2WMYA

Crystal structure of the tyrosine phosphatase wzb from escherichia coli k30 in complex with sulphate.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
143
structure length
143
Chain Sequence
MFDSILVICTGNICRSPIGERLLRRLLPSKKINSAGVGALVDHTADESAIRVAEKNGLCLKGHRGTKFTSALARQYDLLLVMEYSHLEQISRIAPEARGKTMLFGHWLDSKEIPDPYRMSDEAFDSVYQLLEQASKRWAEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Capsular Export Regulating Tyrosine Phosphatases Wzb of Escherichia Coli and Cpsb of Streptococcus Pneumoniae.
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords PUTATIVE ACID PHOSPHATASE WZB
total genus 55
structure length 143
sequence length 143
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wmyA00
5ED4A 2MYUA 1YTUA 1TVMA 1NXVA 1YS7A 3OMXA 5TPZD 1PUXA 1Z25A 4Q6WA 5TQ0B 3SNKA 4CBVA 2QXYA 2RGYA 2PUFA 4N41A 1LK0A 1JHZA 3LKBA 5I4CA 3L6UA 3HSYA 3F6CA 2E4UA 2FEKA 2FLWA 5IC5A 2GBPA 2GKGA 1M2FA 1ZY2A 2NT3A 3IP7A 1CYEA 3HO1A 3HUUA 4TLMB 4Y9TA 3QLUC 1LJUA 3A3KA 5DTEA 2J48A 4YGXB 2FXIA 3HCWA 1P8AA 4JASB 5BQ3A 2R25B 3BREA 3RVNA 1A0OA 5DLEA 5C5EA 3O2JA 3QEKA 3GYBA 3QLUA 1NTRA 4RK7A 5IUKC 4NCAA 3C3MA 4JOQA 1J56A 1KMIY 4MS4A 4YRZA 4Z4FA 2QVGA 1BAPA 1DRJA 3OO0A 3VNBA 3K4HA 2FMHA 4EYQA 1MVOA 2XDYA 3M6MD 1D4ZA 2WJAA 3DGEC 4GPAA 3E61A 3IPAA 1ZITA 1EWVA 1GCGA 2HQOA 3TX6A 3H5LA 3HDVA 3T95A 1NXXA 5TQ0A 2IKSA 2GWRA 5HQJA 3QEMB 2AYXA 3K9CA 1U2QA 3URMA 3HXMA 4RK0A 3OM1A 5TQ2A 1VLZA 3KTOA 4XXHA 4TLLB 4F06A 4G97A 3FDFA 2AYZA 5B3JC 2JBAB 4MQEB 5TPWB 3SAJA 1APBA 3HK2A 1NXOA 4NQRA 1U0SY 3CLKA 4D6XA 5T7BA 2CHEA 2HQRA 3T6KA 3TD9A 3OMWA 1RPJA 3QK7A 1RXIA 4MLCA 5FBKA 4QYWA 4EY3A 3A10A 3MYYA 1GUDA 1ZH2A 1MIHA 5DKFA 4ZMRA 1PHRA 5EWLA 2MSLA 3CNBA 2QR3A 4O1IA 3CG0A 3RVMA 3LUKA 4YCSA 3GBVA 3FFXA 4PZ0A 1QQAA 4UHKA 1OXKB 1NXSA 3JVDA 1DBQA 3F7NA 3ROTA 3I09A 3G85A 4IMIB 1LJLA 1ABFA 1MAVA 1YK1A 3N53A 4EYGA 5EWJA 4RKRA 1YVUA 4MS3B 3TO5A 4MR7A 5BRJA 4ML3A 1Z13A 1W25A 4N0PA 3RVQA 1BVHA 2JVJA 3OO1A 5C5CA 1DZ3A 1Y1LA 2OENG 4JB0A 3EODA 1JYFA 3QELA 4KQ9A 3T38A 3BILA 5D2CA 2NT4A 2PLNA 4UHJA 3KJXA 4RDCA 5FBHA 4RXMA 5FWYA 5HSGA 4WT7A 1JX6A 4KREA 3CG4A 3FFTA 3E3MA 2IOYA 1JFTA 1JF8A 3B2NA 4KQCA 1EWKA 5TPZA 4RY8A 3H75A 3Q7RA 4JA2A 5FWYB 1TMYA 1YS6A 3I45A 2F8TA 4OLBA 3H5WA 4MR9B 4TN5A 3CRNA 5CHYA 4W5QA 4N76A 2M98A 3CZCA 5GQSA 5JS1A 3NNSA 1BA2A 3EGCA 3NNDA 3N0XA 3LMKA 4Z4EA 3EAFA 4MQFA 4IRXA 2E4XA 4RSMA 1NY5A 2PUCA 3L49A 1EHCA 4G0OA 1DBWA 1E6MA 1YIOA 2CHFA 2NZUG 9ABPA 2P4UA 3GT7A 2FMFA 4MS1A 4N0QA 1Z26A 3HDGA 3NNNA 5EWMB 4F12A 1QO0D 4W5TA 2E4ZA 4KFCA 2PJUA 4EVQA 5IUNC 2A9PA 2FVYA 3H1GA 3ILYA 4G86A 4D6YA 3QLTA 4G0XA 4RZSA 5PNTA 5IUJC 4OBBA 4Z4CA 4LDAA 2RJNA 3LUGA 3GRCA 5EWLB 2PMCA 2IPNA 3IDOA 1JWLA 1RZRD 1XWWA 3O2QB 1ABEA 4HNQA 1FQWA 3CU5A 1WETA 3RVSA 6CHYA 3EQ2A 2MYTA 5BR1A 4G0QA 4ZJPA 1HEYA 4P98A 1D2AA 2R48A 3QELB 1USIA 1A2OA 1DJMA 3BBLA 1Z2DA 4W5NA 5HKOA 3QLVA 1JLKA 1NXTA 4F3TA 2RDMA 2WWVD 4ETIA 2L19A 4GNRA 3BRQA 1ZN2A 3I42A 1U04A 3CHYA 3D02A 3HEBA 1R8JA 1ZGZA 4MR7B 3TMYA 1E2BA 1FSPA 1M5UA 3IP9A 4E7PA 2VYCA 3VNAA 3W9SA 5IEJA 1L5YA 5CNJA 4OLAA 4LDZA 3S99A 5JNWA 3LFTA 3N0WA 4RXTA 1EFAA 2NZVG 4ETMA 5KQLA 1DCFA 4XASA 2TMYA 4OTZA 1KGSA 4Z0NA 1ZESA 5F64A 4ZPJA 2HQBA 6ABPA 1KRWA 4NICA 1USGA 4H3HB 3NBMA 1VKRA 1YMUA 5TQJA 3SG0A 5B3JA 1QP4A 1S8NA 3Q41A 3JVIA 2VUIB 1ZAYA 2E4YA 1TLFA 4KVFA 2GX6A 2IDMA 3OQOA 3O1IC 5KWSA 4N47A 4G0ZA 4MR8A 4JB2A 2P9HA 4LRQA 4Q6BA 7ABPA 3RQIA 1FFSA 3Q7TA 4NV3A 4OG2A 3UUGA 1SD5A 4RU1A 3C6QA 1JBEA 2QZJA 2ID9A 3HZHA 5KC8A 4Z4HA 1W9HA 1EAYA 4M88A 2ID7A 3T8YA 2PL9A 4Q7EA 3IP6A 1ZH4A 2CD7A 3RVJA 3OLVA 2MSWA 4MQFB 4XLTA 3GA5A 3NHZA 4JAVC 4O1HA 3SM9A 4LE0A 2RJOA 4IILA 1CHNA 1ZGGA 2MYPA 3HV2A 3HM9A 3IP5A 3DLHA 1I3CA 2L2QA 2LUOA 2QU7A 3DGFC 3N8IA 5IULC 2HJ9A 1PNRA 1QP0A 3OLYA 3MF4A 4LE1A 1DCKA 3JPYA 3MMNA 2Q5CA 2FKAA 4KMRA 1DRKA 1Z2EA 4KPYA 3OLWA 4P1ZA 3TB6A 4O5AA 1Z18A 2E4VA 3RVOA 2YHBA 1RNLA 3SQNA 2ZAYA 1GUBA 2FEPA 2FN9A 4MYRA 2A9RA 4EYKA 1DC7A 4LZLA 5JNUA 2WJWA 4ETNA 3OQMA 3D8UA 2BGGA 3LUAA 2FQYA 2QVCA 4DN6A 2MYNA 4QICA 2N9UA 2LPMA 3GL9A 2O20A 5JS2A 2JRLA 2A9QA 4Z4GA 2L18A 5TE9A 1D1PA 4KRFA 3RVRA 3H5TA 3M9XA 4RY9A 3QX8A 2W42A 1SRRA 3N0RA 4KV7A 1TM2A 4G0YA 5BRAA 5CNKA 1YK0A 3FGZA 5JNVA 2A9OA 1Z12A 4EVRA 1QKKA 2HPHA 4RWEA 4YWHA 3CS3A 3H6HA 2PAFA 3O1HB 3KLOA 2QW1A 3FFWA 1DBPA 2OQRA 3QLVC 1F4VA 4PE5B 2IPLA 1MB3A 3LKVA 5DGCA 1M2EA 4Z99A 3GBPA 1U2PA 4YS6A 1F51E 4QPJC 2H3HA 4H3KB 4RV5A 1TJYA 1QQBA 2QSJA 4HNRA 3O74A 1ISSA 1LBHA 3A0RB 1JDNA 3C3WA 3H5IA 5ABPA 3Q9SA 4MS4B 4WXMA 3OLXA 3QX9A 1PEYA 4RXUA 4RK5A 4FB4A 3CTPA 2HSGA 3CKMA 4H60A 5HM6A 3GWGA 4LE2A 4DQDA 1XHEA 3MQ4A 2GI4A 1SXHA 4TMYA 3EULA 1BDHA 1A04A 4G0MA 4W5RA 4MPTA 2JVKA 1B00A 3JY6A 3C97A 3O2SB 2R47A 1AB6A 4YR7A 1DC8A 3Q15C 1E6KA 4ZMSA 2PUAA 2JVIA 1ZHHA 5EWMA 1XHFA 4IGAA 3IPCA 3CZ5A 3MA0A 3UKJA 2M1ZA 3FMVA 1C0EA 2JK1A 1JL3A 4Z9AA 3KKEA 2FQWA 3H5OA 1D5WA 4MLDA 1H9CA 1IIBA 2NUBA 3G1WA 3DZDA 3MM4A 3C3KA 3KSMA 4WUTA 5T3YA 1PNTA 2B4AA 1Z17A 4S05A 1JDPA 1QO0A 4MR8B 2FLKA 1UDRA 3O1JC 4E7OA 1QP7A 3KHTA 4XFKA 3O75A 3RVLA 1D1QA 1BDIA 4YLEA 4HYEA 2FW0A 