2WMYA

Crystal structure of the tyrosine phosphatase wzb from escherichia coli k30 in complex with sulphate.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
143
structure length
143
Chain Sequence
MFDSILVICTGNICRSPIGERLLRRLLPSKKINSAGVGALVDHTADESAIRVAEKNGLCLKGHRGTKFTSALARQYDLLLVMEYSHLEQISRIAPEARGKTMLFGHWLDSKEIPDPYRMSDEAFDSVYQLLEQASKRWAEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Capsular Export Regulating Tyrosine Phosphatases Wzb of Escherichia Coli and Cpsb of Streptococcus Pneumoniae.
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords PUTATIVE ACID PHOSPHATASE WZB
total genus 55
structure length 143
sequence length 143
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wmyA00
3A10A 3HK2A 2MYUA 1EFAA 4KFCA 4Q7EA 2WJAA 1ABFA 1RNLA 4MQFB 1E2BA 1M2EA 4DADA 1QMPA 2PUGA 4XXHA 5IUKC 3GBVA 4N0QA 4XASA 2FQYA 2PUDA 3QEMA 1I3CA 4Q6WA 2L2QA 2CHEA 4F11A 1JWLA 4HNSA 3D8UA 3DLHA 3NNSA 5DGCA 3KTOA 1VRVA 4MS1A 1MB0A 2ID9A 5I4CA 2PUCA 3HS3A 4MS1B 4ETIA 4RK7A 2IDMA 1A2OA 4Z4GA 3RVOA 1GUBA 3O21A 1QO0D 2GWRA 5B3JC 1QPZA 3IP5A 3GL9A 3H5LA 5E3JA 4MS4A 4RDCA 4ZYLA 1ZAYA 1GUDA 2NZUG 1USKA 2QSJA 3KG2A 1VPWA 1VKRA 3OLXA 1PNRA 4OLAA 1CEYA 5JNTA 2IKSA 3CFYA 4LRQA 3OLWA 3FMVA 4Q6BA 4Z9AA 3QLUC 4PICA 1A04A 1BAPA 2PUAA 2I6FA 2IPMA 1YMVA 2WMYA 2FN8A 1KRXA 5DTEA 2A9OA 3O1IC 4N03A 4ETNA 1QP7A 3SG0A 3F7NA 2PL1A 3N6VA 3LTEA 5BRJA 3KKEA 3RVLA 4KRFA 4YV7A 1UDRA 2FEWB 5TQ2B 4RXTA 1NXPA 2FEKA 1U2PA 2VYCA 4LDAA 4P1ZA 4WUTA 3H5OA 4RK5A 1P6QA 3GYBA 1NXVA 1RZRD 2QR3A 2ZAYA 1RPJA 1BDJA 1YIOA 4YO7A 4MLDA 1QO0A 5TQ0B 1NTRA 9ABPA 1JF8A 3KHTA 4ZMSA 4RXUA 1NY5A 2HQRA 4RY0A 4ZPJA 1Z17A 2OENG 3JY6A 4RK4A 1Y1LA 1DZ3A 3SY8A 3B2NA 2JB9A 3RVRA 3HDGA 2JVIA 1PUXA 2VUIB 4QICA 4MAAA 4GPAA 1IIBA 2Q5CA 1PHRA 3MQ4A 3QLVC 5KQLA 3F6PA 2E4XA 4YGXB 4MPTA 5JNWA 3TB6A 1JDPA 4ETMA 4RKQA 5EWMB 5TPZA 1JFSA 1TM2A 1JFVA 3A0UA 1ZESA 1ZH4A 2MSLA 1J56A 3H6GA 2X7XA 1KMIY 1P2FA 2H0AA 3OMXA 2JBAB 4KVFA 3RVSA 1ISSA 3TO5A 2VUHB 3C3WA 1USGA 5C5EA 3RVNA 1MAVA 4IILA 3CNBA 1L5YA 1AB6A 3GA5A 2PJUA 4NICA 2LP4Y 5KQGA 1D4ZA 3O1JC 1QP0A 1DCMA 2P4UA 3GV0A 3Q7SA 4G0YA 5T7BA 4MR9B 3M9XA 3IPCA 3CKMA 1DC7A 2NT3A 4KMRA 3T95A 3IDOA 1DP4A 3FFXA 3UK0A 1RXEA 3N0WA 3NBMA 5BR1A 1E6KA 3LKVA 2PKXA 4OATA 5JS1A 3EQ2A 2HQBA 1JX6A 3TX6A 5TE9A 1CHNA 1BDIA 3QLTA 3HEBA 3DBIA 4KQCA 2F8SA 4E7OA 1LJLA 3SQNA 1K68A 3QK7A 3NHMA 4KZKA 4G0PA 4DN6A 1APBA 4IF4A 4WXMA 2IPNA 2B4AA 4M88A 3QEKA 4TLLB 4OG2A 3H6HA 4MLCA 1ABEA 3HJFA 1YS7A 4EYQA 4N41A 3RVKA 1ZH2A 1M5TA 2L18A 4PYRA 5GOTA 3H75A 4LZLA 1K66A 3ROFA 2E4WA 5JS2A 5HM6A 5KWSA 2FXIA 2PE5A 4YLEA 5PNTA 4IMJB 4Y9TA 1S8NA 1ZY2A 2HPHA 3BRSA 4MR7A 4RY9A 5KC9A 3H1GA 5BRAA 3C3MA 4S05A 5IUNC 3KLNA 3OMWA 4Z4IA 1URPA 1YMUA 2R25B 3Q7RA 3OLYA 4MGEA 3BRQA 4RY8A 3LUCA 3OM0A 3EDCA 3OM1A 1Z26A 2FLWA 4EYGA 3DGFC 1XHFA 5JNRA 3MYYA 2LUOA 3I5AA 4WZZA 3I45A 4JOQA 1QP4A 1ZHHA 5CNJA 5CNKA 1LBHA 3W9SA 2V0NA 5HKOA 1WETA 3NNNA 3CTPA 3G85A 3H5VA 1ZITA 3RVPA 4NCAA 1NXWA 4XAQA 2R47A 1B00A 1SXIA 1EAYA 4YR7A 3HVRA 5EWMA 1JHZA 2L17A 3NHZA 5TPZD 1NXXA 3JPWA 4PEVA 3Q7TA 2MSWA 4F8JA 2J48A 2ID7A 3H5WA 3LUJA 5TQ0A 1ZGZA 1MVOA 1YK0A 4MS3A 5IBQA 5IEBA 3Q41A 3QELB 1C4WA 3O2SB 1PEAA 3TD9A 1VLZA 3LOPA 2HJ9A 3IP6A 4RSMA 6CHYA 4YWHA 4EY3A 1TVMA 1JBEA 3A0RB 1FSPA 1TJYA 4O5AA 3KS9A 4Z9BA 4Z4HA 2NZVG 5GQSA 1Z13A 3RVMA 4W5TA 3IP9A 3FGZA 4L85A 4EVQA 1P8AA 3HUUA 3H5IA 2FLKA 2RDMA 2FKAA 2WWVD 2FW0A 2AYXA 2JVKA 1W9HA 2FTKE 1EWVA 3GBPA 1P6UA 4NV3A 3KSMA 3SM9A 5HSGA 1SRRA 4H60A 3CRNA 2R48A 2E4VA 2FMFA 3HZHA 4W5OA 2IPLA 2E4YA 2PL9A 2QW1A 3C3KA 3FFTA 3I09A 2PAFA 1LK0A 5DCLA 4OTZA 4RK1A 4QPJC 1D5WA 2MSKA 3OQNA 3CZ5A 4H3HB 3O75A 3H1EA 3ROTA 4G0OA 4XFKA 4IRXA 4RZSA 4MR8A 3MA0A 5EWJB 4LDZA 4JA2A 1E6MA 5FBHA 4WWHA 1DC8A 2F8TA 1R8JA 3QEMB 2NT4A 3NNDA 2QZJA 1YS6A 1W25A 3O1HB 4RK0A 1M2FA 2L19A 1EWTA 3SNKA 1ISRA 3HDVA 3HM9A 3EGCA 2H3HA 4G0MA 2PUFA 3DGEC 4FE4A 5CHYA 3CZCA 3QX8A 1SD5A 4MR7B 4LE0A 2PMCA 3A3KA 3T8YA 1PNTA 2E4UA 2FMKA 2JVJA 4TMYA 4N47A 1U2QA 1NXOA 4RXMA 5IULC 3KJXA 1QKKA 4MYRA 1XWWA 4ZJPA 4EVSA 1DRJA 4UHKA 1F51E 2A9QA 3Q9SA 1TLFA 3LMKA 5F64A 1EHCA 4KNYA 1GCAA 4Z4FA 1XHEA 4NCBA 3EODA 2FMIA 1TMYA 3MF4A 4XARA 1M5UA 2MYPA 5EWLA 3H1FA 4YP9A 2MYTA 3LFTA 2M98A 3O2QB 4EUKA 5JNUA 3LUKA 1Z16A 4TLMB 4ZMRA 2RGYA 3F6CA 3L49A 3DZDA 5IX8A 1YTUA 3OQOA 3OLVA 4KQ9A 4RV5A 5IEJA 1U04A 1OXKB 3C97A 3N8IA 5TQJA 4W5QA 5ABPA 3CU5A 2WRZA 2GI4A 4P98A 4PE5B 8ABPA 4H3KB 1USIA 5TPWA 1JH9A 3RVJA 1DCFA 3CS3A 2BGGA 1BA2A 1GCGA 3DLBA 4FE7A 1MIHA 1YK1A 3MM4A 4ML3A 3M6MD 4L4UA 3M9WA 1DG9A 4RK6A 4HNRA 4D74A 4W5NA 2MYNA 3JPYA 3LUFA 4Z99A 4JB2A 2TMYA 1JLKA 5JNSA 5CNIA 4KREA 1ZN2A 3LUDA 3N53A 1U8TA 3I42A 4F3TA 2PUEA 2AYZA 4JB0A 3MMNA 4CBVA 2ZWMA 1NATA 2FMHA 3BBLA 2HSGA 3LKBA 5FWYB 2WY2D 4JASB 4FB4A 3VNAA 4D6YA 3HXMA 4IMIB 5TQ2A 1DCKA 1E6LA 3S99A 5KQMA 4PZ0A 1YVUA 3OO0A 2N9UA 3EJWA 2DRIA 2FSPA 2YHAA 3GWGA 3HUTA 1Z15A 3JVIA 2QU7A 2FQWA 2KYRA 2P9HA 4MR9A 3GT7A 3F73A 4MR8B 3KLOA 3RQIA 5DLEA 3IPAA 4HNQA 1NXSA 2FVYA 2CHFA 4JAVC 3SAJA 4W5RA 4LE1A 5KI6A 3EAFA 1ZDMA 5C5CA 3Q15C 2XDYA 4F12A 1RXIA 