 4G5OA 3VNUA 2V8OA 1YRBA 3I92A 4HDQB 1PUIA 2QBYB 3CRMA 3LRPA 4QNMA 3SE0A 4DWJA 4ERNA 1G21E 2FSFA 1E0AA 1IAQA 2FWRA 1KI6A 2NPIA 1FQJA 2AFHE 3O8DA 2CLCX 4OBEA 3HU1A 5TXGA 5D3QA 2IUUA 2YHSA 4TTQA 3EX7C 1GAJA 2QN6A 3TR0A 3KXIA 4DT1A 1E9RA 3IBYA 4MGZR 4NONA 1HH4A 1OH6A 1ZW6A 4Q4AA 2H18A 2QRZA 3EG5A 4M1WA 3WP0A 3TVDA 2W00A 4FINA 3ZVNA 1OFHA 2VHQA 4A0GA 5FL7A 3L8YA 2F43B 2H92A 4QJ4A 4OQXA 3AF3A 4CDGA 4DT1B 5TVKA 2A9KA 3E5HA 1F3OA 4FXPA 4N0DA 5G53C 3LLUA 3MSXA 3SEAA 2KSQA 4D4MA 1FMLA 3IUYA 5JI3E 1ZUNB 3A6PC 5J47A 5EXXA 5IT5A 1VCMA 1UKZA 4LYFA 1VCOA 3IHWA 4BLTA 3I62A 2FSIA 1OE0A 4ZO4A 2NO0A 5CDFE 1XFAA 3AVPA 1GRNA 4MKFA 5GADl 3DKPA 5FTNA 4JVSB 4OQMA 2ZRCA 5KSZA 4LPKA 4NZYA 1CIPA 1FUKA 4NHOA 3W3AA 2F7SA 4X8HA 3GPLA 1KMQA 2CVFA 3K09C 1QF9A 2HYIC 4XSGA 1YR7A 4M1KA 4DEXA 3KQHA 3KUDA 4RD2A 4HEJA 3OIVA 3BRWD 1Z6GA 2B7BA 3MWKA 3REGA 4OHXA 3VX3A 3GP8A 1IXSB 4IDNA 2XXAA 4Q9HA 2EVWX 3W8NA 1XPOA 4B6EA 4B3FX 1E2PA 2QM8A 2QAJA 3CRQA 4PHGA 2CEAA 2OLJA 3MAAC 1BMFA 1NKTA 3E1SA 3CX8A 4QGFA 4JJZA 1NIPA 3KQUA 1DAHA 5GJBA 2CCGA 3C8UA 4GRAA 3I5XA 5HKKD 5DI3B 2IBMA 4JLBA 2IWRA 1WB9A 4PQYA 2C95A 1MR3F 5BYKA 2AD5A 3OE7D 1EFRD 4TZ0A 3HDTA 4FIDA 1GZSA 1VG9B 2X1VA 1CTQA 3B2EA 3A1VA 3SOPA 3NEYA 1G3IA 1F2UB 2VF8A 4B76A 3CF2A 4A9AA 4QFMA 3QI2A 1XCMA 3KQKA 3CBQA 2ZYTX 5L8VA 1HUQA 1G41A 4NYMR 2FSHA 4V02A 2JJ2A 3KKQA 3T61A 2C04A 2OSBA 2EYUA 2CHGA 3IKJA 2NTYC 3QPUA 2BEKA 3VHXA 5K8LA 3VKWA 4G01B 1X86B 2VYFA 1YRAA 4US2R 2RCNA 3EWSA 4XVRA 4N0EA 2WOJA 1KI3A 2GNOA 5FR2A 2QAGC 4FD2A 1EESA 4YDSA 3AGPA 2JIZD 1KDTA 4LHZA 3RS0A 4PPQA 4BFYA 4DJTA 2BOVA 3KKOA 3QKSA 2J45A 3BJIC 1DELA 1G291 2YWHA 5FOWA 1W48A 5F3WB 4CEJB 5F98A 1PLLA 1K5DA 3FYHA 1R7RA 3RYTC 3ZZTA 3ZS9A 1ZC4A 2AKYA 2CHQA 3MWJA 4DEYA 2O8EB 2ZIAA 1T4GA 3U44B 1UKVY 2OLKA 1U8ZA 4Q9IA 3G5UA 3GLIA 3WBJA 3WMGA 1YZLA 1E9SA 1G5PA 2IK8A 3CH5A 1K8RA 1G4AE 2BJWA 1JAIA 2WV9A 4L5BA 1T9HA 3V9PA 2GTPA 4A2QA 1XF9A 3WRXC 2AX4A 3LDAA 1UEIA 1JXMA 2A30A 1N0WA 5TDHA 1EK0A 3KKMA 5J40A 2YKGA 3TSWA 3U4QB 4BGDA 1IONA 4YONB 4S35A 4RFVA 3SNHA 3PUXA 3CRVA 3KUCA 3QPWA 2D3WA 1GILA 4HATA 1KSGA 2QTFA 2BKUA 3A4NA 4A2WA 1ZUHA 3RWMB 2DFKB 2G1JA 4QOSA 3SR0A 4E5UA 1JR6A 4LC0A 1OXSC 1T0JB 1S3GA 1H8HA 1TADA 1DPFA 1R5NA 2OXRA 1ZAKA 2ZRAA 4QKQA 2Z4SA 2FA9A 4LJ6A 4NKRA 2WSSA 3HU3A 4F4JA 3OFNA 1W2HA 3HYTA 3WXMA 5JCPA 2EW1A 4F91B 4EFLA 4OQFA 3J81k 4MKGA 1YZUA 4J0QA 1Z5ZA 3BK7A 3CNLA 3QBTA 1QHNA 4PQRA 1NBME 5AJWA 1XZPA 1U2RA 3QNUA 2ZE5A 1E3MA 1X1RA 3EXAA 1GL6A 2X2FA 4V0KA 1AJEA 2JLVA 3BH6A 3ZD6A 1XXHE 4A82A 1RE0A 3N2IA 2J9RA 4TSFD 4M53A 3WYGA 4LSGA 4POAA 1W5SA 4QXAA 2ORVA 3KXLA 2C78A 4XTCS 3ND9A 4LZZA 4YDHB 3Q7QA 5CITA 2H17A 2GAAA 4MQBA 1D8TA 4Q7KA 3FVQA 2IYXA 3M1IA 2DWQA 1E4YA 3RS7A 3BE4A 1CBUA 4LBYA 3TW4A 1KDPA 2VP9A 1CJMA 5KSOA 4GZLA 4TZ6A 2WWWA 2XB4A 4O0MA 2R65A 1XMIA 2GBLA 1UPTA 1CLUA 2ZI7A 3LVRE 3VTKA 1U81A 1JEEA 1P2SA 4Q00A 3HPQA 5HZHA 4KYIB 4EFMA 3U60B 4TMWA 4BZXA 3S1AA 3BXZA 2QMHA 2IYZA 2IYQA 3AP3A 2O8BA 3P4YA 4BFUA 3NEJA 1QVRA 2D06A 2YNMA 2IYUA 1KI9A 5DHFA 1S4QA 4M0LA 2GESA 2QT0A 2W2XA 1ZIPA 4URVR 4LCBA 4WA7A 1Q20A 2WIAA 3C41J 3Q5EA 2GK6A 4M9SA 1KOFA 3THWA 3AVXA 4FMCF 2BBOA 3VR5A 5KNBA 1LTQA 4MYUA 4IRUB 3CR8A 2AWNA 4BEBA 2WMNB 1S1MA 3QXHA 1W0KD 2WAXA 3U61B 2B6HA 4BZQA 3B9PA 4EPYA 1FL9A 4GMXA 2Q9BA 5A5GA 3SQWA 2XTNA 4O25A 4LJ8A 3I61A 4EPXA 2YWGA 2J59A 2NG1A 4M8NE 2Y8EA 1DAMA 3GFPA 2GJSA 4OQNA 2W6IA 3T5DA 2FH5B 1R4AA 1FQKA 4LV6A 1ZNYA 3H4MA 2ONKA 4D82A 3H1TA 4MDEA 3P32A 1IJFA 3IIJA 4NYMQ 1ESMA 3DVLA 1F2TA 4I1SA 4JZKA 1Q1ZA 2BM0A 4PXAA 4C0LA 1II8A 5B64A 2A5YB 5FBVB 1ZP6A 3K0EA 1NBMA 2ZU6A 1M8PA 2F1JA 5DLQC 3ZIAD 5JJIA 3CW2A 2YOGA 4GNKA 2P3SA 1MO4A 2JA1A 3CX7A 1T5LA 1VHLA 3BS4A 2O0KA 1G5RA 2HLDA 4QNRA 2NMVA 1KJYA 1QG4A 3X1WA 4FWTA 2P6UA 2WJIA 4LBWA 4C2UA 2BDTA 1S9HA 4F93B 3TE6A 4Q1DA 4EKDA 3W90A 3WMFA 2YZ2A 2CLSA 3CZPA 3EZ7A 2LWIA 5HZKA 1KZGB 4D0LB 1VG0B 3BB3A 3DOFA 2J0SA 3SQXA 4RVCA 3OZXA 3IGFA 4HB2A 3DMNA 4MITA 1Q21A 1XB2A 3IILA 5FOUA 5JS8A 1TX4B 4NL4H 5EUQB 4YQFA 5B30A 1Z07A 1NMZA 4IVRA 3FMPB 5JJLA 3GJ5A 3R20A 1WBBA 3E2IA 4Q66C 2I4IA 1AA9A 1OHHD 2C98A 2J0UB 5EUMA 5LB2A 1YKSA 5JEDA 2FZ4A 2FMXA 3C5HA 4M1YA 3LBHA 2LKCA 1TL7C 4RSGA 1SVWA 3P27A 3HPRA 1T5IA 2ZJBA 3ZZUA 1NLFA 1L2TA 2GWHA 2RGBA 1Q3HA 1ZCAA 4W7SA 621PA 4Q9JA 1NMYA 4EJSA 5JSZB 1XMVA 2HCBA 