3KYJB 3LOPA 3KLNA 3LUHA 4W5OA 1RZRA 1GCAA 2CWDA 5CNMA 5DCLA 1SXGA 4WZZA 2KYRA 1K68A 1T34A 4D74A 1Z15A 4PEVA 3SY8A 2PUBA 2PUDA 2FTKE 4EYOA 1ZDMA 3ROFA 5IX8A 4Z4IA 2LBPA 2WRZA 2YHAA 2IPAB 1JYEA 2WB4A 3HJFA 4LX8A 1FFWA 3LUCA 1JH9A 3BRSA 3LUDA 4N03A 1NXWA 2L17A 4MS3A 4FE4A 3F73A 5EWJB 1L5ZA 2JCGA 3CFYA 3ILHA 4XARA 8ABPA 3H1FA 4IMJB 3OLZA 1RXEA 2VUHB 1PEAA 4EGSA 2FMKA 4KK3A 4MRMB 2WMYA 4IF4A 5IEBA 5KQPA 3H5VA 3H6GA 1CEYA 2DRIA 1QNLA 4MR9A 4ZYLA 1VRVA 3HS3A 1M5TA 1VPWA 4QYMA 4KNYA 1USKA 3GV0A 1EWTA 1YMVA 4RK4A 3H1EA 4L4UA 4RK6A 1NATA 4WXEA 4JP1A 2VK2A 2JB9A 2PKXA 4KK4A 3EJWA 2I6FA 1P6QA 1OXBB 4YV7A 3R0JA 3RVKA 1NXPA 1LBIA 2QV0A 4F11A 5FWXB 5JNRA 2E4WA 1SXIA 3JTEA 1P6UA 5TPWA 2PE5A 1QPZA 3DLBA 1C4WA 1QMPA 3KG2A 2WY2D 3MIZA 4MRMA 3Q7SA 3LUJA 5JNSA 4YP9A 4YO7A 2B1JA 1AB5A 1ISRA 1Z16A 1DG9A 2FEWB 4RK1A 3HUTA 5TQ2B 4G0PA 3P9YA 4L85A 4RS3A 5IBQA 2PUGA 1KRXA 4MS1B 1DP4A 3O21A 2FQXA 3QEMA 4S04A 4DADA 2LP4Y 3DBIA 4F8JA 1E6LA 3HVRA 4NCBA 4MGEA 4MAAA 5CNIA 2F8SA 3OQNA 5KC9A 2IPMA 4WWHA 3JS5A 1K66A 5FWXA 2PL1A 4OATA 4PICA 2IYNA 4B09A 4EUKA 2FMIA 3LTEA 4Z9BA 1JFSA 3RVPA 5JNTA 1JFVA 3KS9A 2FN8A 2FSPA 1BDJA 3KYIB 3N75A 3NHMA 3I5AA 4PYRA 2LIVA 3EDCA 1ZVVA 5KQMA 1MB0A 5E3JA 3LUFA 4EVSA 2MSKA 5GOTA 3RH0A 4HNSA 4XAQA 4KZKA 3JPWA 1U8TA 1URPA 3A0UA 1GLGA 1P2FA 4RY0A 3N6VA 5KI6A 2JBAA 4MQEA 2PUEA 1FFGA 4RKQA 3F6PA 3KCNA 2R4QA 2ZWMA 2H0AA 2X7XA 4FE7A 3EQZA 5KQGA 1DCMA 3UK0A 3M9WA 3OM0A 2V0NA
chains in the Genus database with same CATH superfamily
3TSYA 4MUKA 3WZLA 1NLUA 1Z0SA 2NLOA 4IUBS 5G53C 4QOHA 4JP8A 3W1WA 3PTAA 3FETA 2LRHA 1Y6QA 4P3XA 1IN7A 1Z25A 4E5YA 5PGMA 2VOJA 3ABZA 2CLEB 4RELA 4S1OA 1JXAA 1UBCA 2O7SA 3EPRA 4FHZA 4XYGA 3U4GA 4US2R 1LK5A 4RA6B 3AZPA 4D96A 2Q28A 2EJCA 3EXG2 4RF2A 1W0KA 2HCTA 2XCSB 1O89A 1WMBA 1ND6A 1SC9A 2ZJ8A 2M6KA 2HW8A 1CUYA 1KNQA 1NURA 2XTNA 3PC8A 2H5IA 4ITVA 4P3PA 5F76A 2V1XA 1GLNA 1L1FA 4BLOA 4FOTA 1PR1A 2O2XA 1TM5E 4BN5A 1HTWA 1I32A 1P8AA 2JJQA 4C9BA 1X7YB 2JEZA 1EBBA 2HBZA 2RBKA 1JIJA 4GO1A 1S3IA 1R2QA 1S1CA 1T35A 3GYBA 1XTBA 1CQPA 5DTQA 1PVVA 2YY5A 1X7GA 4RK7A 2WD7A 2YNMA 1P0MA 3KXPA 1NQUA 2GPJA 4YRZA 3EXAA 3G6KA 4AMYA 3ZCPA 3S2SA 1F8GA 4L3OA 1VJRA 4J9VA 2GZSA 4F56A 3DKVA 3OZTA 3WIDA 2CXTA 4XB6B 1N7JA 3T06B 3VA7A 4PRKA 1RCTE 4AKSA 3RARA 2R6DA 4K81B 1Q3HA 4R8VA 2VKTA 3PXBA 1TADA 3QV2A 5KWVA 3R9KA 4LYHA 3UF0A 1GV0A 121PA 5A7GA 1QG6A 1UFRA 4PSAA 1NN1A 5KJCA 3V8NA 1N0HA 1TI7A 3ZE9A 1H69A 2IPXA 1JILA 4L9RA 1G0OA 1WZCA 2BI7A 5HQJA 4Y9SA 3QG5A 2AE1A 4TL6A 3ELBA 3DULA 3HVHA 3NIWA 3MCWA 2O0LA 3OM1A 1WRBA 3EMDA 1LWOA 1VLZA 5A6SA 1I4TD 2PWZA 4H31A 4UARA 2G9VA 5JALA 2VJNA 2VWPA 1ML4A 3QBVA 2AWOA 1K7SN 3HCFA 1X8LA 4FZRA 4L8WB 3IOMA 4XIJA 3TLBA 4Q24A 1KEZA 2CHQA 1U6IA 2BDTA 3CH4B 5D6OA 3L04A 1V7QA 3O2NA 3QPBA 2BGJA 3EQ7A 1MF7A 3VO1A 4GGOA 2CVFA 1J9EA 5JROA 2SKDA 3ZHCA 1S01A 4JI2B 1OVGA 5SYNA 4ZMRA 3L5OA 4XPIB 3OE7A 4FZ3A 3TSWA 3MJVA 2I2FA 4HY3A 1H6AA 4M38A 3RVMA 4Q02A 4HH1A 4PINA 3DPUA 1NVAA 2DWOA 3ITEA 3KKPA 1N2EA 4I7EA 2Z2ZA 3QUTA 1Y48E 4ZOCA 3L0CA 3SJAA 1HG1A 4UCQA 3SZLA 4IHJB 4C2UA 1FFXA 2A2ZA 3I09A 5A06A 4IMIB 3FLEA 4Q21A 5D3KA 2W4IA 5HMLA 2DFDA 1TAHA 3V4OA 3DDNA 1A9XA 4MWOA 4C6RA 5BNIA 3LX8A 4GLLA 3RRJA 2ECQA 4DL9A 1NU8A 1DV2A 2XKJE 1DTEA 1NDUA 2V7WA 3IJRA 4TV8A 3U40A 2NUPB 1ADJA 4L22A 1H5NA 2OORA 4XCXA 3U7QA 2G1UA 3WGIA 4CL3A 4QREA 2WU4A 2BM0A 4KU4A 4URFA 2ID8A 2QJRA 4FYIA 1UXHA 4UFNA 5CVDA 3LBAA 4C7OA 1W7AA 1NN5A 3N0VA 2NYRA 3UWKA 1R8YA 4H6PA 2ZAIA 4JR2A 1U6JA 4TXHA 4V0KA 1UKCA 4WADA 2Y77A 1IWOA 2CFSA 1RMQA 5TPZA 3TW8B 3H75A 4ZAGA 1W75A 4JK3A 1JEJA 1J0BA 2GUWA 4RDXA 1L4EA 3SYRA 4W1RA 2EJUA 4PXSA 1LLFA 2M9MA 3KOYA 3OEWA 5IHXA 4PCUA 2OGWA 1QF6A 4FEYA 4F84A 2RCNA 5F7ZA 1XZ8A 3CY6A 4GKVA 421PA 4AMGA 3KWMA 2IHJA 4MQFA 2XVYA 1HYQA 2E4XA 3VHRA 3ZGYA 4EGCB 5I48A 3ZCXA 2V6GA 5IABA 4QFCA 3F4LA 4FHGA 4E88A 1AV6A 4IQFA 3UTCA 3DWIA 1P0QA 3ICCA 2J0VA 3UPTA 5F5NA 3U4HA 1RKXA 5IVKA 1G8PA 3A4VA 3U0BA 1PZHA 4UFPA 4QBHA 2QL5A 1A82A 4AS3A 5JMTA 2OQIA 1ZG3A 4GZ3A 2B0CA 3QNUA 3ZX5A 1OLOA 1N78A 3B60A 3TZKA 3V1YA 4BQRA 4NYIQ 2OA0A 1VCMA 3WYCA 1N3LA 4ZU1X 5PNTA 4OQPA 3H0CA 4LDAA 2KMLA 2KS6A 1WMFA 3UJ6A 2PMCA 1YQGA 3H17A 4AJKA 1XWWA 4NX2A 1B93A 4KKVA 1M1YE 1JS1X 2GA8A 1XNGA 5I7VA 2P0EA 3S2GA 1GPMA 2IQ5A 2J7PD 4EFKA 3ET4A 2XA9A 3D2CA 2PZGA 2X3FA 2R48A 1T6ZA 4M36A 3ZK8A 5C1DA 4QU5A 4OHFA 4GQIA 1WM1A 2Q9BA 1U8AA 1L7NA 4PLZA 4C4SA 2HXYA 1UXOA 3MJTA 4S0XA 3QLVA 2G08A 2J9XB 2W2VA 3RRNA 2RDMA 5A3VA 3EX7C 1K98A 5AI9A 4GNRA 1VYVA 3AFGA 1E9AA 2AN5A 1XVTA 3OEHA 2JFPA 3CF4G 3W8NA 1CIVA 3DFFA 5KIAA 1PQUA 2OZVA 3E58A 3HB0A 1V3UA 2VAVA 2ZBEA 5HDBB 1DS6A 4IIHA 3FI9A 3S4YA 2PVCA 4R9UC 3W9SA 5IJ0B 5JNWA 2R1TB 3AY3A 1XMOB 4E5KA 2WZQA 4OP3A 3KT8A 5E1OA 1JB9A 3ETHA 3BH0A 1ZGHA 4NS4A 5CM2Z 3CLRD 3DMNA 1ONNA 5LMCA 3FMIA 2BGLA 4Q3OA 3V6MA 1VKNA 1ZESA 4FLEA 1F14A 4NENA 3ELYA 3U3DA 1MOZA 1T5LA 4NBLA 2C8KA 1Q0TA 3DAGA 2YWEA 3CBGA 4YIKA 3OEYA 1N2XA 3WQQA 3BIXA 2WUFA 5CH5A 3CUVA 1W9MA 1AUVA 5DNDA 4D8UA 4RSHA 5C5IA 1ADFA 1NVGA 1LPPA 2NOAA 2Q6OA 2VUIB 1RSZA 4M54A 5FYQA 1Z4JA 3WDLA 2GX6A 4E4TA 4PLHA 2IDMA 