2WMYA

Crystal structure of the tyrosine phosphatase wzb from escherichia coli k30 in complex with sulphate.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
143
structure length
143
Chain Sequence
MFDSILVICTGNICRSPIGERLLRRLLPSKKINSAGVGALVDHTADESAIRVAEKNGLCLKGHRGTKFTSALARQYDLLLVMEYSHLEQISRIAPEARGKTMLFGHWLDSKEIPDPYRMSDEAFDSVYQLLEQASKRWAEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Capsular Export Regulating Tyrosine Phosphatases Wzb of Escherichia Coli and Cpsb of Streptococcus Pneumoniae.
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords PUTATIVE ACID PHOSPHATASE WZB
total genus 55
structure length 143
sequence length 143
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wmyA00
4RSMA 5B3JC 3IP9A 4MQEA 1TMYA 5IBQA 3RVOA 3M9XA 2I6FA 1URPA 4TMYA 1YS6A 2FLKA 3MYYA 3SQNA 4LDAA 1CHNA 1I3CA 3SG0A 3RVMA 1JHZA 4MS3B 4RY8A 1D1PA 5EWLA 3D02A 3OLXA 1FFGA 2LBPA 3G85A 5IX8A 4S05A 1Z17A 4G0XA 4Q7EA 2A9QA 3HO1A 2ID7A 3KHTA 4GNRA 1JX6A 3CRNA 5JNRA 1DRJA 2PL1A 4RV5A 1ZY2A 3O1JC 2GWRA 1RZRA 5IULC 4L85A 2L18A 2PUBA 2PKXA 3OLVA 4IF4A 4G0QA 4ETNA 1ZESA 2H0AA 2HSGA 4EYQA 1H9CA 1DCKA 2JBAB 4OTZA 3MM4A 1JFSA 1ZH4A 1NXTA 4G0ZA 3MMNA 4MRMB 1XHFA 4YP9A 4UHJA 1JH9A 3LUAA 4KVFA 3OMXA 4H60A 5EWJA 2JBAA 3HVRA 1TLFA 3H75A 3GA5A 3O1IC 1GUBA 3F7NA 3LUKA 3EGCA 1ABFA 3RVPA 1AB6A 2CHEA 4FE7A 4RDCA 5FBKA 1Z26A 1KGSA 2WJWA 3QELB 1M5UA 4XFKA 3N6VA 3GT7A 4RK5A 1LJLA 2DRIA 3UUGA 3H5OA 3HCWA 4HNRA 4MS1A 4QYMA 4XAQA 5JNSA 2A9PA 3LUDA 4DN6A 3NNNA 5KWSA 2WRZA 3E61A 4KK4A 3KYJB 3CS3A 3EJWA 3HJFA 1Z16A 2MYNA 5TQ2A 3HDGA 4PYRA 3M6MD 3QLVA 5CHYA 1KMIY 4P98A 4F3TA 1BDJA 3DBIA 3OM1A 3H1EA 4E7PA 6CHYA 5DTEA 3A0UA 1C0EA 4YLEA 4WWHA 4XASA 2BGGA 1Z15A 2PMCA 3CG4A 5IUNC 3GL9A 3T8YA 3LUCA 3D8UA 2QZJA 3IPAA 4FB4A 4DQDA 1D2AA 3MF4A 1LBIA 4MS1B 4N0QA 1E6LA 1ZGGA 2CHFA 2FEPA 2PUAA 2PLNA 3NHMA 1MAVA 2J48A 3BBLA 4RZSA 1HEYA 4Z4IA 2PUGA 2WB4A 3H5IA 3SAJA 4F8JA 1YIOA 2O20A 3RVSA 3DZDA 3VNBA 4KRFA 2XDYA 1JWLA 1NY5A 1F51E 2VUIB 4Z4HA 1E2BA 3L49A 1S8NA 2FXIA 1ZGZA 2L19A 4G0YA 3HS3A 2IOYA 4Z9BA 2LP4Y 4Q6WA 4HNSA 4Y9TA 2JVKA 4LE0A 2QR3A 4MQFA 3CG0A 3JVIA 5FWYB 2VK2A 3F6CA 1A2OA 1YK1A 4WZZA 1TJYA 1QO0D 2LPMA 1RXEA 1XHEA 5HSGA 1BAPA 4G0OA 4YS6A 5FBHA 2WWVD 2HQBA 5TPZA 4KQ9A 3FFTA 4W5RA 4ML3A 5KC9A 1QNLA 1NXSA 1DBQA 1M5TA 1NXOA 1SXHA 1W25A 4RXMA 3I5AA 3N0XA 4RXTA 3JY6A 3GV0A 3L6UA 3F73A 2FTKE 1NXPA 3R0JA 3H6HA 4YWHA 2FN9A 2E4ZA 3VNAA 4KREA 4F11A 4RS3A 4ZMSA 3OO0A 1FSPA 4FE4A 1SXGA 3EAFA 2V0NA 4H3KB 3NNSA 4RXUA 4EY3A 1JBEA 3MQ4A 5TPZD 4ZJPA 3T38A 4RK0A 4OLAA 3HSYA 2TMYA 3H5TA 4MRMA 1BDIA 2N9UA 3T6KA 1AB5A 5ABPA 2IPLA 2YHAA 4KV7A 4Q6BA 3OMWA 3QX9A 1KRWA 3CKMA 2CD7A 2HQRA 2JB9A 4LDZA 3CNBA 4Z0NA 4TLLB 2NZUG 3IP7A 3OLWA 5JNTA 2LIVA 2E4XA 4EVSA 1DCFA 2PJUA 1L5YA 2FMIA 4IGAA 3F6PA 1U2PA 1DBPA 1Z13A 3OLZA 3QLVC 1ZVVA 2JVIA 3NHZA 2FMKA 3RQIA 5F64A 3H1FA 1P2FA 1ISRA 3FFXA 3QEKA 4JP1A 4KK3A 3LUHA 2PL9A 3CZ5A 3C3MA 1P6UA 2RJNA 1F4VA 4WXMA 1FFWA 5TQJA 5HM6A 1EFAA 1U2QA 4Z4GA 2FW0A 4PE5B 1RXIA 2JK1A 2MSLA 3NNDA 4RY9A 3EDCA 1M2EA 1JF8A 1VRVA 1JL3A 3OM0A 2MYUA 3K4HA 2E4UA 2A9RA 5GOTA 5B3JA 4MS4B 3IDOA 3IPCA 3KSMA 3O1HB 3FFWA 3OLYA 3Q7SA 1XWWA 1QKKA 3T95A 4Z4CA 1YMUA 3ROTA 2QW1A 1LK0A 3KG2A 1CEYA 5KQPA 4UHKA 2R4QA 3SY8A 1SD5A 5KQLA 2MYTA 3HDVA 1IIBA 4MR7B 3URMA 2OENG 4G0MA 5TE9A 3QK7A 3B2NA 2IYNA 4KQCA 4ETIA 4MR8B 3JPWA 4WT7A 4LZLA 3Q7RA 3QLTA 4QYWA 4E7OA 4NCBA 3EQ2A 2GBPA 3N8IA 4RY0A 3QLUC 4PZ0A 4IILA 1TVMA 1DC8A 1L5ZA 3A10A 3KLOA 4D6YA 3E3MA 4JA2A 3I42A 5EWMB 5JS1A 1NXVA 2OQRA 1QQBA 4W5NA 1BDHA 3ILYA 4LRQA 3H5WA 3HUTA 2RDMA 4L4UA 1PHRA 1U0SY 4IRXA 4N0PA 5IEJA 3RH0A 1NXXA 4W5QA 5IC5A 1CYEA 2JRLA 4NV3A 2IPMA 1BA2A 4MR8A 1SRRA 1P8AA 3N75A 1QQAA 1P6QA 4RK6A 2HQOA 3BRSA 5DGCA 5ED4A 3HM9A 5HKOA 1DG9A 2JCGA 3O74A 2NZVG 5IEBA 1EAYA 1PEAA 3KLNA 3CZCA 1D1QA 4MAAA 4W5TA 3HK2A 5I4CA 4RWEA 3QLUA 4Z9AA 3Q9SA 1ZH2A 2RGYA 5BRAA 3CLKA 1DCMA 3Q7TA 3O2JA 5D2CA 4EYOA 4N41A 4ZPJA 1GCGA 4EGSA 1QP7A 4MS4A 3EULA 1JFVA 2MYPA 2M1ZA 4WXEA 3LFTA 4KMRA 3FMVA 1JYFA 2VYCA 4QICA 3TO5A 4XLTA 3RVQA 3TB6A 5T7BA 4O5AA 3SNKA 4D6XA 4XXHA 2KYRA 5C5EA 8ABPA 1E6KA 5EWJB 2WJAA 5CNMA 5CNJA 4OATA 2LUOA 4MS3A 2FN8A 5CNKA 2NT3A 1UDRA 1VKRA 4KZKA 4OBBA 1BVHA 3DGEC 5DCLA 1JYEA 4WUTA 4KPYA 4CBVA 4TN5A 5JNVA 1TM2A 3QELA 1B00A 4Z4EA 1DP4A 4O1IA 5BQ3A 1ZDMA 3EQZA 4MR9B 3LUFA 2E4VA 3HXMA 5KC8A 1DBWA 1SXIA 1YVUA 3OQOA 2QV0A 2PUCA 3HEBA 2GKGA 4IMJB 1DJMA 4N76A 3LUJA 5JNUA 2HJ9A 2B4AA 2QXYA 2W42A 3KKEA 2WMYA 1DZ3A 5FWXA 3FGZA 4YGXB 2PUEA 5TQ0A 4TLMB 4RU1A 1MIHA 4JB0A 4LX8A 4MPTA 3G1WA 5IUKC 3C3WA 4F06A 2FEWB 1RPJA 1USKA 4EVRA 1D4ZA 4N03A 3W9SA 5T3YA 3UKJA 4GPAA 3P9YA 1DRKA 4MLDA 2QVCA 2FQXA 3EODA 5JS2A 3N0RA 1ZHHA 3RVKA 2VUHB 4JASB 4RK1A 4EVQA 2FQWA 7ABPA 6ABPA 4YRZA 2WY2D 3KCNA 4P1ZA 1APBA 2L17A 5DLEA 4YR7A 2FEKA 3H6GA 4RKRA 5EWMA 3ILHA 1ABEA 2FQYA 4RK7A 1RZRD 3HZHA 4KFCA 1PNTA 2FSPA 5CNIA 4YO7A 2NT4A 3K9CA 5EWLB 3SM9A 1MB0A 1Z25A 1U04A 1Z12A 2M98A 2MSKA 3H1GA 3I09A 4Z4FA 1ZN2A 1JDNA 1NATA 1NTRA 3Q41A 1GCAA 3GYBA 5KQGA 1JFTA 4MR7A 4G86A 1PEYA 2QSJA 1DC7A 3GBVA 4MQEB 