2WB4A 3EQZA 1QQAA 3LUHA 4Z4CA 3FDFA 4QYMA 4EVRA 1DBQA 1FFSA 3JVDA 2JCGA 1JDNA 4Z0NA 3T6KA 5D2CA 3RH0A 5B3JA 1U0SY 2IPAB 2GX6A 2FN9A 2HQOA 4N0PA 3UUGA 4E7PA 3BREA 5T3YA 1AB5A 1L5ZA 4HYEA 4OLBA 2FQXA 4G0ZA 4O1HA 5KC8A 3N0XA 4OBBA 2JBAA 4EGSA 1D1PA 2VK2A 3HCWA 1T34A 1LBIA 2LBPA 3TMYA 4RKRA 5ED4A 3KCNA 1EWKA 3HO1A 2YHBA 1D2AA 3MIZA 3HSYA 4RS3A 1DBWA 1SXHA 4LX8A 1BVHA 3ILYA 5CNMA 1PEYA 1ZVVA 1LJUA 3E61A 2CD7A 3IP7A 3QELA 1JL3A 3N75A 1DJMA 4DQDA 3OQMA 1ZGGA 3FFWA 4MS4B 3R0JA 4G97A 2JRLA 1Z25A 2IOYA 4MQEA 5HQJA 3OO1A 2LPMA 4YS6A 5IC5A 1KRWA 4MQEB 5FWXB 3K9CA 4Z4EA 3KYJB 2NUBA 4RWEA 4YCSA 1DBPA 5FBKA 5DKFA 1Z12A 1RZRA 2JK1A 2FEPA 4YRZA 1QQBA 2WJWA 3GRCA 5TPWB 1BDHA 3JS5A 7ABPA 3CHYA 4G0QA 4F06A 3N0RA 1C0EA 1Z18A 3JTEA 3LUGA 4RU1A 3QX9A 2W42A 1SXGA 2A9RA 4O1IA 2PUBA 2PLNA 3HV2A 3O2JA 3RVQA 1KGSA 3BILA 3CG0A 3H5TA 2QVGA 4JP1A 5KQPA 4N76A 2LIVA 1FQWA 3ILHA 3LUAA 3EULA 4B09A 1JFTA 4MQFA 3T38A 4G86A 3UKJA 1MB3A 1JYEA 4KV7A 4MRMB 5EWJA 2R4QA 1Z2DA 4UHJA 4MRMA 4NQRA 4MS3B 4IGAA 3KYIB 4TN5A 2QV0A 3QLVA 2O20A 3CG4A 1DRKA 5BQ3A 2RJNA 3D02A 3L6UA 1NXTA 3P9YA 1OXBB 4D6XA 2B1JA 3G1WA 3O74A 5FWXA 3K4HA 5IUJC 2GKGA 2A9PA 2IYNA 2OQRA 2RJOA 2QXYA 3E3MA 3QLUA 3VNBA 4WXEA 1D1QA 6ABPA 1GLGA 1H9CA 1A0OA 4KK3A 4QYWA 5JNVA 4KPYA 1Z2EA 4GNRA 4WT7A 3C6QA 4EYKA 5FWYA 5EWLB 4KK4A 2CWDA 3OLZA 4XLTA 2GBPA 1FFWA 3CLKA 1FFGA 2M1ZA 1CYEA 4G0XA 1HEYA 1QNLA 1F4VA 3URMA 1JYFA 4EYOA 2QVCA 2E4ZA 4S04A 4LE2A
chains in the Genus database with same CATH superfamily
2R6R1 1GQQA 4B83A 1GV1A 2JAQA 3PDJA 3RHFA 2IHVA 2DECA 1N36B 3QE0A 3C6MA 2WKQA 1VLHA 4JHXA 3WBKA 5AVQA 5E4JA 3MJRA 1CZHA 1UM8A 2B30A 4DQ0A 1AG9A 2ORIA 2OYRA 3E7FA 3C3PA 1IXYA 5CDFA 4DLLA 3IPYA 1CVLA 1ZEJA 4Y6RA 1TVKB 4NAUA 1I3CA 3V7FA 4Y7CA 3WB9A 2CHEA 4GS5A 4MYDA 3UPDA 5T8KC 5FPYA 3DKPA 1N2CE 1UK6A 2OYSA 3GFTA 3N8GA 4G84A 1X7ZA 1EXVA 2PUHA 1DIBA 5LNK1 3TG2A 3THXB 2JBHA 1AQ6A 3CX6A 3G1TA 5FEUA 1YH3A 2D74A 2I65A 3INGA 4LG1A 3ZIUA 4H16A 5E3JA 3RV4A 1LZKA 3JV7A 1NF2A 2XE6A 2GN8A 3D4LA 3PQ6A 5DRYA 4YRGA 2XT0A 1F0KA 1PN3A 2YZKA 3BGWA 3BSSA 3KAQA 3QUCA 4R81A 3PUKA 4CL8A 5BSFA 3ETLA 1HT3A 1VPWA 2O8FB 4UBJA 3DMTC 4Q7KA 2DCMA 4D4IA 3P2MA 3CFYA 1GUFA 4LRQA 4MEJA 4HZUA 1KVSA 4A2QA 3OZUA 5L9AA 1Z0DA 1QYDA 1UR5A 4WADA 2YJ5A 4BQSA 3UXMA 1U99A 1RXWA 1QP7A 4D9MA 3LG2A 3T94A 3IILA 1B1AA 1WDKA 1Z4LA 4WTOA 5CGQB 5CLIA 1VP9A 1CD5A 5TQ2B 1TA4A 1L1EA 3V7NA 3FLMA 4PZYA 1PK9A 1IWOA 1C1DA 3NKFA 4H15A 4TTSA 3W2GA 3W4IA 3CSDA 1CUAA 4GOLD 3LFUA 2Q4TA 4UHHA 1Z5NA 2Y1GA 4BTVA 1FMJA 3FGPA 4RJLA 3U2QA 1Y4AE 3WAGA 1J21A 2FSFA 4Q3AA 3UJ7A 3TZKA 4MLDA 2AGVA 9ABPA 1XYGA 1TI7A 3MQFA 3ASYA 4MVJM 4P0QB 1EFCA 1W47A 2FWBA 1DTSA 2ZWVA 4RK4A 4IICA 3U81A 3ZDQA 5JS8A 1T4CA 3WB1A 1LW6E 4KNVA 3RVRA 2Z8XA 1AT1A 4AO7A 4UZEA 3UK1A 2BR4A 4CV3A 1KH2A 3C4QA 1MPTA 1N7IA 4IEEA 3V34A 2ODNA 2Q5CA 3VPAA 2I67A 1U2DA 2WJIA 2XCIA 1UQTA 4Q15A 4QXRA 4DZTA 1E61A 4E51A 3UPTA 5AJYA 2N3ZA 5JH7B 1IY2A 5EVJA 2PQ6A 1OR8A 3DA8A 2GDZA 1HMYA 3R6WA 4IWNA 4RVUA 1NVWQ 2YWXA 3V4LA 1PI3A 4IJ5A 4BP9A 2OKCA 4KLCA 4JI7B 5H02A 4X6YA 1JHAA 3W05A 2XDAA 2AG0A 4L5CA 5KQRA 4XPIA 1JBQA 1JSXA 1E9SA 3WGVA 3DP7A 2PD6A 4O59O 4QJ5A 4RYDA 4HDSA 5EKDA 5GONB 4E46A 3NP9A 3RJMA 2WQ6A 2QN2A 3OICA 2WAMA 1YSCA 3FUTA 5DE3A 2NVUB 3JAMA 4UHEA 1S2NA 4D9CA 4AG3A 1UPUA 2YJTD 3CKMA 4MV8A 2Y1EA 5FYQA 2YFKA 4QL3A 2CVFA 3QBJA 1KVUA 1B74A 2QIPA 3MWDA 4IGIA 4V0MA 4EFMA 4FZRA 5BR1A 1R4NA 1ZXLA 2D2EA 1MABA 2WZBA 2HIGA 3LKVA 1JPNA 3I1YA 3L1IA 3TSZA 4POOA 3FR7A 2QP3A 3F1LA 4MZDA 7YASA 4QNRA 4EB3A 1SZDA 2EHJA 1WU7A 2UUBB 2Y77A 3NBKA 3IV7A 3A27A 3ENNA 5CDHA 2X5KO 2AR7A 1GGMA 1PJRA 3FOZA 2HA7A 2QMHA 1UJ4A 4HEJA 3TOXA 4A2WA 1IHXA 1YQEA 1OHHA 3P4YA 2H17A 3NDIA 5B4VA 1U3FA 1FDOA 2PXAA 1Z07A 3KKLA 1W8DA 4F4IA 1IOLA 3Q11A 4URZR 4UU7A 4DABA 4LX0A 1ZGCA 2AC7A 1MAHA 1YS7A 4RDIA 2WVGA 3DMDA 2L18A 4H6VA 4PSAA 4K6CA 1EH5A 2WU4A 3FTQA 1K66A 2YL2A 4LZLA 5K8UA 1DAMA 4Z54A 2PEYA 5ERYA 5JYEA 2IIQA 4X7MA 5E7JA 4JFAA 1IAQA 4D25A 1PVOA 2UV8A 2Q6IA 3E9YA 3BRSA 4MR7A 4QTYA 4YMIA 3JQ6A 1EUDA 2JJ1D 3P2EA 4BTLA 1ZOIA 2HI0A 3C4VA 3OQIA 4DR2B 5DF1A 1A3CA 1BGXT 5FUWA 3C5VA 1L8XA 1TQ8A 4U6SA 1ZYUA 4FDVA 2PX3A 4M38A 1XA0A 1ZD3A 5AW1A 2VZ0A 5ULLA 3GLQA 3S81A 2IITA 5I7UA 2GA8A 3MYYA 2EFDB 3K9NA 4JH0A 1GG9A 2CNOA 2A5GA 1U5CA 2KQUA 3DEJA 4LZAA 4WZZA 4Y6OA 5ETJA 4IO0A 4UTNA 1LNZA 5HKOA 5CM8B 5HW0A 3WK6A 1Y0BA 3OPYI 3VUFA 3HL0A 5T4HA 4BXOA 4XB6B 3LIIA 4EHNA 4GXRA 3GLFE 3ECAA 3B3FA 3QFHA 4R16A 4UEQA 4ESVA 3P7MA 5PGMA 1JPJA 2W0MA 2OXIA 3HHPA 2OK7A 4AULA 4P22A 5J2UA 1R1DA 2NO5A 3AEKA 4P32A 5JTUA 3J7TA 1TM3E 4ZZ0A 2GXAA 4PEVA 4L27A 1ZC4A 1U5BB 1VG9B 2W5UA 1FPMA 2XODA 3BKWA 2MSCB 4YCAA 4CW7A 4WOCA 3K94A 4DV7B 2QS9A 4WJLA 4ERXA 2GJ8A 1MV5A 1WUHS 4LXUA 3TQIA 4EG4A 1XMJA 1SD1A 4RE6A 1SOWA 3QKRA 2ZUFA 2XCQA 1ANKA 1U4NA 4MVJE 4WY8A 5ALDA 2HU2A 3GC6A 4KV9A 5KO2A 2CDAA 3BK7A 3W8EA 2I29A 1E2JA 4LECA 4PGMA 1E79A 2OE2A 4MA0A 1C7QA 1EK6A 4AY5A 4DE5A 3FY4A 4JGGA 1Q1AA 3AO0B 4E5MA 1EBBA 1ZZGA 4F96A 3HUUA 1J2RA 2NU6B 1K63A 2WAXA 3N07A 4Y2VA 2XB2A 2Y0BA 4X63A 5DP1A 2REBA 4BMDA 4IJWA 1F7VA 5L6LB 2GJKA 3L0YA 