2WMYA

Crystal structure of the tyrosine phosphatase wzb from escherichia coli k30 in complex with sulphate.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
143
structure length
143
Chain Sequence
MFDSILVICTGNICRSPIGERLLRRLLPSKKINSAGVGALVDHTADESAIRVAEKNGLCLKGHRGTKFTSALARQYDLLLVMEYSHLEQISRIAPEARGKTMLFGHWLDSKEIPDPYRMSDEAFDSVYQLLEQASKRWAEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ACID PHOSPHATASE WZB
publication title Crystal Structures of the Capsular Export Regulating Tyrosine Phosphatases Wzb of Escherichia Coli and Cpsb of Streptococcus Pneumoniae.
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 55
structure length 143
sequence length 143
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wmyA00
1NXWA 3GL9A 4IGAA 3ILYA 2L18A 4ML3A 4G0XA 2YHAA 4O1HA 1WETA 4RZSA 3FMVA 3QEMA 4YGXB 5KQPA 1S8NA 4H60A 2P4UA 4G0MA 3QEMB 4IILA 4OATA 3RVSA 3CS3A 1SXIA 2M98A 3MF4A 4TLLB 3Q41A 2N9UA 4JAVC 1E6LA 3NHZA 2AYZA 4MS1A 4DQDA 3H5WA 5EWLA 1U2QA 1Z13A 4MS1B 5DLEA 1P2FA 1HEYA 2PLNA 4RK6A 1GCGA 1URPA 5EWLB 4KREA 4MYRA 2H0AA 5CNJA 1QNLA 1U0SY 1EWKA 4GNRA 3K4HA 3IP6A 2QSJA 2QZJA 4RY0A 1JX6A 1QO0D 2FEKA 2GBPA 3O74A 3SNKA 3CKMA 4MS4A 4KQ9A 3GRCA 1NXVA 1BDHA 4MQFA 4FE4A 4D6XA 5IUJC 1USKA 4MS4B 3QX8A 4XFKA 2MSWA 2LP4Y 5KC8A 4G0PA 4MQFB 2FMIA 1M2FA 2X7XA 3Q7SA 1RPJA 1D2AA 2FLWA 1ZH2A 3OMXA 4HNQA 4EVQA 4EVSA 3OLVA 3H75A 3TD9A 4Z4CA 2GX6A 1BVHA 1JYFA 1U04A 4D6YA 1JDPA 1MVOA 1U8TA 4UHKA 1QQBA 3B2NA 2PUGA 3E61A 2R48A 4YO7A 1EFAA 1D4ZA 1D1QA 4M88A 3SM9A 3N53A 4F12A 5KQLA 3F73A 4G0ZA 2VUIB 5BR1A 2PL9A 1D5WA 1EWVA 8ABPA 5JNVA 1EAYA 1NXTA 5FBHA 3A0UA 5C5EA 2QVGA 3QK7A 1DG9A 2R25B 3LKVA 4YS6A 1RNLA 4KNYA 1LBHA 4RDCA 1ZN2A 3G1WA 1GUBA 3IPCA 4F06A 2A9QA 4RKRA 2GKGA 1DCKA 3QLVC 4WT7A 4HYEA 2IYNA 5D2CA 4EVRA 3I09A 4DN6A 4N76A 3CTPA 4FB4A 1ISSA 3LFTA 4NCBA 4O5AA 3TB6A 5DKFA 4Z9BA 1KMIY 4Z4EA 1ZESA 1KRXA 3RVNA 2E4WA 3DBIA 2RJNA 3G85A 3HV2A 3HXMA 4RS3A 4JP1A 4RXUA 3RVOA 2MYTA 3GWGA 1PEAA 2RGYA 3EQZA 3HM9A 2RDMA 4WXMA 1ABFA 2HQBA 2JRLA 1JFSA 4IMIB 2IPMA 1K68A 4FE7A 3DLHA 3RH0A 1MB3A 1L5ZA 3GT7A 2A9PA 3MA0A 2MSKA 4WUTA 3SY8A 5KQGA 4EY3A 2F8SA 2R47A 3CNBA 3CG4A 5KC9A 4MRMA 1Z17A 1FFWA 2FMKA 3JY6A 3UKJA 2YHBA 3EAFA 2NT3A 1GLGA 2IKSA 4ZJPA 3O1HB 4MRMB 2IPLA 2V0NA 3A0RB 1YK1A 1NTRA 1Z15A 2FEPA 3OQMA 4RY8A 2E4YA 3L49A 3OLZA 4YLEA 5BQ3A 5IUNC 1LJUA 2IDMA 3HJFA 4IMJB 1RZRA 1GCAA 5KI6A 1Z18A 3A10A 4W5QA 1GUDA 2DRIA 2JB9A 4MPTA 3DGEC 4KFCA 4EYGA 5ABPA 4ZPJA 3LUKA 2IPAB 5TPZA 2QR3A 3TX6A 5HKOA 2A9OA 4YV7A 1ZAYA 4P1ZA 1PUXA 3Q7RA 4W5NA 2PE5A 3GYBA 4N0PA 3H1GA 3N6VA 3QX9A 3W9SA 3RVJA 3A3KA 3NHMA 5DGCA 3RVMA 3LOPA 5BRJA 1YIOA 5E3JA 4LE2A 3JPYA 1CYEA 2L17A 3URMA 4D74A 4LE1A 1Z16A 3O2JA 1ABEA 4RK0A 1Y1LA 1F4VA 2QW1A 1B00A 1TMYA 4TLMB 5BRAA 3H6GA 3LUCA 5B3JA 5HSGA 3JVIA 4ZMSA 1AB6A 3H6HA 3Q7TA 4G97A 4Y9TA 4W5OA 4KPYA 3OLWA 2CHFA 5F64A 4F8JA 3KLOA 4F3TA 2WRZA 4MLCA 2NZUG 3CHYA 4RXMA 3FGZA 3LTEA 1AB5A 4S05A 2OQRA 1C0EA 4Z4IA 2LPMA 1FSPA 3N0WA 3MM4A 1Z2DA 1M2EA 4WWHA 1YS6A 3M9XA 3O2QB 4Z9AA 1DBWA 2WMYA 2QVCA 5CNMA 4Q6WA 1QPZA 3EODA 4LDAA 1RXIA 3HSYA 1MB0A 5IEBA 3RVQA 1RZRD 1UDRA 1A04A 1XHEA 2XDYA 2FXIA 1FQWA 2QU7A 1ISRA 2FSPA 3KS9A 4EGSA 1DZ3A 3H5LA 3JS5A 3CZCA 3T6KA 1CHNA 3FFWA 4RXTA 3JTEA 3KYIB 4OLBA 4MR8A 5HQJA 1BDJA 1PNTA 5TPZD 1JWLA 2HSGA 3C3KA 3BREA 2E4XA 3D02A 4MR8B 2P9HA 2WJWA 3C97A 1XHFA 2QV0A 5DCLA 1TVMA 1YTUA 4G86A 3ROFA 2WB4A 3H5TA 3RVKA 1P6UA 4Z4GA 2LUOA 4RSMA 5C5CA 5CHYA 2PUCA 1XWWA 1ZH4A 3I45A 3TMYA 1D1PA 2NZVG 1TM2A 3C3WA 5KQMA 1EWTA 1DBQA 1PEYA 2L19A 1FFSA 3D8UA 1USIA 1YMVA 3FFXA 4Q7EA 3F6CA 5HM6A 3I42A 2I6FA 2Q5CA 3CRNA 5FWXA 1M5UA 4QYWA 2LIVA 5TE9A 3HDGA 5FWXB 4OBBA 5JS2A 4IRXA 3OQNA 2LBPA 2NT4A 3NBMA 4O1IA 1JBEA 4S04A 3QLUC 3O2SB 4H3HB 4IF4A 4MLDA 2ID7A 3HDVA 4P98A 3N0XA 5GOTA 4F11A 4YR7A 1JF8A 3KYJB 3MMNA 4EYKA 3NNDA 3SQNA 3P9YA 1PHRA 5DTEA 4Z99A 2PJUA 2B1JA 4RK5A 2VK2A 3L6UA 2OENG 1A2OA 1T34A 2CHEA 1OXBB 2VUHB 2J48A 1E2BA 1R8JA 3M6MD 2ZWMA 2W42A 4RKQA 