1YTUA 2IPAB 5FWYA 2PAFA 1GLGA 2E4WA 1OXBB 1T34A 3HUUA 4MR9A 3MIZA 3JPYA 2IDMA 4Z99A 2RJOA 5TPWB 4G97A 3RVRA 4H3HB 3RVNA 4KNYA 3BRQA 2IPNA 2R25B 1EWKA 4IMIB 4RK4A 1YS7A 1QMPA 2MSWA 5FWXB 2YHBA 2QU7A 3KJXA 4OG2A 1USGA 1USIA 3MA0A 3OQMA 1QP0A 2FKAA 1Z2DA 3C3KA 3GRCA 4PEVA 3M9WA 1VPWA 3TD9A 1FQWA 2FLWA 2GX6A 3GWGA 1VLZA 1ZAYA 3DGFC 3TMYA 4S04A 3IP5A 2CWDA 1PUXA 3DLBA 5TQ0B 2QVGA 1EWTA 4ETMA 5E3JA 3C6QA 2X7XA 3O21A 4YCSA 3CTPA 3N53A 4MLCA 1A0OA 1QO0A 1E6MA 3JS5A 3N0WA 4PICA 3S99A 4MYRA 1WETA 4MQFB 1Z2EA 3CFYA 3LTEA 1LBHA 1RNLA 2JVJA 2FMHA 3CU5A 3O2SB 1FFSA 2H3HA 4HNQA 5JNWA 3CHYA 1D5WA 5DKFA 5C5CA 3LMKA 3KS9A 3OQNA 2P9HA 3A0RB 3Q15C 1W9HA 4G0PA 3FDFA 3QEMB 5KQMA 1EHCA 2HPHA 3A3KA 3JTEA 1JLKA 3KYIB 3ROFA 2A9OA 4DADA 3LKBA 5HQJA 1ISSA 4EYKA 3DLHA 1M2FA 3GBPA 3H5LA 2FVYA 3OO1A 3UK0A 1YK0A 3O2QB 2L2QA 3RVLA 2AYZA 2E4YA 2NUBA 4QPJC 4LE1A 1R8JA 1K66A 2GI4A 2P4UA 9ABPA 1PNRA 2Q5CA 4EUKA 1NXWA 1QPZA 4B09A 4EYGA 2PUFA 1JDPA 5GQSA 4ZMRA 4O1HA 4XARA 2B1JA 5KI6A 5BRJA 4NCAA 3I45A 3O75A 3KTOA 2PE5A 3TX6A 4JAVC 1EWVA 4F12A 1Z18A 1LJUA 1U8TA 1J56A 3NBMA 1GUDA 4JB2A 4LE2A 1Y1LA 5PNTA 3BREA 2F8SA 4HYEA 4NICA 3C97A 2AYXA 2PUDA 3LUGA 3LKVA 1KRXA 2ZAYA 3QX8A 5TQ2B 4YV7A 4OLBA 4RKQA 2F8TA 4MGEA 1MB3A 1YMVA 5BR1A 4NQRA 2ZWMA 4W5OA 3LOPA 2FMFA 1ZITA 1OXKB 2IKSA 2R48A 1MVOA 1QP4A 3JVDA 4N47A 4ZYLA 3RVJA 2ID9A 5TPWA 1C4WA 4D74A 2R47A 3HV2A 3QEMA 3H5VA 4M88A 5IUJC 3BILA 3IP6A 1K68A 4JOQA 1A04A
chains in the Genus database with same CATH superfamily
1UZMA 1QQ5A 3RR2A 1DXHA 5C1DA 3M9XA 3RSZA 2ZSJA 4AMZA 1V35A 1W87A 1XDWA 2EW2A 3EN0A 3WRXA 3DCIA 1KZGB 1SBQA 3L41A 2WWIA 4DB2A 5EIAA 1C1XA 5I7HA 4JGGA 2Q7XA 4G41A 4WMLA 3FOEC 1MGOA 3OF2A 4L8WB 1E3EA 3BSWA 3HKBB 3MIIA 5JUWA 2GUWA 3TZEA 2HCRA 2LBPA 1JG4A 3QV2A 4YJHB 2G1AA 3SU8A 4ALLA 1P2BA 2APJA 1L1FA 4DUGD 2X1HA 1SVKA 4DLUA 1MA3A 4Q39A 5DULA 2ZM5A 4DMFA 4WINA 1R8XA 1O96A 2EERA 2E87A 4BNIA 4P3YA 2PKXA 2QIPA 1YUBA 2QL5A 2QU8A 3KXKA 1K08A 1OWOA 4HDNA 3BAZA 2FJUA 4L08A 4CM4A 5LQNA 3RUHA 4JLSA 2Q28A 3VAZA 1ZVMA 2HDHA 2I4RA 1CUCA 1OT5A 3AFIA 3KEOA 3PYMA 4NR0A 3DVAA 5DCUA 4ZRNA 5AT1A 2YV5A 1UJ5A 1A8IA 3TW0A 2XYQA 4K8OA 2BVNA 4HH4A 5A5VA 2J7PA 4J49A 2X9QA 3IR5A 1DNPA 1VKJA 3M4XA 4D46A 1R0XA 1CD5A 4CV2A 1E7WA 2J9FB 2VZLA 2WFLA 5SZJA 3W5JA 2CL5A 5D8DA 3DD5A 4MV0A 1USUA 1WCYA 3TJZA 4AWXA 3G2OA 3OJEA 3IJEB 4GMDA 4EG7A 1JLLB 5C31A 2P4QA 1TYEB 1X1QA 2OZEA 3CVJA 1YUMA 3C7KA 4PRZA 3GN2A 2O2XA 4R84A 5DBFA 3WLFA 4QT4A 1JPNA 1UBUS 3H2BA 1T1GA 3DS8A 3L7JA 3Q8WA 4MYCA 4KKVA 2AW5A 3VPFA 3HI6A 1EJ0A 3NBXX 5KNBA 3VTFA 2ZWPA 5ICSA 2JKVA 4LZAA 1W75A 2WG2A 3LC0A 4XAQA 1Q1QA 1ZRSA 2GD0A 3OY7A 4MRVA 2XYVA 4WIAA 2XOKA 5JRZA 1EI9A 1XL1A 4WXHA 1Z16A 3Q1LA 4BU0A 3V4PB 1TECE 4JIMA 5TQ2A 3UMSA 3FPHA 4E32A 5FJJA 1GTG1 3RLFA 2ZRBA 4MB2A 2ODAA 3ST7A 2RHJA 3IOEA 2HA5A 4IJKA 3U0BA 4EMTA 2A92A 3FKQA 1FNSA 1RAAA 1RWVA 1JQ3A 4H7KA 1UPBA 3ABZA 1A95A 3T35A 1SGWA 3I6YA 1XNHA 4IDNA 4PSKA 1BDBA 2DUNA 3LT1A 4HDAA 2TMGA 3NOQA 1K92A 5LLTA 3EC2A 1UBFA 4N3AA 1RFGE 4PG4A 2BTQA 4LYEA 1JLHA 4HD8A 1X1TA 1O4WA 4TSKA 2AXEA 1AGNA 3CZQA 4YRSA 2QB5A 4UMVA 2JEOA 3RYFA 1QFZA 2B6HA 3FNRA 1S89A 3TTYA 3CBGA 4G5XA 3MMSA 1PIWA 1XR3A 2XUAA 5A4IS 2QIOA 2VUIB 2BFNA 1M7GA 1IXRC 5FUVA 5TXGA 4O2AF 3CWQA 5IXJA 4PHGA 4J76A 3E6AA 4BDSA 2IZ0A 2PTGA 1X39A 4OUDB 1YBHA 1R9NA 1SULA 2NVOA 4RYDA 4AO7A 3MJCA 1CUVA 1JV2B 2IFTA 1ISFA 4RM2A 1F8GA 1SG6A 4M60A 4AY4A 4JP8A 2RC5A 2VZEA 4YP7A 5A1JA 2RE8A 1S4QA 3BEDA 2VHUA 5JADA 4CXMA 3DDCA 2BTQB 5CIQA 2IF0A 5J43A 2GZSA 2IIBA 4AQ7A 4II7A 4ZOCA 4DV0B 2IW1A 5E6SB 4DCGA 5E1MA 3NH6A 2V7QD 3D5QA 3D8HA 1EUZA 1JT2A 2J6BA 1PBTA 3TSCA 2E9SA 1ZOSA 5IM5A 4LEIA 5JO0A 2GR9A 5CDFA 3ZBTA 5JSHA 3NP9A 3R0JA 1GGVA 3H6HA 3B51X 1M1YA 2E4ZA 2R1TB 2D74A 4TOIA 1KO4A 4OYRA 1FSPA 1UK7A 2W6OA 2YWBA 3SFVA 1DKOA 3NT4A 5HR5A 1LS6A 4X62B 3G68A 1UOPA 3ZNPA 3KSRA 4FN5A 3BPSA 1YZKA 1JBEA 3PEVA 3C70A 1KXZA 3A1DA 4JI5B 4AZVA 4GL2A 4UQOA 2DFLA 1FK8A 4EDHA 4RUKA 5T4EA 3T38A 1YA6A 2PX2A 2RI1A 3NC4A 4ZN6A 3KJQA 3K4PA 3LO5A 4V38A 3GLIE 3LZ6A 3WRWA 5A4MS 2A58A 1MEJA 3MT8A 1S1CA 1GNPA 1MABB 1V5FA 2AC2A 3EUEA 3LNTA 3NEYA 4ITRC 3SX2A 3ADBA 1MOZA 4ZVMA 3CKMA 5IHXA 2BZGA 4P0QB 1NURA 1FPQA 2JB9A 4MKXA 2FRXA 2ZTHA 3THXB 1HE2A 1NQOA 3CJRA 2C29D 1OXXK 3VU9A 3OLWA 5JEDA 5EJ7A 4G0VA 3I1YA 2CV2A 4PBRA 2R2GA 2A9JA 3OWXA 4WZ6A 4D9MA 1O87A 2Q5OA 2ZIUB 1XK7A 1KEWA 3IUJA 4KPEC 2ZVPX 3UOGA 2RBKA 1GGHA 5FOSA 1C4OA 2ADMA 3AUJB 4W63A 3QX7A 2ZIEA 5KPJA 2JJ8A 3NIGB 2YWXA 3FFXA 3QEKA 3JSXA 4I0WB 1ECJA 3QEOA 1TQDA 1P73A 3E5HA 4OU5A 4BCBA 1NBAA 4MRSA 1FC0A 1V8PA 3LYHA 3SHWA 4R7GA 5LQUA 3DE6X 5AKEA 1UQRA 2ZUCA 3MWEA 4H1UA 5DNAA 3EVBA 4U1RA 3WTCA 4D9BA 4RGBA 5DNDA 4ZTZB 2V45A 4RY9A 3DEAA 1N9GB 1X1CA 4HPXB 4JJIA 2P62A 1GGFA 3WLPA 3P26A 2GB4A 1QPGA 2C57A 3AJAA 4ZZ3A 1S4MA 4FKZA 1QTRA 2C94A 2B99A 2HRRA 2WJIA 4HJXA 4BWGA 1D4OA 1XTPA 1Z2AA 4LYHA 2F1IA 3IB3A 3IFSA 4DJDC 5A2GA 1KIAA 2P40A 3BK2A 3H1PA 5IDXA 3FTFA 1QF6A 3VNVA 1H3FA 4RMIA 3LW7A 2JG3A 2YNMC 3EF3A 3GVIA 2RGDA 3SQOA 2WAOA 4WY8A 3MWDA 1S3IA 4NONA 5H3HA 3OU2A 5J2UF 3OM8A 3OLCX 4RA6A 4XQEA 5AK0A 