2HO5A 4IJ6A 1ORIA 3KFLA 1RWPA 2IJGX 2P4SA 1H8EA 2RHTA 2ZSAA 4EKDA 3LRXA 3UAGA 1XE3A 3AOEC 3OIYA 1AS2A 2FDXA 1NNSA 3P4UA 4RU1A 1US8B 1BRMA 3UJ3X 3CN7A 4NG5A 4JT4A 3EPLA 4C2AA 5C53B 1QFJA 4QASA 1RJEA 1IEVA 3OY7A 4UTNA 2A4MA 2P79A 3PEVA 5IHPA 5JECA 5AOCA 5JDIC 3OLVA 2AOUB 2VPWA 5C3MA 3V1MA 1MN6A 1FYVA 2F3PA 2FFRA 4FEEA 5K0SA 3D2LA 3MWJA 1MC1A 3ZGNA 2QBYA 3BHIA 1ZM3A 5FO1A 3DMFA 1QIHA 3GJ0A 1CY6A 1MCZA 4IDPA 4EHFA 2VJCA 2OOSA 1CHNA 4Q18A 4U6NA 3NFYA 4FIZA 2VRBA 5FPHA 4AP9A 2Y6VA 3HKDB 3GAAA 5I9SA 5IH7A 1E5VA 2QN7A 2P5UA 1H4QA 1QU3A 4EEZA 1N6LA 5A5FA 4G84A 4XDZA 4Q4AB 1YHYA 1ZW6A 2HRQA 4D44A 4UXHA 3V8VA 1CLEA 4L6CA 3LPAA 3O92A 5LIPA 3WKAA 2FKNA 1DINA 3GEHA 3H4MA 3KFXA 4BBJA 3NTRA 3IAFA 1WHTB 5E7IA 4KSBA 3ITDA 5CJ2A 3TH5A 3Q7QA 3ZVMA 4FT2A 3TAHA 4Z4GA 1W0JD 4PLVA 2IYVA 5KJFA 1P9LA 2VT2A 2RK6A 1YK0A 1J09A 3UXEA 3LECA 4JIGA 3K6JA 4WDQA 3R5SA 2CZCA 2GEBA 2D5AA 2QUJA 3F6SA 5H81A 2Y3IA 3UQZA 2D0OB 1PT6A 5J4LA 3DW1X 2MR5A 4YMWA 2FW7A 4YRCA 3TG2A 3DOIA 2HJRA 2IPLA 3KQNA 3LNTA 1G2PA 2YUTA 1JG2A 1T9ZA 3OZVA 3Q6NA 2R7MA 3BOSA 4M4SA 4QPJC 1W85A 2WNIA 1G8AA 3CVUA 1TJYA 2Q2QA 1SBNE 1O94C 4MYCA 4RF4A 2D5CA 4X61A 4UUPA 3L43A 1XLWA 2C2YA 4Y2RA 1VSBA 3WYNA 2QI9F 3Q9NA 3QX9A 2VQ6A 1JAIA 2RBGA 1FRZA 1L7DA 1GGJA 2VP5A 3EZNA 3MW8A 3R3VA 4QEKA 1KE1A 1FBTA 1WLSA 4EI2A 3VKWA 3D9QX 3HHEA 1U7UA 5I3CA 4QELA 3ZGOA 4D4GA 1JZSA 2PZAA 3EZ2A 1C7RA 4HG2A 2NO0A 3T34A 4ZDKA 1MJ5A 2GI4A 3AM1A 1N5OX 1CV2A 4XR4A 1VLMA 3TIIA 1WW8A 2IEZA 4RFSA 2ICAA 2E6UX 1ZK4A 4QDKA 3I30X 4M7OA 3VU0A 2HF9A 1NRIA 1KZGB 1P2TA 3CT4A 3BE4A 3DVAA 2AOTA 3SC4A 3OCCA 3ZE6A 3L1VA 1HBJA 4XWTA 5TMDA 3DT8A 4I3GA 4FYKA 1LW6E 2FZVA 3AU9A 3OPYA 1KKMA 2R5FA 3MHTA 1NHWA 5F4ZA 2GJ8A 1FFCA 2M1ZA 3ABQB 2AT1A 1VIAA 4PNPA 2OCYC 4DABA 3RVLA 1QQ5A 4NOKA 1GNSA 3O3CA 3EXHA 1OBFO 4YV2A 3PTLA 1M7GA 5L3SA 2I4LA 3WDKA 1BEZA 4C87A 3KTAA 3BWYA 3TXXA 1TJPB 1U5CA 2H4XA 5G41A 4C7VA 1GLVA 3ZNPA 1C50A 4UTVA 1JHMA 2VTEA 4CEJA 1CUJA 4HKTA 2Q5JA 2NTVA 3KDPA 3M7IA 3QEOA 4EDHA 3BEOA 1BDIA 2HU8A 2JPDA 3VU8A 3LY5A 2BP7A 2OT3B 2YWFA 3HJAA 1GRCA 4V0NA 3D4BA 3A04A 1IQUA 4OGWA 2OUIA 1K1EA 5I4KA 1S0UA 2QZZA 2VUUA 1VXRA 1LEHA 3TL3A 5K3FA 2KYRA 3PFFA 4GOLD 5CH8A 4D74A 1Z15A 3FR7A 1CZKA 2NU7A 4PEVA 2FPOA 3H5NA 1P4JA 2B8EA 2IEIA 1MRSA 3R8XA 5F12A 4Z4IA 2GN8A 3HE3A 2BEUB 2JC3A 1NPYA 3Q98A 1G5TA 2OR3A 3L07A 4WTOA 4RTOA 4NBRA 5HFNA 3QVXA 1QFSA 4KE8A 4MS3A 1XP8A 5EN4A 2HL6A 2JGRA 2RBEA 1NN0A 1DXQA 3NATA 1RC1A 4IJMA 4TWRA 2RG1A 4DR7B 4LFBB 2D1FA 3A7DA 2PKWA 2VUHB 3AR9A 5J9FA 4EUEA 5KYYB 5IEBA 3T7TA 1W76A 2J3DA 4JYBA 2VZLA 3AKDA 3KEMA 5HGXA 1D0IA 1K6JA 4QULA 1X1RA 3E1GA 4UBOA 1VRVA 3HS3A 1TEXA 3PBKA 2CNKA 2RHDA 1HRKA 5E1DA 4IDOA 3QJ5A 2OLEA 4XLLA 4EG4A 5BSHA 3WB9A 3BFXA 3FYDA 5FEMA 1PVOA 3NCTA 1XPOA 4DR6B 5CX4A 2C2KA 1A5TA 2VH5R 5AM1A 4GP7A 2I6GA 1NSYA 1L7PA 3SXUA 1EJ2A 3J80A 3E70C 1QV7A 1IATA 1U9ZA 1FC0A 2GBLA 2ZIAA 3CWZA 5TPWA 1JE1A 1Q2UA 1W1UA 3L6BA 4TV8F 5FRDA 5JYBA 5KYYA 4B6OA 2A0KA 2I54A 2GZ1A 1WZ2A 1Z82A 1Z7YA 2P91A 2JEYA 1ACLA 1I2CA 3DEZA 3H3JA 5JW6A 13PKA 2W4MA 3U1BA 3DWEX 3O38A 3BIFA 4GOKA 4YP5A 2D5IA 2YOFA 1O3YA 2DU8A 2LP4Y 4M1WA 1E6LA 3WWPA 4AT1A 4B3SB 3PNMA 1Y7LA 3H7AA 3IIEA 3OJWA 1GR0A 2H1CA 1NJFA 2IPMA 5T6BA 2JCSA 5B1IA 2EERA 2RFLA 3K5IA 5IBRA 5ITSA 3OE5A 2Y76A 4P92A 5K9ZA 2HYIC 2WDPA 4LXIA 1JNYA 2IYNA 1SKQA 4OAOA 3IEPA 4BWGA 1G3QA 5K0GA 3R1IA 3EMKA 5AM4A 3G2MA 4CF3A 2FX5A 4HGPA 4JQSA 1DTSA 3FOAA 3RLIA 4CKCB 3T35A 1CKEA 5EMLA 1U11A 3AV0B 2QM3A 3CNEA 4KYTA 2GHTA 4PYRA 2OSVA 1MB0A 2Y0CA 2ZUDA 4YAFA 2IIPA 2VA8A 1ICEA 4J29A 4AS2A 4EB8A 2ZUFA 3VFDA 1E1CA 2C42A 3RH0A 1G8YA 3N2IA 4OHXA 4I1UA 4MWDA 3UV3A 2P9TA 1YIDA 2D2IA 2XSZD 3DONA 4HX5A 4CT0A 3H84A 2ZR0A 1K0UA 4KACA 1DEOA 4KR2A 3R41A 4RJKA 3JARA 1E1QA 4G4SP 1KAOA 2DWUA 4M9CA 3PYXA 4CM8B 2E21A 1O4WA 1WAMA 3D81A 2P62A 2I65A 2Z4TA 1DCMA 2FUEA 3JQGA 1E62A 2VK1A 5DM2A 1IY0A 3FSGA 1C41A 3HCCA 4N4AA 5AK0A 1AO0A 1D03A 2QE7A 3JTMA 4GP6A 3W2TA 4KBGA 5ALFA 2BIFA 2PH5A 4CBVA 1ISMA 3H4IA 4DLLA 3A9SA 5A3JA 2VP9A 5HJEA 2YHUA 1L7EA 1XCBA 2R44A 2QU8A 4EO7A 2E4UA 1AK1A 3KBOA 2C8JA 2AK3A 4G01B 4GMKA 4ER6A 2Q9AA 3KTDA 4UDYX 4KAXA 2OPHA 2VAMA 4E2FA 3MEQA 3QJGA 5F9HA 4IIFA 4KIGA 3UFXA 3CZ9A 3HUUA 4YH1A 1P9WA 1PYDA 5CYPA 3DO5A 4JC5A 1J1IA 3BXHA 5JHGB 4TSFD 1QZTA 2V96A 2VJBA 1VSTA 1S6YA 2IF0A 5LDGA 1XMJA 5LU9A 3DZIA 4DXAA 3LZDA 1UJCA 2EKBA 1U5BB 2BGTA 1ECLA 4WCDA 3ZIUA 1NBMD 2PMKA 4C7MA 4FFMA 3K09C 1TVKB 2X0EA 1OH5A 4WXRA 3ECAA 4B46A 4FSHA 4NCAA 3B7PA 1KMIY 4RGQA 2HCRA 3DHWC 5A04A 5AUOB 4FM9A 4LSMA 3USES 3EPHA 1HYEA 2OLKA 4EHAA 2NP7A 3AVXA 3JRNA 3EHEA 3WGNA 1U0FA 4DWWA 3JWJA 3OTWA 3RKSA 2QVXX 3VYRB 7YASA 4QAQA 1XVIA 3M6MD 2DH6A 3HGMA 4O25A 3EUWA 4JC0A 1T3LA 2PX4A 1EWVA 3HEMA 3UMFA 3K2QA 2P75A 3O26A 3T95A 1DHRA 4K9KA 1L5MA 3UFBA 2WUWE 2J0QA 3PE6A 2PAAA 1NJ6A 2AYXA 2D0IA 4LJ5A 2O52A 4RO0A 2NZYA 5JU6A 3EFOB 3UK2A 2ONCA 3HB5X 3KQYA 4MV6A 4Y2YA 5DHQA 5TQ2A 2B36A 2F43B 4FQ8A 3SLGA 4XB1A 3CEMA 1R88A 3JARB 3CSDA 2OHVA 1JGTA 3QKRA 5FTKA 4EUNA 1TQ4A 4M1EA 4BUJA 2P2NA 1RI1A 1T2AA 3KKNA 1A71A 3CLTD 3DVRX 4H7PA 1NZFA 4UAUA 4FDLA 4MUFA 5E38A 2Z6UA 