2FMFA 1QP0A 3BRQA 2FN9A 1JFTA 1USGA 2JVJA 1PNRA 1QKKA 3HZHA 1NATA 3IP5A 2JK1A 4G0OA 1QP7A 4PE5B 3LUJA 3N0RA 3Q9SA 2PUDA 3H5VA 4E7PA 4W5RA 3MQ4A 4WXEA 4OG2A 2R4QA 3CU5A 4L85A 2CD7A 4RK7A 5IULC 4WZZA 3HCWA 4NCAA 2GWRA 4W5TA 1LBIA 1ZDMA 3QLVA 3LUAA 3N8IA 1E6KA 3FDFA 4JA2A 1FFGA 3R0JA 3RQIA 3MIZA 3KLNA 4MAAA 3HS3A 1W25A 1DBPA 5TQ0A 4OLAA 3ROTA 4KK3A 4ETNA 1ZITA 1JHZA 3LUDA 2FTKE 5TQ0B 6ABPA 1DRJA 3RVRA 2HJ9A 4NQRA 4NV3A 4QICA 4KQCA 4QYMA 3SAJA 1BA2A 1SXHA 2B4AA 3OLYA 4RV5A 4KZKA 2O20A 1W9HA 4OTZA 4KRFA 4EYOA 2PUBA 1DC8A 4YWHA 4B09A 4E7OA 3EULA 4G0QA 3SG0A 4JOQA 4ZMRA 5IUKC 5FWYA 3OO1A 2BGGA 4YCSA 1QP4A 2AYXA 1Z25A 2JBAA 3F7NA 5FWYB 6CHYA 3H1FA 2JBAB 3C6QA 4MS3A 5I4CA 2PUEA 1QMPA 4N0QA 1EHCA 4RY9A 4L4UA 4MS3B 3CG0A 3UUGA 3DLBA 3RVLA 3LUGA 1C4WA 3E3MA 1Z12A 3ILHA 1OXKB 1K66A 3OMWA 4YP9A 1MIHA 3EJWA 1CEYA 5JNRA 3GBPA 4MQEA 3IPAA 2ID9A 3I5AA 1DCMA 5EWJA 1JLKA 4H3KB 3QEKA 1YK0A 1A0OA 2FEWB 4DADA 1SXGA 2ZAYA 4MQEB 1ZGGA 4PYRA 3K9CA 5EWJB 5TQ2A 2FQXA 3TO5A 4JB0A 3T95A 1DC7A 1TJYA 3IDOA 4XAQA 3BBLA 3M9WA 1QQAA 5TQ2B 3KSMA 4XXHA 3T38A 5IC5A 1VPWA 2E4ZA 4XASA 4HNRA 3GA5A 2E4UA 1LJLA 4MR7A 5JNSA 1Z26A 3BRSA 3LUFA 2FMHA 3OO0A 5ED4A 4MR7B 4ZYLA 1P8AA 2KYRA 5JNTA 5CNKA 2QXYA 4KMRA 4UHJA 4KV7A 5TQJA 2PUAA 4XARA 4YRZA 5JNWA 2HQRA 3C3MA 3CZ5A 4LE0A 3H5IA 1VKRA 3O21A 4QPJC 3IP7A 1J56A 4CBVA 2PKXA 1SD5A 4RK1A 1JFVA 3H5OA 7ABPA 2F8TA 1H9CA 3MYYA 2TMYA 5CNIA 2FQWA 3BILA 4LZLA 4TN5A 4RU1A 2HPHA 5KWSA 1NXOA 4N03A 5T3YA 4MR9A 5TPWA 9ABPA 4Z0NA 4ETMA 1NXXA 4EYQA 1NXPA 3HEBA 3KHTA 3F6PA 4MR9B 5TPWB 2JVKA 2IOYA 3RVPA 1BDIA 4RK4A 3S99A 1JYEA 3HUTA 3EGCA 1I3CA 2PL1A 4Q6BA 4TMYA 4MGEA 1M5TA 3NNSA 1Z2EA 2FKAA 3EDCA 4JB2A 4PZ0A 2E4VA 4G0YA 2H3HA 2WJAA 2MYUA 3OM1A 5JS1A 1DJMA 3OM0A 4HNSA 2RJOA 3UK0A 5GQSA 1DRKA 4LX8A 4Z4HA 1KGSA 5JNUA 2FQYA 3CLKA 3KCNA 4N47A 3N75A 1RXEA 5EWMA 3DZDA 1DCFA 4KVFA 2MYNA 4PEVA 3IP9A 3O75A 3O1JC 1JH9A 1ZY2A 5EWMB 3GBVA 3KTOA 1YS7A 2MSLA 3KG2A 1F51E 2FLKA 2M1ZA 4LDZA 3LKBA 3OLXA 4GPAA 3DGFC 4Z4FA 3NNNA 2FW0A 2FVYA 4EUKA 2PMCA 5IEJA 4KK4A 5T7BA 3CFYA 1L5YA 5PNTA 2PUFA 1BAPA 1VLZA 1YMUA 2VYCA 3QLUA 1NXSA 4JASB 1SRRA 3Q15C 5B3JC 1QO0A 3QELA 1KRWA 3LUHA 1MAVA 3HO1A 3QELB 2CWDA 4PICA 1ZHHA 1VRVA 2GI4A 3LMKA 3FFTA 1ZGZA 2WWVD 2MYPA 3T8YA 1JL3A 2A9RA 3HK2A 5IX8A 1ZVVA 3KJXA 3OQOA 2FN8A 5IBQA 3VNBA 2PAFA 5FBKA 2JCGA 2JVIA 1E6MA 3HUUA 3VNAA 2WY2D 1LK0A 3H1EA 4ETIA 2L2QA 1APBA 2HQOA 4NICA 1TLFA 1DP4A 2IPNA 3GV0A 3JPWA 3JVDA 3KKEA 4RWEA 3HVRA 1U2PA 1YVUA 3EQ2A 1IIBA 1JDNA 2NUBA 1P6QA 3QLTA 4XLTA 3O1IC 4LRQA 1NY5A 4N41A
chains in the Genus database with same CATH superfamily
3E1GA 2CGEA 3ILYA 1KR5A 2O4CA 4U0KA 1R0SA 1KSGA 5DE3A 4PLWA 3OICA 5THXA 4BC0A 3M2PA 3R7LA 1IN8A 4ZV9A 1ZHOA 1TYZA 3RODA 3K5HA 4OF4A 1AKQA 3FN4A 3CS3A 5EXXA 5DNWA 3PNMA 3B3QA 1Z88A 3ZZTA 2FPMA 2GN0A 3RSCA 2AF4C 4RA6B 5IC6A 1YVDA 2AOUB 1L1RA 1F2VA 4HDQB 3TH5A 2ZRHA 5LA6F 1VCNA 4D5EA 4ZGGA 1NRIA 1I9GA 4CETA 1IC6A 1F0NA 1V8FA 2F48A 3EZLA 4RK6A 3IDZA 2O2EA 3I5XA 5G3YA 5IMBA 4W9RA 1FNSA 4Z5XA 5CAEA 2A2ZA 4I1YA 4XKJA 3CLRD 3QVOA 5G0SA 3UG7A 5A6SA 5JISA 1YQ9A 1EWKA 1PV1A 4UTVA 5LIPA 5E4YA 4GR9A 1Y8ZA 1R10A 3IIMA 4R01A 1LTQA 3AV3A 2OOKA 5BT9A 1J2TA 4D99A 4XCQA 2BF4A 3E3OA 2ZI9A 4MS4B 5TS3A 3CUTA 4XSVA 1KJ8A 4Y0VA 2YZNA 1VDMA 2ZWPA 3B6EA 3D4NA 4QOJA 3KQOA 2AVNA 4MPRA 4DLBA 1X74A 4L4XA 1W5TA 2AEEA 1GPKA 1C9JA 4C7VA 2VDMB 1EP1B 1UK7A 4L8FA 4DZRA 5JI3E 2G1JA 3WDMA 4B32A 2G07A 1T36A 3RUPA 1J4AA 1HTTA 2C3PA 2JJ1D 4EB3A 4L22A 1EFDN 1YR6A 3PF8A 4XIYA 3PEUA 5F4ZA 1R0RE 3VTFA 4EVIA 1DMSA 2Z83A 2PJZA 1ZJYA 3KKLA 2R6CA 1PW5A 3JYHA 3N53A 1XNRB 1MKYA 5CJ2A 1Q7CA 2PL9A 1GKKA 1Q7GA 1TIKA 3W4JA 1P3Y1 3EOZA 4JLJA 1GOTA 4MWGA 3OFNA 4XFDA 1E6EA 2I55A 2MMCA 4LVNA 3VSBA 1DTSA 2IP4A 1LFDB 4KTVE 4BO5A 4KN8A 5IMSA 4ERNA 2OCAA 1I9CA 2WAAA 4MGZR 1CNEA 4IUDS 2FMXA 3P0FA 3UAWA 3K0FB 4D8YA 3TJRA 2WG1A 1KR2A 2IYNA 3B6KA 4JEIA 1HK7A 4K81B 3R6WA 3TXYA 3DOUA 1TF2A 3EDQA 4AKHA 4ISCA 4DRXA 4O5AA 2ZRQA 5D7NA 3TTUA 1EDZA 2C83A 