2BR3A 3A25A 3QPBA 3U4QA 3WNZA 3FMFA 4K9NA 5L3RA 4II3A 1Z5UA 2RAVA 1SEVA 1E77A 2FPLA 5EJMA 3TTUA 3CZAA 3FWZA 4HDRA 2YYAA 1BOFA 4AICA 5KB3A 4JLUA 4LRQA 4LVOA 4A3SA 2BCGY 3H5WA 4L4UA 1BQ3A 1ID8A 2GYUA 1KZ7B 1DAMA 4RD2A 3ZHRA 4P35A 4UD6A 2QRUA 4NS4A 1HDEA 5IK2D 1SVOA 2OAQ1 4UE3S 1E6UA 2VDPB 3IVAA 4RCZA 1CYEA 1SC4A 4G56A 2PU5A 3KZVA 4IX9A 1N5OX 4HXGA 5CCEA 5LZ8A 1IVSA 1BVYF 4ZAVA 4MVJM 2PH1A 1NUHA 3HPRA 2HQOA 2ZFUA 3BRSA 1S2IA 4AU1A 1NJ8A 5AUPB 5BY2A 4B3MB 1F20A 4WZBE 3GUVA 1X70A 5ALLA 2IJGX 2FW6A 3O74A 5T5QA 4Q9AA 4J4BA 4BLWA 3G9UA 2C5AA 5AVKA 5AJTA 1SEPA 4I1OA 1E9RA 2A5GA 4A26A 1K1EA 2RIPA 1JE1A 3TEFA 1W7AA 3FSGA 4D8TA 4B35A 5E6RA 3AB8A 3EFOB 3GAFA 4KVZA 5KEIA 4YQFA 1M0TA 5DYTA 2IYUA 1ORHA 4RTRA 4FMCB 4OI0A 1E89A 4AP6A 4ZPJA 1GCGA 4EGSA 1IJEA 3WLQA 1QO9A 3T1YB 2GLXA 4V02A 4Y2HA 2PR7A 4X9XA 1EVZA 3LFTA 6AT1A 4CEHA 1SUBA 1Y3IA 3LIIA 3BRWA 1TJ4A 2VYCA 3K09C 4HGRA 5FHQA 4E33A 2PVCA 2A5LA 1D04A 3ER6A 2ZG6A 2ZRHA 3O92A 3RTCA 4D4LA 1YR6A 1ZZGA 3WNVA 4ZVSA 4BP3A 1MBZA 2X2PA 4EI9A 4JXZA 2H1LA 3BULA 3P0FA 3ZR4B 1U8ZA 2V7EA 2CMHA 1E64A 2JHCA 3TSOA 4YO8A 3ZQ4A 5DK6A 3UG6A 4Q3NA 1H4VB 1L5KA 3TLCA 1GVNB 5KMGB 2X4DA 2MSCB 3B13B 2XWQA 4JBLA 5DCLA 1O0SA 5EZ5A 2AR7A 2J32A 5HMMA 3RT7A 4TVBA 3QKRB 4ZTUB 3IQGX 4MAMA 4F3CA 3QI2A 1X92A 3BKXA 3I76A 2Z8YA 3IVMA 3LUFA 1LDEA 1DRVA 3R20A 1P5FA 1H2AS 3URKA 5J2UA 3HWWA 4U7TB 1J8FA 1RU3A 4JXKA 4OO3A 3BJRA 3TL3A 4N3NA 1E1DA 1G41A 4KUEA 1DZ3A 4YGXB 1WQ3A 4KO3S 4CG1A 5AKIA 2P3QA 2OHIA 1THZA 1MIHA 1EE1A 2FWMX 3C87A 4HMOA 1QORA 2ZE6A 3L9WA 4M8LA 3RKUA 4C6TA 3IXLA 1JHXA 2R84A 5C1PA 1EPUA 2ES4A 2H4ZA 4ROSA 2VQ3A 4YLYA 4BGVA 2FP3A 4YV1A 1X1EA 2F43B 2V58A 1MKYA 2HHAA 5BQFA 1E4EB 2RHBA 3NHPA 4TKZA 3G9QA 4WBNF 4ZTBA 2XGGA 4I99A 4HMQA 2WP8J 4DMGA 4C7VA 4FYJA 1TB4A 3DNPA 4C4YA 2VAVA 1JXAA 1PS0A 2JGRA 4ZQBA 3KT8A 4G24A 4DA7A 5KBYA 2V3CC 4A6XA 4EQZA 1EEXB 3H6GA 1ABEA 4TL8A 1LEHA 5JBQA 1K5PA 2JBWA 5REQA 5J2TA 2Q9UA 1F6DA 2FPPA 4GUDA 5IDVA 4OJTA 4UM9D 1MOSA 1Y7TA 1C81A 2OQVA 4A2CA 3RJZA 3PVZA 4M8NE 3WRYC 2DPHA 1XYYA 5F4BA 3EPLA 1Z12A 1YBMA 4FHCA 2O59A 2EG5A 3T7DA 3WK9A 4R71A 3MSXA 3C8MA 1AA6A 3HBMA 1UFQA 3M3DA 3G23A 2HKIA 3T52A 3DV2A 4BP1A 1IQPA 3VPBA 3KU4A 5LZ4A 3M83A 4S1NA 3USES 3ZKAA 1E3WB 1JBQA 1RWWA 4FP9A 2HIMA 4QHSA 2G71A 4F3NA 3ZV5A 3C8DA 5KSWB 4QELA 3ZDAA 3PC2A 3RJ9A 3JRXA 4B6QA 1OXMA 2QVLA 4ZI5A 4BO0A 3WVNA 1ELOA 3ZLVA 1NNI1 1THTA 5CW2A 2HA3A 1XEXA 1YR7A 5JCOA 3OG9A 3TQTA 2RD2A 1EXDA 4NH0A 5C32A 2PYZA 1VMAA 1JR2A 1LC0A 5AJZA 1EESA 1OVGA 4L28A 3OQMA 3BMXA 1QP0A 3GRCA 2HU8A 4B4VA 2ZUUA 2EEPA 1B16A 1GL6A 2AQ8A 1U3UA 2C96A 2GZHA 5AWFC 1G1MA 4RD1A 5LDHA 3MJVA 3N3BC 3DDUA 2AB0A 3KXDA 4KAJA 2I5PO 4QBGB 4QQNA 3SBOA 2Z09A 1H23A 1M73E 2QVGA 1EWTA 4ES6A 2X7XA 1O5OA 1CJMA 3N53A 2GO7A 3PF8A 3PDHA 4AKSA 1XNQB 1T9BA 2JAHA 4L5JA 4ERXA 2WPNA 2ZB8A 3M33A 4B82A 1N32B 3IB6A 2W43A 4ALNA 4JOBA 3ICCA 4ZVKA 4E5VA 3ZD6A 3JQFA 1HMYA 4EA8A 1AHHA 1JFFB 5GAJA 1E1LA 1QTIA 1W85A 3KVYA 1B76A 3LMKA 4DC1A 3RWOA 2VAPA 2RGEA 4GLFA 4G0PA 3SF8A 5CA0B 2UUCB 1DTEA 2QNIA 4OSPA 5E7IA 3C4JA 3WKEA 5JNLA 4BY9E 3IDFA 4EY6A 1JLKA 2QE7A 2XQJA 2VZ9A 4TTSA 3HACA 3SKVA 1VKZA 4C06A 4CRWB 2JLUA 2P3LA 1IN4A 1OHHD 2EKQA 3L7BA 5JW6A 1J21A 4FDLA 3SDBA 3WDLA 5F7OA 1FPMA 1GZ4A 2PVPA 4GICA 3PJDA 2X2OA 2XYGA 3KR1A 5A05A 1GUAA 3QX3A 3HXOA 1VI5A 2D0PB 4OSOA 5A9TA 4HVCA 1C8KA 1KZ4A 1R27A 2DE0X 3KFVA 1HYHA 4JLVA 2DX7A 4IO1A 1IPEA 3AI2A 2SKDA 1FQJA 1KI2A 1ECCA 2JD0A 2OLKA 3LCRA 5BW4A 2K87A 5F7ZA 5EKUA 4HFRA 1QHIA 1KEVA 3LQ1A 3N1UA 4RZQA 5LB4A 3MT7A 3OQIB 3GWZA 1JIXA 1ZK0A 1N2OA 1UADA 3BJIC 1I7LA 2AEJA 2IODA 3IA2A 5EHGA 3NBMA 3VYWA 3LCCA 5JY1A 1Y1LA 3ELYA 3MJSA 5DSXA 3L8CA 1XLUA 3NOXA 1L7NA 2XEXA 3QU5A 5AXAA 3U7EB 4AP9A 1SUIA 3ZY4A 1V16B 1PUJA 2R66A 1OLXA 3MJTA 4N5HX 2XZDA 3NS7A 2E82A 3OBIA 2A1UA 5BR1A 4NNPA 2CUTA 3BS4A 1RQXA 4R51A 3FWPA 4PZDA 4AJOA 2O5CA 2IKSA 5HMLA 1QP4A 3FFBA 2C9YA 5DH9A 1X0VA 2E5FA 1W4LA 1HDOA 1Q2XA 3C0KA 2B3TA 1QLWA 1JR3D 3A6KA 4Q4HA 5CT6A 3AUUA 3WYEA 4BKMA 4DLNA 1Z2PX 2NN3C 2HH9A 2Q2NA 4MKZA 3OIGA 2P6MA 3MNFA 3ZKWA 5AI0A 2GJSA 3U3MA 3S1AB 1RPZA 5AH0A 4X5OA 1OI2A 1ZUIA 1K8ZB 1FDOA 1LDBA 3VR4A 2ZVQX 3WGGA 4KYVA 1RI4A 1LSSA 1T6XA 5FOVA 4KR6A 1Q19A 1LK7A 4U39A 2B5VA 3F9IA 4V0SA 1L1QA 2AJBA 2F3PA 2GRJA 3I12A 3NM6B 3SQNA 4PIMA 4WXPA 2NX2A 1NKSA 1LLCA 4O2LA 3CWZA 2EW8A 4N12A 2LDXA 3WRXC 3EBPA 5BUSA 5G0SA 3OLXA 1WUKS 1X7XB 2JAOA 4R1TA 1VE5A 3EZ7A 1LDGA 4X1YA 2XGJA 3TQHA 5KREA 5FUXA 4HQ0A 4QPZA 4H1WA 5A1TA 1O9BA 1HQDA 1X8XA 2A1IA 2HJVA 1RD4A 1PBNA 4P54A 2VDOB 1JA0A 1WDTA 3HHPA 3I0NA 4L1KA 2WSSD 5IC6A 3TNJA 1XCLA 2O8VA 2QVYX 4R69A 3LO8A 2UZAA 2J45A 3EVTA 1DKLA 3IJ5A 3N2GA 1A9PA 2Y76A 3NASA 2O8FB 3PGMA 2C7QA 3E18A 1JH9A 3L8ZA 3VR2D 1LLFA 2Y99A 5CDGA 3KAJA 5AK6A 2C54A 2V1XA 5I7RA 2DWCA 3DMNA 4KDEA 2RHHA 4DPMA 3S8YA 3IEPA 2GT1A 4O59O 1W6RA 5FTJA 2QRVB 1EZ4A 2PFSA 4Y9UA 5ALTA 2CYAA 3LUKA 3T9BA 3DL4A 3R3WA 1QIFA 4HO1X 5KU1A 2BISA 3B20A 3G9XA 1L5FA 1QQ6A 1N6PA 2FWIA 2PZEA 3REQA 2HJHA 3G88A 3RIYA 1D07A 1OBOA 1VPTA 1XC7A 4OL0A 5H83A 1NUAA 4QXRA 1JEQB 4EI2A 5EJ4A 5E0KB 1Z8HA 3UUGA 1U7DA 4UUOA 1A76A 3QF4A 