2QGNA 3KTAB 2XZLA 3NG1A 1W4AA 2JLSA 2WVJA 2DWOA 4GP6A 4NP6A 4NBSA 1KI7A 3B9QA 3B78A 4LHVA 2NO1A 2HJVA 2YV5A 4NCHA 1AQYA 1YR6A 2J41A 4LK2A 3NBZC 1OSNA 2DHRA 5TARA 4HLUC 5AJZA 2GF0A 2WICA 4R2HA 5CK5A 1G3QA 1ZIOA 5L3SB 1E9BA 3B85A 4L9WA 2PLRA 2VIIA 1A4RA 2ZAMA 3LX8A 2QA5A 4QHYA 4KSCA 1T6NA 2MSEB 4Q18A 1R6BX 4ILEA 5SZKB 3ZZ0A 3QSYA 4BZPA 4XWAA 1HEIA 3CH4B 3TUJC 1M74A 5ELXA 3CR7A 1RIFA 1U8AA 1XTSA 3TAUA 3PJRA 4ZPXA 3UKDA 1US8A 2YC4C 3CB4A 3MRSA 1G5TA 1HV8A 2RGAA 1UBEA 3OEHA 1XPRA 5DE3A 3AVVA 4K46A 3W34A 4V03A 4DLUA 3R7WA 3ZQ6A 2IS4A 4B33A 5J4VA 2AL7A 1U99A 1SXJD 2P0EA 2UZIR 2WJJA 5EE5B 1KJWA 1N6RA 1KZ7B 2VHJA 3QEJA 4UKDA 3LAWA 5CIQA 2GA8A 4L4UA 1JNYA 1FNMA 3MFYA 2PBRA 3RHFA 4Q7MB 5H70A 3RDPA 3RRNA 4TMXA 2OUKA 3TH5A 1NVUQ 2EFDB 1ZM9A 3L2OB 4GOJA 3U7HB 1SVSA 3H84A 3C14C 3P1JA 2IYWA 3T1TA 4I1VA 4B2LA 5FBWB 2WM9B 1CULC 2FSGA 4AWXA 3L0PA 4JVNA 2I1VB 1T3SA 3LFUA 2JCSA 4DBLC 2PMDA 1I4LD 5FOTA 2BMJA 2G83A 4HI0E 4QRHA 2PL3A 3A36A 1TQ6A 2ZJ5A 3AP1A 1HY3A 3CF0A 2V7QA 3R9WA 3FE2A 5FI1B 3WBKA 5GVRA 2WHXA 2CJWB 2BV3A 2ZROA 5CLLA 1CJKC 3EAQA 2ODBA 2RGCA 2ZR9A 3P4XA 4KHZA 3I5YA 1JQJC 1BS1A 4LHXA 2QORA 3UPUA 2P6RA 4R71A 3K70B 3UG7A 1DG3A 3VR3A 3UATA 3MWLA 5DYGA 2GKSA 4IDOA 2ZEJA 2GZDA 3VMFA 4MUBA 2VSOA 3CONA 3WNCA 3AKDA 4TLBA 3BFXA 4MRPA 1I4DD 3W3ZB 3CNNA 3CWZA 4URZR 1XD2B 1T8TA 5KYKA 4ZCLA 5KHOC 1MO5A 4TL7A 2ZRHA 2R6FA 1KIMA 2WPDD 2D2EA 3OESA 3K09A 1G64A 2GCOA 3AM1A 1B23P 1E2KA 4RFSB 1N5IA 5AWFC 1G18A 4B3CA 5L3QB 3TSZA 3D6TB 5JEEA 5J4LA 5B58C 5B2ZA 2FG5A 4IJMA 4AG6A 1ELOA 2ONJA 1IN6A 2N46A 5CYPA 1S2MA 2B7CA 4C0AC 4FW9A 4NE2A 1UFQA 2QROA 1RZ3A 4ON9A 1UAAA 1PLKA 1YQTA 2FEOA 3ETLA 3T15A 4D0GA 2IF2A 4URWR 4JSTA 2ZJ2A 3QIAA 4DLSA 5JFGA 3QE0A 3TSOA 4MGIR 1QHIA 2ZI9A 3B1WA 1TEVA 2O8CB 1SVMA 4RD6A 4TYWA 4G5RA 3V4FA 3LQRA 2CJWA 4F92B 3AVTA 1NIJA 4JBYA 2NIPA 3MMPA 4LHWA 2RB4A 4TTRA 2H8KA 1M7BA 3RAPR 4CT4B 1E96A 1NVXQ 2ANCA 4KCGA 1AIPA 2Z5FA 3PUZA 3UIEA 5E7IA 2Z6VA 1LNZA 4C0QC 4L16A 5JBQA 1W46A 1E2QA 1P9WA 2ORWA 2ZI5A 1TTTA 2JDIA 1ZRHA 2ZI3A 2QTHA 4YMVA 4GL2A 2WKQA 4WOPA 3EARA 5FR1A 3SS8A 5JSZA 4CVNA 1UBCA 2LKDA 5E7JA 5EXTA 4XD7A 1G8GA 2CK3A 3QJYA 3PEVA 3KKNA 3CRW1 5EXPA 4ASUD 4KFUA 3W5JA 4Q5IA 5E95A 4DHEA 2J0UA 2QPOA 1WE2A 3OAAA 2EFHB 2RGNA 2ORIA 3BH7A 1N6KA 4B35A 3GLHE 4MRRA 4PFSA 2WJGA 2W58A 1HTWA 1KNQA 2WWGA 2PMKA 3LD9A 4NCIA 1HT1E 2R6GA 4BLSA 3UMSA 1J70A 2JEOA 421PA 1P4SA 5J4KA 5M04A 2X2EA 3AF2A 1Q12A 2J87A 2ZREA 3QXSA 1FTSA 2IEZA 4ZKEA 1KJZA 3OE7A 4G3XA 2IXFA 2J1LA 2AK3A 3K0AB 4NMMA 2EFCB 3Q85A 4O2RA 4KAXA 2XNDA 2IXGA 3ICQB 4PO9A 1ZJ6A 2BMEA 3BFKA 3TKLA 5C1BA 4DLTA 1YJ5A 3VHLB 3OIUA 4IVPA 3K0SA 4B71A 1N6LA 2HYDA 2W6JA 1NKSA 1LF0A 4DRZA 1AM4D 3A4MA 2UZ3A 3LW8A 2WSSD 1G6HA 1LS6A 3QKRB 5K8UA 4URXR 4NYIQ 2IC5A 4PZLA 2GK7A 3AP2A 4TWZA 1NG9A 2NZJA 2YWEA 4BLPA 1W2GA 2CE7A 3G0HA 5D3MA 4KLNA 4L15A 221PA 5FUYA 4V0ME 3EPLA 4OYHA 2VPPA 2FJUA 2AK2A 2J7PD 4LBZA 5LDDC 1ZU5A 3GEHA 4NYIR 2GCNA 1IN7A 2SHKA 1YU9A 4LPSA 4B32A 3K70C 4ZIRA 5CB6A 2XX3A 3WRYC 2NZ8A 4A0HA 3N5CA 1T3HA 1VYVA 5FUVA 3ZQJA 1SVOA 2KB0A 1FFHA 4WVFA 3IIKA 3A8TA 4DLZA 4QL3A 4B2PA 4LYAA 1IY0A 1KO5A 3NHAA 3TR5A 3WHLA 2YC2C 1N0VC 4DVGA 1HA3A 1HE8B 2PZEA 4RKFA 2JLXA 4P3YA 3T35A 1Z6YA 1EWRA 1CF4A 2BC9A 2XTZA 5LPNA 3BERA 3LA6A 3PENA 4OHYA 2JJ2D 2JLUA 4TLDA 4ARZB 3U3KA 1OPXA 2FE4A 1JR3A 3GCGA 3O8BA 1OXUA 1E2JA 4EPTA 2HF9A 1ESNA 3QEOA 4ZDIA 3THYB 4KO8A 4OK5A 4D80A 2F55A 2JLZA 1NN3A 2ZM5A 2ERXA 5DNYB 5C2JB 2WSMA 4LI0A 4HAWA 5J5CA 4QHTA 1GM5A 1UEJA 1XCGB 4A6PA 2HT1A 1RRGA 4TYQA 1N0UA 2AWOA 4Q19A 1XDBA 2JATA 2VH5R 1AS0A 2WJVA 2PEZA 4U02A 1S9DA 5AK0A 1EWQA 5IK2D 5SZHB 2XOKA 1RYFA 2GJKA 2IUSA 4PC1A 1II8B 4UNRA 2BEJA 2OFOA 3I4LA 1Z6TA 5HPYB 4RZUA 2CCKA 4X8OA 3TUZC 4C7OA 4KITB 4Q21A 1HQYE 1MABA 1GKUB 3BAFA 2ZANA 2ZR0A 4MYCA 2C5LA 1Z0KA 1G3UA 2REBA 3RLFA 3TBKA 4DB2A 3NIBA 1ZNXA 3E70C 1DVRA 1YZQA 4DCTA 2IYVA 1G6OA 1NJGA 3CNOA 4UNNA 4E03A 1R0XA 3O47A 4JVMA 2J3EA 2D7DA 4D4LA 1Q3TA 2EU8A 2NO9A 4IFEA 1EFRA 1B0UA 1LVGA 1LV7A 2FPMA 1ETUA 1F2TB 1DAIA 5CLQA 4JSYA 2WOOA 1NP6A 4X8LA 1GSIA 2MMCA 3ZLJA 3FMOB 3EIQA 1PUJA 2REOA 2J0QA 2ZVPX 4LX0A 1H65A 1DARA 2HLDD 3BBPA 1XXHA 2F1HA 2XITA 4OK6A 2KE5A 5HCNA 4B2IA 2JLWA 3A1TA 2ATVA 2AKAB 3GJ7A 3OFND 5CJ2A 4HAUA 1VIAA 5G40A 3AKYA 1WDTA 3NH6A 2A5JA 2AR7A 2DBYA 2ZJZA 2IHBA 4RD4A 5JWOA 