3DEYX 4BVFA 1KDPA 3CUYA 1QHFA 3THYA 4H60A 5COQA 5CD9A 2FZCA 2R48A 1FL9A 4IO1A 4MMZB 1WMFA 2A9KA 2PXHA 3E1SA 4TWIA 1JQJC 2QLMA 4WBNF 1R5NA 2YJGA 1CQJA 5TGTA 5A4JA 4YAFA 1VL1A 2O3UA 2ZJ2A 4AJNA 2ZE6A 4FWTA 5EMKA 1KQ3A 3GFOA 4GLJA 5EFOA 4LPSA 2QRQA 2X4LA 3PDUA 4FEAA 3PE6A 1ZM4A 4RTOA 3OQNA 1P29A 2VS1A 5LMNB 4ND3A 4TKVB 4PRZA 1EIWA 3TECE 1H22A 2Y2VA 1T2DA 2VLIA 4KTVE 4OQZA 2EL9A 1IK4A 3QVVA 1GPAA 2WM2A 3JYQA 3I5MA 4JYMA 4OBXA 3ZG6A 4BNNA 2OD9A 5INTA 1LY1A 2P2YA 4CXMA 4WBSA 3JQ8B 2FF7A 2HK7A 3AESB 3T3DA 9ATCA 4DR6B 3IR5A 3DB1A 2FKNA 5ARDA 1Y3DE 3CY6A 4BNWA 1DKLA 3LUBA 3DZHA 4LZWA 4UATA 5EN4A 3RJZA 3U4CA 2VJMB 5CAEB 2KSQA 2CGEA 3EFOB 3RC1A 1Y9AA 3QX8A 4R9RA 3AY3A 1YZGA 3IAHA 1SBIA 4IVNA 2QNIA 4OGKA 1JBKA 1U0OC 3WNBA 5CA1A 3DDCA 1PSZA 3EWSA 2O5VA 3TLCA 3ET4A 1Z83A 1PNTA 2JJ1A 3M2PA 4FINA 1AQUA 5DHQA 4BOYA 5K99A 4K9NA 1RHQA 3H97A 5IC6A 3SR0A 2OLKA 3MJFA 3VJMA 3L8ZA 4QYIB 3VX3A 2IS4A 1A98A 1QKKA 3A7EA 2EBUA 3CPSA 4MCIA 1L7RA 4OA8A 1BXGB 4W99A 4AMYA 4EL0A 5LSAA 1W0JD 2B8JA 1V6CA 5DLDA 4A27A 2X4GA 1GDTA 3CWQA 5E7IA 1JWLA 3TIVA 4WNAA 2YMLA 3ZTTA 4NCBA 3KSDO 4NFHA 4BO2A 4E6PA 4NXMB 1GPYA 1YZHA 2VTBB 1RRFA 1LI7A 1V35A 1QV7A 4QQFA 4TLMB 3EVZA 4XCXA 4M1WA 3ZBUA 4JEIA 5EYPA 1AKRA 2V58A 2QX4A 4EJFA 2AMVA 2V5UA 1KMNA 1VE5A 4E5NA 4D4LA 2ERXA 4KO1S 4X00A 3CF4G 3L8DA 4EPWA 3N8IA 1JWAB 3HN6A 3NBAA 4LBYA 4H31A 3KDSE 4AJPA 2Z9DA 5FWNA 3AL0C 1NW6A 4BFWA 1KEUA 1B93A 5AW5A 1R9GA 4AY6A 4M87A 3DJYA 4ZOQI 1W581 2BGGA 1VHDA 1X80A 1JFFB 1XZPA 2QAGB 2R97A 4MYSA 3SP1A 4CNQA 1L3IA 4HUTA 1YK1A 2Z3WA 3MIIA 2HTFA 1L5SA 3BQ9A 3GVXA 3HBNA 3T4XA 3TVTA 3W34A 3WJ2A 3ZHBA 2HK9A 3ETCA 2ZT8A 4ZV9A 3ZIAA 2C94A 1ECCA 1PWEA 4Z99A 2GN6A 2BPOA 3RAGA 2VI5A 3S6JA 1EGQA 5LZ5A 3UF0A 3SX2A 2DR0A 1ZJ4A 4OYRA 1XDDA 3N53A 4EDFA 4ZJYA 2QN3A 2BDTA 4E14A 4ER6A 3L8MA 1Z6GA 5CCXA 1FQKA 3SX0A 2HHJA 3IVGA 4I1YA 4NSNA 4EM6A 1R5BA 2EOAA 4IR7A 2XMRA 1A77A 2CLIB 1FW8A 2M6RA 1IZYA 1UAGA 1K6XA 2BJVA 2C5EA 2ZI3A 2DWOA 3OOJA 4M55A 3FYCA 3I4FA 2QYHA 3GWGA 4UTZA 4IDOA 4QG3A 4XX0B 3ZV4A 1PD1A 4C88A 4DAOA 5KNDD 2BBTA 2CDBA 2IYPA 3BGSA 1QORA 4MUEA 1Y8AA 1U4OA 4BQQA 4NH0A 3HKCA 4NZYA 5CLFA 3QWIA 4ZQEA 3TW0A 3B52X 2AC4A 4FHCA 2I76A 1QO9A 2GB4A 2V74B 3GGCA 4MP6A 3TDNA 3UZUA 3ZXIA 4E5SA 4CEJA 2X9GA 3HJHA 3AJ9A 1IPEA 3D0KA 2Q3MA 1JDNA 3H1PA 3T6KA 3V1LA 4J9UE 2CNDA 1U0SY 1W96A 3I9KA 1KU6A 1QAQA 3UUGA 1YR3A 3FWHA 4KAAA 5GADl 4X60A 4QZVA 4MEAA 2Q46A 1FUEA 2LR0A 1SIUA 4NBWA 5UKDA 5ALNA 1UODA 2VWPA 5GM1A 1ZCAA 5JECA 3BL6A 5L7YA 4LF6B 1NQTA 2A67A 4IDDA 4I55F 4WN3A 3VH2A 3ONEA 3TSCA 2QJFA 2XOXA 4OBEA 2UZ4A 2OCLA 2Y93A 1RU3A 4GPD1 4LBWA 5K3FB 1ZD5A 3DUFB 1FFYA 3ZH9B 3ACBA 1KK2A 5JY1A 5FTLA 3IJPA 3O73A 1XP5A 4OLHA 1JAIA 4X97A 2EL7A 4UZSA 3EGVA 1GSIA 2GJ9A 3QIVA 1KZ7B 3GFSA 3NEYA 4UCWA 4X90A 5AW2A 4HBZA 5KS2A 4IFTA 3FOAA 5CVTA 9LDTA 2ZU6A 3DVAB 4LMPA 1FS4A 1H94A 4JJGA 5ERXA 4PYJA 2P35A 1SHLA 5EXTA 1N2JA 5FBKA 3MB5A 4PLGA 4XWKA 3CZ9A 4TSFA 2Q0XA 3SHTA 3H3JA 1MW8X 2FWAA 2IUEA 5LLTA 3WK7A 3A3NA 2IEDA 3UFBA 1OYWA 3PNQA 1E1CA 4M6WA 3VI3B 1F9AA 2IEYA 1OFUA 3LQKA 1TCAA 3HP7A 2REXB 3ABIA 3Q85A 2XY4A 5L8VA 3D8TA 5FBZA 2C03A 4V38A 1X80B 1C7FA 3YASA 5FPTA 3G1UA 2HSZA 3IR6A 1PZGA 3OQJA 4L2IB 4OHMA 3G17A 2P0AA 1GA1A 4C3ZA 4D92A 3T5AA 1G6OA 1L1FA 3OIWA 5KTPA 1EHYA 1P17A 1TF5A 4WKOA 1YFJA 2ONCA 5D8DA 1MPXA 2FUG1 4CV0A 1TF2A 1VKJA 1G1AA 3TL2A 4ZKDA 3HB7A 4ZEMA 5I8PA 4GM0A 1A9ZA 3AC0A 2J3HA 5DTIA 1DKRA 1X7WA 4G86A 4Y6PA 4CGYA 2CNNA 4LS3A 3V9PA 2G5PA 4D0RA 1H2YA 1AKYA 1ZIXA 2FX3A 3RIXA 4K9PA 2HRRA 4PG4A 4KLRA 1AOXA 2YJ4A 1Z82A 4HQLA 1A4UA 1K98A 4F3YA 2PGIA 4QQNA 4TUYB 1NJ6A 3GOQA 4RCYA 5EAIA 2HEIA 3HM2A 4NOJA 5FWXA 3RWMB 3PD0A 3H5RA 4GU5A 3RO7A 3O4FA 3QLUA 3E3MA 1G55A 4ODIA 1G5IA 5M34A 2VBGA 4LIPD 1S4QA 1J33A 5IDVA 3M7IA 2GFQA 2EXXA 3HVKA 4I4LA 4HAVA 4P3XA 2QLTA 1Z4NA 2JEYA 4XIJA 3VR4A 1ULTA 1NG1A 2OESA 2CWDA 2I1WA 2CVZA 1CQZA 3JYLA 3L8CA 4IFBA 4WAUA 2A59A 1Z5GA 3EXFA 2M1ZA 1SHTX 3DTNA 1HEYA 4E5PA 3ECCA 5AWFC 3ENZA 4BO3A 4DS3A 1COWA 1AGXA 1FY2A 2VVTA 1KPGA 3WRVA 4IYRA 2NU8B 1N9ZA 4LE2A 3NAZA 1FW6A 1L7DA 4GKVA 5DU2A 4J7UA 2MYUA 3HK2A 4CUJA 2HFJA 3P20A 4Q7EA 4RMIA 1YBFA 1JEOA 2VR1A 5DASA 4GOJA 3I12A 2Y6VA 4WJZA 3ADBA 2ZRJA 1ZGHA 3ABSB 4MI1A 1MLDA 1H0HA 3L0OA 1OGYA 1KYIA 2PN1A 2WK1A 5I9MA 2HZ7A 5FHQA 2AFHE 3BXPA 2BFEA 5KTYA 1K06A 4F11A 3D8UA 1VJGA 4HLUA 1WU8A 4LN1A 1RZVA 5AM2A 2GZSA 1QRSA 3CPJB 1JVNA 5IZCA 1KJQA 4YQEA 2X5OA 2WPDA 1I9GA 4EB0A 1YR9A 4EZBA 2IX9A 1ECBA 2FPOA 2P3LA 3O21A 3IIJA 4GDMA 1V8BA 4FQ5A 4U7HA 4ZVPA 3O94A 2WVAA 2H1LA 3OZBA 3VR4D 2VJYA 1CUCA 4R1OA 1DQPA 3SC6A 4E4YA 5B1YA 3MAGA 4CIWA 4US2R 1M7GA 1TA9A 3BIFA 4IVRA 4EATA 1HEIA 1GG5A 1E2QA 1UXOA 2C9DA 1DAEA 2CB9A 2JKZA 2HDNB 1DTEA 2PXXA 1RRPA 1N7JA 3GZJA 2IC5A 4MPRA 4OJTA 4PQFA 5DZSA 5FBWB 5BRNA 3VR3A 4G1MB 4FDTA 3QF4B 2H0QA 3PFHA 4UUOA 2Z9BA 5FCDA 4B46A 4UMFA 3TQSA 4C76A 2JIDA 2HMVA 3T5DA 4ZQHA 3PC3A 3EY4A 3RUAA 5EJ9A 3GWZA 1U8YA 1RDFA 3I53A 2EVWX 3KR9A 3R7NA 4CU5A 5DPMA 3PUWA 1LTKA 2IZOA 2CDNA 4R51A 4RQTA 3SBEA 4AYTA 2Q5JA 4OQLA 3NW9A 2ZS8A 1DDOA 2I78A 2I3DA 2NVOA 1NXQA 3MCWA 5H7XA 1U7HA 1Y5RA 3AYXB 