5DLQC 3D1VA 3RU3A 5DXFA 2WRZA 5DNCA 5CB0A 5FUWA 4F04A 2PMKA 2MYNA 2NWQA 4M1YA 4P4SA 1T6ZA 4X1KB 4E0BA 1A8QA 1NU8A 1M2HA 2WHEA 1RJ9B 3E1SA 3JQEA 3O91A 1WMSA 2REQA 3OM1A 2H2GA 4L76A 2YVUA 4DVJA 5KHLB 1SMKA 1OX4A 2IYFA 2B4KA 3B1JA 4YLEA 3WK6A 2A9VA 4WWHA 2PWYA 4UAGA 1D0VA 2PWZA 3GQVA 3JD1A 1ETHA 1KI6B 4AZ3B 4RHFA 2QZJA 3TRDA 1SG9A 4XX1A 2HLDD 3WA6A 5CA1F 1MORA 2H65A 1FFCA 1V3VA 2WAMA 1TOAA 3LPDA 3MXTA 3O3OB 3PI6A 4KGZA 4N0QA 3AB7A 4N4AA 2ECPA 1JFLA 1V96A 2W2TA 4KE6A 3SE0A 3ZIDA 8MHTA 2F4NA 3KTAA 4K3UA 3GAAA 3A4YA 1F1BA 3WMWA 2YHIA 3D1LA 1R9JA 3QVLA 1UDBA 2QZ9A 3U3OA 1L5VA 2I34A 1NY5A 3SIPA 2JASA 2UYCA 1Z0FA 3NOOA 3AJ8A 5EJ8A 2Q5QA 3PQ6A 2L19A 2YS6A 3AILA 3AO0B 3EVCA 4M49A 3IL2A 4WESA 2I66A 3NEJA 1NVKA 4Y9TA 4OMCA 2WPDA 4LTDA 1YQWA 1NDUA 2QR3A 4FCVA 4RHEA 2I99A 3PE6A 4DV1B 2IH5A 3CG0A 1JLLA 3LCUA 1FP7A 2ASEA 1L7VC 2VK2A 3H8SA 1YK1A 3FPEA 2LKCA 4RDHA 4RQTA 2V4UA 3QVXA 2AG8A 4WNIA 1CQIA 1Q14A 2XWSA 2DH5A 3PQ5A 2R00C 3TVDA 3VYUB 2B94A 4B74A 4FW9A 1KNQA 3VZRA 5FWNA 2C7OA 3ADOA 4N48A 1YZNA 2R97A 4Q16A 1TXGA 2B2XA 1JBKA 5FWYB 1A5ZA 3BGWA 4QOIA 1ATZA 5DGHA 1P18A 5JYEA 3DVAB 1J33A 2FPIB 4FQ7A 4NZNA 4A6EA 2ZJ8A 5C8YB 1D2EA 2DHQA 3FH0A 5ALFA 3UC9A 2N1BA 4UUBA 1OIXA 1X7WA 4PYIA 4BEVA 4PZUA 1MB9A 4W6ZA 2ZIXB 3QE2A 3QVMA 4BNFA 1SIUA 4GEGA 4MGYR 2NU9B 2V0NA 4FXPA 4KQ6A 3PTLA 2GBGA 5GONF 3HYTA 3EUAA 2OV4A 5DT9A 5SZKB 1KQGA 2VSXA 2GAOA 2FK8A 3NYIA 3F5QA 5FUBA 3V1KA 4CMCA 1NJFA 3UMRA 3AF2A 2QUHA 3FDZA 2JAXA 2EQBA 3A6GA 3T41A 3HSSA 3U4DA 1FB5A 4BP9A 2GZ1A 3SLRA 1CZKA 2YHAA 1M6YA 1U31A 1UK6A 2F9LA 2EWMA 1SB9A 2ADFA 3HO6A 2PX6A 1EQ2A 2JLBA 4AZ0A 2GBLA 4C87A 1E8NA 4NZZA 4ER5A 6YASA 4JYZA 4UD2A 1NVXQ 3R7WB 5LZ5A 4C4RA 5L3QA 1G5TA 1TVKB 4RW0A 5IANA 5L40A 4YUZA 4Q7QA 1AX9A 2HI0A 2JANA 3FTPA 5JNTA 4WUVA 5F2EA 2I7CA 1QVAA 2WNIA 3DVLA 4Q9NA 2PJUA 4UOZA 2WD8A 3KOMA 4GVPA 4QATA 2NPFA 1DBPA 4CM8B 3F96A 3QLVC 4DIBA 2IUSA 5JFGA 5KNLA 2EX4A 2ZAGA 2ZSBA 2FVXA 5ITZB 3M82A 2GAFA 2HGSA 2Y6VA 2WFZA 1M2VB 2NXWA 2PL9A 4HEA1 4LGCA 5HXAA 5HM6A 1Z38A 2ACEA 2O6HA 3MGCA 5EMLA 1G6HA 4QUIA 4EF4A 2QRVA 3BCRA 3A8TA 2G5CA 1KJYA 2OB1A 5EL0A 3RVDA 2BHRA 1DMRA 1RXIA 5A6SB 1I1OA 1P9NA 3NNDA 3EDCA 1RYNA 4N5IX 5COBA 1VSBA 4B3SB 2PM8A 4AMYA 1JF8A 2NP6A 3NJRA 4R8MA 3STTA 1EQUA 2E4UA 2VR1A 2HDWA 2QUKA 4FR5A 4NE2A 4XD7A 2H8KA 1LPAB 2ATIA 4L4RA 4EOGA 1IMOA 3JATA 1R9MA 1E3QA 3EIHA 1DAPA 3FYCA 4DG9A 2VWHA 3IKTA 3CX3A 3LW8A 5CT4A 1LY1A 3H2SA 1P9LA 3DKIA 3VPCA 1Q3TA 2J5QA 4EO4A 5TMDA 3RC1A 3PT9A 2ZS7A 5MFPA 3KSAC 2JC3A 3QWBA 4IIFA 2CB9A 4ETIA 4MR8B 5LDDC 3PIIA 4ND3A 4QA9A 1GKIA 2XQKA 4HN2A 4BNKA 4X3OA 2YXPX 4RESA 1Q3KA 4C2TA 3CUSA 2AT1A 2ZJ5A 5AUQA 1XG5A 3P9ZA 4Y1FA 3RQSA 1ULUA 4JWTA 4X91A 1QH8A 4D6YA 2FMXA 2AG0A 1CRZA 1DIBA 2OQRA 3VDMA 2XXAA 3E2MA 3HO8A 5K51A 1IAQA 4E5KA 5KAPA 2WSMA 1PLLA 3QG5A 4C9BA 4IXWA 4RNDB 1XCGB 5CYOA 1CRPA 2YXBA 4DLZA 3ILXA 2GD6A 4LRXA 4RTPA 2NUPB 1U65A 3CQ9A 5FPYA 3TINA 4ZANA 3NALA 1I3KA 1T9GS 3HV0A 4NF2A 3HCRA 3IXMA 3DDOA 4U3JB 4QU0A 5F5XA 5DRYA 4C6HA 4HQFA 1PJZA 4DM3A 3LOQA 1X6VA 5FOQA 2VQ6A 1RAGA 1NMQA 3RAJA 2D6FA 2QLJA 2QM3A 2QLMA 3V9AA 3PX7A 4AJKA 5TGDA 1M2JA 4YYZA 1YKFA 4LJ8A 4JEIA 2NZVG 4HS9A 4C05A 1PEAA 4ZV4A 3CZCA 5LLDA 1L3CA 4W5TA 1P4RA 3P5BA 1YS1X 3FIJA 3NAGA 4IP0A 3G7UA 4TUYA 5LMNB 4H0FA 2FWNA 1UMKA 3U3RA 3CSUA 1V11A 1TQ4A 3O8RA 1KU0A 4HX5A 4K26A 4HP8A 2NO5A 3FNIA 5BN5B 1Y3DE 2XNSA 1VTKA 3L8GA 3T5GA 2G1PA 1L7QA 2DBQA 1CDZA 3T7TA 3Q3HA 1N2ZA 1G6Q1 1ZOIA 4H3VA 1ZONA 1IWPB 3CJQA 3ELUA 1CJSA 4EPVA 1VE7A 3HB4X 4IMPA 3WK8A 1DL5A 3PEUA 2WA1A 3FRJA 1RI2A 2B0CA 4JI4B 1IZ0A 3BB3A 3PPIA 2GILA 3DXYA 4G23A 2FUEA 4GWGA 4YWJA 1DIRA 3TB6A 2OP1A 1Z0SA 4KE7A 1IBMB 4ENPA 1AOXA 4BB0A 1A3CA 3BL8A 1N34B 2J9FA 1BGWA 1CW2B 4YQZA 1ADFA 3EXG1 1QHGA 1C9KA 2F62A 2QGFA 1L8OA 3JQAB 2FP4A 3JVUA 1CXZA 1UDRA 4Y2RA 2ORYA 3I9V6 3PDIA 2GUGA 5HA5A 3D0KA 3LUBA 3N7AA 4JQYA 3UWDA 1S7GA 3JQPA 4JC5A 3N76A 4C7KA 1JEYA 1O6BA 2EJBA 2CJWB 2W0SA 4IIUA 1QRDA 3BCHA 1R0YA 5H68A 3VR3A 2XADA 1T9KA 1YDHA 4GAEA 4EQ6A 3LXUX 2HF9A 3FETA 3TFOA 3RNLA 1OAOA 2A30A 1MIOB 4PYKA 4XH9B 1ISGA 2R87A 3DOFA 2JEYA 1MJHA 2WMYA 1DG3A 1UDAA 4LJ4A 3WGQA 4ZT5A 1C3VA 1N9GA 1C8LA 4LTMA 1Q7RA 1ISHA 2DG2A 2Q4RA 3K1JA 1OWMA 3E9QA 2PS9A 5AICA 1HZJA 2O6LA 2WM3A 2VCEA 2AMFA 3KL2A 1U7WA 4D1YA 1E7YA 1OGYA 1Z07A 5DX0A 3U1TA 3OEHA 4NYIQ 4R3NA 3RKRA 3K6JA 4D9JA 4N8SA 4FIDA 3NBUA 4H18A 4L07A 3SJCA 1NP7A 3ND9A 4O63O 5LXTB 1CNFA 2R86A 2JLCA 4CM9A 121PA 2GYVA 2FQWA 3FKSA 4IIBA 1GLNA 2CXTA 4RK1A 4YRZA 1BCSA 2HWYA 2V6BA 4HXFB 4RVUA 1T1JA 3FTQA 5BWNA 5A3JA 5LMCA 2CLDX 3IT2A 1ZGCA 3D8NA 2K4MA 2XRYA 2JGNA 4JU8A 2H9YA 2G09A 2DQ4A 2AFVA 1UOEA 1E1QA 3TFQA 4DA9A 2PYIA 2OL4A 2ZR8A 3EIEA 1KC3A 3KQPA 4PZ9A 1CLEA 5IZ4A 1IY1A 4LXYA 2OHGA 1P5HA 4HRVA 1KK3A 4H1VA 4RKFA 4YJDA 1N9ZA 2HLPA 1E92A 2NUTB 2PXCA 1A4IA 1B41A 4MR7A 2RK6A 2P9ZA 5FPHA 3BSSA 3LQ4A 4YRPA 2B8TA 1C3OA 2G25A 1JMVA 2R1VA 1B74A 1J2RA 3HFGA 3QSGA 2LCQA 4TUYF 4YX9A 4J07A 1JQKA 2PD6A 3GMIA 1JDJA 2G6BA 4IH1A 4C22A 1E0AA 1M6VB 3T1OA 5HFJA 5EE9A 2B9EA 5EMHA 2P9TA 1IHYA 3CC8A 5D85A 2YDXA 2EF1A 2QENA 1KMMA 3HY3A 3P52A 4K9LA 2ECKA 