2WK1A 3THRA 5CCEA 1SO8A 2FSGA 2XWPA 4K9LA 4UBOA 4X20A 5ECYA 5FTMA 2R79A 3RV4A 2O0KA 1BQEA 3REOA 4N01A 3BGVA 4RS3A 2O2YA 2IXBA 1QRDA 2PX6A 4S2EA 3JASA 3E4CA 2Q27A 4ZGWA 2H1HA 3JQBA 5D5PA 4LYDA 4ND8B 2QD5A 4LV5B 2HRQA 2FSVA 1Q0TA 1K86A 2WM9B 1GO2A 1P0QA 2XB4A 2XCIA 1AKYA 1C8LA 1Q0PA 2ZTLA 3HDYA 1XZBA 2Z4RA 3KPWA 3M8KA 1J2JA 4U3JA 4EY3A 5KQGA 1KWGA 4YJFB 1VJ5A 1IPEA 2FSUA 2LV8A 4OQNA 2VXYA 4FWIB 3GROA 3MINA 2P69A 3D5EA 3NC4A 2Y71A 3NBXX 1WMBA 3GJ4A 5JCJD 4ZCMA 1Z15A 2FEPA 5AVYA 1OF1A 3M4ZA 4Q7JB 3IP3A 4QQFA 3WBJA 5CYOA 4B33A 4KFTA 1CS4C 5HCUA 4BFUA 2PPVA 5K0FA 3TCNA 4G23A 2P9ZA 4LHYA 4B46A 1OXXK 3DAHA 3IL2A 1GGEA 2OVFA 4EGQA 3AL0C 3RK4A 3GQBA 1Z6TA 2A33A 5LMCA 1VIVA 3VR3A 1MRNA 4C7KA 1DKMA 5EG5A 3A2LA 3OCCA 4PC3A 4ZPJA 3U3DA 1KIMA 1USWA 1DO8A 4RLFA 3FCYA 1MEEA 2A9OA 2ZJZA 2R6ZA 1XV5A 2NP6A 1XJQA 3KC2A 3R40A 5G40A 2IZ5A 4KN5A 4MB0A 1Y1SA 1E1KA 2OHHA 2QPTA 3L0YA 3OHPA 3H1GA 4JJAA 1QHNA 3A3PA 3PT5A 1UBTS 4D25A 1VC2A 3G89A 4MA4A 4H2DA 1XJCA 4R69A 4RBNA 1BKSB 5HQ3B 4R8KA 1HNZB 3C8HA 1A9XA 1CYEA 2L17A 2H48A 3DLTA 1MO2A 3ZDEA 4REQA 4F4CA 5IC4A 4TTRA 4RH3A 2QNRA 5CH8A 4MROA 4MVJH 3GNLA 3H6GA 2VTBA 5CIQA 3RK0A 1F20A 1XIVA 2QRLA 3H6HA 4LXUA 1CD5A 3RAEC 5EZQA 2PLAA 4E2WA 1XHLA 1ZUNA 5KDOA 3ZDAA 3DEZA 5B7GA 4YN3A 2A35A 3BM5A 5F64A 4DR2B 3CB2A 4YUXA 3KLOA 5H68A 3MHPA 1KYTA 2QYSA 3WGMA 4MWZA 1RC8A 1BD3A 2O8VA 2HBYA 4MUJA 3FI9A 5AH0A 3ET4A 5KYWA 5FCDA 1X1DA 4WTOA 5CK5A 3QY0A 5K01A 4I8IA 3IJPA 1U3DA 3LT4A 4B2LA 4WBSA 4X6YA 1HDRA 4UASA 4XQGA 4Y6OA 3KEMA 1W34A 4P81A 5ECGC 3AFMA 5TT1A 3TZCA 3G8AA 3A7DA 2HPZA 2P27A 5GP1A 3KQSA 1SAYA 1SXJD 4QASA 3OKPA 4KI7A 1OX4A 4J0JA 3LRXA 4ALKA 3GNSA 4NG5A 4QL3A 4FMCF 4XM2A 3TQCA 2XMGA 1AHNA 4CR6A 3QLJA 1WWKA 5BW6B 3SC2A 1RYFA 5HZHA 5JS6A 2FXIA 2QU7A 3PIDA 1R74A 1L5SA 3AEUB 4JR2A 4X7MA 1D7OA 4HNHA 5IZCA 1QHFA 2ZBPA 4CTOA 3ICOA 2WINI 4E4TA 3ON5A 3DB1A 1QDUA 2BWJA 3PI7A 4AJEA 4M1WA 4PX2A 1DELA 2YKGA 4IV0A 3BREA 4QJ4A 3UMBA 3I39X 5K0GA 4IFIA 1ULBA 1M1UA 2WJ4A 4DCJA 1TVMA 4HQRA 1ZM3A 3UC5A 1C3LA 2QEQA 1F3LA 2ONKA 4IG4A 4QNMA 2VHUA 4IMRA 4A91A 2CLLB 4FCVA 4PFSA 621PA 3HH8A 1WKBA 1ECFA 4JL6A 3TMYA 4I99A 2I4NA 2IS6A 3UJAA 2DQ4A 4EA6A 1FNNA 3R44A 1QX4A 1SU8A 3PENA 2VBFA 2VDWA 1P31A 3BIXA 4YGYA 2NU6A 4XDYA 2IXAA 2VDKB 2ZI5A 3LU1A 4UREA 2QL5A 2WFZA 1Z5UA 3HGTA 3I01A 1KZ6A 1REQA 1VA4A 4GUAA 3R4VA 1C1YA 2G80A 1P5FA 4BECA 3ND8A 4UATA 4JBNA 1R6XA 5JDCA 4O1IA 1RZVA 4S04A 5ALMA 1RE1A 5T4HA 3RC8A 4H3HB 3HDVA 4QU0A 4H7IA 2Q4BA 2YXDA 5H9VA 2WD7B 3NHUA 2IU0A 4RGQA 1ZXBA 5HYVA 4GMFA 3LYAA 4MHOA 4KEAA 5LQUA 2X1MA 2R6R1 3QE4A 3TFQA 4PLZA 5EJAA 2R60A 1EVJA 3HXQA 2VUUA 3G5UA 3T4XA 2AX3A 4N39A 2VZ9A 3COPA 3DAPA 4Z6KA 2Y66A 1FJXA 1OI4A 3CUKA 3DZHA 2VXBA 3U44B 4FFVA 4WIAA 4ZOLB 2G8NA 4L07A 4EEXA 3RYCA 1JVBA 1W5SA 3R3WA 3OBBA 2J7PD 2VUTA 1FZQA 3C15C 5FA6A 3KSRA 3TR0A 1YRAA 1WZ2A 1RRFA 1OT5A 3K09C 1IY2A 1UDWA 3L8HA 3Q7PA 3KBBA 1GNQA 3MQ4A 4WOPA 1QF9A 2QVYX 4RJ2A 1E2IA 1UPBA 4IOLA 5AJTA 4NABA 5A7GA 1DX9A 2NZWA 3HN7A 3SQMA 2NUAB 3SHFA 4PSKA 4DLLA 2WWHA 3PRJA 4Q3NA 1KP2A 1BG6A 1KK0A 1NN1A 4PXSA 3N6RA 4A0HA 3R0JA 1JAHA 3CZ9A 4K1LA 4Q4AA 3NVKI 3MQFA 2G40A 1EUCA 4ID9A 2X0FA 3M1IA 4LBZA 4BXOB 1YL6A 2BCGY 3RFXA 1PP4A 4BO6A 3QRWA 4X1IB 1Z5VA 3RWOA 1G8HA 2PX8A 4RZHA 2ZROA 1ZITA 1YDHA 4HSEA 1G2IA 3LUDA 1A9ZA 1C9DB 1OTHA 3AIIA 3ICPA 3OD1A 1NUQA 5DASA 4K6FA 3RYTC 1RXYA 2XQJA 4F4FA 1STOA 4TTPA 1K5GA 1SEVA 3AT1A 4WK0B 3VU3A 4QOHA 4ROTA 3HP4A 5IDWA 4RCYA 3QA9A 4NV3A 1SG9A 1XZDA 4HS4A 4R84A 4KR9A 3WRVA 4RULA 3VTZA 5KWEA 1RHRA 1U99A 2O8NA 3BJRA 4HXEB 2ORIA 3LO5A 2XNDA 2I6UA 2XTMA 3SXUB 4EYOA 1Z73A 3QPVA 3PWZA 3GZ4A 4CMKA 4DQVA 2O8EA 2WSYB 3CWQA 1JECA 4ZMRA 1XQ1A 3WMXA 4MAMA 4KQIA 3KXPA 4E5VA 1U8ZA 4YDQA 1TYCA 1E9FA 4TMXA 2FV8A 2W6CX 5JWHA 1NBOA 4BMDA 3TLEA 4OOFA 3C6QA 1TT7A 1IXRC 2FZWA 3W3AD 2BGMA 4JVOA 2XWSA 1DG3A 4HDCA 5EPUA 3QP9A 3RC1A 5MN4A 3WJAA 4MS3B 3DZBA 4PZAA 3LC0A 3LA8A 4KKVA 1MR3F 2PFKA 3LUGA 2RGAA 3ISVA 3QKIA 4QXMA 1IVSA 2C9MA 3PQ6A 3OT1A 4BRZA 4BKRA 