3CB2A 3UJ3X 1BDJA 1US8B 1YIOA 2B5OA 1QO0A 3ST7A 5AUPB 2GLXA 4M3NA 4ZU6X 3S1AB 5KSWB 2WWXA 3ZY4A 1J49A 1KJZA 2H16A 2VJDA 1ATIA 1QE0A 1ZOSA 4M83A 3TW6A 3WWYA 2OXTA 3SLGA 4F3NA 2GM3A 3GH3A 1DZ3A 1ZIOA 2LZ0A 2P30A 2PZJA 4QT4A 4V0KA 2OUKA 2XHZA 2JHPA 3R9WA 2C9ZA 3OPYA 3OE5A 1JG3A 1UQUA 3ELWA 4WK6A 1SCJA 4QU9A 5E3HA 3DPUA 4CF4A 3ZCRA 4CMKA 4PVCA 3IA7A 5ALVA 1DG1G 1DO2A 2D0OB 4KQWA 1JEJA 1V1RA 3PQ7A 1KI4A 2F59A 4BP1A 1QV9A 4UPDA 1JLSA 3G0OA 5T4FA 1OTXA 1T9ZA 3DLIA 3U7EB 1RHKA 3LT5A 3T3EA 1E3SA 3T9AA 4JUBA 4HZUB 1JJVA 3EEFA 4IILA 5KYWA 4B6RA 3RHSA 3RT7A 4EITA 4KPUA 1ZK1A 3JATA 2P77A 3G82C 1N2SA 2HDOA 2I80A 4FT2A 4I4TF 4G37A 4EPVA 1KOJA 5D3QA 4ASUA 1ND6A 2XMCA 2AWNA 2OWEA 1DC7A 4KMRA 1NZFA 2IYYA 1QUEA 1VSQA 2X15A 2VZLA 4Y0AA 1EJ0A 2VT7A 5LVAA 1P5JA 4YJGB 1KWKA 4DIKA 1CY8A 1X1CA 2CHQA 3D3QA 5EPEA 3N0WA 3UHJA 5KVSA 1JEDA 4BO0A 3P94A 3JQ9C 4BJ3A 1K0UA 1YTLA 4TWZA 3RUDA 1PG5A 4QVGA 4W1RA 1G5HA 4KE8A 1L3BA 1TA0A 3QLTA 5A3QA 3Q8KA 1SGWA 3ITKA 4BV8A 1K3TA 2AQKA 4IRUB 4D82A 2ETVA 3BCHA 3MB8A 4ZU3A 1E3DA 4I4TA 4RSRA 4DCPA 3U7JA 1I9CA 2O7SA 1SK9A 4MDHA 4YRQA 2FN4A 2R00A 4V1CI 2P6MA 4B3FX 1XFDA 3GMIA 4CIXA 1ECFA 2BP7B 3R20A 4M1OA 3AEZA 2IHKA 3T15A 4EB6B 3DHEA 4OQXA 4AMZA 4AZ3A 5JT1A 1LU9A 3DEZA 2FK8A 1UH5A 1AU9A 2FJUA 3BG5A 2D00A 3PKIA 5JAHA 3IXQA 4GUAA 4NE7A 4PGFA 2ESRA 5DNVA 2J9RA 1AKQA 4FGZA 3RANA 2VAWA 2ZXUA 2H2IA 1QQ6A 3BBPA 3WGMA 4FI3C 2WVJA 4I50A 3ZQUA 1WDTA 1OIXA 3TLJA 3CTMA 3OQIB 4Y2UA 5AKKA 1JKJB 3C45A 4KQFA 4S05A 2H1OA 4A2CA 2FDXA 5BUSA 3HA5A 4ZYXA 4GIBA 1HKHA 1L1QA 4NZPA 3HCCA 4QJ4A 4AZ0B 1Q57A 3FHOA 2R25B 1AQLA 3Q7RA 3IXMA 1G21B 2RK4A 1ZW6A 1T9BA 4H6WA 4GMHA 4QQRA 4HVLA 4RC9A 4RHEA 1CHDA 1T5TA 5EUCA 3VPHA 4QU5A 1YONA 2HH9A 3GLFA 4N9WA 1NKTA 3RYFA 5JG7A 2GF0A 2H9AA 3H18A 3MGBA 4XQCA 1RE1A 3L8EA 1L5WA 3QUTA 3TLAA 5T6MA 4RLFA 5CB4A 3CE6A 5EJAA 1N2ZA 2PX5A 2ZIAA 4I3HA 1SURA 3BDAA 1P0PA 1Y33E 5KMGB 4ARIA 2REQB 2RI1A 4J4BA 1YZLA 4IXMA 3ROQA 4ZOLA 1F2TA 3KD3A 4BNTA 5L7WA 3AESA 1XSEA 4G07A 3ISTA 3Q7TA 4XD7D 3H5WA 4KI0A 5IBQA 1QGOA 3GNLA 4PGAA 5LYJF 4LRXA 4B3XA 1OAOC 1EP2B 1TT5B 5LQAA 3AZOA 3HJCA 3GX1A 4TOIA 3ZGYA 4ZREA 2QUIA 3D7SA 2AKEA 3TD9A 4YMUA 2XYGA 3IP6A 1LRLA 1NN5A 1P8JA 4GPIB 2FWRA 1JLLA 4PC3A 4RTPA 3HO6A 5HBRA 4AKSA 1FLDA 3H2YA 2JIOA 2CHUA 3EIEA 1CJSA 1RPAA 4YCDA 3W3AH 4ENUA 3ZWOA 4IMRA 3HVJA 1BMTA 1X39A 1T36A 2W83A 2WIBA 4I6EA 2PR2A 3FGZA 4HX5A 4ZQCB 1Y48E 1MNQA 1NI3A 3OZGA 1N1EA 2E1RA 3ISVA 3ZHZA 4ZCTA 3V2IA 3ZHUA 3M1AA 5C35A 5K01A 2IH5A 4HAWA 2EW8A 1XGKA 1YDMA 3I5UA 3LA6A 4YAOA 5EP3A 1MVNA 2B94A 4ZHSA 3DZIA 5AVXA 4KXVA 1C0PA 1E7QA 3GUHA 1EWVA 4TWAA 4X45A 3U31A 1O95C 5ADWA 4F4UA 3H2SA 2RIPA 1YRYE 5EIBC 4WKNA 3B6MA 2PL9A 3GNQA 3C3KA 2OP0A 3CKYA 3I09A 4C87A 3F98A 1FYEA 4L76A 3WYBA 2IIBA 2V6IA 1BKYA 2EKPA 2X2FA 3CZ5A 2ERCA 3TL6A 3R7LA 3OESA 3ZCVA 1TZCA 2RHGB 1HK7A 2PT6A 3H4MA 4OYLA 2QTTA 4RCVA 4WVLA 4AUNA 4ZGBA 1GTSA 3DLTA 2EX1A 3ORRA 4IQ8A 2ZM5A 1ODSA 3MWJA 4AS2A 2BF4A 2KJQA 1Q22A 4L02A 5KTOA 1XJCA 1E99A 1OFHA 2V7XA 1YS6A 3JAWA 4QPZA 5C1OA 4OUKX 1QFMA 2HU7A 2PLAA 4DV3B 4AJKA 1V95A 3LTNC 1I80A 2VNIA 1QZTA 3H9CA 1ABBA 1CE8B 4JIGA 1LK5A 2LCIA 3RBAA 3UW3A 3K15A 421PA 1MX3A 3EXEA 3NBXX 1RC8A 5EKSA 3C5CA 3NKLA 4I50B 3HFGA 2B7CA 3R3VA 4OBWA 5GJWC 4FOSA 1YUBA 1U8ZA 1LSJA 2RHLA 1I7LA 1RD4A 2NACA 3A4LA 3LDFA 2L0XA 3NATA 4BMZA 4UTVA 6REQA 2C4NA 3QXXA 5TS2A 3AR8A 1MAUA 1KRHA 1YQQA 5C4IA 4EI2A 4AVYA 1VP3A 1ZFNA 1WDWB 3NT4A 8GPBA 2YC4C 3NWPA 1F51E 2EBWA 2GEDA 1UUFA 1IHDA 3OT1B 2N1BA 1DEHA 1USVA 1XP8A 3PFKA 4ZICA 4IGKA 3UGTA 2QP4A 2BCEA 2B3TA 2ZIVB 4OQMA 4KX3A 3VC7A 4RHCA 4YP9A 4R41A 3H1FA 2R4TA 3PFCA 5B3LA 5FWDA 2A3RA 1T4DA 1BVUA 2ZFUA 2D3TA 3ZI7A 1EUCA 2D7CA 4UNSA 2RGYA 4PR0A 4WLFA 4LJSA 1HWYA 3CM0A 3RREA 3ZDBA 4F4JA 3OQOA 3WI7A 2YRWA 4EOGA 1RVV1 4YRBA 1V43A 1SUBA 4OMCA 4YH1A 3AEUA 1AK9A 3OIFA 5CGZA 4ZAXA 4EJ0A 2JD1A 2ZITA 3DFUA 4CZ2A 5HRCA 1RADA 3DH0A 1PJTA 1J5EB 1LLQA 2IYSA 4JI4B 1JH9A 3SZLA 1Q50A 4LNHA 3QPCA 4UBNA 4UE3S 1G7TA 1DCFA 2GWHA 1G59A 4WXHA 1BRMA 1CJKC 2HF9A 5D6NA 5HF8A 4EI7A 1IHPA 1RMQA 3GXOA 2B37A 2MSEB 3EE6A 2IU3A 1L4NA 4QDKA 1XCPA 3LUFA 2ZIXB 5FX2A 3JD2A 4RTJA 2BKEA 3OA2A 4LY6A 2UAGA 3M5CA 5GIPE 1P0QA 1TQHA 2DFTA 2VXCA 2VNKA 3H7AA 4GI1A 1GILA 5JYDA 1OMOA 4F3TA 2FPGB 8AT1A 3E7DA 1EE1A 1C7IA 3ILXA 1GPDG 3QHQA 5A9TA 5SY9A 1YJQA 3MINB 4IDAA 1KEZA 1JHRA 3U16A 1DV1A 5JMWA 4BMCA 1V11B 1JB9A 2EDAA 1GT6A 5DN6A 2PJRA 1MF7A 2FW6A 1CF4A 2C95A 2RKWA 3PJGA 4RFVA 1FTSA 4C4YA 3P0IA 2FSPA 2HNKA 4TT3D 3WXBA 1RJFA 5CDUA 1YQXA 2C0PA 2V54A 2P9HA 2ZE8A 4UAUA 1RCUA 5DP2A 4B5KA 1X7DA 1YI1A 3HN7A 2AR0A 2OP1A 3SXPA 1E2LA 3UMJA 3WZMA 2IHUA 1T0IA 2X4DA 1FE8A 2XHEA 4YFYA 3O0TA 3AF1A 5J23A 2CHFA 2P11A 1SCUA 4OI2A 4W5RA 4HXYA 2I1VB 2KBEA 5KYKA 1SU7A 1ZH8A 4B8YA 3HFJA 3ODGA 4YRNA 1OAOA 3Q15C 2CZCA 1M67A 3V4ZA 4DKXA 2QTLA 1RI3A 2QT9A 3DCJA 4CN8A 1OLSB 2JCGA 2P2ZA 3I1FA 3B9BA 1ZJWA 2VHYA 4DLUA 1TC1A 2HF2A 3H04A 4CF7A 3ID6C 3RU9A 2ZU0C 5KC8A 4YXWA 3L8GA 3MMSA 1E1LA 3KFVA 2W8BB 5BT9A 3KJHA 3I8XA 4ZCMA 1GL3A 4Z49A 2OD7A 4RUKA 2O2JA 1T5HX 3AP2A 3PGLA 4GC5A 4GLLA 5HKKD 3GLGA 3BIJA 3LT2A 1W0CA 