2FRDA 4PCUA 3W05A 1X8JA 6REQA 4YMTA 2WUFA 1VPWA 4FJ1A 1SQ0A 4A5SA 1ZU5A 3ESZA 1VLZA 4ZYVA 3OTIA 1E3SA 3S2EA 4DMHA 2QG9A 1DKNA 4O4HB 5F73A 5HFAA 3HCCA 4L7VA 4BRZA 1HNXB 2JGMA 3EG5A 5E3JA 3QMWA 5A6SA 2NUPA 1NOIA 2NO9A 4Y8VA 4MXDA 1GAQA 1R4NB 5A71A 2VYVD 4PC6A 1X80B 4LC0A 1VBNA 3TD6A 3SKXA 1LBQA 4BLTA 1A8UA 1G17A 4LRSB 2ISSD 5J40A 3B7WA 2F1OA 5FL7D 1ZJZA 2PLWA 4O4HA 1KJ9A 1QX3A 1FFSA 2H3HA 4HNQA 4L5AA 2PZ8A 5DKFA 3JWJA 3AG5A 2PNFA 4LISA 3VX3A 1U0TA 1RKBA 2VAMA 3OP4A 5CLFA 6REQB 1V5EA 4PPYA 1XVTA 4R2MA 3VOSA 2G9UA 4YV2A 4WLEA 3WK7A 4DADA 4EP1A 3QEBZ 2A9OA 2WF7A 4EDFA 2Z04A 3DAYA 4AWBA 2OG2A 2O7RA 3E82A 1NBOA 1Q21A 1CULC 1P4HA 3GFQA 3TR6A 3ZS9A 3P9XA 4G9GA 5AW8A 1KYQA 2WB2A 3EF1A 4HZGA 5DCYA 4OOEA 1JTFA 3SSAA 4UC0A 5DNEA 1FA9A 1NAHA 1TO6A 1YZUA 2IOFK 4JLWA 4M9UA 1O94C 4MQUA 1UT5A 3WLRA 5DHRA 2WE7A 1GRVA 5TSDA 2H7VA 3HRKA 5EMKA 2XEDA 3FLBA 3IEKA 1USWA 3DYBA 5CEJA 4M87A 3C1TA 4Q4HB 1AS0A 2FMUA 3CT6A 2V5UA 2VJQA 1GNQA 2BF4A 1T2VA 2XGSA 4RIIA 3MERA 4MVJD 4R0VA 1SELA 3W8FA 1PFKA 4KC0A 4B4WA 5HDBB 1XRSB 3U7FB 3LX6A 1ES9A 1S0UA 3FR8A 2IV7A 1A82A 5C37A 5FOWA 1LJUA 4OFWA 2PHZA 4CFSA 4YRNA 2ZI6A 1EGVB 3VYVA 1XZBA 1AUVA 1KFJB 2HXGA 1GU7A 1Z5OA 1NRXA 4HYEA 2DOKA 3EXHC 3LUGA 3P7MA 3V2IA 4EUEA 3KOZA 2R8XA 5CLJA 2ZAYA 3AU8A 4MAFA 5H02A 3LPLA 3P4YA 4Y7CA 2HW8A 3JQBA 1GARA 1I1QB 3F98A 1K06A 5H80A 4CM8A 5JD6A 3TLGA 3W3AD 5CVVA 2GXUA 2V5AA 1TZMA 3N2EA 3MPOA 3RIMA 3UG7A 3MILA 4RVNA 1P2VA 4RVOA 5CH3A 4RGYA 4RFVA 1HFKA 1DQRA 1NF3A 3GGCA 1NN1A 2XZTA 2R7MA 5JHHB 2DKOA 4TMVA 3WZ2A 2ZBGA 2UYQA 2I6UA 1NP3A 2YVKA 4MYTA 2V3VA 3S2GA 3R9WA 3BILA 3A05A 4D3XA 1ZK4A 4IKEA 4PYNA 3ZX5A 4D9FA 4ETNA 3AUXA 4JHLA 3EPKA 4BX9A 2ZSHA 3DHWC 3U1BA 2OFOA 2D1FA 2EBUA 2OD2A 4H4EA 4BN5A 4DDHA 1N33B 3TIVA 2CGEA 3ZCQA 3QKWA 2IEIA 1XPJA 5EZQA 2O1WA 3RANA 4CUZA 3MMXA 1D1PA 1XQVA 3Q5GA 3M0EA 5J23A 4BFTA 1PYDA 2BRUA 3WGUA 5IX8A 3CVOA 5REQB 3RPEA 2VAXA 4E31A 3KHTA 3TB4A 4Z6KA 2NSYA 1E2FA 1CQZA 3LQFA 3DOOA 2PL1A 3EOZA 1ACJA 1UBTS 1W581 2RH9B 5CVJA 1OIWA 2REOA 4U7DA 1LD3A 2RHOA 2N1MA 2HSGA 1XZLA 2PWAA 2RK4A 4K2AA 5AK4A 5ALEA 4B3TB 3W90A 3OCXA 2E37A 3CA8A 3NAQA 5EHNA 3RNOA 4IAOA 2AN3A 2CLOB 1A27A 2OHXA 3VSBA 5KVAA 1NXTA 3LA8A 4PGGA 1TIPA 5KNBD 4MLPA 5TRTA 4EPYA 1BJTA 4V0LA 1MPTA 1WPRA 3AWIA 4K6CA 4HZUB 2PKYX 2Q4DA 2Z1NA 3PRYA 5JV5A 1S3FA 5I7OA 2O2ZA 4LJSA 4QUKA 3WB9A 4CGYA 5KZMB 3HCNA 2CXXA 3OPMA 1PKEA 1YB2A 4XM2A 2OAP1 2EOAA 3G8YA 1FDIA 2V54A 3H75A 3ASYA 3LZDA 1RYZA 3WS7A 3GEMA 1NIJA 2BGUA 1GO2A 1ZP6A 3NATA 3QGMA 3CF4G 2VPYA 4XKJA 1J0EA 4XIFA 3TUIC 2H1RA 3KQTA 2XW6A 4EO7A 2D0OB 2OSVA 4OHWA 3V9PA 4OA5A 2FHSA 1U9IA 2YN0A 4MW6A 2O4CA 3K05A 1VGQA 5E2AA 4YJGB 4CYMA 5A0VA 1HFEL 1TZ2A 3K8QA 4PFSA 1G66A 4RHXA 5E6SA 3ZI0A 1XAGA 4LHVA 5BQPA 4PYJA 2WABA 1IUOA 4U2FA 4UMDA 1PFYA 2J9YB 3KYBA 1P7ZA 1DOAA 3H83A 1IUNA 1T2NA 3C39A 4LY6A 2WM9B 3BDAA 4P98A 5D86A 2H4YA 3VBEA 3H1EA 3I9NA 1XYVA 4JN6B 1NSTA 2AI1A 2F43A 3SWWA 4UBNA 2BR4A 1DMSA 1VZ3A 5ALYA 3OHSX 1Y34E 4YCAA 2X0DA 1IC6A 1YH3A 3INNA 1O6CA 3GLRA 3R3XA 5DISB 5J63A 3SBXA 3GJZA 1I7NA 5GONB 3U26A 3A6HA 4B47A 2XXAB 3KR0A 4DQDA 2X5NA 4Y6PA 1NBMA 3MF4A 1TYBE 2OCAA 2WPDD 5KTTA 2FEPA 5AHOA 4X66B 4X90A 1ZL0A 2XYRA 5CR9A 1KR2A 3KQYA 1G7CA 2PSJA 4HAVA 2G77B 5NULA 3SKYA 1HURA 3ESRA 4IEEA 2B0JA 3VGJA 4TT3D 2XDYA 3M5CA 4QSHA 2CMGA 5ADHA 3QHQA 1CUZA 5EYPA 2MINB 2Y2VA 3V7UA 3WWEA 1YHYA 4C01A 4N3BA 2UVPB 1KFBB 3MZ0A 1Y9DA 4RMHA 3QVJA 4LK2A 4O0LA 4L78A 5JCPA 5IAGA 1K7EB 3WK4A 1ZO8A 4B46A 3VSEA 3VVCA 3OECA 1YUNA 2YZKA 3JVIA 4XVQA 1FUUA 3FPBA 1VLJA 4XSHA 4MRAA 4YJFB 5I9TA 1U63A 1E5DA 4ENTA 4MV3A 2CYCA 2LPMA 2QD2A 2EJCA 1I24A 3AHHA 4FZJA 4G0OA 4OQZA 4KX5A 4QUBA 3JWPA 2II6A 5TGTA 4ZHSA 2FN3A 1NJ6A 5DI3A 5TPZA 1G64A 2ZYGA 3LUPA 5K4AA 4X6UA 1RQRA 2NU7A 1RAHA 2DXIA 2GZDA 4TWRA 2X5JO 4Q9IA 4JYPA 3ZDYB 3HGMA 2ZIZA 1W25A 3BICA 4ZCTA 3S2UA 4DV6B 4PHCA 3N59A 1ZKMA 2AHRA 2P27A 1JE0A 2FTKE 4EKIA 1AZTA 4LF9B 2NZ8A 2PT5A 1KI8A 1B8UA 2UDPA 4G65A 4RS3A 2H16A 4TV9B 4W99A 1TVKA 1I0LA 3F3YA 2QAIA 1N9KA 3TR5A 4XFJA 5K6TA 4KH1A 4JMLA 3AVUA 4F1JA 4ZJYA 3D3WA 1T3SA 2CJFA 5ADUS 3Q7EA 1D4FA 1ZMOA 2FN7A 3PCTA 1A5BB 1CEEA 3IDAA 1EJ6A 3MC1A 3VKVA 4TQ9A 2J9RA 1D2HA 1JKXA 4ZJPA 1NWHA 1EHIA 3IE0A 2C82A 4O2AA 5SYAA 2G0TA 2C3YA 4N39A 2G9RA 2IUEA 3B12A 4B9EA 1R6DA 3RLIA 3H5TA 3ZHCA 4BFLA 4E1BA 5BR8B 4IJMA 4C0SA 1GAJA 2HWUA 4QOHA 1GZDA 4EHAA 4B85A 4E21A 4QQFA 2Y9MB 1P1JA 2C1XA 5BN1A 1UKVY 1E9DA 1XFAA 1V6SA 1K7YA 1Y4ZA 2JFNA 1FVXA 3A1TA 1QGUB 3AEQB 2CXHA 4JGIA 3K70D 3NT5A 4ZJUA 3OM9A 4ZO9A 1YRYE 1OXUA 2W8BA 2J08A 5SV2A 5CFOA 4HATA 3V55A 4CCYA 3ZGOA 1SBYA 2UZ0A 4TLLB 4JITA 2QMUA 1CP3A 3WO0A 3ER9A 4BNGA 1JXMA 1OYOA 3T9FA 1Z29A 2IPOA 1EK1A 1OQAA 4FCTA 5EGSA 1U8FO 2XODA 5JSYA 1CQXA 3DWIA 2H5IA 4QLOA 3UQYS 2FPUA 2F9FA 2DSNA 1AJEA 3Q3VA 2AMJA 1BC5A 3QPWA 3VH2A 4MMXB 3MK31 4R05A 2NU6A 3CZ5A 3B1ZA 1CERA 1V3UA 1UIRA 3NLLA 1RZ3A 1XAHA 3PC8A 5AOCA 1U2QA 1ZWLA 3O47A 1C0LA 3REGA 5B64A 5ERYA 3OT4A 2FMTA 2W2NA 1OGJA 3D0OA 5IABA 1KMHA 2VHCA 2GM9A 1YS2X 2CEAA 3BXZA 3IIMA 4FTWA 5A02A 2CXOA 1JFRA 4HTFA 4B3FX 3IE2A 4JOCA 2WF5A 3NPAA 1R0KA 4BVEA 