1D4AA 3G5UA 3UJDA 3THYB 2HQRA 2DQ4A 1RYBA 4JGIA 3OX4A 1XTSA 2JIDA 3B1FA 3NGMA 4X8OA 2VTKA 3ZG6A 4U0JA 2RHGB 1SUFA 2X2EA 1L0BA 4OJKA 4OBWA 1V47A 5FBKA 5U9CA 3KOMA 4JY7A 4E22A 1MIHA 4DBLC 2BR4A 1PGPA 2F64A 3KQMA 1E2LA 3UM9A 3QTBA 3IR6A 1QRSA 1I33A 1OLUB 3C3AA 3CG0A 3NH6A 3NANA 5C1IA 2DUNA 3GBVA 3DDUA 3PQDA 2NU8A 4P4GA 1XZNA 1LI5A 3VZQA 4A16A 4YRSA 3KT0A 5DNCA 2HLPA 1HYGA 2ODEA 2Q49A 4J43A 3TZHA 3WHKA 3WL3A 2A0UA 3F0TA 4TVKA 3PI6A 4CQLA 3ROTA 3VPSA 3DPSA 1MOPA 2KPOA 4RJJA 5JTUA 5MF6A 5L9AA 1P7VA 2R0QC 3N53A 1GU7A 1AZWA 2X5JO 4RKRA 4X54A 4TTVA 4IFEA 1JEAA 5EHXA 1KI6B 5H3CA 3WMGA 1E1NA 1JFFB 1UKYA 1VLJA 1SOAA 3QFTA 3OQIA 2QUKA 2FFJA 3KQKA 2UZAA 2EWWA 3ZWYA 1PP4A 3CW9A 1JIQA 3STUA 5LP6F 3AR5A 4JROA 1HGXA 2OQVA 3SXUB 5EKUA 3EEBA 5FWAA 4DA8A 1GRVA 3TCXB 1A7AA 3VH1A 1Z3CA 2SHKA 3S5JA 4RD1A 2J3KA 4EBBA 1NVUQ 4GYJA 1A4UA 1AS0A 2C3OA 1JTFA 3ROEA 4WT7A 3VR5D 4B6JA 1ZH0A 2D13A 2IA5A 3MC1A 1EUDA 5D00A 4GHWA 4BATA 3WB2A 3Q7RA 4DCUA 3SC6A 4E5VA 1TMYA 4GPEA 4JBLA 4MUIA 1GEEA 5A9SA 2PX8A 3R3SA 4HDNA 3ZCVA 3HU5A 4F6CA 6REQB 4OLBA 3D8BA 2VTBA 2VQFB 1D9ZA 3LCVB 3DEYX 4TLCA 3ZEAA 4BNZA 2JA2A 4BE4A 5A02A 3FOCA 4IWNA 2H2HA 2NAFA 1QH8A 2PA0A 3LMKA 4LRWA 1X7DA 2CFIA 1OPRA 3PEUA 4D4JA 4B2LA 2ADOA 5IPFA 1IY9A 1ZN9A 3I83A 3A6GA 1C4KA 5LXTB 5I8ZA 2B4RO 2JKYA 5JRDS 1GPYA 4CCAA 4NLLA 2QYOA 1ZSNA 2Z58A 5EWMB 1CQJB 2VDPB 2RONA 5BVGA 3BL8A 2RAVA 3MRXA 4AMVA 2UUBB 1JVNA 2WF9A 4HC4A 3IL2A 2OECA 3BPSA 3PGMA 4L3VA 4ZAFA 3ESYA 3A27A 1C7ZA 4BVFA 10MHA 2JD1A 2CLDX 1UBGA 2WSIA 2XYPA 1FVFA 3KYDB 2GCPA 1BQ3A 2GVNA 3GFBA 3PLRA 2K2QB 3UH1A 5JSKA 3PE3A 3LZ6A 1QS0A 5FI0B 3KK0A 3NHRA 1QMGA 2XMBA 2E87A 1MC4A 4EG5A 3EQ2A 3H7IA 2NN3C 3EIWA 4OA8A 3OFSA 3LNCA 3PC4A 4U8GA 1FNBA 2JGNA 2WSMA 2ZSJA 4G37A 1HEYA 3AW8A 1F9AA 4W4TA 3HYTA 1XXHB 3K9BA 4TYQA 4PYJA 1BW9B 4JLWA 5HKOA 5KWEA 1JLKA 3QF4A 3JVUA 4HGQA 3L4KA 2C4MA 3R7DA 4CMIB 3M2PA 3B82A 1H6DA 4EFNA 1OIVA 4EG7A 1P1FA 3DHVA 3EWAA 3IUJA 4NKRA 2H18A 1JXQA 1L5YA 2W4QA 3ESBA 4WK2B 4LDZA 5ALDA 5K0NA 3A2KA 1DVRA 1D2MA 3C98A 4D5GA 1ZW1A 3OPMA 5ED0A 3VU9B 5JVDA 4TT8A 1ST3A 3E8MA 5F2EA 3VKFA 4ABTA 3I9FA 3JAKB 2P2CA 2ZU0C 1SBCA 2Z04A 3UOAB 2FV8A 1NPTO 4Z7NB 1E5DA 1P72A 1Z6AA 3H1AA 2DHEA 5DM60 4K8RB 4PG8A 4KRXA 3NTUA 4QM7A 2ZIZA 1KRWA 5D5QA 3RSOA 1PW5A 3CRW1 3HY6A 1D8TA 5EXEA 4U2BA 1JEQA 4KR0A 5BV8A 3EZYA 1UDCA 1EESA 2YY6A 2ZI4A 5TQJA 5FX2A 1P2UA 3DMGA 3EUAA 2IVZA 3WY9A 2E5FA 4UHDA 1J23A 2BZ1A 3SJBA 4Z7JA 4B85A 1M76A 1X2EA 3D3KA 3H9JA 4NK4A 1T0JB 3A2MA 4WZBE 3QWAA 3GZNB 1FXSA 1YACA 4LQDA 4MYDA 3VR6D 4BEJA 1DUSA 1U0OC 4K87A 1RBMA 4LY9A 4AJNA 3EMBA 5F52A 1ZD1A 5B6PA 1UT8A 3OIVA 1TNDA 2WKQA 3OEEA 4Q6BA 2P9HA 4LRQA 1EG7A 4B79A 3NKFA 1TF7A 1W36B 4BBPA 2XE4A 5LZ9A 3BVPA 5FULA 1MU0A 4KITB 2ZTMA 2A9VA 2XCIA 1P4HA 4WGGA 3SZUA 1VE5A 2A0YA 3H18A 1J2EA 2PGOA 3FE2A 1NF3A 2CFTA 4BMZA 3UWSA 1WU7A 1MJGM 1ZH4A 5F5LA 3RRMA 1SELA 3WWYA 4IDBA 4WZ6A 3OECA 3GA5A 1CUHA 3QBDA 1CP3A 1NVDA 3FNRA 2EQ5A 1MAWA 2P6UA 2PX2A 4I1YA 3CNOA 4H77A 2MYPA 4MW7A 4HNGA 3CVYA 1TB4A 4RS4A 3VPCA 1YS4A 1RM5A 1EVJA 2BFBB 2P65A 2AGVA 4FFBB 1EVYA 4ILKA 1QGYA 3GG9A 1JBQA 3LDFA 4M8LA 4JYCA 1D9XA 2IBSA 2EF1A 3LS2A 4BLSA 4ZT2A 3MRTA 5LQCA 2ZCUA 4BFYA 4O63O 2BGIA 4O59O 1XMQB 3JALB 1ZM2A 2OBMA 1OGYA 2JFOA 1YS1X 4JI8B 2CVPA 1X1TA 4U63A 4Q82A 2W2MA 3C3EA 1P2VA 3DTNA 3DBRB 2RGNA 1T5IA 2QJTA 4EARA 4HRYA 5KX5F 5TX7A 1DO0A 2FHPA 2J8ZA 4D42A 2AJBA 5TE9A 2AVDA 4OFXA 5EG5A 5FP0A 5J40A 1E6CA 4IDFA 4XUDA 1W4BA 2Z30A 3TQQA 1SFRA 5D84A 1QLHA 3HR4A 4PYOA 5FL3A 3WGLA 4FXOA 4EVRA 4U7HA 3DVLA 1RZUA 1Q7RA 3KLBA 1P91A 5SYAA 3LI2A 1RMTA 3DTTA 2A88A 4OLFA 5TARA 4QODA 1O6ZA 4U7WA 1JSLA 2OQRA 1T6BY 1DEKA 1NU6A 3KKKA 1MB3A 3AGQA 3PUWA 4OYLA 3VPDA 4C4XA 4ECAA 5BR8B 2IS1A 1U2PA 3BGOS 4L07A 1Y7HA 1T2NA 4XJSA 4ZFNA 3B6IA 4QQNA 5J43A 4Q01A 3UBMA 1DO8A 1WXDA 4IXWA 3H2KA 4L4YA 4INOA 3JYOA 1P5HA 2QR2A 3HI6A 2UAGA 3VU1A 5LQKA 1GDDA 1J70A 4RHTA 4HPJB 2R6CA 4MS4B 1J07A 1UBOS 4R9VA 5D3MB 4WBNA 5IKEA 5T5QA 3ETCA 2BAGA 2I2BA 2PL3A 2Y27A 3ESRA 3IO3A 3OEHD 4RAQA 3WLAA 1IEQA 1Q3KA 3QUQA 1IRXA 2G28A 2QP4A 2DECA 2ZRAA 3TI7A 1IH8A 3DDZX 3NIGB 3FNIA 4YJ2F 2AJCA 4N8SA 1SK9A 4G0MA 4U9HS 1FNMA 4ZJZA 4ALLA 1D6SA 3D2BA 1YC5A 3JYLA 2PR7A 4N9QA 3O2SB 2VPYA 3I3OA 3RUFA 3WSTA 4IZIA 1NQ5A 1UWLA 5FOSA 3ZVNA 1TT7A 3MGGA 3ZWCA 4PU0A 1M2WA 3GNTA 4NONA 1OU4A 5EI5A 2DC1A 3M6UA 2OAP1 4HP8A 3LHIA 4S2EA 3NHJA 1WXFA 2IE0A 3PGXA 4X00A 2WQZA 4F3RA 4Q7KA 1BCRB 1LC3A 4HLQB 1C0EA 3SEFA 4B8ZA 3WGZA 1YR8A 4DPLA 8AT1A 5EIFA 1D5WA 4H6WA 1PI3A 5F3WB 3MELA 3ZDQA 1UBHS 3TJMA 3QVOA 2FCRA 4MEBA 1PNTA 3PUJA 4H17A 3KE9A 4BLUA 3RV4A 4PIVA 4YV1A 4S05A 1X3LA 2EF0A 4DLAA 4NI5A 3VRHA 1ZINA 3A9RA 1SIUA 1CUCA 3MUEA 3OCUA 3CEHA 3QHQA 1Y6JA 2V54A 4Q1DA 4ARUA 4B73A 1CEQA 3I58A 3CTMA 5J58A 4EHIA 1WCXA 4L5JA 3FBWA 4AJEA 3IIJA 1RP7A 3T7RA 1JG7A 3QOXA 1WDTA 1GN9A 3B12A 3ZHQA 1H8HA 1HV8A 5ES4B 4IH4A 1RZRA 4H16A 4YR9A 3BXXA 3RIEA 4V39A 3GXOA 4ZI7A 2EFHB 5JWHA 4LYJA 3HCNA 4Y9DA 4YCMA 2H31A 4NH0A 2PUDA 1LDNA 4KLZA 3C5EA 4H35A 2W00A 4Y7DA 1U3FA 3IV9A 3IVXA 4OU4A 1N4AA 2W6OA 2Q0QA 4O4IF 2YNMD 2HB6A 1FFWA 3CPSA 5DNVA 4ILEA 