4TL9A 5FOXA 3QUSA 4N1AA 4ZV4A 1EFTA 4P0TA 1PVOA 5B57C 1GRQA 1E94E 1OF1A 4TQAA 1Q1QA 1EXMA 3NBYC 4ZDWA 4IHQA 3LQQA 1TUEA 1U94A 3MLEA 4M9QA 2FZLA 3ASYA 1RRFA 5EZ6B 4XTRA 2A5FA 2OO7A 1NBMD 3GEIA 3K0CC 3X1YA 5FH9A 4RKEA 3CZQA 4PQFA 1Z2CA 3LBNA 1X8LA 4DLVA 3U44A 5FUWA 4CIDA 2GCPA 4B34A 1BYIA 1R10A 5CM9C 1OV4A 3ZS8A 5IRCD 5D3MB 1VCNA 1D2NA 4TLAA 2BBTA 1Q0UA 4AY2A 2N1BA 3CIOA 3B5JA 4Z54A 2QNRA 2J46A 2VL7A 3SJAA 2VSXA 1KAGA 3W5IA 4HYYA 4M4SA 1T91A 1N6NA 5H8WA 1SHKA 4HB3A 1UKEA 4A6XA 4MDFA 1R5OA 1SZPA 4ASUA 3M6AA 2W6ID 4W5WA 1XEXA 2DR3A 1ONBA 2C99A 2Q0HA 4AKHA 1DO2A 3EC1A 821PA 2RHDA 3W9YA 4RJLA 5F9FA 1L4YA 4YC7A 1NY6A 2F3RA 3SFZA 1KK1A 2FNAA 1KK0A 1Z28A 5EZ5A 3Q3JB 1P3JA 2J5XA 3CO5A 4H9GA 2O8FA 4HUQA 4TQUS 1IY1A 1Z06A 2D74A 4M1OA 5SZIA 3HJNA 1IN8A 3AVOA 2FOLA 2IHYA 4FN5A 4ZDKA 1JR3E 2D2FA 2A2ZA 2ZJOA 4AG5A 4WZAE 4HZIA 5TB5A 3EC2A 1YVDA 1L7VC 2YOFA 1HE1C 4W9MC 3AVUA 1GTVA 1X8KA 4TN1A 3RS3A 5GJWC 5FBLB 2WWHA 1PJRA 5FBQB 1ZM7A 3R8CA 3WMEA 4ZDJA 3THXA 4PHHA 1XX6A 4TT3D 2ECKA 2CL7X 1IXZA 3UWOA 4LDJA 2RGXA 1MO3A 4B43A 3IDQA 1KK2A 2F9LA 4TYYA 4IEEA 2GETA 4BQSA 3K9NA 5H1YA 2OAQ1 4WAUA 1DS6A 2BMFA 2ZSEA 1CEEA 1GKIA 1R0ZA 1QG2A 3EZ2A 1CJVC 3V4RA 2PZGA 1XTRA 3HP1A 2G6BA 5GJCA 5JCZA 3U4QA 1TMKA 2ZSFA 2CCJA 3U7GA 4C0SA 5DN6D 4FI3C 4FWIB 4IDHA 1Q22A 4RZ3A 3SC3A 5FPTA 3T12A 4Q48A 5EP4A 2V54A 3OEED 1WF3A 3SBDA 1W4BA 1Q1EA 2CBZA 3GLIE 5KPJA 1ZVQA 5EXSA 3W6NA 4IFBA 3IPXA 1AKEA 3PITA 3AUXA 4BEJA 2VHUA 1FMJA 2JDID 2BIFA 3GJ4A 2QL6A 2HXYA 4PC6A 3P26A 1QHGA 4MH0R 4W5HA 2IF0A 4PR0A 3NWJA 2OG2A 2DY1A 4OJQA 2O8EA 3SI7A 1D2EA 4DZZA 1KHTA 2GEUA 3THOA 4C7OB 4NCKA 3MUFA 2Z83A 1OHHA 2OT3B 2B92A 4DCVA 5BN5A 1ZBDA 3FHCB 2GZAA 4DUGD 4Z1MD 5KNCA 2IYSA 1G20E 4U5XA 2GXQA 2XSZD 1A2BA 1G3MA 4A92A 3ADKA 3CPJB 2G77B 3DKVA 4P31A 3R8FA 2PLFA 2DWPA 2V7QD 2WPDA 4URUR 3PFIA 1BH2A 2IT1A 4JBXA 1GNPA 2QRNA 4GDFA 2GILA 5ANRB 4KFSA 3BFVA 3K9GA 2QMEA 3T1QA 4PSAA 4AYXA 1KI6B 1BYUA 1D2MA 2ZS7A 2ZUBA 3KFXA 3NBFA 3KJHA 2RH5A 3VAAA 5JRJA 5H68A 1HT2E 1KYIA 1PLJA 5HTKA 3ADBA 1P6XA 1G8PA 1K6MA 1OW3B 4EDHA 4A0RA 4Q4JA 1P73A 1XEFA 4NCNA 3H2YA 1XP8A 3D31A 3GJ8A 4GMDA 2WWIA 3KZ1E 2WTUA 2A5GA 3QF4B 3TMKA 4H1UA 3BB4A 3FTQA 1FZQA 2GXUA 3KB2A 2B8WA 1DAEA 3MGCA 3NXSA 4LYHA 3N2EA 4KLZA 3GLIB 4A1FA 4AKGA 3AF0A 1JQLB 3ZD7A 3EA5A 3DOEA 1KI1A 1G7RA 4JS0A 1G9XA 4LGMA 4ZIRB 1A7JA 1KY3A 4FCWA 2AD1A 1DAFA 3LLMA 4IOLA 2WWXA 3GQBA 3P20A 5AJYA 4F4CA 5SZJA 1E0SA 2QENA 3KJEA 4PPGA 3U2QA 5GVSA 1E9DA 3ADDA 3OHMA 4BFTA 5A4JA 3B1VA 1E79D 1U0JA 3K53A 3A4LA 4IEIA 2O5VA 3LWNA 3C15C 5DISB 2GF9A 2XGJA 3ZYCA 3VR6A 1GDDA 3C4JA 1UDWA 4MUAA 5E4FA 5DI9A 2QE7D 4QG7A 1W44A 2OILA 4DDWA 1NJFA 1XD2A 3RS5A 2A5DA 3U7EB 3GLGE 2RGEA 3RSOA 1WCV1 2TMKA 1RVDA 2QTVB 4JL8A 3R9IA 3SZRA 3ZH9B 3EPHA 5JHHB 1E2HA 1E2IA 2AXNA 1E2NA 2ZRFA 1DO0A 4D6PA 3LV8A 1VG8A 4WZ6A 3PEUA 4JLKA 3FKSD 4O2LA 2UKDA 4YLGA 2ZRPA 1NN5A 1ZCBA 2YJTD 2F43A 1NVVR 3VX4A 2GCOB 2W0MA 5BXQC 3JVVA 5DIFA 1KDOA 2H1LA 3IEVA 4HB4A 1NMXA 4C3ZA 4HAYA 2E1RA 4D25A 3JVUA 2YYZA 3VKGA 4IVQA 3FMIA 1XEWX 2QU8A 4PO8A 2C8VA 5LD2C 3NH9A 1Z08A 1IBRA 4JLDA 5IHPA 3EIHA 4K8OA 4DIEA 1Y63A 4DDVA 1N5KA 1VG1A 4HB0A 4HLCA 3TQFA 4M1SA 1CJTC 4R2IA 1P61B 1TPZA 4PAQA 1DEKA 4GP7A 3CLVA 3QVUA 3UMRA 1SXJB 3BD9A 1A1VA 1M7HA 1Y3AA 2WKRA 2ASEA 3UG6A 2R44A 2I3BA 3VU9B 4DDUA 3GLGA 4O3MA 5FBRB 4X8MA 1TQ2A 2RKOA 1RC8A 2XNDD 1DTSA 1W0JD 2QP3A 2VP6A 5E3HA 4UJ3A 3G82C 1JI0A 3DEFA 1OKKD 1Z0DA 4QHSA 4V0NA 4Q4JB 4EPWA 4WIAA 1UBFA 3T34A 5TY0A 5UKDA 2O0HA 3TNFA 1OXXK 1Z6XA 2D4HA 2OCYC 4AK9A 5K8TA 4DIDA 2IEYA 1N5LA 1N2CE 1GNQA 3K0CA 2GAOA 1X3SA 2FN4A 1KO8A 1JR3D 4I81A 1KKMA 4RY2A 4BECA 5DH9A 3UK6A 3OAAD 4P4SA 4LJ7A 5HR5A 5K8IA 4DDTA 2XZOA 5KSPA 2VP2A 2ERYA 2OCAA 5G3YA 1OIXA 5C18A 5BWMA 1DE0A 3QPVA 2O8DA 5CM8B 4GZMA 4JLAA 4OI1A 4IXMA 3GLHB 2VEDA 4A36A 3ICEA 4JYBA 1TQDA 1X8JA 1FOEB 2L0XA 4A8JB 1U0HC 3QG5A 1RRCA 2QI9C 4WXRA 1DADA 4UXIA 4C9BA 4BUJA 3Q9LA 1GIAA 4R98A 1ZYUA 4OI4A 5JECA 2ZQ5A 4UNSA 2WMOB 4PTLA 4Q1CA 1KTVA 3I8XA 4LJ4A 1NLZA 2HV8A 4A2PA 3PCRB 3M0EA 4Q4LA 3QY0A 1YZNA 5G41A 3OEEA 2CK3D 2IX3A 1M1YE 2R62A 4GOXA 2G88A 3RC3A 4MKIA 3WHKA 4DLWA 4OK3A 2BVNA 3CPEA 1JJ7A 4G5GA 3Q8XB 4LUCA 4XVQA 2QBYA 3DDCA 1U98A 4DC9A 2CNWD 2C77A 3DL0A 1XWIA 2W6JD 3DHWC 3VR4A 2VRWA 3BB1A 1SXJE 2PT7A 1AGPA 4U7DA 1W36C 2R8RA 3RNLA 1E2EA 