3HSYA 4GZ3A 3WGYA 1ENPA 3LECA 1M66A 4EKDA 1EVQA 3FCAA 3OT5A 4BMYA 4MVYA 5JZOA 1GKYA 3NBQA 3AJAA 3CGWA 4FCWA 4NMHA 4G4SP 2X13A 3K73O 2LIPA 3ZIAD 4YUXA 4TZ0A 4EQ6B 5F7XA 4LHWA 3JQAB 3NOOA 1N9GB 1ZBDA 2HLNA 1EX1A 4KQHA 4MV4A 4Y2PA 4PQYA 4YR9A 1T15A 4FYPA 4YS6A 2MSDB 5KAMA 4F5EA 5AW3A 1Z4QA 3AI1A 3JVUA 4FGSA 4XM1A 1ESDA 2ONKA 3L7KA 5ALOA 3HY4A 1T6NA 4WA7A 5JBIA 3EXFB 4NHOA 3KZKA 2HCTA 2OCDA 3IEXA 3IDAA 4RA9A 2ZCJA 4Y2SA 2YVLA 3EF1A 5DLPA 3DPIA 2CF5A 4EARA 3NJ8A 1SWWA 1DPGA 1ENOA 1E9DA 2ZBDA 3DMHA 3P4XA 5A3SA 4HYTA 5P21A 4PVDA 2IYEA 3DKRA 1XZBA 4IX9A 3UOGA 2RKBA 1EP3B 4IDPA 2ECQA 1CT9A 3QX9A 1R6XA 1X19A 4PWYA 3CVXA 4B3SB 2YZNA 1OF1A 5D5PA 1ZXBA 4X3PA 4BE7B 1BZYA 4M1EA 2XA1A 4MUIA 3THRA 2RG1A 4FCVA 1LTQA 3BILA 3B60A 2WAAA 1G7CA 1H1LA 3SE0A 3P5SA 1EPUA 1SH7A 2V7EA 3AIIA 3R09A 2OSBA 4E88A 1JFTA 3DE7X 3O31A 1THZA 2VSOA 4MQFA 3P9SA 4YJ3A 3GJXC 3KP1A 3NXSA 2PVPA 3TYXA 3EX7C 2ZAOA 5IYZA 4M22A 5FO0A 4DANA 4NDAA 2WFAA 1ZJJA 5EMMA 3LFHA 2HBRA 4IDFA 4CKXA 3OUZA 3IULA 4L9AA 4D1YA 3SE7A 1EQAA 2UZ1B 4OP1A 3HY3A 1AM4D 5EIWA 5B1DA 1O08A 1Q1GA 1LDGA 1TL7C 1NUHA 1Y4UA 4NFYA 3TLGB 2JZCA 4CLRB 2D1YA 3BCRA 2JGMA 2TECE 2OLJA 1D0IA 3D8BA 2C5HA 4N4AA 2JCVA 4X5OA 5TT0A 1K3UB 2GKOA 2WNIA 4BO5A 1FSSA 1H93A 2DHQA 2DFVA 5AK3A 3K2EA 5SICE 3QSYA 4FILA 1M0WA 2Q1TA 1KK1A 2ZTLA 1HI9A 5DNEA 1XTKA 5B53A 1QR2A 5K3SA 1TZKA 3BFXA 5SYAA 4PYOA 3FOFC 4CFZA 1UXHA 2CMGA 5FULA 1XD2A 4PN3A 2QT0A 4G5RA 1GEGA 5EKXA 1I0ZA 1TUEA 1XDZA 4FXOA 5ALHA 1J7JA 3EWIA 4Q3NA 4MYCA 3RJTA 2GK6A 3EMVA 3EZNA 5ES4B 3B7GA 3GPIA 4JLWA 3M3PA 1HY3A 3QOFA 4PGGA 4C0QC 1DC5A 2N75A 1M2EA 2W6ID 4NAHA 3BJZA 5F76A 5CCBA 1WABA 1BJKA 1U8XX 3RJ5A 4TTTS 3KPJA 3VUEA 4D98A 5I48A 2Q6KA 1RHJA 3E18A 3CUUA 4ZVKA 1DXQA 4PLHA 3D7MA 4EW1A 1GTRA 1NM5A 3PLRA 3LPLA 5GP1A 1UT5A 5EE5B 1KYTA 3I32A 1NFRA 3MGKA 4KL8S 3RVOA 2D1QA 3B8HA 1Y6QA 4IWXA 1Z4PX 4QOJA 5HFJA 1VI5A 3OZCA 1C8LA 3L4BA 1KERA 3U3DA 4X1OA 2C77A 4NARA 2PRYA 5DTQA 2WFLB 1TMKA 4PFQA 3I9FA 4EG3A 1W88A 3MK31 2C42A 5K0NA 2UVPB 4HN4B 2P68A 4TX1A 2R1VB 3HYRA 4DMHA 5A06A 5ALRA 4S0XA 5LB4A 5B1IA 1KF0A 2W22A 4MCAA 2GPWA 3F7NA 2PL1A 3CRMA 5A5GA 3KOOA 3ZLUA 4YROA 4GR4A 5J2UF 2B2XA 1LLDA 4HEQA 3FCOA 5ESDA 2D5LA 4KRFA 4EKIA 3GFBA 4BQNA 5BR8B 3BWEA 2AUNA 3EFBA 1U8UA 1OKKA 3HA7A 1U0RA 2GEKA 4JOCA 1XQXA 3ZPXA 4D3DA 3CUWA 3ADDA 2WF5A 1U2PA 2C9OA 5AKZA 4WW0A 1S01A 1YB7A 3F5DA 4ZOCA 1NQOA 4PHCA 2DM6A 3T3MB 2BDEA 1DQYA 2OBFA 3V7UA 2FMTA 1FTGA 5EUQB 4DJEC 1P74A 1UXGA 2PMKA 4ZANA 4RY0A 2FOXA 2P2SA 1ZGBA 2IYOA 1GR1A 1HLPA 2J5RA 2W43A 1N6OA 1I3NA 3U4GA 4YCLA 3EGXB 1P2VA 2I2DA 1NW5A 3QLEA 4ED9A 2IDJA 2VH1A 2IYVA 2QD5A 3DOIA 1WZEA 1RHRA 4MPTA 5DHFA 1A7JA 5COAA 3KPYA 3QMPA 5HQ3B 3PB3A 1S2LA 4LQCA 4F4DA 2WIFA 3THWA 2FU5C 4XQGA 3PC7A 4L7QA 3L7MA 3A0UA 5AO9A 3NJ4A 4U8GA 3LQQA 1X1QA 1XZLA 2FP4A 2MSNA 3DL0A 1GPKA 2CE2X 1DHTA 3IOCA 4M60A 4KVFA 5DB4A 4BLSA 3Q3JB 3I6YA 1J9EA 1FRFS 3I1IA 2I03A 3KQWA 5C4MA 1HLGA 4MPJA 1W4RA 3IBFA 3RVNA 2YWHA 2IS2A 4EUHA 3IUQA 3OX1A 1KMCA 1G2QA 3PVCA 3NU1A 3HG7A 1XJQA 3X2EA 5JATA 3HXQA 5JZ9A 2DBZA 3SEAA 4YTEA 3IPCA 4PS0A 1ODCA 5GTDA 3FZGA 1OBCA 1V1MB 2Y71A 3HKEA 3LHKA 4TZKA 4Y9RA 7REQB 4YT8A 3UYLA 1LFDB 1HDIA 2ST1A 3KAJA 5E6SB 4Z8XA 5FIUA 1F8XA 4Z3KA 5KNCH 3V4RA 3ORYA 1F6WA 3GJ3A 3W2EA 1JDSA 1AF4A 1SXJC 1E6KA 2XOEA 1JFRA 4UUAA 4AZWA 1QYRA 3B5IA 3NDPA 4GRAA 5IVDA 3A1TA 1Z2CA 2VP6A 2WILA 2XOKD 5CFQA 3D1LA 1J23A 2ZBEA 1XMOB 3R9KA 1I2BA 1QSGA 4JBNA 1MC4A 4M1YA 1N57A 1BWQA 4EJSB 4F2HA 4EY4A 3EUWA 2ZPTX 1NVBA 4MWEA 1G5RA 1W34A 1M6NA 2BKUA 3CISA 1KBZA 1NUPA 1YI0A 3O90A 2X6RA 1VBKA 1C2TA 4KZKA 2VYVD 4P3NA 4RSHA 1I5EA 2IPNA 2JGEA 1Z8DA 1YR1A 4AKTA 3QBVA 2F7SA 3LPAA 1LW7A 2QGFA 2IYZA 2GCIA 4Q4AB 2QE7D 5HNKA 1C5KA 2IHTA 2QRKA 4M0CA 4OB8A 3A05A 1IHUA 2JW5A 4KOAA 4XRRA 4Y2RA 4DRZA 4N41A 4PPYA 1PV2A 3S2UA 5BNZA 3AHCA 4WECA 4RBNA 2AE2A 3N2KB 2IYTA 3OPXA 4G5YA 4BZZA 1U1DA 4CG0A 3ZNNA 2DFDA 2ZRIA 1SOUA 1OBFO 3A4MA 1TYAE 3K0BA 4JBGA 4L16A 5DI3A 3ESXA 4Y9TA 1P7PA 3R7BA 4N49A 2NSYA 4ALLA 4BLWA 4DEVA 3MEQA 2XBLA 3OX2A 1FNCA 1ORWA 1U6IA 3C3MA 3O8QA 3S2SA 5IFKA 4S1PA 5CB8A 4DV4B 2F9FA 3CLHA 4U7DA 2WIKA 2QTHA 2HF7A 4Z4IA 2RI6A 2ZSBA 4H7FA 3G2QA 1GP2A 1CUDA 5IWAB 1CJBA 2GNOA 2QQ0A 3FAKA 5EE0A 3G59A 3TLYA 1AHHA 1CDEA 3EIWA 4HX9A 1SHUX 2WKWA 3D64A 4NE9A 1JAXA 2GVDC 2HA4A 3I5AA 4JOQA 4BBZA 4GEKA 3WLAA 5KYYA 3EGXA 5IJAA 1GIAA 3BTSA 1Q84A 4AW9A 2VPPA 1H23A 3KTFA 2DUWA 3GROA 3TZBA 4XUCA 1ZMXA 4KVZA 4GZLA 4BE4A 3WO1A 4N3BA 2DWCA 4AMGA 1IE3A 3EY9A 1JHZA 2L17A 4JS0A 2V3WA 2YXEA 4BV9A 5ELLA 3LWNA 3U44B 3FR8A 4UTOA 1AKEA 5TQ0A 4F71A 1RJGA 1YK0A 4B43A 2BT4A 2R6FA 4EGJA 3FGNA 4RTLA 3IDSA 4YJFA 3SVTA 3A11A 2FSHA 4D9JA 2C8VA 4RAQA 2YFYA 4GI5A 3C8MA 1HNWB 4RSMA 4JJFA 4P08A 5I5EA 4LJYA 2VZ9A 1JQEA 1USUA 2G83A 5BYAA 2O2ZA 4MKIA 4KDRA 3MWKA 4L85A 1ZW1A 5ALTA 1DINA 2KBFA 1LF0A 3CIFA 4LRWA 2AHOA 2CLFB 1FK8A 5THKA 1LKZA 1W9HA 1C41A 4OMFG 5D84A 1JIQA 2B5WA 1GLVA 2JDID 3LO8A 1P2GA 1KEVA 4BL5A 1XAJA 3G68A 4N82A 5CT4A 2O4CA 4WMLA 3PEFA 1RT9A 3JWEA 4AIIA 1RJ9B 3OU6A 1IH8A 3AM5A 3C6YA 4M0KA 3OY7A 4QOEA 1X7YA 1HYQA 1SVWA 4KJXA 4BGUA 4LJRA 