3G89A 4PN7A 1F5NA 2QN3A 4IYRA 2JLVA 1KJ8A 2G8NA 4BZQA 3F73A 1M34E 4GOOD 3KD2A 1V35A 3V4PB 5BXQC 2FPIA 5TEVA 1CW2B 1OWPA 4US1R 1SO8A 5CFZA 5JSQA 5KQPA 3H6GA 5TVGA 1LSOA 1WMDA 4GXNA 2GDJA 3MD9A 1X7WA 4H0NA 3TLCA 1XTTA 4ZYLA 1N1EA 4OHRA 3ZGVA 4PGAA 1OFVA 2VYFA 3EH2A 3WV4A 1M5TA 4KWCA 4BVAA 4D0SA 3RTCA 1U9CA 3RHSA 3SOPA 1L5RA 1V48A 5EXSA 2C82A 4H0FA 2M1XA 2O06A 4GM0A 1B1AA 4L73A 4P58A 3ZHSA 1V6SA 4K6HA 4PZEA 1T5SA 2FFAA 4HO1X 3HMKA 3EJWA 4XD2A 4YCAA 1GSIA 3LQFA 2C7GA 4IEEA 3MGKA 3H05A 1EVKA 4WZBA 2CCGA 5BSRA 3HV0A 4RW0A 3TSCA 1P6UA 3WMFA 1HY3A 1IXRC 4QNNA 1C4WA 3LUJA 5DYTA 1LJ8A 3SZ3A 1NNUA 2V8OA 4L28A 2XYVA 3NRCA 2ZJ6A 1I7LA 4G0PA 5IBQA 1C7QA 2HT6A 2PUGA 2BE7A 2Q3DA 3W6UA 2C7BA 2E7ZA 2I1VB 4E33A 3ER6A 3PXAA 5CNIA 2QTWB 2VXCA 2X19A 4CM3A 1N9KA 3OJEA 3LW8A 4DEYA 2Q7OE 2HSZA 2VAWA 4N5NA 5BOVA 1LXCA 1Y8QA 2FW6A 2OO5A 3OJOA 4G5YA 3RF7A 3MWEA 1HYHA 2O50A 2WUGA 3CEAA 3A4NA 5E4TA 3SKYA 3TR5A 2P0YA 4E46A 4ENSA 5CITA 5IDXA 3OZ7A 3TSZA 3T5AA 3WMXA 1BDJA 1H0RA 1C1DA 3AHCA 4Q1FA 3SQMA 1ZWLA 4DHEA 4ALJA 3P9ZA 2LIVA 4MVJH 5AVJA 3BA1A 2DFNA 4DDTA 5K2OA 1AKNA 5F21A 2HA5A 2GLXA 1LSJA 2ASVA 2CCKA 4TMZA 3U19A 3GFFA 4X45A 4CDNA 2CXHA 4BMPB 1IN4A 1XFAA 5CD9A 5CMLA 1LGYA 4C06A 2VYVD 3NUZA 1THZA 4RENA 3CUTA 3KAJA 3USZA 2YXPX 3COSA 3PGA1 3PQCA 4RKQA 3WRYC 1R27A 3JASA 4RE5A 5EJ5A 5HM8A 4G07A 3GDFA 5KQGA 1DQYA 3FMOB 1T0IA 3D0RA 2YN0A 2V0NA 1EUCA 3S6JA 1P77A 2XZTA 3PSHA 5P8WA 4NYIR 4Q5IA 1Z8NA 4M1YA 3WP1B 4B3DA 1CBUA 5ENZA 3IAM6 3EXHC 5DOVA 5C81A 4TYNA 4QDUA 4UM9D 3FPSA 2ZB8A 2ZBQA 4UU7A 4A0FA 4QTZA 5DO9A 1NQAO 5JQGF 3FW1A 4JLVA 2A5GA 1UM9A 3A3KA 3OKCA 2J48A 4I1VA 4LYAA 3UT5A 3VOAA 1FP2A 3OU6A 2DHCA 4I4CA 2OCDA 1A0OA 2FSUA 3Q1LA 1J33A 4D9EA 2XOEA 4ENQA 2GM5A 2MT9A 2FOXA 3DBLA 2UYCA 1JFLA 5REQB 3TIXB 3SFTA 5IUKC 2BGRA 2C00A 4BFZA 5GZ3A 2AZTA 3FVRA 4Z0HO 3L6EA 2ZE5A 4ZI3A 2B30A 4IM7A 2D6FA 3QTLA 4H3VA 2OP0A 2QVGA 3D7KA 4B5KA 5KPJA 5A0VA 1IHOA 1XJCA 1G5HA 1WE2A 1ZCAA 4BVGA 1QHNA 2HH9A 3IBSA 3F8TA 3SJUA 1U98A 4N0EA 2CL0X 3V8QA 1C4OA 4G2TA 3BAFA 2H1VA 5JLAA 3L0SA 3RIHA 3VC7A 3WMWA 4COOA 5KINB 2V9PA 5M29A 2JCVA 3RSQA 4ZYZA 4KZPA 2Z1MA 3EBPA 1RJDA 3G2QA 2QM8A 4QYSA 2JI9A 2Q29A 4HEJA 4R0MA 2ZRJA 4E12A 1WXIA 3PGVA 3LZCA 1RI4A 3L7JA 1BEUB 1O96B 1UL1X 3K5WA 4LXYA 4RK0A 4HNUA 1X74A 4P7JA 4R54A 4DWJA 5D5PA 2LNDA 3DCJA 1H4TA 4QECA 1Y6GA 3EVNA 1ENYA 1DWUA 1L9XA 2VNHA 3C41J 4G36A 2WSLA 2F3SA 4OSOA 3G2LA 4OREX 2IHZA 1BYUA 3WLEA 2R6JA 4C0SA 5DFAA 1DUVG 3PHCA 1N2CA 3P96A 3TLGB 3UWDA 5ADHA 3TRHA 2P9CA 5EPOA 3PNPA 3WNBA 5ICMA 5J2UA 3ZXXA 3HUDA 4EPXA 1K3FA 2VPTA 1ACMA 3MYYA 1KZ1A 2P4EA 1I24A 3K0SA 1V4NA 5KHAA 5BR4A 2HLDD 1C14A 5FTLA 3D0QA 1K27A 4RY2A 2GSDA 1E94E 1GSHA 1Q77A 2Q6LA 3AHFA 3DEKA 5GGXA 5AYVA 3M6FA 3EB9A 4OYRA 1C0KA 3ETNA 4BMXA 1J2JA 3LD9A 4DXDA 3P1JA 4DMKA 3E23A 4MDEA 3OZRA 4ZGWA 4Y8VA 4B4KA 1F20A 2FXVA 1XLTC 4FHEA 4F5YA 1SCUA 5EIHA 4EYGA 4AY6A 1SXJD 4CMKA 1XZIA 3WWZA 5J2UF 5C7OO 4C20A 4H15A 2ZSDA 4IL5A 3HA5A 2ADFA 4EMBA 5MGBA 2LTAA 3PDHA 1A96A 3PIDA 4N0PA 5HKKA 2CVQA 3W06A 4AJ4A 4CM8A 4CKBA 5JBQA 2O8BA 4B3XA 4JSYA 4GQBA 1U6KA 3R74A 2NXEA 4QRDA 1MH1A 5LU8A 3N8GA 1ZRMA 2PSEA 4I50B 1DB3A 1UFVA 1X42A 3T38A 4FMDF 1SXQA 3V33A 2BF7A 3QMWA 2BSQA 5H82A 1SU7A 1UANA 2MSNA 2WVAA 4E13A 2AW5A 5AM5A 1S1MA 4DLBA 2ZYIA 4YV0A 2IEAA 3OX2A 3E7DA 3KQQA 1TMOA 3MUFA 2FNAA 2QOEA 1JFTA 1JF8A 1VPDA 3HJBA 3LYUA 5LOVB 5FWYB 3I9MA 4AIRA 4CKCA 3TRIA 3PC3A 2VBIA 2WK1A 1YVEI 4R8KA 2KBEA 2PQ2A 5LC1A 4DOMA 1XPRA 4FILA 1ZMRA 2CVZA 2M98A 4Z9XA 4YUYA 2BCGY 1BCSB 2XW6A 1QANA 4FGZA 3HP1A 3G0GA 1KMNA 3E82A 2I5PO 2WD8A 3AC0A 2AN3A 5EJ9A 1LBEA 1UT6A 5BOSA 3Q8WA 5KSWB 1M0WA 2PWPA 2RC6A 4HDQB 4V0SA 4PZDA 4ZXPA 2J07A 3L7YA 3STHA 5BSUA 2P4UA 1YJCA 4MS1A 3V8PA 2D2FA 3T7JA 4KUEA 3V80A 3W5CA 2JLXA 2ZTHA 1QO0D 1XEXA 4H1TA 4IRMA 2E4ZA 2FSVA 4P22A 3RJ9A 4F4FA 1I80A 1GQYA 2EJVA 4FDTA 1NM5A 3EXIA 2FVYA 2R85A 4RDIA 2ECOA 1WDMA 1GXSA 5IKXA 1Z4IA 1YDWA 5IG2A 2Q2OA 4OQMA 2ZYAA 5KVAA 2WUVA 1RLOA 1OYYA 3KLMX 3WADA 1SVMA 1YJQA 2DQSA 2F59A 3P7MA 4LJLA 4LOHA 4BAUA 1FFAA 1ZO8A 2FWBA 3FLMA 4I0WB 3KHKA 1PWEA 3O0DA 2CLIB 2Q3LA 2YFQA 4MP8A 4ZOLB 2QTGA 4F5ZA 1HT0A 2BOVA 1WOYA 2JA1A 3SIXA 5T6MA 1Z2CA 5DYIA 1NQVA 3NTQA 3TQCA 1EM6A 2J0EA 1USIA 2FRXA 3BMCA 4Q3KA 5IWAB 3TKAA 4A4DA 2WYOA 1B14A 4LF4B 4ZT5A 2GHRA 3QSGA 3F3SA 4WK6A 1RBYA 3WQRA 2IXTA 1NRXA 2ZKIA 2L19A 3P2MA 2PIDA 4DVGA 3HEBA 1E0JA 2F1IA 3N39C 4DREA 5I7UA 3KKOA 3OC6A 2IYZA 4OOEA 3LKZA 3GFPA 4WA8A 3IP9A 7AT1A 2AB0A 2WD9A 2LKDA 5CNJA 3WHIA 4OLAA 4X94A 3EPJA 4IOMA 2O8EA 1FXUA 1USUA 4QXPA 3AHJA 1CUXA 1ZU4A 2YYSA 3BFKA 2C95A 4V2IA 2GZMA 1KWGA 4DT1B 1P18A 3DE7X 4LBZA 4L1KA 5ECGC 4ZAYA 1VCOA 4KXVA 3O95A 4AQDA 4AF7A 1WDKA 4ZCMA 5F64A 1EDBA 1II0A 1AHNA 1XYVA 5JI3E 5JJLA 4D98A 2EW2A 3D3WB 4NS1A 1G8KA 1QHXA 1Z6ZA 2PH1A 2FGJA 3ASUA 4KQXA 1I1OA 3QNMA 4EX6A 1KJNA 1USVA 3H1TA 2VR1A 1ZOPA 1JQKA 1RLJA 2O6HA 2VLBA 3FOEC 3TQTA 1GU0A 1YGPA 2QLFA 2FUNB 3CR7A 5JNLA 2C0PA 3M4YA 5FKJA 2ZATA 4BJ5A 1WHSB 3X44A 1FB5A 1UPBA 3BDIA 3DXFA 3IDFA 1M83A 1A8UA 1HQDA 1KFJB 3EGXA 4RLSA 4KP7A 1MO2A 3DP7A 1JR2A 4MR8A 1EG2A 2H2IA 4TTJA 