3B1ZA 1WP9A 4MYHA 3KJIA 1HYQA 4B44A 3U3JA 3QF4A 3U6KA 3X1ZA 1TU4A 2ZJ8A 3CX6A 2QQ0A 1QRAA 5KUTA 1G7TA 3A37A 1E1RA 4WW0A 2QQEA 5BW8A 4ESVA 4RZ2A 2KJQA 1FUUA 4EUNA 2KWIA 3FKQA 3LXXA 1IM2A 1P60A 2XTMA 2ZUDA 1E9CA 3FDIA 4ACAA 2V1UA 2O8FB 2EWVA 1VHTA 1XJ0A 1N6HA 4MGYR 1P7CA 1YR9A 3VKHA 2V4ZA 4NH0A 5J4HA 2B21A 4XH9B 2OFWA 2XNSA 3VFDA 3GFOA 1FTNA 2G1KA 4IOMA 1XTQA 4DSTA 2V1XA 2FEMA 4RCYA 1Z0IA 2A78A 3LBIA 3WP1B 2JJ1D 5JJKA 2R9VA 4C2TA 1NG1A 3V00A 1I2DA 2AN9A 2GJ8A 2IYTA 4M1MA 3IBGA 4P32A 1VDZA 5G3ZA 4OHVA 1AZSC 2QSYA 4CYMA 3GFTA 3SJZA 1ZC3A 2ZI6A 4P4TA 5DHAA 1RRPA 3EPJA 1H8EA 3CRRA 3NVAA 1C1YA 2Z0MA 2VTKA 2CXXA 4OI2A 5LBIA 3H0KA 5BYJA 1G4UR 3TUIC 4OHZA 4PHTA 3N70A 1EFHA 1CRQA 5LD2B 3SFVA 4B3GA 4PC2A 1BOFA 4NDZA 4G0NA 1T3LA 4Q4HA 2VBCA 3PR1A 3SU8A 1BIFA 5IK2A 1VECA 4R7ZA 2ZS9A 4KU4A 1UDXA 4L9SA 4BLQA 1E32A 4XD7D 2JAQA 2P5TB 5L3SA 4Q9KA 4NTZA 2XEXA 3K0FA 1G19A 1SXJC 2PT5A 2GXAA 3AV0B 1TF7A 5FPHA 1NY5A 1UBGA 3KXKA 4MYTA 1W1WA 2BWJA 1KMHA 2RGNC 2BCGY 4HSEA 1E9FA 1HURA 2QSZA 4MA4A 5DO9A 2QUZA 1CR1A 3CPHA 3L43A 5AJXA 2DCUA 1KSHA 1YZKA 1SULA 4EFNA 4BFXA 2OXCA 3TAHA 4B48A 8OHMA 5DSZA 2ZITA 2CL0X 1VKJA 1DAGA 2GHIA 5FTMA 1OH5A 4HUTA 2FPKA 3VNVA 2DFTA 2ZRBA 1KO7A 1Z6AA 2WZQA 1COWD 2ODEA 2GRJA 5EE9A 1GG2A 3M4YA 3KQLA 1KSJA 4KYUA 3KDSE 4BFWA 4AD8A 1P5ZB 1RPZA 5EP2A 2OHFA 5EE0A 1KKLA 5KPDA 4QBIA 2Q3MA 5FOSA 3RABA 2I1QA 2FV8A 3RS4A 4TMZA 4IOJA 4CZ2A 2X77A 2FFHA 1O3YA 3PG5A 1SKYB 1KMHB 3BC1A 4CW7A 4B3XA 3HYRA 4JKYA 5J4YA 4B3BA 4Z51A 1OFIA 2IYLD 3DZ8A 4E22A 3LY5A 1AZTA 1A82A 1E2LA 2ZJYA 4TMKA 3EIEA 3QKTA 1NVWQ 1M2OB 4ZI3A 4TYPA 1LFDB 2NQ2C 2V9PA 1P2UA 2VP5A 3ND8A 3T1OA 5JZVA 2LCFA 3W6PA 3AKCA 1SVKA 5BQ5A 1XCPA 4S2EA 1MKYA 5CIWA 4UJ5A 4CEIA 4Y0AA 4B6FA 4HDCA 2NO7A 3GEEA 2HT6A 1JALA 2ZRMA 5HE9A 3D7MA 3FFBA 2BMDA 2D62A 3NTUA 3CKLA 1QHHA 1D6JA 1IHUA 4GT1A 4LWZA 4BLOA 2FFQA 5DN6A 4JMPA 2P67A 2CE2X 3JZMA 2H57A 1NNEA 2PJRA 1S8FA 4BLRA 2WJHA 2OBNA 4OQLA 2NPFA 1LF5A 1F60A 1XRJA 2GEDA 1J2JA 4MGKR 2ZYUX 3K0AA 4RZXA 5HE8A 4ACBA 4JBWA 1LB1B 1P9NA 1W4RA 3FGNA 3SJBA 2Z43A 2Q6TA 2C9CA 3D3QA 3SYLA 4PC7A 3I72A 2ZI4A 1JAHA 3WYAA 3Q7PA 4JIMA 4C0JA 1ZM2A 3O8CA 3WY9A 5A0FA 5JLJA 1PZNA 3C5CA 4D26A 1X1SA 1CKEA 1LW7A 3IIMA 4PAOA 4JL6A 2AFIE 2Q3HA 3TJZA 2ZXUA 3R9XA 3TVTA 4Q03A 1G17A 1E9EA 1R8SA 2OEPA 1UADA 4F4IA 1SKYE 3QQ5A 3BIFA 3UANA 3SDZA 2JGNA 1GRRA 1K5GA 4JKIA 2IS6A 2Z4RA 2IS1A 4DUGA 4C0BA 1E2FA 1U0LA 1OYWA 3F8TA 1XJCA 1X6VA 2RGGA 1ZNWA 3ZVLA 3BGWA 3RRMA 1XJQA 2JIZA 1KI4A 2PH1A 1JBKA 4MRVA 1E1QD 3K9LA 1IXRC 3IO3A 3AVWA 2OV2A 2ZRIA 2FFBA 4ESHA 2XZPA 3U7FB 2ODNA 2JLQA 4YMUA 2QEQA 1TQ4A 3ADCA 2C2HA 1SGWA 3I3SR 1TF2A 2ZSDA 2G9NA 5BN3A 1LY1A 4N3NA 1R5BA 4WBSA 4I99A 4TT3A 4NYJR 3MG9A 1ZM3A 3EASA 2J7PA 2CNWA 1RFLA 2ZYVX 1WMSA 3DMDA 1IOZA 3AF4A 1KO1A 2Q9AA 4BFVA 1M34E 2K5UA 1WRBA 1E0KA 3PEWA 2YINC 1Z0JA 4Z1MA 1XBTA 1BMFD 1U9IC 4RD0A 5KDOA 2JLYA 1XD8A 4BPBA 4KXFB 2H7VA 2W2VA 2QP4A 3X2SA 2JASA 4CEHA 3OF5A 1OIVA 3CWQA 4WXPA 4DCNA 1E1RD 1KGDA 4I1UA 4CGZA 4Q1AA 4DB4A 4CEJA 1G1MA 1MV5A 1E0JA 2EQBA 4JLJA 1N6IA 4G1UC 1G7CA 3AH8A 4LJ9A 2QZ4A 5EE3A 3QKRA 4KODA 2ZUCA 5KTYA 4A8JA 1VYUA 1SVIA 2Q21A 1JXOA 1E99A 2QMUA 4KJZA 3O8RA 2XJ9A 5CK4A 1YE8A 4HZUA 4P4UA 4BFZA 1R8QA 1KK3A 1M7GA 1Z47A 1A2KC 2JJ8A 1TU3A 2O8DB 1H8HD 4Q4AB 3DM5A 1GL7A 3NC1C 5IDVA 2QG6A 2GJAA 4Q1BA 4UQOA 3ZGXA 3SHWA 2G0NA 2IXEA 4P4SB 3RSLA 2ZRNA 5DI3A 1IQPA 1MRSA 1QZXA 4DCUA 3AF1A 2ZVQX 5FL7D 4TLEA 3L0SA 4BRUA 3PEYA 4XIGS 3LNCA 4LC1A 1O87A 4OL0A 3THYA 3EZ6A 3LX5A 5C4MA 2CL6X 2JLRA 1JJVA 4QC2A 2XOKD 3PUYA 5FI0B 4EQ6A 2J7KA 3B6EA 3QBVA 1R2QA 1GITA 2EWWA 4TSFA 1Z0AA 4YMWA 4M1TA 1F6BA 4M2LA 4Y0VA 3RRYA 2P2LA 3SYKA 1YZGA 1M6NA 2PEYA 4ZKDA 1Z8FA 4KV9A 1FX0A 1UJ2A 5LB4A 3NDPA 2RHMA 2C96A 2ZETA
chains in the Genus database with same CATH superfamily