3WISA 2BF7A 2QTRA 4BV8A 2BGUA 2QSUA 4RPJA 1BHJA 1P75A 2PS0A 1M3SA 1UR5A 1D2MA 4AJ2A 3HY6A 3PL1A 5IYZA 3MVEA 2BEVA 4D8XA 2BTEA 1YJXA 4U7GA 3IURA 2EEZA 2PKEA 3ABOB 4MKIA 1B42A 2WNIA 3AB3A 4WZAA 5FOWA 2W2XA 3IQGX 1VG9B 2C9ZA 2QTNA 4I1VA 3T38A 2GARA 2XD9A 1YJ5A 2AF3C 2E4ZA 3DTVD 3EIQA 3MUNA 4KXWA 5DTQA 5B7NA 5CG1A 1UEJA 2DG2A 3H11A 4EF5A 1XF9A 2FE1A 1PS8A 2JBHA 4WJZA 5CYFA 2ZIAA 3RIHA 2BUCA 2NG1A 4IOMA 2JLBA 2Q5OA 4IEFB 3W1WA 5B4UA 1BFKA 1ZI6A 4KFRA 2G5TA 1QV6A 1MVNA 2FETA 1HOXA 1DOAA 3FTDA 4RACA 2BSQA 3QOFA 1OH7A 2QTMA 3A2NA 5JWRA 1RQ2A 1W2GA 1IB6A 1Y1TA 3Q40A 2DFDA 4A9AA 1QHHA 1J20A 1ULAA 3VKHA 4RTQA 3ZHTA 3ILXA 4LJ6A 1Y5RA 5FTNA 2HCJB 4RQAA 1QSGA 3NORA 3ZWKA 1J56A 1XYGA 3OTIA 3KZXA 2XUZA 1Z4JA 1IG3A 1OX6A 4GOXA 1E3IA 2N75A 1ENYA 1LV7A 3D3NA 3AY0A 2TMYA 5IJZA 2P4QA 4ZK6A 1N3IA 5T3YA 4UQOA 1HYEA 2D5AA 4BVEA 3AJEA 4U8GA 4YMIA 1M2HA 3KXDA 4TXNA 2WJGA 2ZIGA 4R1SA 3RTEA 3OEYA 4FS8A 3AKCA 4QEZA 4BWGA 1PSZA 2DPLA 4KR0A 4F04A 1DIBA 4COKA 4MGEA 1OA0A 2VF8A 2C96A 3I9JA 5EZ6B 3A9CA 4H7PA 2WJ3A 2FJUA 1RAIA 2O6LA 2XCUA 2GTPA 1M8JA 2QUBA 5F1PA 3OM1A 3QXJA 2PBFA 3B5IA 3GJ0A 3GUVA 3P0EA 2HEIA 3IO5A 3GXOA 1Q74A 2HBZA 3K8ZA 4KXNA 5I7AA 5B37A 2PNJA 2WQ6A 3EOAI 2H2FA 3SKXA 2EJBA 2ZJ4A 3K5WA 2ZBVA 3MG9A 4LSMA 1Y6FA 4TMFA 5CEFA 3PUZA 4YUVA 3ZDFA 3K92A 3GRAA 1KE2A 1A9PA 4EAAA 5D6OA 3ITNA 3ZXYA 4HDSA 5JC1A 3KVOA 3ZVKA 3M5CA 4HVLA 4D9KA 3X44A 1JHPA 4HL6A 1HDEA 4OH1A 5GMOA 3HJTA 1K7EB 4F56A 5AI8A 1BEZA 2WF6A 1Y4UA 5PNTA 5AW9A 3F46A 4G9GA 3E5NA 1C9KA 1CXZA 3GJTA 3NBFA 1UBGA 3TE6A 4IZ6A 1D0SA 3FWKA 2FPGB 2X4LA 1KH3A 3MJVA 3OPXA 5K5EA 1NNEA 3HO1A 2C4VA 5EN4A 5TR9A 2RHTA 4X44A 1GFWA 1XU9A 4K9KA 3FFTA 4LDNA 3IA2A 4OJNA 3T8YA 1Z63A 1E0KA 3VVBA 1FFYA 1SC6A 3JQFA 1AQNA 1E2KA 2HDHA 5FBKA 2ONZA 1K8YB 2EG5A 3UOWA 4IGEA 4DCPA 5E9AA 1NLYA 1IU9A 2QTWB 2YFYA 4BATA 4LF7B 1GL6A 3P32A 2BONA 1DBSA 3T3OA 2OO5A 4AF7A 2QPLA 2VJLA 3GV0A 3NIWA 4J7UA 1BC5A 3ZZMA 3F90A 2YHIB 3I83A 1M83A 3HDHA 3NYIA 1R4ZA 3EQ2A 3I1IA 4IINA 4E12A 1W4BA 4EJMA 2YZMA 1JDNA 3LCCA 3O4IA 1YQEA 1Z5PA 2JFHA 1P0MA 2FPOA 3JZMA 4XGQA 1L1FA 2RGCA 3GU3A 1WR8A 3D8SA 4M1ZA 2VEOA 1PL6A 4DCGA 3EUEA 2L18A 5AK4A 3K0AA 4JVSB 2ZUVA 4LK2A 2A84A 3K9GA 3I05A 2N47A 3HJUA 2WICA 3OF5A 2NV2B 4R51A 3LO8A 3QH4A 3TW0A 2WJPA 4DV0B 3QEMB 2BFAA 1SEPA 2X2OA 3KJNA 3QWAA 2HRBA 2X8JA 4K6CA 3NLLA 3WYDA 4PV7A 3T5CA 4QUIA 4AY5A 2QMQA 2WF8A 1KO1A 2XE7A 3BXPA 2DGDA 1OYWA 1PFWA 4I4CA 4Q9NA 2A30A 4R4JA 1GVHA 3R5XA 5H81A 1FBTA 1KY5A 1QZXA 2AC2A 2DBVO 2PWZA 3P4XA 2PRIA 3LAWA 5E3HA 3VAYA 4ZFNA 2FRXA 4D9BA 1L4FA 4ASUA 2VR1A 1BE0A 3GNQA 3H9UA 1IUOA 1OC2A 1TK2A 2A5FA 2IGBA 2XJ4A 2YXLA 4R3WA 2QLJA 2B3TA 1PTJC 1WQ1R 4JENA 3O74A 4JHLA 3SFVA 3V7UA 2X42A 3X1ZA 2XMPA 4KQ9A 4BNDA 1RTKA 2CBZA 4P34A 3WLTA 4J94A 2XHEA 3R7AA 3SY8A 2VXCA 2H7CA 3F9RA 4NJMB 2Q8PA 3EA5A 4PTYA 4TTSA 4MQFB 1RPJA 5SZIA 3TUJC 4EVQA 1U7UA 1UEXC 1JAXA 1HM5A 2C04A 2GX6A 4QDOA 1QV9A 2N1MA 3R7FA 1A9TA 1WCIA 2BAGA 1Q20A 1L4KA 1MVOA 4Q24A 4FGKA 1J39A 5MGBA 3AWDA 3GCDA 4O2AF 3KWMA 1NQXA 4HOYA 4M0LA 3M1YA 2FVXA 4UE6A 3ABZA 4E15A 3EXFA 5F77A 5KTMA 4NMLA 3K96A 2B4RO 2ZKLA 1HNXB 1D5WA 3L7JA 1WPGA 3T5MA 2OCXA 1GN8A 5IJ0B 1DOHA 4X1YB 4ZIRA 5C5EA 1Z6XA 2AN9A 2QVGA 3GRVA 3W77A 3IAM1 1RNLA 3RLFA 1NQAO 3L05A 4LXQA 1XFDA 4PHFA 3GFQA 1CLEA 1SURA 1QVZA 2CXSA 2OECA 2WSBA 5E3IA 3TL2A 3V8NA 4QJIA 5CBKA 1KEKA 1R64A 3M0EA 3AFNA 3BRWD 1ISSA 221PA 3AGQA 4HATA 5K3BA 3ZX4A 1K7CA 3BFVA 4L02A 3ED1A 4PPNA 4WXHA 3AUJB 1J8YF 2DF8A 4O4IA 2NO0A 5LXTB 1I2BA 1XCBA 2XTAA 3B1YA 1TQDA 3HV2A 3K9WA 3HXMA 3M6AA 3HBMA 4CV1A 4WXMA 4KRYA 4QUHA 4URWR 4ND6A 1KZ1A 4IICA 1MO6A 5GV7A 6YASA 4GZ5A 2O3UA 1QB7A 4E6EA 4UDNA 3KWJA 1YOVB 2R47A 3C4JA 5FI1B 4BZXA 1PFUA 1BGVA 3DO8A 3PUVA 1QQ6A 1FTGA 1N2XA 3V4ZA 1N6HA 3IAM6 4FYKA 3CXRA 4B6JA 2SCUA 5IW8A 5U9CA 2EJVA 4IDNA 1OWOA 3QPUA 2HJHA 3K94A 4I4IA 4OMFG 2EP5A 2BHRA 5HIAA 3OKFA 4U2GA 5CH3A 2X7HA 2IDMA 1RM0A 1F0YA 4J4BA 3OEHD 2M6KA 1FYXA 3AEYA 3FD8A 5ESRA 3FTEA 5DSZA 5DPMA 2RAVA 2EKZA 3EPHA 3ACDA 2FPSA 