3ZHRA 2BVNA 4CCYA 4ZVVA 2PUJA 1MB2A 1QP8A 2NU6B 1VMDA 3CSSA 4NV3A 2IXFA 5SY4A 4KCGA 4PONA 3RAJA 2B7BA 4X64B 1ZR2A 1CDEA 4R84A 2EKDA 2F4NA 4TOIA 2ID9A 2ZPAA 4INJA 3WBJA 2A5LA 3GLIB 1IM5A 2BFWA 4HAYA 3ZE8A 1CZOA 1ORDA 4M88A 2ID7A 4CQNA 1Z0AA 2XWSA 5EHIA 5C34B 3IEVA 4YP7A 3OETA 1EFPA 1RFGE 3GP3A 1F0NA 3A3NA 2FZCA 3DG9A 4M0DA 5B12A 2NTEA 5AKYA 3H9UA 1BWRA 1EXMA 1N8NA 1QWOA 2XMZA 3DMHA 1QIGA 1SG6A 4CI9A 4WOPA 3I39X 2IY7A 4R81A 1U4SA 3ZZNA 4DDUA 1E8NA 1W1WA 2CNWA 2VQSA 2O14A 1OAOC 3L4BA 5HRAA 1UUFA 2C2HA 5DHPA 3WBKA 4BLQA 1DRKA 1Q0ZA 4WLVA 2IK8A 5GJCA 3PGJA 4WX2B 1VZ3A 2PGXA 3OTIA 4AO6A 3SQNA 1MC5A 3AFHA 1FDTA 2QIPA 1AM4D 1JKFA 2W6IA 3QFFA 3QUAA 4X8LA 3TLGA 1R6VA 3M4ZA 5C51B 2GJ9A 2NO6A 1KARA 3CPEA 5AK5A 1B8NA 1YRAA 2BTQA 5KTOA 3LY8A 3FH0A 4ZQBA 1IDN1 3LC1O 4QOFA 3AL2A 2Q7XA 2J09A 2POQX 3E8XA 1PLKA 2XUQA 3GA0A 4I3FA 1PR4A 4KPUB 4U9UA 3M9XA 3PPVA 2DBZA 1CE8A 2GXUA 1C7IA 3PVZA 3P2IA 1AF4A 2OZPA 4O4JB 1Z12A 4RD4A 3MLBA 2BR3A 4GICA 4RWEA 1QAOA 2X0IA 3QKSB 3MT0A 2P27A 4PXAA 3AUAA 4OHMA 1Y80A 2CDNA 5FAKA 1AZTA 1JEDA 3AUSA 1BXGB 1K4YA 3F4KA 3FFWA 3VYWA 2WVJA 5L3QA 3B85A 2WJIA 3UHJA 2ZBPA 1RQPA 1HXHA 1Y7TA 2FZ4A 3GBPA 3LPMA 3NWJA 2BZSA 3OQJA 3RK0A 4TLEA 3BQNB 3RC9A 4PC1A 3DF7A 4DCJA 4H3KB 2O2DA 4LK3A 4X9XA 3IO5A 5LZ4A 4J1SA 4NK5A 1Z5GA 3QYPA 4Y1EA 3OM8A 2QJWA 4DV4B 1QHSA 1P4RA 3VZRA 3FXAA 4PYIA 2G0NA 5KOJA 1WCYA 3F3YA 2IYEA 3Q9LA 4V02A 3ZDYB 3E9DA 2IZ7A 2I7XA 4MIEA 5FQOA 5CIQA 3IELA 2B3TA 2O7NA 2I2CA 1R6DA 5EA2A 1OR8A 3NPAA 1AKRA 5KSPA 2YR0A 3UB3A 5SZIA 1XFDA 4ISBA 4WRRA 3AJ9A 1VHLA 1HDRA 2DCUA 1TX4B 3EK2A 4GBED 4TUYB 3TI9A 1YDMA 2GTHA 4EEXA 4D0RA 4W8GA 4HSEA 5HTOA 2OZLA 1DG3A 1BDHA 1Q1AA 1DC6A 1B23P 2AMJA 3BWVA 3FJOA 2O1WA 4X1KB 4B8WA 4YIHA 1X8JA 4R16A 4W6ZA 1TW3A 1CX9B 4KWEA 3ZWNA 3GLQA 2FDCA 1LSUA 1SG0A 4HEHA 2TECE 3WLOA 3GUHA 4UAJA 1YULA 3OP4A 4KQIA 1YASA 2WWXA 4M0UA 3VVBA 3KZOA 1NOJA 1C9JA 4NMLA 5J2TB 2I8CA 5JH7A 5KNBA 1EUCB 1PBNA 4R8MA 1ZQ9A 4LXHA 2A7QA 3EF3A 1FJXA 4QVIA 1YCGA 5DCUA 1U8YA 3F96A 1VHJA 4HFMA 2HD4A 3JASB 3R5FA 4X63A 4ACBA 4EG1A 2PZLA 1N6IA 3G1WA 1IM2A 3DZDA 3R40A 4PX3A 4DSAA 1STOA 5IDQA 2K5UA 3STYA 3EUFA 3PWZA 1DZIA 1EGMB 4PG7A 1X94A 1L3BA 4TUYF 1YBHA 2X0RA 4CYMA 4I6GA 3K0AB 3VAAA 1S3GA 2FUG1 5GVRA 2DUJA 1I7DA 4N5DA 1D7OA 3I8SA 3NV7A 4HH3C 3OQ6A 4ND4A 5KYUA 2QUZA 4QUBA 3HYSA 5DXJA 1T9DA 4ETWA 1YIAA 2YV5A 3OF5A 1BMDA 3KLNA 1P19A 4PX9A 4XIIA 1UM9B 3UT5B 3SYKA 2FY8A 1R9JA 5JAMA 3PPIA 2CDAA 2H85A 4M83A 2RGAA 2LCQA 1B43A 1E9SA 3QPWA 4PN3A 4FOSA 4O2LA 5LQRA 4UATA 1V41E 5HZKA 4YECA 5IX8A 3MIIA 1HC7A 1NZJA 4HUQA 3JQBA 1G4AE 1GYPA 2HREA 2JLRA 2VWGA 1NRJB 1KI6A 2ZREA 4N03A 4QUHA 5ALIA 1TFUA 5ERXA 3FYHA 3UCXA 2EFDB 5J4VA 2YCLA 4IRUB 2JRCA 1RVDA 2I3BA 2JCGA 2QUHA 2XUFA 1SGWA 2XYQA 3HCBA 3ILHA 4KGZA 3ZE0B 3C43A 3E35A 1PWZA 3AHEA 4KK3A 4L8YA 4LOKA 4P34A 4XKJA 1ESEA 4Q9AA 4BECA 2NSHA 1JQ5A 5C35A 5AW7A 4I9GA 4BMVA 4YRAA 1RHUA 2XLBA 1Y3BE 3KC2A 4A92A 4BNFA 3G8AA 2O0MA 2EJWA 2XB9A 3DMTC 3NT2A 3Q1KA 1QVVA 4AF6A 1Z4NA 1YMVA 3IKMB 2H2AA 1I0LA 4RK4A 2D1TA 3BF8A 1BWSA 1OFGA 2ZRMA 2IOHA 4CUJA 5K4AA 1C1DB 1M54A 1YU9A 4KRYA 5IANA 4G9BA 2FWNA 4XDYA 1OXBB 3GJTA 3Q3IA 4L5IA 4YV7A 4DR5B 4KDRA 4UDNA 1QFMA 1ZIYA 1QTQA 1GZ3A 1J0CA 2EZUA 1YZKA 1NXPA 4I5DA 3RVKA 2CBXA 3GRKA 1YQXA 5JNRA 1SXIA 1YSCA 1T9BA 2X4GA 3FWHA 1RQ2A 2A92A 3ZDAA 2DMRA 3UV6A 3R3XA 2X1LA 3W7VA 5H0IA 2I91A 3RB8A 4FONA 4WE3A 2ZYWX 3H0KA 1TF5A 2FEWB 1QTIA 2PCJA 4YO7A 2YW2A 1DSSG 4PCLA 2Q4BA 1DX4A 1WDLA 4R05A 4JI0B 4XQGA 5FI5A 2GN1A 5IVDA 1FY2A 3VR3D 3GJYA 5AI6A 3WSWA 3E5HA 1W2HA 4ZDJA 3HXOA 1L1QA 4HFJA 1M2GA 4ESOA 5BVHB 5FLXA 1E9DA 1RJGA 3IERA 5WRFA 1ETUA 1YGYA 3L0PA 1HT2E 2PKCA 4EUKA 1N3BA 1QG4A 2FMIA 5CEJA 2YV3A 1VSQA 2Q5HA 1E0SA 3DZBA 3RUEA 2PX6A 3D6TB 3PD1A 4R2XA 4W7SA 3OU7A 2R9VA 4DTIA 5HF6A 1YB5A 3M1LA 4L2IA 3CMCO 4A8JC 5IAJA 3AB7A 4I99A 5KQMA 1X87A 2IY9A 2VPZA 4H7DA 1AQLA 1D3AA 1QBGA 3O7MA 4Q9HA 3U3OA 4EMUA 4H08A 4YJ3F 3SF8A 3FKSD 3A0UA 2QXUA 3LLCA 5K8CA 1X7WB 4V0LA 4EJFA 3M6LA 4D9IA 2DFLA 2ZUCA 2HXSA 3KUKA 4DMMA 4DB4A 1RLMA 3CE6A 3KAKA 1UXGA 3MVEA 4NATA 4O2AB 1N2GA 3SFZA 2NUPA 3A9UA 3U7QB 2H0AA 2V7PA 2V7BA 1NVKA 2R1VB 4DLVA 1JG6A 1L9KA 2XUOA 3HJHA 3MJEA 3OM0A 2X9QA 3AW9A 1D4ZA 4L3WA 1BH2A 2CLMB 3GXBA 4TROA 1LSSA 1HSZA 2RGXA 3DE5X 3RBXA 3WO1A 4BNNA 1B6RA 1G8JA 2B2XA 2W2KA 1KR5A 3NORA 1WPGA 1Q50A 4DCSA 2G17A 1X0XA 1W5EA 2FLWA 2I87A 2XTMA 4CM5A 2X3YA 4X6YA 4CUKA 2XYGA 1SXPA 3CLTC 1ZY2A 1CC1S 2HV8A 1OX4A 4MVJI 4DILA 1N57A 1KY4A 1LDEA 1ORHA 4YJ3B 4DAOA 2XECA 1UWKA 4AWXA 4BO8A 3K72B 1W5TA 2XZOA 2XAUA 4LNHA 4QJ5A 3IV6A 5BYJA 1WB9A 4YB8A 1HNXB 2CWWA 2HCJB 4PGMA 2QPOA 3FGOA 3IRUA 4UNQA 1MJFA 1GSOA 1AQNA 4FIDA 2YJ4A 3TTWA 1PDVA 1T2DA 1W94A 2IU4A 4N5IX 4X41A 3GJ5A 1S2OA 2J31A 2Q5EA 1DOHA 2J9YB 4RTSA 3R76A 2ZE8A 5BWNA 1M5RA 1R6XA 1NFQA 1D6NA 2X42A 3LPNA 3WRXC 4G0VA 3HRKA 1CJUC 2B7LA 3LC2O 4C0JA 1ORRA 4IHAA 5K0JA 2XTJA 4I5EA 2O7RA 2PWYA 3H6KA 5CIYA 4X85A 2BL4A 1IL0A 2Z57A 2EOAA 3W7AA 4ON9A 2QBYB 2OAGA 3RS0A 3VR4D 1SY7A 3KU4A 3WS7A 1NXXA 5L6MB 3AH8A 2YWGA 3U39A 3VYUB 3U44A 3ACBA 3W2GA 1G5RA 2Z5GA 4JMPA 2J3QA 2HDNB 2PWAA 