2FMHA 2RMKA 4ZVVA 5SICE 3TRDA 3UMJA 5KU1A 3ABSB 1D3AA 3IDFA 3D8BA 3HACA 1Z16A 2W4IA 4Q02A 1VCIA 4JA0A 4ZVKA 4IKEA 4RJ2A 2A59A 4O1HA 1R9MA 5M3BA 3EPKA 3KSMA 4ITRC 5C4GB 1E6CA 1NC3A 1Q7BA 2X9QA 3PRYA 1IFXA 5CXUA 1J00A 4J9VA 4Q1FA 3JD0A 2H5EA 3AEYA 3IUMA 4QM7A 1E7YA 4TOIA 3GGDA 4CR7A 5FPKA 3JQAA 4MCIA 2RAPA 4N8DA 2W2TA 4ZRDA 4DIFA 2UZ1A 4HMOA 1ADGA 1OJLA 3KHKA 4DMKA 5C8VA 4OD0A 1SCAA 1Y1QA 5E1OA 2VT7A 2VCEA 1B2LA 4OI0A 1MEEA 3GLHA 4FDVA 4GWLA 3A4VA 4MW5A 4RQBA 3RU7A 3MTIA 2XT6A 1JXAA 4AP9A 4GOMD 1RIIA 4H6VA 1NM5A 4I50B 2BKEA 3GCWA 4FZ3A 1QH1A 4QYIB 1L4UA 2BLNA 4RPCA 3C3WA 1U6IA 5AM5A 5KYXB 1AX9A 4FFLA 4IXNA 3EYAA 2HNAA 1EAMA 3TIFA 1GTSA 4Q0MA 2C1XA 3LMKA 1QFSA 3FM9A 3HNPA 4FGZA 4GKKB 2OLEA 2Z8YM 2I2AA 3FPEA 2YBEA 4IWNA 4Q9LA 5J3JA 4ZU3A 4DXDA 3MMZA 5ALPA 3EQ9A 4IUYA 2TYSB 3IVMA 1U8EA 4K9KA 4KSBA 2P8SA 2X13A 5ULLA 1OX4A 2VQSA 3TK1A 3UMGA 3NM4A 4KQHA 3PNPA 4IM7A 721PA 3WAGA 1UMCB 2XMRA 4FHCA 4LJAA 5EJ4A 5JI2E 1R4ZA 1DC5A 3QLTA 3VVCA 4RD1A 4Z53A 2PBFA 4FNMA 4GD3Q 3DH0A 3GAFA 1AQIA 3H9JA 2Q6OA 4MWTA 5AW3A 3U5ZB 4XJVA 4B3JA 5JZSA 4U2FA 3ZHBA 3L6UA 3KQNA 1OB2A 2EKQA 2Q07A 2QL9A 2WFZA 4P4LA 4RLQA 3NKVA 3IIEA 1W96A 1AK9A 2V6JA 1G3RA 3DOUA 3W5UA 1PTJA 5CPBA 4YV7A 3VNRA 1CUIA 3ECAA 2IL1A 1RLIA 2GBCA 2D0PB 3EUEA 1R0WA 5BN1A 1V3VA 1SVLA 4D97A 1MOSA 1CY8A 2Q6LA 2QRKA 5DNDA 1SUAA 4HMQA 4E2FA 1OPRA 4CKEB 4QEZA 1WR8A 1FRQA 4WFJA 5FWYA 3VRHA 2CYCA 3UVEA 2JRLA 3ORYA 3LIPA 4W8HA 1QYIA 2RAUA 3LYLA 4QLBA 3ZHQA 1Z7GA 2TMYA 5EUBA 3G5LA 5FO0A 3R3HA 2VDRB 4H08A 4ROTA 5TMDA 2ZR7A 1V6CA 4KQFA 4WCFB 3MXOA 2NSJA 3K0BA 3PDUA 3Q7TA 2FETA 4RELA 4ZQFA 4ETMA 4I4LA 1BMDA 1C14A 1C50A 2P3LA 2WJ6A 3VO1A 1P0IA 3A04A 4IDQA 4UCXA 1CVRA 3VKUA 4AMUA 3DLIA 1Z56C 5L7TA 1GZ7A 1SUDA 3C7KA 2MOKA 4NBVA 1QZ3A 3VBEA 4MQFB 5J2UA 2P6OA 4Q3DA 2W0SA 3VYUB 1WA5A 3P0RA 4WY5A 4BJ5A 2XUFA 5HS4A 2EIHA 4DLPA 1Q44A 2AE1A 2D0OB 2PH3A 5HNKA 1MRNA 1XTKA 4EG6A 1V1RA 3PV0A 5IUJC 2BFCB 2HM7A 1KBOA 3FYUB 4CEHB 4C4ZA 2JLAA 4MV6A 5T41A 3G2KA 2J07A 3RYHB 4LFAB 3FMGA 4E5YA 3TLZA 5JDCC 4RH0A 3OM8A 3WNQA 3E27A 2DFLA 3N58A 4F2GA 1Y4DE 3EA0A 1OZ0A 2DJIA 1NP7A 1XEXB 2DHQA 2CNBA 2QM0A 2VNHA 5KJEA 5I9NA 3IS3A 4GOKA 2IDKA 3OZSA 1RKBA 1ZY2A 1NLYA 1YBHA 2G06A 2X1HA 3AM4A 3GPCA 3QQPA 4KDRA 5LZ8A 5JZOA 4PIMA 2I6GA 3TDKA 1Y6ZA 5ALTA 3A1WA 2NZUG 4RZIA 4XX0B 4WXMA 1V11B 4S3MA 3IAS1 4IGEA 1Z83A 1EDZA 4I3FA 4DS3A 4DTCA 3VO2A 2ZIGA 3HXMA 1X2BA 4RIFA 1UBTS 3UUGA 3PVSA 3V9AA 1TK3A 1KVTA 1Y5RA 1QKJA 1RYZA 2YXEA 3FHLA 3OIWA 4JYCA 3IPYA 1SBIA 3A1NA 4Y2RA 2O52A 3D4LA 2G07A 4PX9A 4YMTA 4H17A 3F96A 5I8PA 4GXQA 4YXFA 1EFKA 1LLUA 2AZDA 4BQEA 4ZCIA 4U7HA 2PPLA 3L4KA 1KMCA 1WB5A 4XZ3A 1GYPA 3FDFA 3GJ6A 2FEWB 4FFNA 1JLHA 1PW5A 2VJLA 3A6LA 2BCJQ 4LMRA 1N57A 2Q2OA 2A9FA 2Q6VA 4UHJA 4WN9B 3S1LA 1K7XB 3UWKA 5ED4A 4HNSA 4F3RA 3UHJA 4RE6A 4HDSA 5KTOA 2XQJA 1KNXA 3AGQA 1X9HA 2EJCA 1X9GA 3B36A 3DG9A 3GAZA 3JAKB 4G9GA 4NH4A 3SQMA 3D6AA 1EX7A 2MMGA 1SOAA 1JPNA 3CM0A 1CXZA 3D6HA 3HUFA 5F2EA 3M3DA 5LIPA 3A4IA 2XPCA 1AGXA 1AKUA 2GDJA 5CT4A 2ANBA 2VT2A 2IOQA 4FDTA 1WETA 1MTOA 5K45A 1BE0A 1AS2A 5JC8A 2V6IA 1TMGE 1VLVA 2IUFA 1C0KA 1H23A 2FCAA 1XPUA 2EDCA 1PDOA 1RZVA 1JPVA 2OQIA 2X6QA 3IAHA 4EX7A 2P78A 4A2CA 3LCVB 1S7GA 3E9RA 3MWEA 4F86A 4D9NA 4AI6A 1VSVA 4FOPA 4TTVA 5D8DA 4R9UC 5L3RA 3AB3A 3UH1A 4IBOA 3SSAA 3THXB 3U1BA 4RCZA 1K98A 1N7GA 5A4IS 4IXTA 2DZDA 2FUEA 4KMOA 3PXXA 1W4LA 3IBFA 3TLBA 4EPRA 1AD2A 1KIAA 2CYAA 2EAUA 3GJYA 3LUAA 3NHJA 4O63O 5HCUA 4XWKA 2QR2A 4WN3A 4L4SA 2ONZA 3WWEA 2HA0A 3FPAA 4E13A 5BWLA 1QORA 3A1UA 3FH0A 5I6DA 4J4TA 1OIWA 1USVA 1GKYA 3EVAA 4PIVA 2ZU0C 1U9JA 3A31A 3KDPA 5IUNC 3W2TA 1NVAA 3HVKA 4HOYA 1SQ5A 3DHEA 4TQ9A 4M9RA 5HCIA 5CD1A 1XKTA 4A2PA 4UM9D 2DYKA 4DLYA 3BJZA 1U9CA 2IDJA 1QTRA 5FEUA 1YFJA 4Q4LA 1P1JA 1TVKA 3QH4A 3ZGVA 2IYPA 3QE3A 4XIYA 2BM9A 3FFWA 2XB9A 4JI3B 1E69A 3PNYA 5BXYA 3AESA 3SXUB 4UZSA 5IT9A 4DKXA 3HR7A 2WTMA 4OB6A 1G5QA 2A0XA 2WDPA 2XOEA 7AT1A 3TCNA 3NNNA 1K3UB 3CEJA 4IDGA 4PAMA 2JAOA 2ZWAA 4TTPA 4YJKA 5A3JA 2WA2A 1X1EA 1ISJA 4GI1A 5ESRA 1S1CA 3NC0C 1UWVA 4RF4A 5CVJA 2DU8A 3DPUA 2AJBA 1QTNA 1W59A 1LK5A 3KZOA 4G5SA 3UXHA 3W04A 5F1OA 1EA5A 1P75A 4MUMA 4AS2A 4EAQA 2R6AA 5F76A 2NO6A 3A1DA 4QBKA 3M82A 4C29A 2O2SA 1A27A 2X6RA 3W8RA 4BX8A 2B4KA 5IH7A 1U2PA 1WBDA 3ZLVA 3DDUA 5JD3A 3C8MA 4MXDA 1C3XA 1NM5C 1R6VA 3B13B 2NVUB 1RLMA 3U3MA 1XDGA 5KYNA 4ABYA 1W36B 2WM2A 3KOYA 1U5BB 2ZAOA 4IL5A 3GH3A 3NTRA 5SYMA 1OFGA 1G8FA 4US0R 4OX9Y 3SF8B 3U09A 4ZHQB 3TQCA 2HUPA 4ZYYA 2XMZA 5JVDF 3MWYW 2QX9A 2WU3A 1G16A 4QGHA 2GB4A 2PA0A 3PDIB 1CJUC 5CXXA 3CVXA 2H8GA 1YJXA 2MINB 1CRPA 1FFGA 3L93A 5DV9A 2WZCA 4MW7A 1YQEA 3H87A 2HXGA 4BMDA 2Q0SA 3U7QB 3I12A 5IZCA 3DBRA 4P8RA 3I73A 4FMDB 3UH0A 4LQ4A 3I9LA 2NV6A 1P19A 3PDCA 4YRJA 3CCCA 3NAGA 4V0OA 2CDNA 1MABB 1K9SA 4IMJB 3IHTA 4TL6A 1YUBA 1MJNA 3HYLA 3OJ0A 