5JPDA 2H06A 4UZFA 1VA5A 4XGQA 3RGGA 1XX6A 3WDMA 1L5FA 3A9RA 3HNOA 3TNFA 5DBFA 2J85A 3F6YA 1GRVA 4BB0A 2HQSA 3KELA 5SZHB 4R69A 3CEJA 1AUVA 2DPLA 2XRMA 3QEMB 2EQ5A 3AF3A 3LY9A 4RAOA 4R8RA 2FFRA 2NT4A 3IVMA 5KJEA 4LRUA 3FVTA 1QH9A 1V6AA 4L8WB 2YUIA 4TLCA 4U6NA 3FH0A 1ECGA 4JB3A 3COWA 4QO8A 4W6QA 4DT1B 3ZLTA 4X71A 2PBLA 1G98A 3EXEB 3PFBA 4WOBA 1ZWLA 4EI9A 5IT4A 3WGKA 1P0IA 2G09A 4LE0A 1ONNA 1L5QA 4MV5A 4ND6A 4A0QA 3A7DA 1M0TA 4DIBA 3COPA 1QNFA 1DU4A 3DXZA 2ZQZA 1JXMA 1QXSA 1WNFA 3M4JA 3KJXA 1EE2A 4MWZA 4RXMA 4TXNA 1CIVA 1CJMA 3GRPA 2D1FA 1J00A 1IMOA 1I3OA 1VB5A 1WXFA 4GECA 1DQZA 3I4CA 4QUAA 4UHKA 1P1RA 3LA8A 4L3WA 2RK6A 1EX7A 3PD1A 4QLAA 4O63O 6Q21A 4PPFA 3W5AA 3ND7A 4ZQGA 2HU5A 3K92A 5I9TA 3IJRA 3MGCA 4ZZ3A 3T7RA 5HWSA 2WYOA 4HNUA 8ADHA 1TEZA 3L40A 3D2AA 5BN5B 2HTEA 3GRUA 4W6ZA 2MYTA 2QZ4A 1E20A 1DQNA 1W0JA 3G9QA 1CFZA 3IAXA 4YRCA 3W6ZA 2JIRA 4ALKA 1JHQA 3DOHA 3A36A 5K6AA 2FUG6 2XCSB 1VPDA 2H1FA 3ROKA 5EMHA 3P2KA 4RHUA 5KJ6A 1A4XA 5LC1A 3UHFA 2CLKB 1D03A 3FG9A 2Z3ZA 3IC5A 4TT3A 4ZDIA 3G5UA 4KDEA 2POQX 1DIOB 1ZNYA 3LI2A 3NG1A 4DOMA 3PNOA 1A1SA 4NBSA 2Q3CA 4YO8A 4UOEA 2OO7A 1DSSG 3E3OA 3M6IA 4WKGA 3JQPA 5FFFA 1BDBA 4X91A 4TM7A 3KB6A 2ET6A 1J8QA 3BE8A 1MIHA 2Z5FA 3DTVB 3CR8A 2X1LA 1U0NA 2HD4A 3L7YA 3DCYA 2VPZA 2E6KA 5B3AA 4QUDA 3C4JA 1ZUD1 3G9XA 4O4LA 4UAJA 3JPYA 4YQZA 3VR6D 4J3FA 1P5RA 1Z7YA 1IHYA 1PLKA 3I34X 4LK2A 4DQXA 3E6AA 5L53A 1ZVKA 5CVUA 4ER3A 2RCNA 5G0UA 3W2HA 1P2BA 1HQCA 4CM9A 3HKDB 1IRXA 3DL4A 1W0KA 2ZWMA 4CBVA 2ZYHA 1X8XA 1SN7A 3U1VA 5FP0A 5CA1F 1BOOA 2VF2A 4PIVA 4BJHB 3GUZA 5C7LO 4WXPA 4CLOA 3W5BA 3HXMA 3M82A 3G6KA 3KU4A 3NWEA 3QTBA 1RM4A 1T5BA 4RWZA 1VE9A 4HB2A 4NKRA 1O3YA 3FPHA 4BNDB 4FFNA 3P9ZA 4CMIB 4I14A 3N7AA 1L4HA 4ROSA 2ZI5A 2AXNA 3HCNA 4ZQIA 1A9SA 1NASA 1E7WA 4C6HA 4CKZA 4FC7A 2EP7A 4Y6LA 3IUNA 4IZOA 1FMCA 3OFNA 4KUGA 3QNUA 1C9NA 4E03A 5A9SA 1V5IA 1VTKA 4U5QA 1K6EA 4UUPA 1VRCA 1PV1A 4DLZA 2ACKA 5EE9A 1KOFA 2ZSEA 5AJZA 4CMEC 4YDRA 2C5GA 2P3OA 2R6AA 2R5WA 1A2KC 5JSFA 1ULZA 1WBDA 4FYHA 2ZVJA 1CZLA 2BCJQ 2NTJA 2VNHA 1H1LB 1L5ZA 1VBNA 3QWBA 4M89A 3PHJA 5FA6A 1P3Y1 2FQXA 3VHQA 2XUHA 4ENQA 3H8WA 4RGBA 2FDCA 1YL5A 2I4TA 3BHIA 3PJRA 3INNA 2C92A 2P5SA 2BZSA 2EEZA 2HRBA 3R0QA 4FR5A 2AQHA 3D5TA 5ICGA 3JTMA 2F4VB 5L4NA 1BXZA 3CF4A 1HYBA 1P4HA 2QP9X 1FXSA 3QPUA 2NAFA 4MRAA 2VC2B 2XYPA 3IT1A 2VYQA 3OX3A 1PJ8A 1T8TA 4ZDJA 3R7WA 1ACJA 1R0LA 2ZI4A 5EESA 1PKXA 4TMKA 3TUIC 1DBVO 1Z4MA 2AEJA 4LYFA 4XSGA 1W94A 5BN5A 5JI3E 2KHZA 1RABA 4M86A 4QKQA 2VHVA 1GQOA 7GPBA 2RH8A 4LFBB 4MO9A 2P6OA 5CX4A 3VHLB 1CR6A 3IUSA 1HFKA 2B5VA 3IHLA 1E64A 1Z12A 4OHXA 1G8SA 4BFSA 4RM2A 2OKGA 3SJBA 4XLZA 3OBIA 2VP5A 4TS3A 2ERYA 1QQBA 1E1RD 3NCHA 4IIEA 1PO7A 4HS4A 3KYBA 5FNZA 3TTXA 1MMFB 5FV7A 4ND2A 1DS6A 3CHYA 4XFJA 2ZAMA 2KMLA 4F06A 2D1TA 4DBVO 5DNCA 3VZPA 3HYCA 1CUSA 4RU1A 3DDWA 5U9CA 1RYHA 2I99A 3KSRA 4OD0A 4P0PB 1YDHA 2PLNA 3RVQA 3CG0A 5F1OA 5A62A 4ETWA 2D2IA 2Y67A 1GL9B 4TL6A 3LVFO 4F5DA 5EP1A 5T41A 2PPVA 2C84A 3D6FA 2AF4C 4M1MA 2CLSA 4JT2A 1LDBA 1Z8FA 1VE3A 2MINA 5CX1B 1VYVA 1WSBA 1GT91 1UDCA 1WY5A 1H5NA 5HYVA 3TRFA 3VYWA 4Z86A 1XEWX 1K2VN 1NUUA 1ZONA 2VQSA 4FXPA 2O7QA 4ABTA 4FMDB 3DAYA 3T3GA 5L6MB 1EFPB 4K3UA 4F46A 1P91A 3O74A 2BFBB 3HVIA 2IH4A 4B84A 1KORA 4JOSA 5EXEA 1JKIA 5K0CA 2O4UX 2B61A 2ZUWA 2GBGA 4UTPA 5D6OA 2Z6VA 3UKJA 2XYHA 5ALMA 4EQ6A 3PPVA 2FNAA 2JFVA 2QVZX 4M8KA 5DLYA 5KKAA 3A31A 3JRWA 2I3ZA 4E2XA 2ZATA 3ESBA 2GM5A 1Z2EA 3K0HA 4DSOA 1Z0FA 2ZR8A 3OJLA 4FFBA 1NLUA 4OOFA 4Y6QA 4R9VA 2GBPA 1DAKA 2ZRGA 4B6PA 4C89A 3CEMA 1LDMA 1UJ2A 3IP8A 3H05A 4ZKEA 1L7XA 1MQAA 2AL7A 2QVCA 4PNEA 1S2DA 2E4ZA 1EUYA 3FCSB 3K1AB 1N33B 2CHVA 4HT3B 3EH1A 2BEVA 2IEGA 3CQ9A 1OE0A 2AOTB 3HGQA 4R1PA 3IIMA 5DFAA 3T3NA 2HBZA 1UPBA 5EE1A 5CT9A 1I3LA 1NNEA 2Y9PB 1QG4A 1P75A 4Q1BA 4C6TA 1ZM7A 2ZUTA 3UJDA 2CNWD 4BAGA 3FDIA 5IDQA 1PR3A 1PEKE 3O93A 5J2TF 3UMBA 4F4HA 2PUDA 3ISJA 4QTZA 2XSZD 1D6MA 2QD1A 4MX8A 1B43A 3U5ZB 5B2EA 1QKJA 1NX9A 4HNSA 4S1NA 4HOYA 1FDIA 2DKOA 3AEKB 3KTOA 1CZKA 5EERA 4BMXA 4TYWA 4PAQA 5AHXA 5DTJA 1HKUA 2UYGA 2B69A 3BWXA 3LXXA 4KODA 1RTTA 3W3ZB 4BKPA 3S28A 1A2OA 5L3ZA 1TTHA 1I4TD 3GB9A 4G25A 4V2IA 1HV8A 2GWRA 3KZCA 2CXOA 4Y8VA 5H3CA 4B8WA 4RVGA 2B7LA 1GD1O 2IUYA 3GL9A 2QY6A 1QPZA 1CYEA 1YDWA 3KKOA 4E5YA 2VDRB 3LCMA 2HR1A 2VHUA 1V71A 2QSJA 3K8YA 1UM9B 1LSOA 1GQYA 2RG7A 3ZHXA 4ESEA 3A3OA 5AVUA 3ZV5A 4L1KA 5K8TA 1RQGA 3QLUC 3HCPA 3SU8A 4UQLA 4ZAFA 1UKAA 4AJOA 4WGGA 2WYUA 3PP8A 4RH1A 4QTTB 1GWNA 1VIAA 2DU8A 3PR3A 4EEXA 5KYXB 3N6VA 3CR7A 3KYCB 2VHEA 3SEQA 1XQ6A 3THYB 2CKDA 1YV9A 4KXNA 1SWVA 1ZMTA 3GN2A 5JI2E 3AV0B 3FPEA 4TWBA 2YYAA 3E8SA 3DAFA 1QQTA 3T06B 3QPDA 5B6PA 4MV9A 2LGJA 3IUEA 2J3DA 5KOJA 1M6YA 1E63A 4C0XA 5HFAA 3WLTA 2HMUA 5FOWA 2X8AA 5EHZA 1DMSA 3PQDA 4CIVA 1QO7A 2JIZA 3JARB 4ITUA 4KYTA 5BQXA 5MGBA 2VWGA 1R12A 2WJPA 3MVEA 4RXUA 3N39C 3ZU5A 3ZYCA 1HRKA 1K75A 1REQB 3WGUA 1U9IA 5KNCD 2CV0A 4MUXA 5BSKA 3X1DA 3LL4A 1WS6A 1CDDA 2PU5A 2J07A 1QFYA 4L2IA 4W5HA 1XZKA 2A5LA 4QICA 4IOKA 4D57A 2G88A 1M34B 3FI0A 3LPCA 4PG5A 3RBZA 3QLVC 4F84A 1SULA 1E1DA 2JJYA 3UNXA 3HJBA 1BMFA 1BN7A 3WYEA 