2HV8A 4L0CA 2R4UA 5KSYA 3COWA 4RE6A 3BHIA 3GRKA 2H7YA 3TLAA 5JJBA 1UDBA 2A1UB 1TADA 3OF2A 1KMCA 2B83A 2GM3A 3KCQA 1EUZA 3ZDYB 3U7QB 4R8VA 4BGEA 4LYGA 4M1KA 4GQIA 3ZV6A 3T7CA 2MMGA 1GRCA 1KI9A 3YASA 3O31A 3SJCA 2M6RA 3U81A 3IJ5A 5GOZA 3DV0A 4DMCA 1CX9B 4PBSA 2FFHA 3JQ8A 1GZHB 4CMHA 4A8TA 3BJMA 3T5TA 1SA0B 3AL3A 1AC5A 2F59A 1N6IA 3DVQX 1UKVY 2Y1CA 1SKAA 2BZ1A 3VKUA 4DUGD 4ZEVA 2JGDB 5G4KB 1T5HX 1O6ZA 2D8AA 3NEPX 1QR6A 1P44A 3BWBA 3EY4A 3O2JA 1PQYA 4PWYA 5AHXA 5SZKB 2A0WA 6LDHA 1TZBA 3FDJA 1AZLA 2IDZA 4YAGA 1ORIA 1CWUA 3ZU5A 4DR4B 3V46A 4U9UA 3ZE0B 1PV4A 5B3JA 5KAPA 3AZQA 3TEMA 3WC4A 2IZ6A 4RWZA 1ZNWA 4G97A 3L1HA 3FMGA 2Y8EA 1JEAA 4W8GA 1RJWA 4NEQA 3BZUA 2W6QA 2EJTA 1UWKA 1N7HA 4D0LB 3L0SA 3TIIA 3OM9A 5DJ5A 2O59A 2KB0A 2NZUG 1L8OA 3JQGB 3FGZA 5LMNB 5JEDA 1XTRA 2R8BA 1KAQA 1MABA 1TAHA 2P6NA 2ZIVB 1E6CA 3ESQA 4NONA 5C8VA 4YXFA 3HUDA 4CF3A 1SC3A 2E5FA 3DFKA 1E2FA 1V1MB 3FPLA 4GECA 2FPWA 3BMOB 1RKXA 3FPSA 3M9XA 2YVKA 4QOFA 4JLBA 1PUJA 5ETJA 4D3ZA 4ZYUA 3QE3A 4PZ9A 2R00C 2IHBA 2F7SA 3LPMA 4CEHA 3DJFA 4F8EA 2GB4A 3B6MA 2B4TO 2RGDA 3AR6A 3PL5A 4DDUA 3ZGXA 2WABA 4UZEA 3SMQA 3VNRA 4FGLA 2ZDQA 1IZ0A 1RLJA 1OFHA 1ZWKA 1HTBA 2OAQ1 2XA1A 3F5DA 4QA9A 4QJ5A 4RXTA 1CIPA 4YAOA 5T8KC 1JDTA 3DDSA 4NNPA 3WLAA 5JQWA 5F33A 4RTJA 5K3SA 1GNRA 5HXAA 3ETHA 4ZMBA 1RYBA 2Q9CA 1PYOA 4HDKB 3S6JA 3UAOA 3NFYA 1FW6A 4QNNA 3NBUA 1IBKB 4RTMA 2PSJA 3GLSA 1GFIA 2Y67A 3T1OA 5K03A 4RFVA 5CM2Z 3R9WA 4B3GA 1TPZA 2AFHA 1PWYE 2JJ2A 3PHLA 4WY8A 5SYMA 2IKQA 2VP4A 4H3SA 2Z2ZA 3I6YA 1XWWA 4RZUA 4UXJA 1Z0IA 4IV5A 1QCCA 2AGVA 3O0TA 1GZDA 4HG2A 3QYFA 5M5BA 3K2EA 1BDMA 1KEEB 3DMPA 4IVPA 2X13A 4RIFA 3ROEA 1U7TA 1YE5A 3FFXA 5BN3A 4X64B 2QUZA 1BN7A 2I6FA 1Z0SA 2PXXA 3WADA 4EYEA 1HY3A 2PKYX 2I7DA 3U17A 3R6LA 5BV1A 2JFGA 5E9QA 3EXEB 1VE7A 3B70A 3N58A 3S8MA 3CV3A 3M9LA 3PD7A 4NBNA 1VJGA 2YVAA 1KZ9A 4Y2GA 3WL6A 1KU6A 4CIBA 1A96A 2OQIA 5K4AA 2XNSA 2FZKA 3LQQA 3RRNA 3SQNA 1IUKA 2YOHA 1PHRA 3TSOA 1NF3A 3CPJB 2O8FB 3G2OA 2WI8A 1F8GA 1AUQA 1YB5A 3AR7A 4KO3S 3UW3A 3CX7A 1UJ6A 3C1AA 4OYHA 3QPBA 2YXNA 1E3QA 2WVAA 1RQPA 3E22B 2EDCA 4S24A 4DIEA 4IQGA 1T1IA 1S96A 3WGVA 3AW9A 4BU1A 5K4HA 1Q50A 3NC0C 4A2QA 1G1AA 1N0HA 1Z7GA 4G2NA 3O4VA 4MUYA 5DO9A 6AT1A 4P5EA 5JSZA 4FBGA 1JG6A 1G5QA 4GFDA 5K8UA 5BUZA 2OILA 4TV9F 2GBFA 3V1TC 1G5IA 1GPDG 1XQVA 2Z2IA 3AETA 1FVXA 1T2DA 3DHYA 3HCWA 3ITEA 4R81A 1FNBA 2HC9A 3N8KA 4BFVA 2CNDA 5IH3A 4KIUA 2B1QA 3B1KA 3RNLA 3I2JA 2CLKB 1GGHA 4BQEA 2X0IA 1IQ0A 1R9GA 4IHAA 2B37A 2XQFA 4NU6A 3NVAA 1XZMA 3VAZA 3ORFA 3BTUA 3HS3A 2BGNA 2BV3A 2OGUA 3K6RA 3NV9A 1YHZA 4IJ5A 4O2BB 4IHKA 4AS2A 4URUR 1U0EA 2AK2A 2PT9A 4NFSA 3DWGA 4GYKA 5ULLA 4EPVA 3V32A 3HVHA 5FI3A 3TO5A 3W79A 3GUCA 4DIDA 1PR1A 4DV1B 4QAJA 3ZCVA 4F72A 1DPGA 1C3OA 2I3DA 2H7XA 1K6EA 2HJ9A 5MF6A 3B38A 1KZHA 1BA2A 3R8XA 1DKOA 2E49A 2QMEA 1UJMA 2JI4A 3CEAA 3K73O 4DLXA 4IVQA 2O20A 4US2R 5GONF 4RKFA 4OTZA 3FROA 5LYJF 5FPKA 4QPPA 3R9XB 4PZUA 1IRIA 2PH7A 2QP3A 3HVIA 3R3XA 4Y2PA 4DMGA 1CS0B 1GAWA 3NU1A 5GM1A 4K6HA 3U7RA 3RIGA 3U6KA 1EFVB 3AUKA 2CNKA 5JR3A 3CUUA 2WR8A 1P1JA 3B78A 1ZCZA 3ORSA 5KVSA 3RS3A 2NQTA 2QTTA 4OJTA 5K05A 2UZAA 5CR9A 1XVVA 1SUAA 4R1TA 4WBNB 2JL1A 1FTNA 4POAA 3VX4A 1SIBE 2H9AA 2BFFB 2EP7A 3ZU4A 2ADOA 1BX1A 4LQCA 1GWNA 2BFOA 4A15A 3TL6A 3UMFA 5DBHX 3B36A 2R8EA 4KDEA 3F8TA 3IRVA 1H1TA 4ZDKA 3BXHA 3STWA 4HRVA 2YZGA 3A1TA 4Q12A 3WTBA 4OAOA 3CRMA 1OU4A 5T5QA 1S7GA 2FFAA 3IPAA 4LYEA 1DCMA 1IUPA 1Q0HA 4MAAA 4N18A 2CXTA 3ZGVA 3V5NA 3ZGLA 3PRHA 2R8XA 1C50A 4F84A 2CE2X 1U8FO 2DFTA 3QJYA 5HIIA 4MHTA 5EWJB 4JB0A 4OHRA 3PHGA 4MGHA 1N2CE 2PBLA 1RRGA 5K09A 2I8LA 4JP8A 3H86A 1J70A 1NG1A 1ZUWA 4DLKA 3O95A 1I3KA 2BFBA 1PZXA 3GFRA 2WLTA 3ISJA 5AW6A 4QDKA 3ZS8A 5HBGA 4C78A 5ED4A 4WRRA 3KHKA 4FC6A 5A7HA 4X62B 2PXHA 2RHWA 2XVAA 3U3KA 2RH5A 1H93A 2Y1XA 4AQDA 7ADHA 2QAGC 2QX4A 3JQ7A 3M6VA 1GTSA 1J0XO 3ZWDA 1LGYA 4OYRA 4LE0A 1KDZA 4GQBA 2PTGA 1E1DA 4M22A 3ZWVA 3EHEA 4MVJI 4F97A 1UL1X 3O21A 4IHJF 3LRPA 1YO6A 3FVQA 1WBDA 1LDYA 1TJ4A 3NBYC 