5HIAA 5LQNA 3URMA 3SICE 1I5OA 1R66A 1PDWA 4CL8A 2PFGA 2PDAA 5HIMA 4TLLB 2YWRA 4I9UA 3TUJC 3HLTA 4MQEB 5LQJA 1VE1A 3LQ2A 3DVQX 2X77A 5G3YA 4R7TA 1FSSA 4RTMA 2JHCA 1M67A 3JQAB 3NJ8A 5B55A 1WMSA 2UDPA 3VKVA 1QK4A 1YRYE 1XAGA 4N0MA 5CK5A 4BNIA 1AGNA 1MX3A 2IOFK 2V7EA 4OXXA 2V6FA 2FCAA 5IVIA 5NULA 4I8IA 1XCMA 2F1HA 3CPJB 1UJ5A 2QVLA 3PCRB 4IOLA 5JCZA 2C0CA 1FUYB 1OAOA 2PYZA 3L4BC 3OFJA 1U2DC 4PXYA 4FFBA 3QOFA 3MWDA 3IDSA 4LMAA 2VS1A 4ME6A 4RVHA 3K0CC 4NV0A 5C8YA 3T3OA 2O8CB 2B35A 3R5HA 4PZ0A 3HA2A 4LI0A 1QQAA 4B3GA 2ON6A 2FR0A 3FZNA 2IYUA 4JIMA 3KT6A 4O2BA 3EXIB 4FT4A 3K9QO 5KYKA 3CUKA 1FX0A 4HJRA 5JXJA 3WDSA 1NVEA 2Q6KA 1ZUD1 1JRLA 1EIZA 3BXGA 1C3JA 4ARIA 3SHFA 5SY6A 3KFVA 4IDGA 2QL9A 1ZNWA 2W93A 2BFDA 1ULAA 2I3ZA 1T1GA 4BPRA 4JB0A 2QKYA 3T9CA 3L6DA 3ENVA 1M2OB 2WPDA 5JCJD 3BILA 1GKYA 3RKRA 4HWPA 5F2NA 2H17A 2OCXA 2O07A 4UHJA 3GHYA 1G6Q1 4QAJA 3RSFA 1I0IA 4HPWA 4BNJA 2C4TA 2EFEB 1B76A 3KOXA 4E5SA 5J3JA 3W8DA 2P2SA 2ATIA 5JCXA 1QH0A 4DMCA 3THXA 4TKZA 3ZY3A 5BNZA 4YCJA 4YJ3A 2VA9A 3LBIA 3HL0A 1N6HA 5AVYA 1LDGA 4HRVA 3VR6A 2GF0A 2ZS8A 3CVWA 2F8TA 4GKJB 4D4IA 4WCFA 3KZKA 4DSNA 3JXEA 3NUGA 4LF9B 3TVYA 3M3PA 4RSRA 2IXGA 5B1EA 1SHKA 2O1SA 1BA2A 3CZ4A 3NNSA 1H1TA 3BUSA 3LYHA 3U3MA 4YRLA 1RYNA 2I4RA 1T5DX 2VJQA 2EWMA 3P32A 4NCIA 1Z5PA 4FKBA 2RE8A 1Y6FA 1T9GR 1M0EA 1ZL0A 1FEZA 1F0PA 2VTDA 3M34A 2QVYX 1EK2A 3OT4A 5IH3A 1LTKA 3C4QA 1BX0A 3HDGA 2AI1A 1Q74A 1LWNA 2PJUA 4OQNA 4QSMA 2BKAA 4ZYWA 2ZWPA 3LL7A 1NW5A 4R6XA 1XCOA 1ZRNA 2I4TA 4J1TC 4XR9A 3H1GA 1WNFA 4OXIA 3IOEA 3IPXA 3K09A 4OBBA 2FWIA 2BSXA 4AZVA 5EWLB 4HB0A 5IU6A 3W3AA 5BWLA 4QBGB 1BMFD 5JG7A 1DHTA 4G1BA 1OVMA 2WR8A 4MVJG 3ZW7A 1KXJA 1T2VA 2WLTA 4IO1A 4UXJA 1YVPA 3FOZA 2AJDA 4D25A 1QS0B 4NDAA 4WKGA 3UAVA 2QMEA 2EARA 4JENA 3LQYA 3DMTA 3PEYA 4XSGA 3OKPA 4NBVA 1Z2PX 4BKPA 5JH7F 2H1WA 3ESQA 1EA7A 1F3LA 3HJUA 4B83A 5DLYA 3V55A 5T4HA 2J9FB 4E51A 2OQ2A 3AIMA 1TYDE 1ZONA 5BVHA 1WV0A 4PNHA 1YB2A 2GYYA 3VMFA 3X0DA 2FZEA 2J0UA 3KDAA 1GQSA 2FSFA 3QU7A 4CLOA 3EA4A 3JAWB 4AY4A 3KDSE 1DQRA 3I42A 4GS5A 5F23A 1N2BA 4MI9A 1LQUA 4OQDA 2QSYA 2HK7A 1RHQA 4WPGA 1LY1A 1OXVA 3ST7A 3DUFB 1SVNA 3ZCTA 3GUYA 3N0WA 2MWMA 1KMMA 2VBFA 3OA2A 2VPQA 2C7OA 1PJAA 3QYFA 3RVDA 1ZMBA 4ZCRA 1TJ3A 2X8LA 1X77A 4ID3A 4OTZA 4W1QA 1J1UA 1B26A 2VJDA 4Z0NA 2AHRA 2QRNA 3MQ2A 4CF4A 4X44A 1OPXA 4ALKA 4QLBA 5C52B 4OVKA 4NICA 3HKEB 3EIQA 2PZKA 2IYLD 3A1DA 1GPBA 5IAOA 1P0FA 1RXVA 3ZW8A 1FFHA 5ANRB 1QIKA 2RHJA 4OMFG 3RFFA 2NYUA 3RAEC 1V26A 4FCVA 1W36C 2PO5A 2QS9A 2IHUA 2XF8A 1YF3A 1SBQA 3JQAD 1SMKA 3HPRA 3PQ8A 1TLFA 2IP4A 4TS4A 4UEWA 4RPHA 5U4QA 1Z5VA 2XGMA 3AJDA 5J23A 2VDQB 3I2FA 1VCIA 2EW8A 3AF0A 2CHUA 5EHQA 2JLZA 4XEHA 2GD1O 5ER6A 3VI3B 3R7SA 1I1QB 5BYKA 1JDTA 1ZNXA 2PMEA 1GZ6A 3GCZA 2I4OA 2WHEA 3ADKA 2P6NA 1YHZA 5C5DA 1KYTA 1UJMA 1NKTA 1PGNA 2HM7A 5F2KA 4EHHA 4V0RA 4Z4HA 4G8JA 4FFVA 1YJXA 5AIAA 3U7GA 1ZLYA 3T8YA 2FR8A 1G8FA 3NGLA 2WABA 3UENA 5JBIA 3NTXA 4Z0TA 2AOUA 3H1PA 4HSGA 3GLGA 1QH8B 2QRJA 3B9QA 3G0OA 4XLTA 5H7XA 5K3DA 2ZRGA 1T1EA 2C2XA 3HP7A 3K5PA 2AR0A 3NUQA 3HM9A 1J2TA 1TGVA 1EUYA 2L2QA 3DGFC 2FPGA 2XT9A 4EUHA 4EL0A 4F5WA 4EI9A 1E3TA 3JRWA 2WJ3A 2ORWA 1WB4A 2F55A 4M0MA 1Z18A 2FW1A 4XD7D 4AJPA 1E98A 2GRAA 1Q12A 2X0NA 2YMQA 3B6KA 4PYQA 3NZEA 2YKGA 4XM2A 4C89A 5C2JB 1W88B 3AUXA 4H9GA 5CVTA 1SD1A 4H4DA 4LG1A 1P7WA 4U39A 4CDGA 3FI0A 4UVHA 5B3KA 4WQMA 1TO2E 3LA8A 3VDNB 5TR9A 4JUFA 4H27A 3RK1A 3RC8A 1E9FA 1C2YA 1GG5A 3MWKA 3QWBA 2DQZA 4BX8A 3QBEA 1DI0A 3VYSB 4DSZA 4L5BA 1GZ7A 4F7DA 1TLTA 1N2HA 2PO7A 4GX1A 1RKUA 1VIYA 5JFTA 1GQRA 3IALA 1MO3A 5CGZA 2JAHA 4PZPA 2CK3A 5BRAA 4BVKA 1O0CA 3ZVRA 1JLRA 4HQ6A 1E69A 1PF7E 5ICGA 4NY1A 4WNCA 2R1TA 4QQRA 4H0CA 4AWAA 4G5RA 5F35A 3DM5A 4P3OA 1XU9A 3QLVC 4F92B 2FJUA 1OBCA 5GADl 1IBLB 3EZ9A 3EWSA 3WWDA 3LDHA 2EGGA 4BUCA 5AW3A 4L7VA 1U7PA 2PSDA 4Q3NA 1OB5A 2QTAA 2JGEA 3GLHA 3ENNA 2QMHA 4FLMA 3GW8A 4LCEA 4MV1A 4L5YA 3UT6A 5CFNA 5KTPA 4Y6GB 4J07A 1VPTA 2IUSA 4GPD1 3AM3A 1SBTA 2WJHA 3BKWA 4EMSA 3WL7A 4EM6A 4U7JA 3TLJA 1TVKA 1PEYA 1RKQA 1JLLA 3OOSA 5K8VA 3V2HA 3U3KA 3M6IA 3I28A 4GE0A 2QAGC 2WYHA 1PZEA 4B35A 1U3VA 1OMOA 4M8NE 3U48A 4LE2A 2IOQA 1CSEE 3MQ4A 1IK6A 3L8YA 4B6RA 5JXWA 1YI0A 1XR3A 5KPDA 2AXQA 2ZWIA 3LF1A 3TR0A 5BMVF 3DJYA 4W5RA 4YMUA 2O8FB 1ODCA 5CPFA 3BULA 2GD2A 3IMGA 3OMLA 3G7UA 2BMDA 4EECA 3RABA 3N8NA 1A2QA 4Q66C 1UBSB 2YDXA 2I9PA 2IW1A 2CCJA 2CKMA 4UBMA 2HRCA 1SUAA 4WESB 1EWYA 1JQJC 1S9HA 3DJFA 5IMBA 2IYOA 5FI3A 3X3HA 4HR7A 2WU8A 3ESZA 2JL1A 4MUNA 1E3WB 3HN2A 4PX2A 3TTUA 4BFLA 4JA0A 3TGWA 1ES9A 1NV9A 4A9AA 3K0EA 3MM4A 4KB5A 5FBWB 2RK3A 3KSMA 3Q3JB 4XWAA 3RU9A 3TJRA 5IXJA 4DEVA 3AEZA 4WVFA 5SV2A 3O1JC 3MJSA 4UDXX 2VHCA 2SBTA 4J3NA 1V1JA 3SLKA 4ZVSA 3JD1A 1LK7A 3INTA 3ZDFA 3D3EA 1ZVQA 3GLVA 1TVCA 2WV9A 2PGIA 1PVDA 3PD0A 4MJLA 1TK3A 4TXMA 2NXNA 3I3SR 3JWHA 3PV0A 2WUDA 3STTA 1KP3A 2EZ9A 4DANA 5E1BA 3MT8A 2JANA 2BE9A 1OD6A 1JVSA 1NYQA 2PGAA 5DCLA 2QR5A 4EGJA 1FNCA 2XE8A 2YWDA 3A1CA 3BIWA 4L5AA 4QYTA 3DV2A 1DTWB 3Q3HA 5AXAA 4K9DA 2E9SA 2CBZA 4K40A 3ICVA 4HL6A 3PQ7A 4MGHA 2JGKA 3A6ZA 4DPMA 4INZA 3VNQA 1DDIA 4IFBA 3C8MA 