3FMGA 5EWMB 2ZROA 1AK1A 2HV8A 4Z0TA 3V3KA 3FBWA 2HA3A 3DVLA 2A5YB 1UZAA 2CXSA 3Q1LA 1W46A 1XNQB 2ZUVA 3S2ZA 1K8XB 2C82A 1G9SA 5A9RA 4M0MA 5IJ9B 1GTL1 1AKTA 2H2AA 3MTBA 4YCMA 4FR2A 4EG8A 2Z2JA 2A1TS 1RCTE 4KDCA 1A8HA 4FYVA 1FZQA 2OBNA 3NHFA 4RH0A 1Z4OA 1V7QA 1BFKA 2FPIB 5EZ5A 4B87A 1SHZA 1U0EA 3MTEA 3QWHA 3RRXA 3ESAA 3VV2A 4I1PA 4LRYA 4OL9A 4CKWB 2RI0A 3LGAA 5FFMA 1MHPA 2DT8A 4OJNA 1YOBA 3DZCA 4GYWA 1KO1A 1KMHB 3ZVLA 3RAFC 2YYZA 2EYUA 4XR9A 5FLXA 3ZQ6A 4HF7A 3H9JA 4FN4A 4D8TA 4F2GA 3JAWB 1MEOA 2CCGA 4NABA 3DL7A 4PTYA 3VTKA 3ZU4A 4DA6A 1S2OA 3JD4A 3RTCA 5AH0A 1UJ6A 4A8PA 1DI0A 1X0VA 3DBIA 3G2IA 5G02A 3L5OA 2MMCA 2ROQA 3QGMA 4E7OA 4LVNA 3TJMA 2F3UA 2BD0A 3I83A 2XX3A 1BEEA 3TUZC 1W76A 3LK6A 3T52A 4QJ3A 2RONA 1HXHA 5KMGA 1W44A 1GPJA 1S6YA 4EI8A 2O9JA 4LOKA 2BE7A 2ODTX 1TT7A 3GZTB 4NYIQ 2JZOA 4TLLB 3TK1A 1QYWA 3CLTC 3U7QB 1IEXA 2MDTA 3ZWDA 2XXBA 3H9QA 2GF9A 1Z37A 2C5LA 3Q2KA 4JP2A 5K3FA 4WUVA 3UHPA 3NCTA 4F7DA 3EBPA 1H66A 1N5LA 4YLEA 3U1BA 1B6RA 1SEPA 2JHFA 2F3SA 4M7RA 5CFLA 1P4SA 2HPHA 1YDEA 1M83A 1OILA 4Q9LA 3OH8A 5BRAA 2V65A 4K9RA 5IUNC 1G8AA 1X86B 2JIBA 3OMWA 3UWKA 1GZUA 4AM8A 2P8JA 4UUBA 4QGGA 5AKEA 4RA6A 3EC7A 3EIQA 4MGYR 3D6VA 4QATA 3H9GA 5JD6A 4JCCA 1TYDE 3AF6A 3T5PA 3LM8A 4AMUA 4XX0A 2BSQA 1E2PA 1LLFA 3VH3A 3EXG2 3GELA 5BMVB 4HDRA 2G04A 1ZCJA 3HDTA 5LD2B 2QMYA 1O4WA 1U2GA 1ORVA 4I1OA 1XQYA 4TVOA 4X8OA 4DTIA 1WQ3A 4X1YB 3WMFA 3EDRA 4NK4A 1PD0A 2QW8A 3KKMA 3OKPA 2W93A 1Z2OX 4HAUA 3WKEA 4GZMA 1T8PA 1OI3A 1T4GA 3N0TA 4TS1A 1WHTA 5BSMA 4ZGGA 1VOTA 2ATEA 4ZZ1A 1U1FA 1VL0A 1UJBA 2Q1YA 4A2PA 3ZCQA 2OHFA 2XPCA 2K5UA 3AF2A 1NXXA 4DCJA 3TZQA 2ZJAA 1L5VA 2RD2A 4U4AA 2BCGY 2Y76A 1Z0ZA 3WGNA 3CH6A 3W9BA 2PBFA 2H85A 3VR3D 3MSXA 2AN3A 2R9VA 3LZCA 3PBKA 1PEAA 3WHKA 1V5EA 3DO6A 3K6SA 4US0R 1HZJA 1NBMD 1SKAA 3EYAA 4PYIA 3ZYZA 1U28A 2DMRA 1YHZA 4YWHA 4WIAA 1M1YB 3V4VB 3Q5DA 4EF6A 4BV3A 4ZK6A 3KS9A 5JWOA 5LQJA 4G8JA 5GQSA 4I9GA 2RGDA 5K8JB 1IVYA 1BSVA 1XDBA 5SZJA 4F2DA 4IDBA 1HE1C 1OLXA 1YCDA 2NADA 3HDJA 4A10A 5JANA 1QZ3A 3AV3A 3H4VA 3KOMA 4CM4A 2FKAA 3H6KA 1H3EA 3RFXA 3DM5A 3UBMA 3NDRA 3PUZA 4BX0A 1EXDA 1PR2A 3IRVA 2I3BA 5IVHA 4QSHA 1JEAA 4YMHA 1A97A 2HFKA 4OAOA 1KZ4A 3NBYC 1Y4ZA 2EKLA 1C0LA 2XV1A 2ZJ1A 2RBEA 1IBRA 3CRNA 3HZHA 4PLZA 4PG6A 1OLSA 1KEWA 4L95C 2CNWA 5DYWA 4AP9A 4HWGA 2PAFA 2YICA 1E1QD 1XUOA 1KJNA 2AFIB 2G17A 1OBVA 4Y9SA 4DYHA 1D0SA 3GZ4A 4EW2A 1B14A 4JJAA 1P7VA 1WMAA 2ORYA 5FA8A 3CSUA 1OX4B 3AINA 2CK3A 5LA6B 3TGLA 3UV3A 4JMLA 3UKOA 1MIOA 2IYAA 3V1YA 2ECKA 3H9EO 3J80A 1Z4KA 3FTEA 2RHTA 1P44A 4IUDS 1JSLA 1I6KA 1LBEA 4WWHA 3G8YA 4B32A 2F8TA 2E87A 2PKYX 3C8HA 3N87A 4R3NA 2OV3A 3E0XA 1JN0A 1KU0A 2DJ5A 4P3YA 3KFXA 5HM8A 4V03A 1LRJA 2TRSB 2ZS9A 1U0GA 1UC9A 4X64B 2JA2A 3HDVA 3HM9A 2PUFA 1GADO 2O1WA 5I7HA 1OZ0A 1MOPA 2P4EA 2VOJA 1S1CA 4F45A 5CAEA 3TZHA 2J46A 4BLRA 3ZHSA 4LJ9A 4OYYA 2BUCA 1JTEA 3UMSA 3IT3A 3IL2A 4RFSA 2CKMA 3ZU2A 3CX4A 2E4UA 1TJ3A 1PR5A 4TMYA 3U19A 4XDHA 3WKCA 3OQBA 2FSGA 3CUKA 1AA9A 2E89A 3ND9A 2ZIXA 4MI9A 2V4UA 4LDQA 1HNXB 5K4AA 1DL5A 3UAVA 5JC8A 3O91A 2AZ4A 3CZAA 1TLFA 4GXQA 4YCNA 1EHCA 2ZSIA 4K0RA 1NKVA 5H9VA 2NP7A 1Y6JA 5D01A 3CH5A 1CIJA 2ASEA 1ZD4A 2N46A 1M5UA 4X94A 4WJKB 4NV0A 2QW0X 3LUKA 4K81B 4UBMA 2GA9A 3R24A 3FTNA 2Y27A 4NOMA 1U2ZA 5EZYB 4C22A 4EHFA 1O9HA 4ZMRA 4PAWA 3SPXA 2N47A 3K4PA 3L49A 5A9SB 1FMLA 2BFEB 1KARA 1K8RA 2A0YA 2PFSA 2X14A 3L5KA 2DHEA 4TKLA 4URXR 3KTAA 3ZHOA 3T4UA 5FL7D 4CT5A 2GVZC 4POAA 4B2YA 3D1VA 1E1RA 3AY6A 3TKAA 1WX1A 3H2IA 4PC7A 1DFGA 3O4GA 1R5OA 1X7XB 2XNDA 3AXTA 1W6UA 2BF7A 3FPKA 1NPTO 3HU1A 2WUEA 2YNMA 3CLVA 3OJXA 4LMBA 4MAMA 2FOIA 4MB2A 2R4UA 4G56A 1CDOA 1G8YA 1GQFA 4P4GA 1J2UA 4CHGA 5JXWA 3M6MD 3FNGA 4CM9D 3KDPA 1FFEA 1F6DA 3ICEA 1KL7A 3QHAA 1R0CA 3MOSA 4FOLA 4ABYA 1Q14A 2REQA 2WT8A 5SZKB 4D43A 3EVTA 3NT2A 2M32A 3IAM1 4OHUA 1MO3A 4AI6A 5CNIA 2YC2C 3V32A 4LFCB 3DONA 4JVNA 1L7AA 5IK2D 2OFPA 2YHUA 1MT3A 4IP0A 4TYPA 4ZVNA 3RUFA 4BVHA 5H16A 1JIJA 3SLKA 3KWFA 4OHYA 2YUTA 2P5YA 3FPJA 4G5QA 1DEKA 5AVVA 3FDZA 3VNAA 1W4BA 1F4PA 3RKRA 4MWCA 3L7BA 1E6LA 2AQ8A 1ZJ6A 5EE3A 5EQJB 2EX0A 4Q3BA 5CYPA 2H07A 2VHTA 4JYCA 3RUHA 5ICCA 2QJTA 2UYCA 2C07A 3PCRB 5JQGA 3BAZA 3W06A 2QSUA 3WQQA 1C1XA 2Z57A 5HJEA 4M99A 1B8VA 3E5NA 4PFKA 4EG7A 3B1VA 3DR5A 5CB6A 3KQLA 1RP7A 1U8FO 1ZUNA 3TTVA 1UANA 1UCFA 1BGWA 2VDQB 4MHTA 3IPAA 2WD7B 3I01M 3N28A 3BIWA 3H11A 4INOA 3T54A 3WIVA 3TF5A 3WQRA 1KOLA 2HADA 5FYDA 2YIMA 4G89A 4GM1A 3O3MB 3DBRA 4CEJB 3JVDA 1YOVA 4ZK2A 4EHLA 3QE3A 3FPAA 4P7BA 4LSWA 1YB5A 4N0PA 1DWUA 4E7PA 1OOEA 1T9CA 1Y3BE 4NL4H 4FFVA 3D7NA 1XE3A 2H92A 4KXQA 1IN1A 2BL4A 1G5QA 1GGEA 3TW8A 3ZV6A 3D4NA 4TRJA 3II6X 4FUTA 4K6FA 5FOVA 2QUJA 1XVVA 5EPUA 1CS4C 1YB1A 5ED4A 1RYNA 1G8GA 3GJYA 4QELA 4RJTA 4FYYA 4ZEXA 3TS1A 2VK4A 1HC7A 1QJCA 4DCGA 4HLUC 3VTAA 1G6HA 4LV5B 3G02A 1ZR4A 1QVRA 2OHIA 2PKWA 3C39A 4RLSA 3WWOA 3C3BA 1D2CA 2BJWA 4G4IA 4L8LA 1O97C 3GRZA 1AKWA 3ZUGA 4GL4A 4RF3A 1MH1A 3A8TA 1PQYA 4WOPA 3LX8A 4NMWA 5T57A 3ICCA 4HKTA 1JKJA 4UD6A 1F06A 1RQ7A 5HQJA 5IC5A 4AZ0A 2B2CA 2RB5A 3SSMA 4WK2B 3TLGA 4EUFA 1TJNA 2JK1A 2W9XA 3DWEX 4ND4A 2CV2A 