1I51A 3X1MA 4G5FA 4ER3A 2FWNA 2GZ1A 2Q8QA 3OQJA 4NAVA 3OTWA 2BF4A 1MO2A 1XRRA 1PN3A 1B6SA 1U9IA 3NTOA 1P72A 3COSA 2B8NA 3RAFC 2DETA 2Y1LA 4OJKA 4M49A 2C57A 2ZDGA 3L7YA 1VIYA 1AK2A 1DDOA 1TYEB 4HDMA 1QBKC 1O03A 2ZRJA 4ZJZA 1EAYA 4BCCA 1VPLA 4H4EA 3LTEA 2EJTA 1V6SA 3HXLA 3K0FB 1KDVA 1QQBA 3E3OA 4L4RA 1DFHA 1NN1A 2G7ZA 3BMNB 4P82A 3SBEA 4BQFA 4N3GA 4U9UA 4F7WA 5D2CA 5REQB 2XUIA 3BBLA 2C0CA 1S3SA 3MVEA 3CZ9A 2XNJA 4QSMA 4J7AA 3B20A 5KKAA 1SA0A 2HJGA 4A91A 4CRWB 3K2IA 4HFMA 5JCXA 4JI4B 1C80A 1D5CA 2W2MA 2WBLC 4R9SA 4TL8A 1QF7A 1YCFA 1EH5A 4JQSA 5IH3A 1QP0A 1SZCA 4R9RA 5KNDA 5I7EA 3VUEA 3K96A 1CUSA 1UP6A 1AS3A 1CY2A 4LBVA 2QUKA 3NDBB 4Q47A 4QJ5A 5JS6A 1VMAA 2EIXA 4MO9A 1BW9A 3IVAA 4PHFA 6REQA 4J1TC 4ID3A 3CPSA 3OPVA 5FOVA 1T4MA 1MQ8B 1QRTA 1GRCA 4ITUA 1VRCA 1D7AA 2MYTA 3DHVA 3NBXX 2J5RA 2FE1A 3PC8A 4HTAA 1LS1A 2VVTA 3KE8A 4LKOA 4RUKA 5LQNA 1YUMA 5IAAA 1J7KA 1L8LA 3KVNA 3LCUA 2PZJA 2FEAA 4W8GA 1QIEA 5DKFA 3N86A 5TV2A 1XSEA 3KOUA 1V43A 3UJCA 3KRTA 3W1VA 1FFAA 3WNBA 5J1SB 3IQXA 2V6GA 1LDYA 1R6XA 3G2LA 4QVIA 2NU9A 4TX1A 4IIFA 4FYJA 4UMVA 5F4ZA 5CA0B 3NLLA 8MHTA 4FGUA 3PGXA 1DRJA 1SC6A 1TAUA 3O1JC 2AXPA 2C4TA 1M1YA 2JFOA 2V7UA 3GT0A 4OHWA 3KZMA 5KYWB 3K1JA 2G8LA 1W8IA 1JSXA 2I6SA 3C8DA 3UHFA 4KMSA 4ZC8A 4BX2A 3OEHD 2WUVA 4HLUA 2ZT6A 4H27A 1CU1A 2L69A 2WTNA 3F7NA 3FVWA 3KV3O 1EK1A 1BWRA 1EXWA 1I0LA 1P7ZA 1XVTA 3RIHA 4CQLA 4F5ZA 2HEIA 4EKEA 2R4TA 1V5WA 2R1TB 3FWYA 3L9WA 4LOIA 5CD9A 3Q6IA 3QU2A 2XA9A 1B26A 1OLOA 4HYTA 1E1QA 2VSFA 3AWDA 4A6EA 1T1GA 2BGNA 1E4EA 2Q9CA 4KVGA 1E5LA 4DY6A 5KSWB 3ME5A 2JKZA 2QMZA 2W6MA 3L4BC 4UTOA 3HEAA 2G9RA 2GZRA 2IA5A 3BCHA 4M7PA 1AKVA 1Y6JA 4B75A 2ZE6A 2INGX 2G70A 4ZTZB 3ABQB 2Y1CA 2PJZA 3WO0A 3HADA 3CUYA 5IN5A 4F6CA 4G41A 4RM3A 3DEZA 3PXEA 1Z2DA 3BXHA 5E7MA 4KFCA 2LV8A 1YHNA 2N42A 1FU4A 1TECE 1DAKA 3QKSB 3RWOA 3D8RA 1CETA 4OSEA 4JT2A 4X1OA 4ZD6A 1F2UA 2F1IA 3EVTA 1NNUA 4I50A 4K8RB 1K5HA 2EATA 3I1FA 4L6AA 3WLPA 3JWPA 1P2VA 3FTCA 3P5BA 1XK6A 2H2WA 2KBEA 2ZS8A 3ZDEA 1X1CA 2C2MA 3CISA 2XWBF 3KB8A 3OJWA 1ARZA 4ZK6A 1O6BA 2XQVA 3ZHVA 2POCA 1P1RA 3NRBA 3JWJA 1Q2UA 1E1NA 1RRKA 2QL7A 5IXJA 3R6TA 1Y4AE 2ILVA 4KRGA 4UEJA 5JMPA 3DKRA 1JEDA 2C9YA 4D9MA 5CFLA 1O9HA 3E8XA 5DRTA 4YXWA 3ZU5A 1C30B 3EXFB 3KQSA 3U40A 1SBYA 2O9JA 3JALA 4PGHA 2DY0A 3H2ZA 4YBRA 3V4SA 3GQBB 2EQ5A 5B7QA 1Y5NA 4UXJA 3PSHA 4TLCA 4JB8A 4BO9A 2QT1A 4Q3LA 1KDZA 1D04A 3KXDA 1XTIA 3F7MA 1YB6A 3PXCX 1QF6A 3HMKA 4YRKA 1YHZA 5HRUA 1NW4A 1H8ED 1N25A 4N0PA 1YCGA 3JAKA 3N0XA 1MNQA 3QM1A 1NOKA 4QIHA 5FWAA 2P2SA 2Z95A 4US1R 4IQ8A 4C30A 3Q15C 3EW9A 2PRZA 2A5LA 3ELDA 1FNNA 4AKIA 3K4HA 1YR8A 1FBTA 1U2ZA 3HA3A 5ALWA 3RBAA 4YT4A 5B7NA 1VSBA 2AUTA 3GI1A 3L7IA 3OHSX 4GUAA 1J42A 1Z4MA 2VK4A 3MCTA 1QG6A 1ZXXA 1CQPA 1ZLYA 2GCEA 1EFLA 3IFSA 3E5MA 3OIDA 3WRVA 1PUIA 2JBHA 4AJJA 3AFMA 3A2MA 4QNMA 4EJ6A 5JXHA 4PX3A 2PSEA 4XYBA 1G21E 4YUWA 3WDSA 4AN1A 4E21A 1DIGA 1PS9A 2FWRA 5KTMA 1QS0B 2Q4RA 3H6KA 3O8DA 2JEZA 1XAGA 1AH2A 2B98A 5IT0A 5TXGA 4KRYA 3MT0A 5D3QA 5LU8A 5IVHA 1MZVA 4IRXA 2YHSA 1TM3E 3R09A 2A0YA 2GN2A 4WPGA 1Y6QA 3EX7C 2QN6A 2P2ZA 1NBWB 1OREA 4RS3A 1KFJB 1CDDA 5J5VA 1T5OA 3IBYA 4Q82A 1Y34E 1P1BA 2Z1NA 4FTWA 2BDEA 1ZW6A 4Q4AA 4ZJYA 2H18A 2QRZA 3H5RA 4M1WA 4B45A 4MIEA 5BPFA 1Y33E 5ES4B 1OFHA 4HRXA 2VHQA 4J0DA 4JYZA 3FGOA 9GPBA 3U4IA 4ECEA 3L8YA 1DTWB 4GOLD 1ESEA 5DEIA 3DZCA 2F43B 2H92A 3B1KA 1OLSA 1AUOA 4G1VA 4NNJA 4Z0TA 2A9KA 4HWKA 4CDGA 4DIOA 2OXFA 1R37A 4FXPA 2ZB7A 5G53C 3MSXA 3SEAA 5T4EA 1ZUNB 4CUJA 4YR9A 3CEHA 4M0EA 5I47A 3A6PC 2JGJA 4KN6A 4DNXA 1UKZA 3IHWA 3IOEA 5I01A 2GAFA 3O75A 3DE2X 4CCSA 4UQLA 3KTDA 3ZDFA 5JYBA 1GRNA 2RARA 4MKFA 4ESEA 1W581 3LKVA 2O7SA 4NG4A 2FW7A 4WL0A 4EGJA 4LPKA 5E9WA 4YRNA 4D92A 5JZ9A 1CIPA 1FUKA 2HV9A 4OXKA 4H3HB 2F7SA 1KMQA 5LJLA 1QF9A 2CXTA 3NV7A 4XSGA 2ZWPA 1GN8A 4JJIA 1SFRA 4ZV9A 2JCXA 4TKMA 4ZCQA 4BNZA 4DDKA 1HORA 4DEXA 3U37A 4DM4A 3KQHA 1QGDA 1YK1A 3IP5A 3ZU6A 4ZHSA 1OQAA 3PFNA 3GP8A 2UXBB 1FU8A 2P30A 4FQ8A 2ZJ1A 3DHYA 1IXSB 1HYEA 4AAYA 2EVWX 4PYQA 2WUWE 3S2IA 1RKVA 2IZ7A 4IHKA 4PHGA 2YVKA 3WYBA 1SQFA 2YFYA 4UD6A 4F11A 1ABFA 1D07A 1OI7A 3KQUA 4JYMA 3CX8A 2EZ4A 1LI4A 1THTA 4OFZA 3GMDA 3FOAA 1O5TA 1RHUA 2FW6A 3L5KA 1RXVA 2OR3A 1Y7HA 3C8UA 2HW8A 1XRQA 4JCOA 4JLBA 2L42A 3GLTA 3O8NA 3H2JA 4BWVA 3FPBA 4OX9B 3AG6A 2AD5A 1EFRD 5LOVB 1U8FO 