3SEZA 5B57C 4BEVA 2WIFA 1BYIA 1WP4A 1A5AB 2XKBA 5HTKA 4J4BA 2O2ZA 1HX7A 1H94A 1J7KA 2AJ8A 2QN6A 1G6KA 3P9QA 2PM8A 4UMFA 5CFOA 1W73A 3PHIA 5JAIA 2GT1A 4KFSA 3ZV4A 4L9WA 5HMMA 8ABPA 2WKRA 2XY4A 4FJ2A 1XTPA 3UA3A 2K7FA 3LXXA 4MRMB 1U90A 2FJPA 1CQXA 3HUEA 3H5VA 4BASA 1SOWA 3FJ1A 3JQQA 3TBFA 1CR2A 1QNLA 1SJ9A 1Y3HA 3S40A 1O97D 1ZXLA 1AHPA 3LAWA 1ECPA 3MILA 3BDVA 5L8VA 2EGHA 1ZMOA 3WLTA 3VSDA 2IYFA 2R6R1 1XDWA 4RH1A 4L4UA 1KO4A 4NEHB 3GJ4A 3H2JA 1QRDA 1FX1A 3D3WA 4TMVA 1BMTA 1XA0A 1YOVB 1XCJA 3DZFA 3C0KA 3G0DA 3WJ7A 1YU6A 1B16A 4IZ6A 5HZHA 4DV2B 3UATA 4FFRA 4F11A 2DTEA 3OESA 2BM9A 4QUIA 5AKZA 4F8YA 4K7JA 1YBAA 2IEGA 2V03A 1SUWA 5M3BA 2WY2D 4FHDA 1RMYA 2W0SA 2XBUA 3AI3A 2AG8A 5DT9A 4CFZA 2NMVA 4IIXA 2B1JA 5A7HA 2OFXA 4GSLA 1DKLA 1FNNA 1RHKA 4MS1B 1CJTC 2V58A 3C7TA 2D1YA 3MT9A 5L3ZA 2Q2VA 3IHLA 4MV9A 3WK9A 4BNWA 3P9CA 5IDWA 1B4DA 2IXBA 5BOSB 1JEOA 1VBMA 3H9BA 3IQEA 3BXEA 5FUXA 3HVRA 3NBAA 1U3CA 4DBLE 2LKCA 2UVPA 1CZLA 4MV8A 2PBRA 4PZ9A 5ALHA 4J0FA 3UB2A 3LYAA 4GNKA 5FWXA 1XEWY 1BC5A 3VC1A 3FZQA 1SPBS 1D2CA 1L7QA 3K8ZA 5G1PA 2PUVA 2VSXA 4YUAA 4BFVA 4OI0A 4GBJA 3HBAA 3E9RA 3PQ4A 3D8TA 5E7JA 5I8WA 4F6LA 2W6PA 5HDQA 3RS8A 1CVRA 4GXQA 1FW8A 4B33A 1H6BA 2FPKA 4EVSA 1AUQA 1AXEA 1E3DA 4LZNA 3U7HB 2YXEA 1WZNA 2WINI 4KZKA 1JIKA 5TT1A 2ZB3A 1I6LA 3AR8A 2YJGA 4L02A 3DB1A 5A3RA 2NU9A 3NH9A 4LPSA 3TJZA 4EKYA 4HEA1 1ZM7A 2H52A 3HBNA 5T4BA 4PGGA 4K6FA 2CXXA 1AURA 4QG7A 3SVLA 1M1NA 3PFIA 4KKXB 4ZDWA 4PYNA 3V9PA 1C7JA 2WICA 5BQFA 5JXGA 2X2OA 2D8MA 1E20A 1OB2A 1WZUA 2Q6TA 2V7VA 1JG3A 1SPXA 1DJQA 2IELA 2IYAA 3F6BX 3ZWWA 4BGIA 5A4JA 3PT5A 1KSJA 3GJRA 1LVGA 4KQKA 5I4CA 4OEHA 3TM4A 4HYQA 3AUKA 2B9VA 2J32A 5DIZA 1N3YA 2QNBA 3FNGA 1ULSA 1EEHA 1GNQA 3QEAZ 4UEJA 4AU1A 4OH1A 3O8QB 1M8JA 3LDGA 1RCUA 2CF6A 1GV1A 2WG0A 2YJTD 3B20A 3I1JA 2FXIA 3KQTA 3RODA 5CBPB 3BJZA 4LYEA 4LECA 5CVJA 4CEHA 4JLBA 1A5ZA 1JFRA 1C9KA 3PUZA 3QPUA 5GIOE 4MI3A 2QGFA 3DSRA 3OQVA 5TC4A 4YYEA 2NIPA 1ZYUA 3QEKA 4DC9A 6YASA 2QUAA 4CIAA 1QB8A 1V9CA 3RANA 3U61B 1B2RA 2WAMA 4BY9E 2R60A 1AN9A 2GBGA 2E5LB 3BXFA 1Q6YA 3HG7A 3LE8A 2BH9A 2DH5A 1CIJA 4KGXA 4R0NA 5IYZA 4YASA 2H16A 3VYVA 2AEEA 3VNBA 1UIRA 1I3OA 1FPQA 3JYPA 1SH7A 1XCGB 4LBVA 1CJMA 1W85B 1IBMB 3JCZA 1TUGA 3KSZO 3S2EA 2WJAA 1QF7A 1TU4A 1N9GB 3ZH9B 5AUQA 5J59A 4BNLA 2P2GA 1MJHA 1QR2A 1BX1A 2H8KA 3AOEA 3H5LA 3HFJA 3L1IA 2C7PA 1DWPA 5I8PA 2G07A 2CE7A 2NX2A 1E3QA 4B3HA 4BS9A 2R97A 4NYMQ 1GVNB 3ND8A 1MR3F 2HA6A 1OFUX 4KYVA 4Y6QA 1L5VA 3M3DA 2O8FA 4Q1VA 1PSWA 1WY7A 1BVYF 1OYOA 2WEKA 4UVDA 2B0JA 3PDIB 4PQFA 1MABA 1TCAA 1ZK0A 4PZYA 3UMGA 3NHPA 4J8PA 3WQSB 3HGTA 1O5OA 3IEUA 4WKOA 4I36A 3FLAA 1APBA 1XXHA 1NXOA 2I33A 3IMCA 2ZIVB 1E8MA 1U7XA 5COQA 4RPCA 3ZHYA 2PNJA 3U80A 4ER3A 3GPIA 5HQTA 3N3AC 2VKQA 2BISA 2RHWA 5CBKA 1X80A 3B1JA 3R3ZA 1FTQA 5L3RA 3W05A 5AKHA 4OQYA 3HXQA 3G9TA 1UBJS 1G2IA 1NVFA 4G5XA 3IMFA 3V48A 1EJ6A 3NCHA 3PR1A 1C9MA 1HYBA 1N5DA 1S4MA 1XMVA 2GRUA 2BHLA 3LO8A 3OPVA 4GX2A 4HOYA 3H8WA 4D45A 3R9XB 2WKPA 1X7XA 4UHKA 4BN0A 3MAJA 4UAVA 3TX2A 3P2JA 3B8EA 4MV5A 1DBQA 3F7NA 3EUEA 2V5VA 5K7SA 1LJLA 2AN9A 1VP9A 1M1YA 1BKDR 1OTYA 3HVJA 1SAYA 1E1RA 2P6RA 3Q0IA 5LXTA 1FYWA 1RHRA 3P9PA 1X1CA 3ABSB 2GJKA 2BEVB 3RVQA 3I5UA 3ZYCA 4ND7A 1MB9A 3CZMA 4GAEA 2DLCX 5AVOA 4RA9B 5HZMA 1EGVB 5C31A 3IR5A 4Q39A 3CURA 5HKBA 2QRPA 3EIUA 4JEMA 1O6BA 4A82A 4AJ2A 5HFJA 5ELLA 2UZ0A 3IEIA 1YJAA 1PTJA 1BZYA 4UE6A 5FLEX 4C4AA 2YXLA 3MCUA 4IOJA 1VJ1A 1ZK1A 5HSGA 5DLQC 3EA0A 4M0LA 2G88A 1KQGA 1K4MA 3V8MA 2CSUA 3AERA 3TINA 3WNCA 1J42A 2NUAB 4XD7A 1E1RD 4ALNA 4IJVA 1L7RA 2I7VA 1E7MA 3NASA 3PXDA 3U4QB 2JHPA 1PQ4A 1KO5A 2ARKA 2FPGB 3QMVA 1KEKA 1G59A 4X65B 5D1HA 3BFPA 4MR9B 4Y30A 3QYAA 4I8DA 2H4FA 1MX9A 3CRRA 4ZGGA 4YJHA 2JH3A 1XZQA 4ICIA 4PGHA 4BOYA 4K9QA 4CTKA 4IWYA 2QRQA 4RZ2A 3N0XA 4J1QA 3T0GA 4X5OA 1U99A 1WUKS 3DVSX 2CV2A 4WMLA 4Y2HA 1N77A 4TKVB 1JFFA 2AI2A 3F71A 2YZMA 4FE3A 2CHFA 2JI6A 3RFUA 1GPNA 3R0VA 1T3TA 1KAGA 1NF9A 2ETVA 4F3YA 2BW0A 5B3AA 4D79A 5ELXA 4M22A 5CLGA 2Q0XA 1SVOA 3W78A 1SKAA 5IUNC 2YRXA 4RHYA 1IUPA 2Q8QA 2C4NA 2BKUA 1U2EA 3WK4A 2Z9CA 3FIUA 1I10A 4OGFA 5DHAA 1IU9A 1YTLA 4LV8B 1Z07A 3X1JA 3QLEA 3ZD9A 5TIIA 1GTSA 4HYTA 3DBVO 3GRCA 4KTVE 3IDOA 5DBHX 3ULKA 3O2QB 3BEDA 1ABEA 3IAXA 5B1HA 4B2PA 3IT0A 2RARA 4UU1A 1RWXA 3B48A 3KR2A 1WETA 2ZJ5A 1HEUA 2ZP1A 4RF5A 4F0JA 4L16A 2W6ID 2XAAA 1TQ6A 1KYIA 2FWAA 3GOHA 3LK6A 4Y2PA 1D2AA 1GPDG 3Q12A 1SOMA 1XAJA 3I9JA 3VNSA 2EFCB 4WOBA 4MDFA 4P0TA 4OHOA 1JWBB 2YMPA 2IODA 4EJ0A 2J5BA 1IQ0A 4YAIA 2A5YB 2OSBA 1JT2A 3S27A 4DR1B 5MDHA 1JLHA 2AS0A 4MR7B 1ZGZA 2QN9A 1AF7A 4W82A 1Q5PA 5IEJA 3VNAA 3GRAA 3GFTA 1FLVA 5HG0A 5BN4B 3RYFB 1CZUA 4GR9A 1VL6A 3OZXA 4PQEA 3D2AA 1FVHA 5FFMA 1WVIA 4F4DA 4WLUA 1VZ2A 2CSXA 2NZVG 3GEPA 4O4JA 4ZVKA 1YQ9A 2NUTB 5M04A 1EINA 3PNQA 4HH0A 5LN1A 4UREA 2A0XA 3L7MA 4CDMA 5KREA 1PD1A 1TMGE 1E96A 3FD8A 3OX3A 4Y6PA 2RAUA 4B76A 5B4UA 1SBHA 1NFFA 5JADA 3UGKA 4EWLA 3EMVA 4NZNA 2VZEA 4CGZA 1XRLA 2ZSIA 5C7IO 5AH0A 1NI4A 4RCVA 2CV1A 5KOYA 1MRZA 3HHPA 1QRRA 2OHIA 2X6QA 1RXUA 3PEFA 2NPOA 3NP9A 3TDKA 2YYZA 5DN6D 5DSXA 3A6JA 1NFRA 3OQOA 2L82A 1FFYA