4AK9A 3BTUA 3WGIA 3EQ6A 4TV8F 1G3MA 1FU8A 2GNPA 4J7CA 3ZZ1A 2QKYA 4UHDA 5IMSA 2WHXA 3OIGA 5DHPA 3TVYA 3RIEA 1KH1A 1QFJA 1U65A 2IWHA 1GDHA 2VCYA 3U7IA 3H84A 3IXLA 4GRDA 1JJIA 2XVMA 4L4YA 4H27A 5AYVA 4CIBA 5LP6F 2PUBA 4LCBA 4BNGA 5JOQA 2F1HA 2PRIA 2XADA 1WXHA 2QPTA 3FRJA 1E8MA 4KFTA 4MIYA 4R0VA 3J81k 4HWRA 1SC4A 1C7RA 2RGNA 2RKOA 3LUAA 4E12A 4E70A 1NA5A 1U3WA 2BFAA 3G2OA 4X0EA 3USES 2V0GA 1CV2A 1PG2A 2I7TA 3LNTA 1Q7CA 5EWJA 5SYNA 4DLVA 5DOZA 4FNGA 3FX2A 1VGVA 3HY6A 3DNMA 3SJUA 3WP0A 3PTZA 1UFOA 4N9QA 4Y9UA 1Z4IA 8LDHA 1C3VA 1YBVA 4XE5A 1Q20A 1UZLA 2ZUEA 1YB4A 2GZ1A 2VP3A 2GESA 4C01A 5ESRA 3P9YA 4LFAB 3OE4A 3KO8A 2FSVA 2ZRPA 3K9WA 3C3JA 1YR2A 3K0CC 4JCOA 4TYQA 3DAOA 1J0BA 1FQOA 2XB9A 4TV8B 4CM8A 4CM6A 4XDGA 2JZNA 3K09C 3TE7A 4BWFB 5AJUA 3KUKA 5KSOA 2IEZA 1W5AA 2OBMA 4QYWA 2XKKA 3GA7A 4TKMA 4BC1A 3Q3HA 2D06A 1G66A 4E1VA 4PS1A 3UN1A 2O8EA 4IBOA 4MV1A 5GONF 4OVKA 5LDGA 1FFGA 4CI0B 4PX5A 2AN5A 1X87A 3G6WA 1QR6A 3FYSA 1U02A 2NQ2C 4G0XA 3SM3A 3VNQA 1FLNA 5TDHA 1OUMA 1JA0A 4HYQA 4TROA 2WVHA 2E5WA 4DGQA 5JTTA 3NBUA 1W36D 2J6HA 3FVRA 2G9RA 2P2NA 2QL9A 2VL7A 4P53A 2JH9A 3A37A 4R71A 3EUAA 4R68A 1KKUA 4X3OA 5DNYB 4MWSA 1PR1A 4QOHA 5KTTA 3LX5A 4XASA 2ZRLA 1JB1A 2BBOA 2BHNA 2NSDA 3P0EA 3UB4A 1R4NB 4HV4A 2DTDA 1BH6A 3NH6A 5ALJA 5DGCA 3KEMA 4O08A 1MOSA 1SVOA 1CY4A 4MS1A 4X6UA 4DR7B 2Z98A 1A5BB 4QM7A 3SDSA 1HQYE 3F46A 3IERA 4GSYA 3SYTA 3U62A 5JY6A 5DI3B 4MUMA 5ALFA 4BNZA 5TT1A 3ONVA 3KVRA 3STHA 1BVRA 4NE2A 2ZDGA 3H5LA 4HRYA 4GF5A 4Z8YA 1Q0LA 4ER0A 3DLAA 2E55A 4DEYA 4C4PA 1FU4A 4CLDA 1USKA 3QRWA 1DB3A 4B47A 1VKRA 2BFPA 3N2NA 3WQSB 1GR0A 2NUPB 5F4ZA 4F0JA 1UKBA 4O4HB 3GDWA 2VTDA 4L73A 3G7NA 2IPMA 1IJEA 3ZXYA 1QZZA 4GGOA 2ZRDA 4HRVA 3I73A 2VRWA 1CUZA 3QF4A 1GPH1 1U9JA 2HWXA 2QRNA 3CIOA 1EK0A 1CNMA 1GQRA 4S1VA 1L5KA 3PE4A 4DIOA 1QWOA 3LS2A 4WERA 3TFQA 2UZ3A 1PJAA 1UDRA 3OEED 5CH8A 5KOHB 1C0KA 3JQAA 3JU3A 4P84A 5AI5A 3D59A 5AKXA 3X1ZA 2QTBA 4EUSA 2EW2A 5BR7A 1UBMS 2YN0A 5SV2A 5I51A 3P9XA 4RZ3A 5CFMA 3WNZA 1ND5A 5KWEA 4RK5A 2JJ2D 1JYSA 1RRGA 2WSSD 1P6QA 4HH0A 3VSCA 1NXVA 3ZJTA 5TXGA 1RZRD 4EAAA 2R60A 2FWJA 1JIIA 1GDDA 2XYVA 3MAAC 1XI2A 4GP9A 2G28A 5TQ0B 1KI9A 2ZJ4A 4BP3A 3KHTA 3R7FA 4OQPA 5JW6A 2UU9B 1NY5A 4GW3A 3S1AA 3TQTA 3UJ9A 5JQWA 1Y1LA 4DCSA 5CP8A 4DVGA 2FHSA 1O6ZA 1ONBA 4KMOA 3H8VA 3QFFA 1PUXA 4LXYA 5HMMA 4AD8A 1PF7E 4KIGA 3ZU6A 3DTVA 1UDWA 3GT4A 2CK3D 4YGXB 2H5JA 1TYZA 2BHSA 1N0WA 4CM8B 4OFWA 4RKQA 1UPXA 2Q5OA 2WICA 2ZBVA 2CSXA 1CUJA 5LMCA 2ZCUA 2PIDA 3L4BC 3MOIA 2JBAB 3DMGA 3MINA 1RYMA 3NIBA 1G8HA 3OCCA 2J7PA 4YJ2F 2D4AA 2OEPA 3TVDA 4CGZA 1EFKA 1N2GA 1OHHD 2DKNA 3BAFA 3LHSA 4LJ5A 4ZXFA 4X7RA 4M37A 3RDPA 3HU2A 3UJ8A 5CDGA 4IUBS 1RJWA 2HK6A 2QUZA 2I7DA 5IU6A 4PYKA 5KYVA 2IPXA 3KVOA 4KPUB 3EMBA 3OFND 3ZCSA 3DVAA 2HCFA 5IBCA 3ITNA 5T7BA 1Y3HA 4Q7JB 4ZZIA 1QAMA 1YQDA 4M1SA 1BS9A 1Z9BA 1ZKMA 2OAQ1 2OM2A 5DGIA 1FUYB 2NT3A 1NULA 1II9A 2BM0A 3PC8C 4DPKA 1DP4A 1OXVA 1C30A 2EJUA 3I0MA 2Q50A 4YV2A 4JBWA 2GASA 1MENA 2H57A 1RIIA 2ID8A 1T9GR 5C2JB 4YX9A 5REQA 4BIIA 2J9FB 4KBYA 1FP2A 2PTGA 2A1UB 3AOGA 3LZ6A 3NH9A 1DUVG 2WI8A 1EEXB 3VPCA 4L0MA 3WMWA 1CFJA 2GN2A 3THOA 3FJOA 1CP2A 3V6LA 4LYJA 3RT1A 4KVAA 4XCVA 2B34A 1E5TA 2BM8A 1K68A 4RDXA 4YP5A 1ECJA 1H2ZA 4ZJUA 1NX6A 2X0EA 1M2KA 5TF0A 3WBBA 4DN6A 2IFTA 2AG6A 4WXMA 2FEXA 1UJMA 1GAWA 1Q11A 3KB1A 2JGIA 4XPIB 1OXXK 5FNVA 4E33A 3OPVA 4CDMA 4P38A 5A0VA 4HGQA 1JZSA 3FNQA 2IIVA 3BXEA 3JQEA 4QPDA 1ZH2A 2I5PO 3FVVA 3NTOA 3U4IA 4U00A 3TQCA 2G1KA 2FXIA 2WT4A 1CUXA 4IDEA 2YWJA 3FGOA 3HEAA 3HP1A 3IURA 4XM0A 4KXFB 1C8KA 4TWJA 1PT6A 1Z2NX 2PSJA 3OECA 4DHWA 2ZUCA 3N7TA 1RAAA 4M8SA 1BMFD 2Q3JA 3MAJA 3SKYA 2O07A 4TZ6A 4M21A 1OJ7A 4HJXA 3VR5D 4M1KA 2QXTA 1YZUA 1OXUA 5KX5F 1NVAA 4AFNA 1JWBB 3HB5X 2QD4A 4PC6A 3H2KA 1BXGA 1TECE 2RHOA 4P6VF 1QH8A 2FLWA 1MJGA 4NCNA 3N70A 1OAAA 1K08A 1RLUA 2OORC 3DGFC 4YC7A 4LWOA 1P0MA 2AE1A 2ECPA 2IX3A 1TF7A 2XD4A 4TTAA 1FNDA 4HVCA 1K5DA 1T1EA 1Y4DE 3GIWA 3HCFA 3EN0A 4X1KB 2ZUUA 2B99A 4D46A 4DUGA 2ASVA 1JEQA 2C98A 2XE8A 2BGUA 3HN2A 4GH5A 4ZVVA 3W6PA 4D97A 2B7BA 2ODWA 5ECYA 5B5SA 1IB6A 2Q5FA 2ZG6A 2ZLBA 4K9OA 4ND7A 3PI7A 1XR3A 4X7PA 4YLYA 4NPAA 3U7RA 3CF2A 5J4VA 2EJTA 2VPQA 1XEAA 4OEHA 4XB2A 2Y0DA 3UVEA 5U1PA 1AO3A 4DLNA 5IAJA 4C29A 4MW2A 4Q12A 5EIFA 3FHCB 4QNMA 3PIIA 1TVCA 3SXUB 2GETA 5HIMA 1KI7A 1P31A 1RP1A 2P0YA 2QJOA 1NC1A 5A3RA 1Z2AA 2IEBA 5AJVB 1P9NA 4OK6A 4NYMQ 4PCLA 3U7QA 1NVFA 4PXYA 4A6DA 5EIOA 1E6EA 4JBXA 5LQUA 2AXPA 4EZIA 4F4CA 2JI6A 2FG7C 1JQAA 1VKHA 2ZAIA 3DCIA 3KHUA 3QYJA 5ALYA 3DEAA 3OFKA 3RF7A 4Z4HA 1FTYA 3INRA 1B0UA 4W5TA 4QYXA 2YWCA 5JAQA 4M8IA 4EVQA 5E6UB 3ROZA 4EKEA 2BE9A 1P8AA 2BGJA 4RJKA 5TVGA 5J4YA 4HNHA 1ILEA 2O3QA 2JFGA 1XQ9A 1VM6A 1Y98A 1YRAA 2AYXA 2IPOA 2X23A 2PGLA 4GBMA 5E2BA 3UTDA 1NU6A 1UP7A 1UZMA 1SVSA 1FFXA 4G23A 2G5GX 4KN5A 1M9NA 3A58B 4Y18A 4HVTA 4H59A 3FLEA 4IIBA 3TM4A 1A7AA 1EE9A 1O03A 1VKNA 3UJNA 3AVUA 4LCEA 4D3SA 2W6IA 2FRDC 3PEWA 2P1ZA 1P1IA 2I9PA 1BE8A 1XVTA 2RGCA 4N0DA 1N77A 1ISFA 3Q9NA 3MOGA 4WASA 1G60A 3O75A 4LDPA 3V55A 1FDTA 1N3BA 1I0IA 5BY2A 1U5BA 2C59A 3HSKA 3FSEA 2GAJA 3PU6A 1DC6A