1U9CA 3K4HA 5JS7A 5GOTA 1UKEA 1QCYA 3KSMA 3FFWA 3I2FA 3U61B 3AVXA 2AL7A 3L6RA 4DG8A 3DC2A 4B32A 2J3DA 5A6VA 2QM0A 1XLWA 1CUXA 3O0DA 2XUDA 2ZRMA 5GGXA 2HMSA 4HWPA 3MUEA 1Z2OX 4H77A 4F2HA 5A5FA 5KVCA 1NF9A 1QAOA 2I7DA 4OB7A 2IS1A 4PHHA 3B2NA 4ARAA 1Q95A 2YNMA 2BPOA 3R6TA 4GEKA 1JQEA 4MK4A 2IEBA 3KDAA 4PSDA 1VIYA 1F0PA 1OLUB 3T5TA 4FFBB 3R5SA 4Z49A 3I72A 1Z4IA 1WIWA 4FMPA 4AQYB 1HPLA 2V9PA 2ZYSA 5JDCA 1ZM3A 5B12A 4PZ0A 2KB0A 3A10A 2QTZA 4JP3A 4MWZA 2ORED 3CO0S 4EG0A 2FXVA 5JRJA 2O48X 2DWUA 4UCQA 5JZVA 3D7NA 3ZN2A 4EG8A 1AGYA 4FR2A 1VHWA 4KO1S 2I55A 5EUCA 2V7GA 2W4MA 2XMQA 4QXOA 2JLZA 3A9TA 5E2BA 5EAIA 2W2KB 1IZYA 2IPMA 5E9QA 2BMJA 1HR0B 5JS8A 2EL9A 3TXAA 4ESOA 3ZCTA 1OJ7A 2H1HA 4UULA 2NXEA 4RTKA 3SDZA 1DAKA 1RJDA 3F5SA 3GFGA 2HJGA 5M34A 1R37A 4P38A 5ADWA 1MRSA 4GKJB 1V5WA 4KPFC 4JR1A 4EKGA 4Q9DA 1R5BA 4GR9A 4RELA 3LIPA 1UJCA 3L0SA 3PX3A 1JW9B 4HQLA 4O3FA 1AKNA 4GLBA 1U5BB 4K6MA 5DYWA 2ZQYA 3CPJB 4LNUA 4J1TC 3DWGA 2NYUA 5KAMA 2Q6KA 3ZHUA 3TR0A 4EEXA 4QFBA 4LY3A 4R5MA 4YJFA 4UJ5A 3GBSA 3TQIA 1H2XA 1QK4A 4F6RB 1CKEA 4DGQA 1E2KA 1YV9A 1DAEA 4QICA 5IS2A 3RS3A 1TLTA 3M3PA 4MV6A 5TVGA 4DOMA 3UMMA 3QOWA 3ELBA 3UWSA 1PU2A 3ZDXB 4R1QA 2V0GA 1G8KA 4LCBA 3UAWA 4GNKA 3NT2A 1T0JB 2WJAA 4BZZA 4CM5A 1W19A 1TUBA 2O2JA 3RARA 4IJUA 2VPWA 5F76A 2JRCA 4M38A 3LE8A 4KI0A 4OBBA 4H6PA 1U8XX 3T4UA 4U5QA 5CJJA 2P2NA 1U1GA 2GN6A 5T8KC 4WUTA 3WQBA 4A9AA 4U2EA 5JASA 4I55B 3K9BA 1L6RA 1OILA 4O1IA 3QKUA 3D6MA 2JD2A 2J4DA 3LJKA 2UUPA 4OHKA 2OY0A 3BTVA 1DBWA 1LU9A 1JHPA 1G5PA 3M7IA 3GDHA 1WSAA 1G8GA 2HJ9A 1U94A 4CMBA 3AR5A 1EVLA 2NPOA 1XLTC 2OZKA 4J1SA 2HR1A 4IKOA 4U9UA 1CT9A 2VJLA 3JASA 5E4FA 3LVBA 4KXXA 5FWXA 1GPDG 5A0TA 1HRDA 1Q1ZA 1YQUA 3ID6C 3IHKA 2P65A 1QH9A 1VM6A 2H11A 1K5GA 3NRJA 4J2HA 4HUQB 1C41A 4QRIA 2B8WA 4BJ3A 1Z8DA 5C3MA 4AKGA 4KGVA 2YQ5A 4GXTA 3VC1A 5HNKA 3L7DA 4DLXA 1NM5C 1G8AA 2QHXA 4R0MA 2AG6A 5CW1A 1GRNA 1T3ZA 4FLEA 4D25A 3BF8A 4M54A 5KYGA 4L4YA 3T9CA 2C95A 2YHIB 3TL2A 3WMRA 4A8PA 1V7PC 5EESA 3EWAA 2P9CA 4YJ2B 3FSEA 4ZCMA 2DFPA 5TJ9A 4DLTA 3GPDG 2WY2D 2BN4A 2WIJA 5JSQA 4C76A 5A04A 1U1CA 4JJFA 1LPBB 3IV7A 2I91A 1HUQA 1EGMB 3INYA 1G2QA 2QY9A 3JQ6A 4RK7A 2FR8A 1O08A 1XI2A 4HSGA 1Y3AA 4FFPA 4RC9A 4YIKA 3A6JA 4DIDA 1DCTA 4LG1A 3V46A 1JKIA 1N2CE 1OLXB 4JYAB 1NJ5A 3SM9A 1N92A 3V8MA 3VYSB 3QWHA 3PJGA 4GPZA 1M2NA 3I5UA 1ONNA 2HPVA 1OFVA 2MTBA 2EEZA 3I0MA 3LP6A 2W6IA 4UHEA 2PMEA 5KJFA 1DPFA 4HDOB 3JZMA 5CYPA 1GR0A 1KAEA 2XVXA 1PL7A 4FHDA 4U4AA 3LYAA 4FNGA 3P0EA 4PG5A 2QSJA 2WVAA 1NSYA 2Q50A 3SYRA 5FWYA 1QCDA 2E4AA 2QWXA 4F4IA 1AKUA 1XF9A 4N5DA 4QDZA 3IAUA 1U9JA 2QW8A 2XOXA 3CKKA 4BNDB 5KU7A 2CBZA 1Z47A 2HSEA 1IXKA 4C14A 1YFKA 3PSHA 2EGHA 2C20A 3F46A 4AO6A 2PZLA 1W4RA 4E4TA 4ZQHA 4AJ1A 4ARUA 2PG3A 1QYRA 4K46A 5F9MA 5BV8A 1L5MA 1M7BA 2AFRA 5K5EA 4HFNA 3BJEA 2JFZA 3V7WA 1NLFA 1ENYA 2JNWA 4OXQA 3DLTA 2CE7A 2SHKA 3KD3A 3QBDA 1FQWA 2SECE 3ZWDA 2O3SA 2GEVA 3PIDA 1UT8A 1RI3A 4DSZA 1XZKA 5L3ZA 2JFHA 4FBLA 3W8RA 5E95A 2FWBA 2OZLA 4G1UC 1UBLS 1UXHA 3CNQS 1PJSA 4NIMA 3L7LA 3IEXA 1A2BA 2GCPA 2WW8A 3BYZA 1P45A 2P2SA 3KEGA 3ZNNA 5JAPA 5BV0A 1IOLA 3SQMA 4BVAA 3CNOA 1VJDA 4EB8A 4ER3A 1AMOA 4WERA 2O54A 2BLNA 1ZI8A 3RRBA 1T9ZA 2PNJA 3KS9A 5MDHA 3ZCSA 1BWPA 3DFIA 1LGYA 1E99A 3FDFA 5I7AA 1TCVA 5JD5A 5KQMA 3WQQA 2Y1GA 1ZMRA 2X42A 4J1NA 4W4TA 1B23P 4LCEA 5ITWA 1QGZA 1PD0A 1WR8A 1Z5WA 4BZPA 4L95C 5C3UA 1QG6A 1RCFA 3R5TA 1B42A 3PENA 4TTJA 2EX0A 2QP4A 5EE3A 5C1IA 4Q21A 1N4AA 3TNLA 4C21A 2BRUC 1QIEA 1AIPA 3GF4A 3ND5A 4DCOA 4KE8A 2ZU0C 5HJEA 3RVLA 3T5AA 4YHHB 1NC3A 4F7WA 1M33A 1JHAA 5BMVB 4MKRA 3BF7A 3ZGXA 2P4UA 1PNRA 4I5FA 4P3PA 5M7EA 2J07A 3NWOA 4Z1MD 1YIAA 3WICA 4PS0A 1OB5A 1QFJA 1EK5A 4DXDA 4KR3A 5HUJA 1FS5A 3MGKA 1CIJA 3ENKA 1E9SA 2GPAA 3CKYA 3F3SA 4OHFA 4ER6A 4G81A 4D42A 3O75A 4ZI7F 1UAGA 5DNVA 3FDXA 2CSXA 4MW4A 3HKCA 3S7TA 4AJJA 3MEQA 2I7TA 3D4BA 4CIWA 4YP0A 4OQNA 3M6FA 3M8KA 5J5AA 4C4SA 2P1ZA 3N6XA 5F21A 1OJLA 2H1OA 4WVFA 3EARA 3T9AA 4NJEA 4B71A 3D6TB 4Z2YA 4INPA 3VV2A 5KWVA 1DARA 4MGEA 2ZREA 5EHZA 3WNBA 2JCVA 3KTDA 5AM0A 4V1CB 3A7EA 3M6AA 2NTVA 2FLVA 3UHJA 1OXKB 3LX4A 3R6WA 4XR9A 1XU4A 2JJ1A 3PEEA 4F3YA 1X3SA 4OL9A 4RF4A 5TPWA 2QJTA 3PL5A 4ZAWA 1E2GA 5IJ9B 2CXPA 2UXCB 3WP0A 1XA0A 4OHPA 3HCEA 3CV3A 1XVUA 3ABRB 4Q34A 3UMBA 4V0RA 3VU8A 2H6EA 1V4NA 5A7FA 5KTNA 2H4JA 1A04A 3U3ZA 1A7AA 3PC7A 1TA4A 2IHNA 5JI3E 1BHSA 2WA2A 4EHDA 4XLLA 2CVZA 3UH0A 3CW2A 1Z4MA 1BFKA 1K6XA 4Q47A 2BEWA 1A5AB 5EQFA 3KHSA 3TNYA 1HBJA 4UBLA 4G4IA 5KTMA 2IHZA 3L06A 4D0SA 3BIXA 1NR7A 2YFKA 2D54A 3WJ1A 4DCTA 2NZWA 4WXRA 5J2UB 4OQQA 2JJQA 3NMUF 1V1RB 4YCSA 4MA0A 1PNOA 1JX6A 4B6OA 1KIFA 2NM0A 4WDQA 2GDJA 2Z2XA 1FP4B 3CN9A 3QKRA 2ROQA 2H07A 3JQRA 2EVWX 3KOYA 3A14A 4YCCA 1R6BX 2M6SA 1VP9A 5JBIA 4KSCA 4DWOA 3GEPA 3GP8A 4ZQGA 3FPAA 1H9CA 5I9MA 2XRMA 4AKHA 5K8TA 5L51A 2H48A 2YRWA 3KJZA 2WMNB 3LM8A 1HKHA 3MJEA 5ITVA 3WGZA 2PQ0A 1ORDA 5D1NA 5HIIA 4AXXA 3E1KA 2H4XA 2G67A 3QMVA 4QL3A 4EB3A 3IV9A 4IH4A 4H17A 5CVCA 5A03A 1EX1A 2B20A 1T9AA 1IDOA 1G3IA 2YV3A 4JUAA 5LLSA 1MEOA 2ZBDA 3NHRA 1HGXA 2IXBA 3GA5A 4YPFA 2C61A 4F9FA 1E79D 1RYHA 2PKCA 5JFTA 