5CB6A 1HE4A 1LEHA 1EJ2A 4AMUA 4CBVA 5IU6A 2UUBB 3UCFA 3IMFA 4OQDA 4P4LA 2ODQA 1Z7WA 2W8BB 2OVBA 3BIJA 3KZNA 4H1HA 4MDYA 5BURA 1W0JA 1E58A 2RK6A 1FFCA 2IJGX 3EF3A 4PW0A 4E3WA 3E03A 1NXOA 2TMDA 4RZXA 5HMLA 3ZV7A 4DBVO 2P91A 3N2KB 1GQSA 1XB2A 2Y4OA 2WSSD 3P1JA 5JRZA 4AVYA 5JAPA 1C1XB 2VQSA 3RSSA 4AY4A 4TMYA 4FBMA 4HEHA 2JW5A 3VU9B 3GHHA 4PRYA 4OI1A 3VM6A 5ALJA 3UA4A 1V16A 2IY9A 1ELOA 1SM4A 1XEAA 2W83A 1D9XA 1NW4A 2QTCA 2WWWA 2X6QA 1M6WA 2YWEA 4YMSA 3SIXA 2CK3D 3HKDB 2O50A 3SF0A 3WYBA 2YUTA 4K9NA 4Y0AA 5MGNA 2C2BA 4EI9A 4IXTA 4ABYA 1ZOPA 2VEDA 4B3CA 3KCNA 1P6XA 3AGPA 4XD2A 3RC7A 3G68A 2J3HA 2IYRA 3BGWA 4Q47A 4QLOA 3SZLA 3ZDZB 1W75A 1DCFA 3HCAA 1JILA 3OC0A 4PEVA 4BCDA 1F17A 3O1JC 4MUIA 4IQ0A 1RIFA 2EATA 3HHPA 3PQ2A 3V1KA 4HO1X 4TYWA 1N8SA 3NW9A 5JSKA 3O92A 1VBKA 4QJ3A 3PV0A 1DJQA 2W6IA 3WYGA 1OWNA 5LBTA 5TGDA 2ZBDA 1J6UA 1Y80A 4JUFA 2QF7A 4I1UA 4JI4B 4KIJA 3NUZA 2IW1A 3TRHA 1ACLA 4IJUA 4TV8B 4JASB 4ZC1A 3RD5A 5JBQA 3UMMA 2QI9C 3GJXC 421PA 3B8HA 4GPBA 2C84A 4G4JA 2FPLA 2RB4A 3IQIX 4F5EA 2XKKA 1DI0A 4B6OA 3VKGA 1GTJ1 3LPCA 1JHDA 3D5QA 1K6JA 2W11A 1YR3A 3WYNA 2V1XA 4B3XA 4YP0A 4Q93A 4FFMA 5IX8A 3HJFA 4ESOA 3E23A 2JCSA 1GQQA 3INYA 4PQGA 5DOZA 3TJMA 3NANA 3L4BC 2EKBA 4YMTA 1G5TA 3HZZA 4JBLA 4KC0A 1E6MA 2R8PA 2XQKA 3GD7A 4MTCA 1CUBA 5U4QA 3GLRA 3HA7A 1EJBA 1D0IA 1ZKMA 4V02A 5DI3A 1APBA 2Q5LA 5KTSA 1DP4A 1J2EA 4KUEA 3JQEA 5JMTA 3KSBC 4R0MA 1QYVA 2KM1A 2XECA 5IF3A 4LYFA 1YVUA 1EFPB 5LZ4A 4BVGA 4RPHA 2CY0A 3DAYA 4OCZA 4X8MA 1M2VB 1F60A 1NUHA 2XX3A 2RH4A 3UNXA 3NYQA 4F6RA 3O1IC 5EQTA 1DSSG 3T34A 4KRGA 5KB3A 2NU7A 4BN0A 2XXAB 1GY8A 1KI1A 1NONA 1YQTA 4I46A 5BV0A 2XKBA 4U6NA 4O3MA 4DLAA 3CT6A 4AROA 4O1HA 5KU7A 2C2YA 1MBZA 4UUOA 1WETA 3M6XA 1H6AA 5EVJA 1QFXA 3SN6A 2ISQA 1KTIA 1BD4A 5CFLA 5EGNA 4HGYA 3OC6A 2P9FA 5IZ4A 4MB6A 2P5YA 1Q1QA 1XZNA 2AQHA 2F43A 1W19A 4LJLA 4UD6A 4ACBA 3MD0A 3LY7A 3Q41A 2WDZA 3COSA 1E2LA 3ES9A 4HLUA 4HBGA 3PDUA 1X1EA 3LLMA 4UTRA 5FEUA 2B7BA 1PU2A 3EDOA 3JW8A 4MS1B 1XT6A 1IWPB 2A4MA 3AFHA 4ZCPA 3V1YA 4WFKA 3HACA 2HUNA 1QS0B 4KREA 3OX2A 4DAEA 3HCBA 5J4HA 4K8OA 2IH2A 4EDFA 4XSHA 1NSYA 1GDTA 4MDFA 1PZMA 4MCIA 2VL7A 3FWPA 5E1DA 3UJCA 2UYCA 2BMEA 3HN6A 3IP6A 5IVKA 3MB8A 1GZ5A 5C8YB 3ZKWB 4UFPA 2ZQZA 2QG6A 4W82A 3SGLA 2NUTA 5F7XA 3CKMA 2RMKA 3N39C 3IFSA 5IAGA 1ENZA 1G17A 1ZZGA 1BDHA 1VCMA 1Y1PA 1E3WB 3WQSB 4BGDA 3URKA 5I45A 3L3BA 3RASA 1W1WA 2PRKA 2ZR9A 5KC8A 1DADA 3SJBA 1X8XA 3OZIA 3AHHA 2BM9A 3AONB 3BTVA 2W6PA 1CBUA 2II6A 1UJNA 2WTMA 3H75A 2QLFA 4OP3A 2VT7A 2GYUA 4A5OA 4D8UA 1WABA 5KU1A 1U1CA 1TECE 1ZN7A 4NH4A 5K7SA 4YJ2A 1FYDA 5L3VA 1TK3A 1G41A 3H17A 1ZCBA 3MEQA 3BH0A 2YWBA 1AUVA 1G4HA 2P4SA 5FO0A 1L5GB 1TJNA 1L1QA 1J25A 2V74B 1I2DA 4KFSA 4MV6A 4XE5A 3WRYC 4AICA 4DSTA 3ZUGA 1RM3A 2Q2VA 4AMYA 2GN2A 4FR2A 4PZZA 2FEXA 2Z57A 3Q6MA 1LBHA 2VAPA 1JIUA 5A4KA 2W6ZA 3C7AA 1JJAA 3QTLA 1FP7A 2HH9A 4CI0B 3AM3A 1PR4A 4WNAA 1NDHA 3D4PA 3AVOA 3LXRA 5AM3A 1Y9EA 1I4TD 2Y2VA 2MSDB 4I3GA 4DJEC 1NQUA 4M89A 4FB4A 3O7MA 2JHAA 5DN9A 4ZVTA 2BELA 1FXSA 5CP8A 4Z9BA 2AV6A 3PFCA 3EZ6A 2HJRA 4X3OA 4EY7A 3BB1A 1Q16A 3A1WA 2CUNA 4DRZA 1BCSA 3UBTA 1VL2A 4ECEA 2OBMA 3PNBA 4IQ4A 1M10A 3UMCA 2QAGB 4L8LA 4AAYA 3O4FA 1KOLA 2IOQA 1JFSA 2XZPA 3IIEA 2AR7A 1KE1A 4NY1A 1FBNA 5HMMA 1Z39A 5K3AA 2E1RA 3C6MA 1I1HA 1ZLYA 4QUKA 2OAGA 3BK2A 3WFZA 1SCIA 4DCMA 3OZVA 3P2KA 4LEIA 3D4IA 2ZAMA 1IATA 4D57A 1X7YA 2VJMA 4FX5A 4GZLA 2PIAA 2EJWA 2NT3A 5A9SA 3QVGA 4ZV7A 1SD1A 4ZVRA 5TRTA 2Z6VA 4BQOA 4MQLA 1JQLB 1JQ5A 2GAOA 5L3SA 1IY9A 3ZDRA 2B1RA 3LHDA 1LWOA 1EZZA 4YLEA 2I99A 4UEQA 2HNKA 1W8DA 4DLVA 1S01A 2Q7OE 1HLPA 4RIGA 4TKZA 1T9KA 1ZMTA 4BJ3A 3AHDA 1IE3A 5KVVA 1UC5B 4MWOA 3CLTD 3ZE2B 2OXEA 4HNVA 1Z68A 5KS2A 4EYGA 4ZT4A 2HU2A 4XB6B 4YRKA 3OAAD 1F7UA 3GMIA 1FE8A 3L6CA 4CIVA 1V43A 5ESXA 4G5QA 1CLUA 2HU8A 3CRQA 3D54D 2JJQA 3IDSA 3TX6A 4AG5A 1AXEA 4DLRA 4JK3A 4CLDA 5JDIA 1CQZA 2OXFA 1RSZA 2IUYA 3CF2A 1RLTA 3NAMA 4O8ZA 4XQCA 5FUBA 3WL5A 3QX9A 3RVJA 2C7QA 4O33A 2IYVA 2J3MA 1YIOA 3K0CA 3TD2A 2GXAA 