3HDTA 3WIEA 1JSCA 4BCDA 4UDNA 3OT1A 2YS7A 4NEHB 1DBPA 2X1VA 1GKKA 2I4TA 3D9QX 3B2EA 1O97C 4H7EA 3EGCA 4PNPA 3STTA 1DQSA 2YJNA 2B2NA 2YHUA 1NF2A 3OLCX 4OJYA 2ALJA 3CF2A 4B76A 5H81A 4QFMA 3KQKA 1JA1A 4J0EA 5AVOA 2HGSA 1GN9A 2HHHB 3DQQA 1WM1A 4H4CA 1G41A 4H6XA 5A4FS 4IXDA 2C3PA 3TOZA 1H9AA 5TPWB 1Z2OX 1MC5A 1Q17A 1ONSA 2PUTA 2Q7XA 2XLCA 4V02A 5ADUS 2O2CA 2EYUA 4V1CI 5KWJA 1NJ2A 5JOQA 2UUCB 2WB2A 2P0YA 4JV5B 4ZVQA 2Y76A 3D7RA 4GO1A 1YRAA 4AL4A 3WE7A 2GD2A 3CVJA 1KMMA 3LNTA 3IR5A 2PV7A 1VJTA 3H4VA 4GM4A 4N0EA 4TZTA 5DHRA 2NZXA 2HEGA 4FD2A 3E84A 4GNRA 4LF7B 1GNTA 5B3KA 5K4GA 4KOAA 3QEMB 3OA2A 3RS0A 1OV6A 3H3JA 1DXYA 3D6UA 4BFYA 5KQSA 4LGCA 2JG3A 3AUFA 1T0UA 3JCZA 1ULZA 3KKOA 3ODPA 3QKSA 4BBJA 5AJUA 3IMEA 3FDZB 3CA8A 4BGVA 5F35A 3FYHA 3RYTC 1C8VB 4QXQA 3ZS9A 4KV7A 1NUPA 2PIDA 2GM9A 4ROSA 1APBA 3UJNA 1IPEA 3QYPA 3VI3B 3HDHA 2Y0DA 1W85A 3PNBA 1BDHA 1V7QA 1PVDA 4CM8A 4QRIA 3O84A 3RUFA 2ZBQA 3IKLA 3WMGA 1ZGHA 1JMVA 2VPZA 2XUKA 3H2KA 4YGXB 3WL8A 3E05A 1IHOA 1QV7A 4BQIA 1G4AE 2BJWA 2GKOA 1JAIA 2NV2B 4HLNA 4L6CA 3TF5A 4KR2A 4D57A 3DMYA 1UEIA 1JXMA 1ZSYA 2CFIA 3MAGA 1G8MA 5FUQA 4JI0B 2VBIA 4KL8S 1IONA 1XGKA 4S35A 1DC3A 1UXJA 3PUXA 1OWPA 3O31A 1WEKA 1UOQA 2VSNA 3IUNA 1BWSA 1WUJS 3ESQA 3TN7A 4HWRA 3MUOA 5CA0A 3VSDA 1SCBA 3A4NA 1W5FA 3V8VA 1Y6FA 4JC8A 5DBEX 4MQMA 1NVTA 4FXOA 4HX2A 5IJWA 1JR6A 4R0MA 2YXBA 3FVRA 3HKBA 1CF9A 1PTJC 4JBLA 1S3GA 4JX9A 4NZNA 4A1OA 4OJMX 1DPFA 2OXRA 1ZAKA 4RHUA 5T64A 4MJ7A 1UC5B 4QKQA 5K0LA 2HSEA 2WJ4A 4NIMA 2WSSA 1H2YA 1BC5A 1RHMA 1FSZA 1W2HA 5JVDA 3ZCQA 1NU6A 4BVKA 2OV8A 1ZN9A 4OQFA 1KP2A 2ZSKA 3J81k 4MKGA 1YZUA 3CVVA 3IMGA 3O8QA 5KYVA 1KMIY 3E9YA 3L6BA 5EUCA 2G09A 1BROA 4Y98A 7REQA 2WD9A 3R76A 3PF8A 3DNPA 3HU5A 1DQZA 5AVUA 1L7PA 1AJEA 2JLVA 4DANA 1QAQA 1XXHE 1QUFA 1OY1A 3N2IA 1XALA 2O3SA 3NOQA 3QLJA 4BTLA 3DVQX 2IIVA 1O97D 2A9QA 4LSGA 5DWVA 4NENA 5BRNA 2C2OA 1TC2A 4B9EA 2Y1KA 4CKCB 2O4UX 4QQKA 4YMLA 4JBNA 4EMSA 4C4XA 2B37A 3DBRB 3ND9A 3Q7QA 3PFBA 4RTRA 1WIWA 1TW3A 4MQBA 1ZEMA 3S2UA 5I9TA 4OQDA 1MIOA 3GEPA 3FWHA 3P9SA 5EINA 3TW4A 2YUIA 5COBA 2D00A 4GZLA 4F60A 2XB4A 4CTKA 1P4HA 4O0MA 2R65A 3RREA 1XMIA 5CURA 5DX1A 2FSVC 5KVVA 1CLUA 2H1WA 2NXCA 1A98A 3TPCA 3GFVA 3N05A 3VTKA 2CV1A 5HZHA 4CDMA 1QJ4A 4JI1B 4EFMA 3ZUPA 1BXRA 1WMDA 4BZXA 1Y82A 2IYZA 2IYQA 4LDZA 4ALNA 4RMHA 1NUAA 4LZAA 4EBFA 1NYRA 5C7IO 2O8BA 3NUQA 4DYDA 1EBUA 1L5FA 2F48A 1X39A 2YNMA 1EJ2A 1KI9A 4CMJA 1PFGA 3AEQB 1S4QA 4IKOA 4N7MA 2P9FA 4LTNA 4URVR 5ARBA 4LCBA 1I3MA 4E0BA 3RTDA 1G8SA 1PWEA 5LQJA 4B2YA 3O26A 2ZQYA 1B0AA 4KWEA 3UBTA 2NYUA 2R1VB 2QDKA 4QTTB 1WO8A 3VR5A 3BTOA 3KD3A 1FLAA 1G55A 3PGMA 3VDXA 1DRKA 3I5UA 4CT0A 2R1VA 2WMNB 3KS9A 4X6YA 5JCOC 4MKXA 5LCXA 3KSBC 2B6HA 3T7KA 4YJ2F 4DNOA 3KAQA 1JZQA 3B9PA 4LW8A 3MT7A 1FL9A 2XTNA 4WNYA 4LJ8A 3I61A 3I05A 2D5IA 1NPYA 2YWGA 4PLCA 4CI9A 1ESDA 1I80A 3G2IA 3GFPA 4A8PA 3V6MA 2WLTA 5BV7A 3D0KA 2ATEA 3VVLA 1C3OB 4LV6A 4RENA 1B76A 3H4MA 3KOOA 3RTEA 4D82A 3H1TA 1Q92A 1VPVA 1OWNA 4MDEA 1DC7A 1K2WA 4LDRA 4NYMQ 4C2AA 4PNZA 1ESMA 1H9BA 3DWGA 4RXUA 1F2TA 2G28A 2V59A 1YB2A 4DMCA 3EODA 3EK2A 1XZKA 3FZGA 3LUGA 4C0LA 4YUXA 2VF5X 3DXXA 3FNGA 1ORHA 3I2FA 4JOSA 5EXDA 1DMSA 3K0EA 4CQNA 3PQ3A 1BKYA 1GEEA 4Q9AA 4IV8A 4PCUA 1UK6A 3IB3A 4WKPA 3IT0A 1MX5A 1GA1A 2IYNA 4NU6A 2YW9A 1P91A 3OZWA 1NUHA 4AJ1A 1V71A 2O0KA 3A9TA 1E1CB 1KJYA 4FWTA 4MV4A 1IHXA 1ZA1A 4LBWA 4NFLA 2BDTA 1V5IA 4MP8A 3MPOA 1S9HA 3AI7A 4MB6A 2VPQA 4K9DA 2QD3A 3EG9A 1MBZA 3FAZA 3FJYA 4EKDA 2NXEA 2QTRA 1JG2A 3FJOA 2HLPA 4AZ3B 2HMTA 3HJRA 1HRKA 3P2EA 4XQ9A 4M8LA 3SQXA 3OZXA 3IGFA 1O57A 2VDUE 3DMNA 2ZWIA 3N76A 1JEOA 1XB2A 2R8EA 2YQ4A 5JS8A 2AN3A 1G9TA 2IKSA 5EUQB 3WYCA 5YASA 4IVRA 4XE5A 4EL0A 3LS2A 3BX1A 3R20A 1RR6A 4ZHQF 3PC3A 4AMYA 4E2ZA 4A8TA 2GZ2A 2C98A 2J0UB 1BX3A 3H1GA 1M8KA 5EUMA 5FO1A 1RWBA 3IUPA 5LB2A 1YKSA 3ZX4A 5JEDA 1M2FA 2FMXA 4RTJA 3LBHA 3IH5A 3AHJA 2E4UA 1GXSB 2ACKA 3DNMA 1IG3A 3GGOA 1YKGA 1K0FA 5CLHA 3ZZUA 4PZUA 3OX1A 1J0XO 4WI1A 1BNCA 1JLKA 2HK8A 5CNIA 3EGXB 4CIYA 2HIMA 1ZCAA 4W7SA 3BDVA 4RKWA 4Q9JA 5C9ZA 4IKPA 2QGNA 4LRTB 3KTAB 4C07A 1QH9A 4NDNE 1MB9A 3TNDA 2M2IA 1U8XX 5I7UA 2JLCA 1Y98A 2J6CA 2DWOA 4FJ0A 3AZPA 4JBIA 3TLAA 1MQ9A 3GT7A 4UVGA 3OZTA 4MUIA 1DJLA 3EAFA 2R6R1 4LK2A 3BWXA 4HVLA 4OP2A 1EDOA 5L4SA 5LP6F 3COWA 4ER6A 1H4SA 4UU7A 1PJQA 1IPFA 