1E7RA 3EGWA 4REOA 1IH8A 4FE7A 4Z9FA 5F2KA 4BKUA 1SC3A 5FBKA 3JYPA 2NQTA 3M1LA 2R7KA 3ONEA 4EG1A 4IW3B 1EIZA 1SK8A 2PA3A 2VEOA 621PA 4WTOA 5BSKA 3JD4A 3ONNA 1WQ1R 2F3TA 3C48A 3VX4A 2D00A 3EC1A 3R5HA 1GQQA 3SEAA 3KBBA 4CLEA 4K6KA 4MUYA 2CUKA 2RKOA 3EJWA 1G8MA 4IICA 3W4JA 2WYUA 2JIPA 2W8ZA 3EVZA 9LDBA 2VQFB 2PY6A 3ASUA 3EEBA 3IKJA 4KWHA 4CEIA 2I71A 4CIYA 4E7PA 4KQIA 3WMXA 2PQ2A 3RC2A 1GRCA 2K7ZA 4CKXA 1Q83A 5IZCC 2I8CA 3CF0A 2G72A 3VTZA 4MYHA 2NU9A 4U8HA 1OFUX 1Z15A 4ID3A 2POCA 4EX7A 4N5LA 2P90A 1ZRMA 3GLQA 4KQKA 2FSGA 4NDNE 2XBUA 4OJQA 4IH9A 4KJXA 4DIFA 1DWQA 3FOCA 2PS3A 5FAKA 1D2AA 4ZI3A 1LBIA 1JAIA 3SOPA 1MAVA 1T36A 2J48A 2IXEA 3RRYA 4CIXA 1OC4A 4JDUA 5CFZA 1CCWA 1UWVA 2QG4A 2QN6A 2PUGA 2G8NA 4A36A 2ZULA 5B3KA 3WLAA 3PGVA 4L5BA 3ITNA 1WPGA 3PT5A 4GD3Q 4R54A 1P0MA 4RKEA 1G8JA 2FWJA 3GK3A 1XTQA 1N77A 4GC5A 1J5PA 3BJMA 4DV3B 1HA3A 5TMPA 2NU6B 3MCWA 2CW5A 4HWOA 3F6CA 3W9YA 2I9KA 2OOKA 2YYSA 4AUMA 1TAQA 1LQUA 4KIUA 1QHXA 1XHEA 2FKNA 1PNQA 5IVIA 1O58A 1FLDA 1MU0A 2YL2A 1EVQA 4MIYA 5JYDA 5SYMA 1Z68A 3OJCA 4OF4A 4QD3A 3V8NA 3P8ZA 1GPBA 2NSJA 2OA0A 1BXZA 1PP4A 4YAJA 1ORWA 2HLNA 3QWFA 3QE9Y 4YJ2A 2VWQA 2Z6AA 4NBUA 5A06A 3K6SB 3LTNC 3NFRA 5LZ7A 4KAAA 2ZRGA 3E8XA 2FFQA 3TS1A 4MX8A 5DNYB 1WMFA 4A16A 3OO0A 4ZHQA 2SICE 3OE7D 5KSOA 1DFHA 4BATA 3IMCA 2A4KA 2JHGA 4D45A 2BP7A 4FMCF 1MNAA 5EUQB 2H9AA 1N0UA 3MQ4A 2NACA 3VVBA 3FJOA 3UC5A 3GLFB 4HZIA 2IBSA 3OE4A 4DR4B 1GL3A 4ATNA 2ZJ0A 4NG4A 3QRWA 5AI4A 1M1XB 1G8SA 1PFWA 5LMZA 2ZATA 4LJ9A 1NC1A 1MLDA 1DO0A 4CM6A 1D1TA 4NJMA 2QV7A 1OXVA 1P1IA 1VHJA 3H05A 3OIFA 5CM9C 3OZDA 3L6DA 1JHYA 4IVNA 4P4LA 4MI6A 4BEBA 2H29A 3UZUA 3LPCA 3OUUA 4AULA 4RIHA 4IF6A 1XHLA 1JEQA 2CD7A 2FB9A 1LI5A 1YMQA 2BFBB 2UUOA 3I52A 3GLVA 4X00A 5B1YA 5MN5A 1PN3A 1S3SA 3A6EA 3DMYA 3PNPA 2HRBA 1JH8A 4XUCA 1G21E 1DXQA 3P9KA 4XCXA 1KAGA 2XD9A 1I5OA 5DM1A 1L5YA 1Q12A 2GD1O 2HBQA 2GPJA 3HPQA 1T0IA 4FW8A 2YQZA 3G0DA 5T41A 3ET5A 1QM5A 4KDRA 1G4HA 1GT6A 1HOXA 2X8JB 2XIJA 4UMFA 1IHDA 2I3BA 4QUGA 4GXQA 1ZGJA 3RK1A 1DEOA 1D9XA 1RXCA 2D06A 4RX1A 3RUCA 3HXLA 4LYDA 4WI1A 4TYYA 3NUGA 1WKBA 2OXFA 2X8BA 4JI3B 1YXMA 3TXYA 2P6UA 4YDRA 2XTJA 4GGPA 2DSTA 4CG3A 4C04A 3H13A 4Z0PA 4CTMA 3GLUA 3BGOS 1E9BA 4K9KA 1XNJA 4R1MA 4R9UC 4V0KA 3UMJA 5K8LA 1FP2A 5LL6P 3DE4X 2CNNA 2IL1A 1ZHFA 4Y1EA 1EK6A 3KEMA 5LOVA 2PKEA 2ZRLA 4HYTA 2A4MA 3ZH9B 3DO6A 1G38A 1EIWA 1MAWA 4Z0HO 3UMFA 2EP8A 4MGHA 1ZK3A 3T1TA 1KHHA 3GHYA 3KQQA 1X7XA 4YHBA 4TYNA 4ZEVA 5KYVA 1Z8FA 3IURA 4DLLA 2X13A 1D3AA 1HDIA 2Q1YA 1JA9A 2HEIA 3ZZUA 4DIOA 1YT5A 3U7IA 1BVUA 4EW6A 5B2FA 5JWRA 1ZUHA 3EZ2A 3B38A 3CGGA 5DYYA 2C8JA 4CFYA 4E7OA 3A04A 3N8IA 3C6YA 4JJGA 1W59A 5E8RA 1J00A 4NMWA 4KPGA 2FX5A 2NMVA 1D2NA 9LDTA 5DBOA 1AN9A 1G1AA 4OKIA 4J0GA 1TKAA 3GGSA 3F9RA 1GAXA 4UTXA 1IBLB 3PHBE 1QONA 3QMPA 5IN4A 3S2IA 3ESBA 1E6WA 4Y2XA 2EG9A 3GUYA 1H3EA 2QQ5A 2P79A 9ATCA 1U8EA 2VIIA 2IYSA 1EFTA 5DLYA 2XKKA 2ADOA 5AXCA 2A78A 1NRJB 1BJKA 1ZA1A 1Z0KA 1CUUA 3A4NA 1RXSA 4I3FA 3CF6R 4ZVTA 1IRXA 1VG9B 3DM9B 3IUYA 3RTAA 4BNXA 2DLNA 2PLRA 1SRRA 3D4OA 3PC8C 3PP8A 2X6QA 4HDKB 1NPYA 1J49A 4N0DA 4AD8A 4D79A 4AY2A 3DOCA 4UUQA 2XUFA 4D3SA 4EVIA 4JEMA 1PL6A 3CEJA 3VQTA 4YRMA 4NPHA 5JWOA 5ANRB 3DBOB 2HCTA 3AUAA 4TTVA 5JY6A 5KOJA 2JLSA 3TRKA 1O3YA 2O52A 3HC7A 3KB1A 5AKYA 5CDSA 4RAQA 3H3XA 1JU9A 3OZEA 2OXEA 2R751 5DVZA 3PFIA 2Y4OA 1T26A 1PS8A 2Y0EA 3K73O 1ZH2A 5C8XA 2E18A 1A8PA 4FHFA 1BX3A 4UARA 1MHPA 4N41A 2X3UA 4LRTB 1ISIA 2XJ9A 4IHJF 1CY7A 3NHFA 3PQ2A 5KOHA 5GZ3A 2W6ZA 3H0EA 2MYPA 5C2JB 4AIIA 1I4WA 2BMVA 2XQVA 3A1SA 4YRBA 3UGTA 3UATA 2X6RA 3DH0A 1ZNWA 1P2DA 4NCHA 1I80A 3SNKA 3EASA 5L8VA 2FPRA 2IHBA 5C5EA 5KNDH 1US8A 1M75A 2QYHA 4H16A 4QLAA 1FYVA 4WKPA 4C0JA 2IT1A 1G3QA 3BMQB 3TTTA 3HMQA 4KZKA 3VHLB 3T3MB 2VQSA 1FF9A 4YCMA 2PD3A 1P39A 5FQNA 5I7FA 4J1QA 4RBNA 5ARBA 3D6AA 4FOSA 2JL1A 1VLLA 3A31A 1YB1A 2I2CA 5LOVF 4U3JA 1YVUA 2AD5A 5BP7A 4GMGA 4PRLA 4MROA 3AJDA 1JKFA 2O0JA 4OJKA 1VMEA 1BKYA 2C97A 3P4UA 2COEA 3TYXA 3AY0A 4KIWA 1QG2A 2BELA 3E23A 3TD2A 4A27A 1XTUA 3GRKA 3V7NA 1UKAA 1G8PA 4QPDA 3DEZA 3BFXA 4QJ4A 4ISCA 1EG2A 2OTCA 3IHLA 4AZWA 4QU8A 1XSEA 2I6SA 4QGBA 2H2HA 1OBVA 5JQWA 4Y9DA 1HFWA 4D5GA 1DRKA 4MLDA 3OTOB 2WVGA 4UTRA 5HWSA 2FDRA 5K0TA 3S40A 5L6MB 5JS2A 3ZWPA 1RQNA 1ZHHA 2E6UX 3RVKA 4CU2A 3D31A 3INRA 4RHYA 2BR5A 2OHHA 2AVDA 3LS2A 1SHJA 3UJ8A 3GIDA 3BK1A 3L6CA 3I6IA 3OCWA 4MKHA 4S1TA 1C50A 3FTNA 1II9A 1ITZA 4LXUA 2UVQA 1KO7A 4QNRA 1H0HA 4CIBA 3F8TA 5CNIA 5KHOC 2OXCA 1CJVC 1Q1AA 2QLTA 4IFEA 1CBUA 1N3BA 3K9CA 3MCUA 4FT2A 4RSHA 3ZK7A 1XCBA 4DEYA 2J85A 1RJFA 2YV1A 3ZU4A 3NYWA 3BH7A 3UUFA 1U7ZA 1ZCZA 1ZN2A 1JDNA 2ZUDA 3DYIA 1WMEA 3LDGA 4L73A 1GCAA 3NV9A 1U7PA 1ZVQA 4AG5A 4NV0A 3SSMA 2FPPB 3K2IA 1XMIA 3JARA 1YZ3A 4BCDA 1GLGA 1X1AA 1YVRA 3CMMA 2H2IA 4LJ5A 4LZZA 5ERGB 3AVTA 3GUZA 3RDPA 4PGMA 3TN7A 1XXHA 2BM9A 4WKGA 3OCJA 3OPYI 5ITZA 4R81A 1FFBA 3OI7A 1J70A 3HNRA 3FYUB 3D64A 1ICEA 1YS7A 4I5GA 4IMIB 4X71A 5JZBA 1RM3A 1O57A 2IHKA 1AMNA 1I0ZA 1PZFA 3C7AA 3KJXA 4FX5A 5THKA 5GONA 3QITA 4URYR 4X1YB 5GJWC 4IDEA 4F96A 4EPXA 4V2IA 1F3OA 1QK3A 3EQ6A 3L0CA 1F2TB 2I33A 