5FWAA 3M83A 1X2BA 3JPYA 2AW3A 2I6QA 2OK8A 4J1TC 4L51A 4LE2A 1N9GB 3PR1A 4TWAA 3WVNA 4LOIA 2OG2A 4YUWA 3UICA 1BKDR 4UNQA 4LQ4A 4MPDA 5IANA 3KAKA 1B00A 1E3JA 4DMKA 1SUBA 1TAQA 1YS1X 2VCYA 3LUCA 4OP2A 1OWLA 4Z0TA 1ZJZA 3OH8A 2GCIA 7AT1A 3OQ6A 5ADVA 1YR7A 3OT5A 2EHJA 4ZCLA 2H85A 3D7RA 2PGDA 1L8AA 3LBFA 1EYZA 3K8YA 3PF9A 5CLQA 3OCUA 4J0CA 3V7FA 4ZI2A 2O5EA 2QV7A 1I4OA 3S40A 3LQ1A 2A88A 2WIBA 4BFWA 3DKPA 3WKEA 2GO7A 1E4EB 4CLEA 4MW6A 1QZZA 5ARBA 3TDNA 1FYWA 3KKOA 3IT2A 4NF2A 4BC1A 2DR3A 4MNTA 1EKXA 2FWPA 2PEYA 2V4UA 3IIKA 2Q0QA 2VPYA 2ZYSA 4GXNA 1S6YA 2R1VB 4I1IA 1A72A 1BNCA 1PZEA 2GAAA 5B6PA 4X93A 1U3UA 3CJQA 2DC1A 2C9DA 3LY9A 3V1LA 5DN6D 2IC5A 2XSZD 5K0LA 4RD1A 2HHAA 2QL6A 5BT8A 1X0VA 2CLSA 3CLSD 3UK7A 1F0PA 2AZDA 3MN1A 5EUQB 4L1KA 2GERA 1NMEA 2WC1A 5BSMA 4CCWA 3C6ZA 1KIAA 1QE5A 4N54A 1AV6A 1JPNA 2IZ1A 4MVJA 5HE9A 1DUVG 3GLHE 3R5JA 4I50F 1FVFA 2PZ8A 3TQIA 3ZPXA 1DZ3A 4LVOA 3T6KA 1J33A 2ZI3A 4XJTA 3KYIB 3AL2A 4UZSA 2K7ZA 4BV2A 1HDIA 1H9BA 4ZVOA 1Q84A 1OI7A 4JV5B 2GPSA 1HPLA 2ABWA 4DA9A 1KPIA 1XHFA 2GAFA 3BORA 1A4RA 2PYIA 3LDHA 4QBGB 1VKOA 1WL8A 2WAXA 4GVXA 3LGXA 3HJRA 2C95A 4UMFA 2AZMA 3ZK8A 5CHYA 2BHTA 2A1TR 1C7ZA 1M2GA 1N2CB 2ATVA 2PANA 1ZBQA 4YJHA 3DFIA 2GK3A 3ID6C 1XMSA 1EK2A 4ER5A 1F2TA 1XKXA 3GF4A 5H3LA 5REQB 5ADUS 1MJ5A 2WMNB 5L3QB 1A5ZA 5GZ6A 5JYEA 1D4FA 2GEKA 2PZGA 4LJ9A 3GX1A 1VM6A 3BVPA 3RFCA 2ZTUA 2YYAA 4GR5A 4E14A 3R5FA 3FHOA 5TE9A 4G81A 3ZWPA 5E9WA 1UXJA 1DC4A 4YJ3F 1F9AA 3UWPA 2FSHA 3HBNA 1UQUA 5KX5A 5CBPA 2FR8A 2XADA 4FEGA 5BR4A 3FNRA 2NADA 3F5FA 4YR7A 3KYJB 4TYQA 4EYKA 4HQKA 4MKXA 4DA7A 3CVJA 1I5EA 1Q0UA 2GUGA 2OENG 3IUJA 4KE6A 4OFZA 3F5SA 1YAJA 4F71A 1OXBB 4OJQA 3EVGA 3RTAA 2KI5A 1B0ZA 5JT1A 3AEXA 2VDPB 1GCOA 1GV1A 2F3RA 1FU4A 4QFMA 2PKRA 1R6UA 1RFGE 3R0XA 4IHQA 4QHYA 1P81A 2VJYA 2FN9A 1XTKA 3OA0A 1P2BA 2Q6KA 3OOHA 5JIBA 1KQFA 1ZFNA 2DUMA 1H1DA 4N3BA 3P96A 4XD7D 4JBYA 2JFVA 1G4UR 3FE2A 3WP1B 4G0WA 3AVXA 1Y7TA 4MHSA 4QX6A 4PSCA 4EHBA 1L5WA 3FIUA 1EGHA 1GNLA 3HE3A 2D3WA 4WZZA 3TQRA 3MRVA 5LN1A 3BHJA 2VF5X 2DETA 1KS2A 5BWMA 2VF7A 1A88A 3DR3A 4C08A 4EKEA 4IH9A 3EDRA 2HJGA 3LGSA 3TXXA 3VQTA 1II8B 3C41J 3EXHA 1NVWQ 4QGBA 4YHBA 2V7QD 2ZAOA 4M8KA 4MCHA 3T7JA 3TLMA 3TMKA 2YWHA 1V95A 1LPMA 3UY4A 5L45A 1IHXA 5E8JA 4UZFA 2O8DB 1RDFA 2UYGA 3M5PA 5CLJA 2JZOA 1V25A 4JUBA 2H00A 1WEKA 3QKSB 1Z8DA 2A6PA 2VHZA 4LQLA 4RQTA 1CUSA 1RYHA 1QXSA 4PSDA 4BVKA 4PYJA 1NNSA 2I78A 4RV5A 3LPAA 2I62A 1BRTA 2A0XA 3L7AA 1U7PA 3RQSA 4BQRA 3TUZC 4Z3OA 3FA2A 5EIHA 4I5EA 2Z6QA 2C7GA 4B09A 4Q02A 4CMCA 4E7OA 2KX7A 1C7EA 2IYLD 4IIFA 3LG2A 1YNOA 3WWOA 2K7FA 3F9CA 4TROA 4K0RA 3P5SA 1AV7A 2VKTA 1D7AA 1M0EA 4B43A 5JQGF 2NN3C 4L4ZA 5C7LO 1XMXA 5JSHA 3KE9A 6CHYA 2JBAB 4QQRA 3MYRA 2ZUDA 1F8YA 4X7RA 1QV7A 1WX1A 4UE2A 1G21A 4D98A 3TIGA 1TVEA 2DCUA 3LQ4A 2JJ8A 3QVVA 3TKYA 3UUGA 1E7SA 2AJLI 2JH9A 2J09A 4FFLA 1LF0A 1PO7A 3QFHA 4NV1A 1HG0A 4OKIA 2GT1A 4DMFA 3VA7A 1Z0ZA 3PC7A 4OK6A 2IUEA 2O8CB 4D8VA 4F5DA 3JYLA 1QKIA 4WCFA 3UAGA 4YRGA 1ZIPA 2AOTB 1RKQA 3HBJA 4JZYA 1SKYB 2D1FA 5CT5A 4AZ3A 1I7QB 2ID9A 1C3JA 2RKOA 1XYVA 1TCUA 2C4KA 3OJFA 4H3KB 1XMVA 1ONOA 1SNYA 1A0OA 1FYVA 2NYUA 3IX7A 3KDSE 1W87A 1ZGGA 2CHQA 3QENA 2AEFA 1AO3A 3IUNA 3QLEA 1EX6A 2FQXA 2ZWOA 5FLYA 2Q5JA 3IDOA 1PK8A 3KJIA 2R87A 1YNSA 3LVRE 3O3NB 4WX2B 1B23P 1VLMA 2WVJA 5GJVC 5IFLA 2KHZA 1KSHA 1S8AA 3V4OA 4RETA 4CKWA 1GAJA 4MR7A 1EX9A 5HS6A 1Z74A 5CDUA 1DX4A 4HZGA 1EQUA 4CHGA 1LC3A 1HFJA 5KYVA 5JNLA 2RBKA 1CB7A 1MEJA 2WPDA 4I36A 4GGMX 3TRIA 8ADHA 3IESA 3B1WA 4IR7A 3IULA 3V9AA 4BAGA 1PGOA 5JNWA 4BS9A 4EPYA 1U9JA 1V45E 2IEIA 3KALA 4GDMA 4UM7A 4HRYA 1P4AA 1ZONA 3HLTA 1EFRA 2Z8ZA 4RLHA 1VE1A 2QS9A 4YBRA 5CMLA 3HNRA 1IIRA 3H0KA 3R8CA 3AFIA 2GKOA 4RK1A 2XCLA 4E5KA 4L3VA 1PW7A 3LHIA 3DDZX 2O05A 3H42B 4KJXA 4WQMA 5F2EA 4EO9A 3EPJA 2IRWA 5EMLA 4KR6A 3P19A 3U37A 1XU4A 4ZZ3A 2PR2A 3TTYA 5KWSA 2CV0A 2OGWA 1I0ZA 1YAHA 2R2GA 2M6LA 1F14A 1EAMA 4EUNA 4JI2B 4CT4B 4HUJA 1KMHB 4D02A 4F4JA 4H1WA 5LLDA 1OPRA 1T5IA 1ZNQO 3NZEA 4Q1EA 