2H0QA 1GGEA 2XE7A 1RVV1 2QDXA 3LKDA 4CL3A 3ZJYA 4KGXA 4MS3B 3RV4A 5L3SB 3AJDA 1G38A 1G20B 1E9BA 4L9WA 2PLRA 1A4RA 2QA5A 4GEGA 5DBFA 2XF2A 3CO0S 1JH9A 1IHPA 1R6BX 1T8WA 1UBJS 2HA7A 4ILEA 5BQOA 4NG5A 5SZKB 4P98A 3QSYA 4XWAA 4BEVA 1HEIA 2QUIA 4JHXA 5EIXA 1M74A 1NLUA 4BKRA 1M33A 1U8AA 1XTSA 1EYZA 2DHCA 4QQNA 2DUMA 4C88A 3BJMA 3V2HA 2HRDA 1G5TA 2OQRA 3OEHA 2QPLA 5D3ZA 4MV1A 4EYQA 3A7DA 2K7FA 3IPCA 2PMCA 4FFPA 4V03A 4EYGA 3O7MA 4M9CA 5IZCC 3ZWDA 5J2UB 3I3OA 1YS9A 4DNFA 4Y6QA 3NHWA 4EKGA 1ZUD1 3NATA 5JQGA 4RIGA 2X5JO 1DV2A 1OBVA 1U3CA 1HDRA 2P3OA 4KWTA 5H02A 4KR3A 1RQXA 3OTQA 1XHLA 2P0EA 2C61A 1SEPA 1SKAA 1VL2A 4P1ZA 1RJEA 5LMZA 3E1GA 4UUAA 4UNIA 4UKDA 3QEJA 3LAWA 3UYLA 4DQUA 3DULA 4FOSA 5DBIA 4I9HA 5DHPA 1JEYA 3MFYA 1CE8A 1H0HA 4RV5A 3E18A 1CD5A 5I7WA 1ZXLA 3AUSA 4TMXA 1DKRA 2PN1A 2EFDB 2VAMA 3JD3A 3U0BA 3L2OB 4D3YA 2R25B 4F8EA 4BAUA 3H84A 3ML1A 1IHYA 5FLEX 3OZDA 3B38A 3G2NA 3QLVC 5TR9A 3RU2A 5LDHA 2CLLB 1ZMOA 2FWIA 3GBVA 2PT9A 1CULC 2WM9B 3PU6A 4F4UA 1KYYA 2Y2VA 4EJ2A 1JNXX 3OJCA 2O1XA 5FOTA 4MWCA 1GTJ1 3CW9A 5KCMA 1CZOA 1QC5A 2Z30A 4PRZA 3A36A 3CF0A 1OX5A 1HY3A 1JUDA 2BAGA 2VJNA 2ZJFA 2CKMA 3KJXA 1I30A 3FE2A 3QPAA 1FMTA 1Y1LA 2VDWB 2BV3A 2MU1A 4H7FA 3USES 2VJOA 1ZISA 4BGIA 3EAQA 2ZYDA 3R5HA 2NVWA 2ODBA 3QV2A 2ZR9A 1KAMA 3VPXA 4FLEA 1P17A 4MPTA 2O3UA 4PLPA 2NP7A 4LHXA 2QORA 3GMIA 3H9EO 1Q0RA 3KZCA 5AKZA 2ERCA 2N1MA 1PJ4A 5EC8A 5HZGA 4RTSA 4D44A 3HJBA 4N5MA 3VR3A 1VQ1A 1DJOA 1QJCA 1JTEA 1RACA 1Y3HA 1Z75A 2GKSA 2GZDA 2X7XA 3R5KA 4O0LA 1WHSA 4XAQA 1GUFA 4GPIB 4H59A 3OKFA 2O5EA 3JQ7B 3AKDA 2NSDA 1H4VB 3RT9A 2PWYA 3C43A 1B00A 1G0OA 5GQSA 3W3ZB 3B2QA 3CNNA 4D8WA 4URZR 1T8TA 3ICVA 3K2EA 4REQB 3DMTA 1PG2A 2JGMA 2I4NA 4C4YA 3RCBA 4YRLA 1NJ8A 3KM0A 4EB6B 1PYDA 4WKCA 1C5KA 3K09A 1IN1A 2I29A 3R5JA 5BQFA 3QVXA 4RFSB 2P2DA 4BEWA 4B3CA 3NYQA 3RSCA 1V0JA 2CB9A 1GPBA 3D6TB 4BKOA 4TVSA 4DYHA 1P33A 5B2ZA 1HKUA 4RBNA 1ELOA 3HRIA 4LOHA 1IN6A 4J0CA 2N46A 2HRBA 5CYPA 4PLHA 1S2MA 2B7CA 4C0AC 3RE1A 3QBJA 1EGHA 3UW1A 2G80A 4JLWA 4B6RA 5IMBA 4XJSA 4N3BA 2REQB 3QU5A 3DFZA 1QHFA 2FAXA 3BMQA 1UAAA 1T3ZA 2BGUA 3RYFB 1YQTA 3H6HA 4QPPA 1T9AA 4KIGA 3WIUA 3WR5A 3T15A 3PD1A 1Q84A 3MUNA 4URWR 3HZHA 3DO8A 3JR3A 5JFGA 4OLBA 1MDFA 3AMVA 3ONNA 2RJ3A 2Q45A 2WUDA 3OCJA 1FE8A 2NACA 3PXBA 2RBKA 1MUUA 2O1SA 3B1WA 3OLWA 4BC1A 1X1QA 5IZ4A 4HGRA 3V4FA 4IJ6A 5KOHA 3LQRA 3ESXA 1YOBA 4IRMA 5LC1A 1EDBA 2O0LA 3L40A 2C9ZA 4QAQA 3MMPA 4K3UA 4G36A 3MERA 4LHWA 1M7BA 2GPTA 4J0KA 1NVXQ 2AN1A 3UV7A 4EGFA 3TE7A 3DOCA 2ZTUA 1A3CA 3TNYA 1AIPA 2BEWA 2Z5FA 3PUZA 4TTAA 2ZCJA 1ZOOA 1XDZA 4H3VA 3L6CA 4MAMA 4PQGA 1NJ1A 1NX9A 5JBQA 5FFFA 1TTTA 1P9WA 1L7MA 3ACCA 4UTNA 5JH7F 1WCIB 4DMFA 2QTHA 4GL2A 1F4LA 2QUHA 5FR1A 3SS8A 1SCUA 4MMYB 4CVNA 4EWLA 3PVCA 2XR1A 2VRBA 5EXTA 2OOKA 4F5YA 3C3BA 1G8GA 3A9UA 1IBCA 4EYKA 1KAQA 2YXLA 1Z8DA 4KGVA 3SQDA 2MYPA 3N39C 5H83A 1I4WA 1M75A 3DJFA 1GTZA 4XYEA 3UN1A 3CVUA 5E95A 2BP7B 2J0UA 2QPOA 3IV7A 3OLXA 1IVNA 1E1MA 2EFHB 2JAUA 1JVNA 1DJPA 2ORIA 1XR3A 1JHUA 1YL6A 4NE7A 3GLHE 4MRRA 5EMMA 4B17A 2H11A 1WPXA 1HTWA 1BE1A 2WWGA 4XYMA 1ZJJA 3ZV6A 4ZYLA 3FFXA 4BLSA 5IWAB 5KWEA 2JFFA 3ZUGA 2ATCA 4BO6A 2PS9A 1QK4A 4P35A 4GE0A 2JEOA 4WLUA 1DX4A 2CWWA 3I83A 2B6NA 3P9IA 4X1IA 3WQHA 2X2EA 1UM9A 3GDFA 421PA 5J4KA 1O1YA 4X62B 4X54A 2ZQZA 1S89A 5DW3A 1KJZA 3OE7A 1A5ZA 1JYEA 4G3XA 2J1LA 2AHRA 2IV3A 3E61A 3ZGOA 5C3UA 2QLNA 1HYBA 1ZJ6A 1Q6ZA 1WZIA 1GUZA 3JTEA 4L0MA 2J67A 1GAWA 3DYVA 3OIUA 4IVPA 4E30A 3K0SA 1O5OA 1AMNA 1N6LA 2COKA 3UAOA 3ZWBA 3AF5A 4TZKA 2NM0A 1KJ8A 1NKSA 2Z8YA 1GR0A 4OUKX 1GV0A 4BNHA 2FPRA 1FPQA 3NP9A 2UZ3A 4QYTA 4WNAA 1IMJA 3SD7A 2I4RA 4CLXA 1JXQA 3NR2A 4EHAA 1G6HA 4MLDA 5K8UA 3RYCA 4HS9A 5HVNA 1NNLA 5JZMA 4PZLA 1Y1KE 3BPSA 2NZJA 1W2GA 1T0BA 1S2NA 4OXRA 5D3MA 4P22A 2CYBA 1UZLA 2VYVA 221PA 3GZNA 5FUYA 4K6CA 2VPPA 2FJUA 5LDDC 5ERGB 2IH2A 1OX6A 3OIGA 4IG9A 4ZO9A 4WJLA 1QYDA 1XAIA 2GCNA 3O7WA 4NYIR 1YU9A 3I9V1 3K70C 1YC5A 5CB6A 4EEXA 3WRYC 3HKCB 3KB6A 1VYVA 3QHAA 1SVOA 5BR8B 1MB2A 1NQVA 3IIKA 3QWBA 3A8TA 3EZXA 4QL3A 4V38A 3IURA 4MVJF 1JFRA 3ZN2A 4AUNA 1KO5A 3NHAA 2C7OA 1MAAA 1WXXA 5M34A 1N0VC 4IPTA 4M60A 1XNGA 2C82A 2GJ4A 1PX2A 4V2UA 1J4AA 4RW0A 5GONB 4D99A 4P3YA 1V8BA 1Z6YA 4ENRA 1CF4A 2BC9A 3D0RA 3QVTA 3VSEA 2YRFA 2JNWA 4FC6A 3S99A 5L40A 4YT8A 3U4CA 4UUQA 4MWDA 2PE5A 2FE4