2P8SA 2I67A 4AX4A 1ZIDA 4RO0A 3TMYA 2FEOA 3KSUA 2W6MA 4CI9A 2Z5FA 2BJWA 2VDNB 3QKIA 2GXAA 3KJIA 4HDKA 3UJBA 5JBNA 3F7TA 1DS6A 2L0XA 3VDXA 3N0WA 1WETA 1IOVA 4XPIA 1TYDE 4JBGA 3ZV4A 2Z9CA 1UPXA 5ICGA 2G9ZA 1ENOA 1UM8A 3ZEIA 3OEYA 4BGIA 2ST1A 3S81A 1D5WA 4TWIA 3FE2A 2XGOA 5BMOA 5BW8A 3OQNA 1RXUA 1Y1TA 3HBLA 1NLUA 1QVVA 2HHLA 3QEMB 4BTLA 1T1EA 4Q1EA 4RH3A 2XAAA 2QT0A 3K0FB 2W2MA 1G5QA 1H2WA 1UJ2A 2QRMA 3V3TA 3BWXA 1IB0A 3RG8A 3T4EA 3GBPA 3HSKA 2ONCA 3ZGLA 3W2EA 3D7RA 1FLVA 4MITA 1ZJ4A 2G3YA 1AUXA 1OYWA 2YXLA 5LYJF 3RFCA 4AF6A 2JIZA 4HDRB 4U9HS 2JJYA 2YWDA 1CETA 3HP1A 5B4UA 1GITA 1X9IA 2ZAOA 2AZ4A 2R8ZA 3OIDA 1KBZA 5CU7A 3FOWA 2YH2A 4DDUA 2QSYA 3VISA 3H11B 3IBGA 3NR2A 3P9SA 4P5EA 5BRJA 1JEDA 3IJRA 3EGXA 3A9CA 4PQGA 2WWHA 2PS0A 1NX6A 2Z3VA 1SNYA 4LDNA 1E3MA 3TX6A 3RM3A 3L3BA 4FI3C 1I0IA 1Z18A 1LWNA 2HA4A 4DCCA 1J56A 1LF5A 4FUQA 4GI5A 4XTRA 1I13A 2ILTA 3DFUA 5A2QA 3FZGA 1UJMA 5HS4A 4KN9S 4P3OA 4BO2A 2RH8A 1Y63A 4OEHA 3DBLB 2H5EA 3EEFA 5ICMA 2BGWA 3FNFA 3Q40A 3DTVB 4KFSA 5IAKA 4X6LA 4INJA 4WAUA 4D41A 4DSNA 3EY4A 5HM8A 1GU0A 4DMUB 2O8CB 3IKLA 3GRFA 2YICA 4YMUA 1Y3HA 4M0KA 2O9JA 5FEUA 1IXYA 1H5QA 3SYMA 2XLBA 3S44A 4MARA 2GZAA 2KJQA 4AURA 2IV3A 3CZ4A 1W85B 3E1GA 4I2VA 4YFYA 3TJRA 3REFA 1CZHA 1E32A 4JLPA 2OC9A 3VO9A 2GETA 1BN7A 3Q6IA 1UZUA 4IZIA 1GQFA 4O2BB 1E59A 2JIQA 2OORC 3EA5A 2JFWA 4B4UA 5JLJA 3TECE 1FTQA 1URPA 1GCIA 1OZFA 2WUEA 3KYDB 4ODIA 2GTPA 1W96A 3SVTA 2BT4A 3VR6D 3GFPA 1P77A 4P58A 5DIZA 4AUKA 2NTJA 1L5LA 3FN4A 4LWOA 3LSYA 3NHLA 2ODBA 5EWLA 1AHNA 5ALZA 1FUIA 3SXUB 3L2OB 3HN6A 3ITDA 2QMOA 3O31A 1HE1C 1FXSA 1I4OA 1YRBA 3A9VA 5JNRA 4DM4A 3O90A 4DYVA 3LWDA 3UPUA 3IYLW 4PTYA 3R8FA 4IEFB 4G0QA 2D5CA 1N2BA 5JJLA 2WYWA 1Y5MA 1ODKA 4V03A 3ZWMA 1O95A 2FN4A 4I4CA 3RSCA 4O3MA 2PGJA 3B9PA 5FNVF 2BBWA 2PGAA 1MW9X 1R0BA 1UZAA 1HG0A 2HO4A 2I80A 3AZQA 4OYHA 2IE8A 1U81A 1V11B 3JALA 4MI3A 4WZAE 5DV9A 3ZV7A 4ZGGA 4L9AA 3WAJA 5IK2A 3W8NA 3LY7A 3T4XA 3TEJA 4UHJA 4Y3UA 1FDUA 1SUEA 3V4VB 2P0YA 1ABBA 4X61A 3ESCA 3D8BA 2CNKA 3ZCVA 3ZG6A 1EFVB 1XDDA 3MGGA 4UZEA 1BEZA 3UHOA 4OJYA 2NUAB 3KZXA 1GPNA 2R6GA 4LY9A 2FZVA 1GZVA 3T1HB 3F2VA 2IX3A 3LHKA 2ZE7A 5IN5A 4OFXA 3RVPA 1J5EB 4K0KB 1BS9A 5FO1A 3QLJA 4Y2PA 4AVYA 4DJFC 4PQFA 2XUQA 1R10A 5F1YA 3W5VA 4BJHB 3GLGB 4E5NA 1GSHA 2FRDC 2JI8A 3ABSB 1LJLA 2UXDB 4HNAA 2Q0XA 2WHYA 5DGXA 3K30A 1RJWA 2A9PA 2B4YA 2IYEA 2OPBA 4MUGA 2BW0A 3NO4A 4H9GA 4JNKA 5KWSA 1TK2A 1HDRA 2ONKA 3KWFA 3H19A 3PKIA 4CMIB 3ZU5A 3U3DA 1E1QD 4E11A 5BV7A 4ZCLA 1KKLA 1KMIY 3GDFA 3NI2A 2BFOA 4F3TA 2VQEB 2FZWA 1ESMA 1SCNE 4XVCA 3GMTA 1KVRA 4ZYYA 4NI5A 3C3BA 4NBRA 3ZI7A 3H2HA 1KJNA 1W0CA 3UGKA 4QGSA 1U8AA 1EA7A 1S2OA 2QRNA 4JKOA 4DPKA 5CB8A 5KSZA 4K88A 4PX5A 2BKUA 4MTCA 5EJ5A 4QUDA 3F5DA 1ZS9A 3AOEC 1ECFA 1CUIA 1Y4AE 2JI6A 3PIRA 3I4FA 3O8QB 3PQ7A 3W06A 2PUAA 2DFVA 2OV8A 1QO7A 2ZRPA 3F78A 4X6YA 2PIAA 4XM0A 3T0IA 4QT0A 2IS6A 1LSJA 2XVYA 2YYYA 4LBWA 2CEKA 1DWUA 3DZFA 4MDYA 1RP1A 4UHHA 3RVSA 3ZVMA 4YALA 5BWBA 1G3RA 4NTZA 2GFIA 2PH3A 2WUWE 3BHMA 4KLRA 3W79A 4UEOA 2DLCX 3ZBQA 1Z06A 2B30A 5ALPA 3DBRA 3HS3A 1RTTA 4GMKA 1XCJA 3R7FA 2FPXA 2LP4Y 3CWCA 3DZCA 3FVTA 3LPMA 5C5IA 2JVKA 5KNBH 1CUJA 2YZ2A 4CLRB 5HJ5A 4F71A 2VP9A 1SFRA 2H1FA 4WCFC 1S01A 4IO0A 4JUFA 1A2OA 3O82A 1VCIA 1NIPA 2GN4A 2BGIA 2DT8A 4BASA 5KX5B 3MS4A 3W5DA 5JE8A 1XLTA 2ODPA 2WWWA 1BEUB 1DAOA 5DU2A 5HSGA 4ARIA 1S02A 1YR1A 4AKEA 5JATA 3AH8A 5CB4A 5LNK6 1ZR4A 3D0QA 2OUIA 4QNMA 2DHRA 1RYMA 2C92A 2V7XA 5E8JA 2DY1A 3FM9A 3KJGA 4KIFA 4DDTA 1PWYE 4LYJA 2H0QA 3CLTC 4U7WA 3P9QA 1QKIA 3F1KA 1XMOB 1X3LA 4GE0A 5GM1A 1AQNA 4GX1A 4JI2B 3FLEA 3R8CA 4IUYA 2OSBA 3HU1A 4NBVA 1C9DB 3JQ8B 3FB4A 4PAMA 3IIKA 1NOJA 1E0SA 1QFXA 4E5MA 3LU1A 3GEIA 4MRPA 3HCPA 1DJPA 3ZWAA 1WXIA 1QHFA 1Y1QA 4Y0AA 3GJ3A 4B48A 1P6XA 2FR8C 3DZHA 4OKNA 1GQRA 3WLOA 2ZI3A 3B3FA 4FQ8A 1HNZB 3T4PA 3E3AA 3VHXB 2NSHA 1M0WA 2PMDA 3L0OA 2H1VA 3TCNA 2G06A 4HG2A 1MIOA 4I08A 2J3QA 4RZ2A 3VZBA 4JNCA 4DQVA 4EHLA 3A37A 3AHIA 3V3KA 2I29A 3DE2X 3QFTA 4J0JA 2XCUA 3R7AA 3AQIA 3OAAA 4BKQA 4NARA 4QYIB 5DM0A 2BE9A 1WU7A 2R4UA 3CO5A 1NJSA 2EJTA 4P53A 5AHKA 5FBQB 5AVOA 2WF6A 1QH0A 2NZUG 1XEWX 2VJCA 2X6TA 4N49A 2Q5LA 4BKOA 3GFVA 3OY2A 4P3NA 1SKYE 5CTJA 3IPXA 3IVXA 4JLMA 4ZD6A 4MTLA 3LY5A 4F56A 3PXCX 2H85A 1Z0ZA 1UBKS 2FMKA 1F60A 3MBKA 2VEDA 4IDOA 1DSSG 1QQTA 5CP8A 1OWLA 1P2FA 2ON6A 3K9NA 1MQSA 1FUKA 2O7VA 3IMKA 4OHMA 4TTTS 3C3MA 1XL0A 1GPUA 2XTMA 3TCKA 4R8RA 1GHTA 4S35A 4BP8A 2AXQA 3HXTA 3ZK9A 2XF2A 2Q49A 3HA3A 1ZLXA 4TQAA 4DLVA 1TFUA 5KDOA 4DR3B 4QVGA 2V8BA 4URHA 3C8HA 2GM5A 1VRVA 2Q29A 1LX7A 3U31A 3UJHA 5L4NA 2ZI9A 1ZD1A 3RUAA 1MOQA 3AETB 4IDAA 4TMZA 5L7TA 3EOAI 1P33A 1B8VA 1W48A 3RUEA 4XRRA 5HEKA 3OZCA 3RROA 4Z4CA 5K3OA 4S1VA 1FTGA 2AC4A 5JAUA 3K94A 1ZJYA 4M9QA 1L7PA 2M2IA 1ULZA 2C5FA 3GVCA 5IAEA 5LXTF 3SY8A 1SD5A 3WR5A 5KQLA 4KNVA 2ZJ7A 4OH1A 4WLVA 5G41A 5EIXA 1JG1A 2F3RA 4QOGA 2EZ9A 3G9ZA 3QK7A 2Y9PB 1KNXA 3OETA 3GFBA 1T0HB 4ZOLB 4HLCA 3OOYA 2BFCA 3VRHA 4BB6A 4CQMA 3Q7RA 3QLTA 4NCIA 4W7IA 1EG7A 3WOHA 3QJ5A 4BQEA 1R4MA 3IDZA 3KT6A 1YU9A 5IVHA 1D0SA 3FNGA 1L3BA 1XD2B 4X1KA 2LVBA 3O8OA 5IKOA