5FTJA 2IV7A 3NUGA 4KSYA 3EGCA 4HNTA 1JDBC 3G02A 3JQAA 4I4TB 2F1RA 1FSFA 1ODIA 3S3TA 2NU9A 3G0GA 4YMWA 4HLCA 1VYUA 1VL1A 3CURA 3OZSA 4M53A 4KYTA 1M5RA 1A4XA 2WJAA 2Y27A 1MDFA 3AI1A 4O0MA 4JX9A 4PG4A 5JAZA 3LRTA 3L0OA 3NKLA 4G84A 3PZRA 3EFEA 4POOA 2ZWIA 5JNUA 2WZBA 4FYXA 3A4NA 2I1LA 4GOJA 1SIOA 2VP0A 3B12A 3H84A 4HQ0A 4EENA 1LU9A 4QGSA 5KYYA 1E7MA 1E8NA 3EQ6A 2ON6A 3ZU3A 3TAXA 3HWX1 1ZY2A 1FC0A 2IU3A 2QIOA 3A6JA 4BUJA 4YDSA 2GD0A 2IBSA 4UMDA 5EYPB 1NOIA 2IHTA 4P82A 4PRKA 3C6BA 4KGDA 2TRSB 1AY0A 4X97A 2IYQA 1M6VB 4ZVKA 1K97A 3Q3EA 4MPJA 1RT9A 3JQQA 3RIYA 4YYEA 2JKYA 4GAEA 3AG6A 2C8VA 1Z36A 1EPUA 4HN9A 4RTOA 3NRCA 1CY7A 1MTOA 4XGNA 1QLWA 4XR9A 3WI7A 3SICE 2HOQA 3WNCA 3LUHA 1JAYA 3UXHA 2CWDA 3H9QA 3CWZA 3AY7A 1KBQA 1I51A 4P22A 1ECLA 1QDEA 2Q1TA 3C7CB 1E1QD 2DCMA 2C0PA 2A9RA 3CW9A 2JFWA 1KOJA 1B15A 3SEQA 4RYDA 1KO4A 1BKYA 1N4DA 5I7FA 4DUYB 1H0SA 1LI7A 3VR6H 3MMPA 4QT4A 4ZI7A 5KTKA 4PG5A 3NIBA 4V24A 5IBQA 1MX3A 2GRJA 3PDJA 4D0GA 2H1RA 2J3DA 3HUUA 1GYQA 3R3JA 3SX2A 3ECCA 3GOQA 1NU6A 3LLSA 4YRPA 2DBQA 1IY8A 5IDYA 3TL3A 3DMTA 2L2QA 2W37A 4IXNA 4NMMA 5JANA 2HREA 1A9OA 1JQDA 4I7EA 4URZR 1BFDA 1K4MA 4RO0A 1FYFA 2O7VA 3DHWC 3GRYA 2Q4OA 3Q2IA 5CT8A 4MOWA 2C2XA 1UK8A 1WHSB 1WP9A 2OBYA 5L95A 3OJCA 2OC4A 3DEJA 2P9CA 2NUBA 3JXEA 4KXLA 4M98A 1Z56C 4X1KA 1ESMA 3QE2A 4YAWA 1R0XA 1TEZA 1JJVA 3UIEA 3KK0A 3R3VA 4ZOCA 4PHCA 4ZQGA 1EM8B 1QWSA 5LP6C 2ZXEA 3BPSA 4ND3A 3O91A 5CJPA 1Z8NA 3MT7A 3X3HA 2O1EA 2R5FA 3INNA 1M6NA 2IIVA 4OSOA 3FMVA 3KZ1E 2PGIA 3Q9NA 4CMIB 3K2BA 1NP3A 5BMVA 4OOEA 1GAEO 1RHUA 1I3MA 4M7PA 4CU2A 4Q4HA 1SVMA 2FPUA 5IJAA 2C59A 1Z2AA 3HI4A 2ISCA 2IYZA 1UBJS 4H1TA 1DXQA 2GR9A 4KBGA 2FAXA 1Z38A 3B9PA 5AXBA 2A7QA 4L75A 3EOBI 2Q07A 3HO8A 1F0KA 3W7VA 2AMFA 2QIPA 2F67A 2PLNA 1YMQA 2XRYA 3NKFA 1GCGA 2E6KA 1XAJA 3P45A 3UFBA 2ZWAA 1H5UA 2H0AA 4K9PA 4JODA 2CL0X 2XVZA 5JVDF 5ENDA 3TNLA 2VDUE 5KZMB 1Q14A 3JRNA 3WHLA 5ITSA 2AJCA 2QRNA 5ERGB 1ZJ4A 4LKRA 1LDEA 2GESA 4A0RA 2FEKA 2BI7A 3BMQB 1I4WA 3EN0A 4B0PA 1I30A 1J7KA 2FMUA 2HO4A 3P9ZA 5CDYA 7REQB 3I9OA 3Q5GA 1QUFA 2X7XA 3MWJA 5NLLA 3WO0A 4AUEA 4F9TA 4YR9A 4HNQA 5F3WB 4JI0B 1D1TA 1EP9A 3OCJA 1XRNA 1LBTA 2ZB3A 5M29A 2QHXA 3OCYA 2C0CA 3EPRA 4JLUA 4WACA 3AV0B 2B5VA 5LUBA 4DGSA 1U8TA 2BFCA 3E61A 3P8ZA 4HEJA 4JYMA 2R48A 1NR7A 3M4YA 3QVLA 4ENTA 3AF5A 4F12A 5FORA 1CZLA 4X85A 3G2QA 3O8QA 3NHKA 4KCGA 4UULA 3AR5A 2C5SA 1EWVA 1JR3E 2JAOA 3GLHB 2XMSA 3SYRA 4E88A 2A57A 3VC1A 1ADJA 2YWGA 1V9SA 4A7PA 2OHXA 2P6UA 4CNQA 1VI2A 5IK2A 4YS6A 1WTAA 3TSZA 5CLFA 2VKQA 1T3TA 3G1WA 1PJAA 3ML1A 1I36A 1T5TA 2C3UA 1CQXA 3KQQA 2JHPA 4GBMA 1EK6A 4DLNA 1F8FA 3V8RA 4JYAB 1T0JB 4IAOA 2ZSKA 4FIZA 4DV2B 1OHHD 1X7WB 5F2OA 1N33B 2IWRA 1M1YB 2RG1A 4Z4EA 4KQMA 2KJQA 1FQOA 2RJNA 3ORQA 4E5MA 2EW8A 3BYZA 5AXCA 5J1TB 3CO0S 1PEAA 1SU6A 3IR7A 4TQAA 1ZWLA 2HQBA 4RHCA 4UUMA 3ANSA 5KMGA 2YFHA 5K3FB 1JHAA 1XTIA 3QUAA 1A5AB 4RABA 3ROKA 3T9FA 1BOOA 3U4MA 2C4TA 1IBRA 1L5ZA 5FI0B 4MSUA 3RAPR 1HZJA 5BYKA 3LBNA 3GLIE 1JG1A 3M1LA 2OFOA 4KI0A 3HPRA 1GQRA 3MS7A 2Q3EA 3FTQA 2GHTA 4L4YA 5ESDA 5A06A 4GSLA 2R8OA 2ORYA 3GJ3A 2XGJA 1X9GA 4WKBA 2VATA 3SSAA 2O1WA 4ME6A 3ND9A 3WICA 3D3EA 5BVGA 2REQB 1EH5A 1FDOA 1T29A 1LVHA 1PZGA 2WZCA 3DPUA 4CLHA 1QORA 1HZZA 3NYWA 3P9KA 3Q6IA 4YXWA 4Y1FA 4Q9IA 2DRIA 2NUPA 3D6TB 1JDBB 2FFQA 4S1TA 2QJFA 5P21A 4B3HA 4PAOA 2C31A 4QUBA 1E79A 4X94A 2P9BA 4EHJA 4PG8A 2QR3A 4B2YA 5HKOA 1NVBA 2H4JA 1ISJA 1ND6A 4FHFA 3JQ9C 4P1ZA 1FLDA 3DL0A 1RJEA 5LU8A 1SBNE 3R41A 5LA6A 3GYBA 2HA2A 1PYDA 4XI9A 4CF5A 2ZJ8A 1PF7E 4RELA 1WDWB 5JHHB 1VBMA 5DGCA 4K2HA 3UGTA 3OFJA 5C3MA 3RUFA 2I6TA 4RVUA 4D43A 1J8FA 3D2CA 2C1EA 1M8GA 2OCGA 2DH6A 3UAYA 4EW1A 2CLOB 3E9NA 5GWXA 2VQFB 2HLHA 4M8SA 4H1VA 3ERCA 1T3ZA 4YCDA 2ZRFA 4KQ2A 1ARZA 1AURA 2FR1A 1GP2A 1FP4A 2ADMA 4KW7A 4AWXA 1KPHA 4CE6A 2ZKIA 5FD8A 1UZUA 2HSEA 3T7DA 4BNZA 2Q46A 1W88A 2FK8A 2HXSA 3RKRA 3RC3A 3BA6A 4Y2XA 3L5OA 1TVCA 2RG7A 2NTYC 3FSGD 3HBLA 3K8OE 3MJHA 3QYAA 1V11B 1ZL0A 3GUYA 1E69A 1M76A 3OUUA 1LNSA 5KOHA 3U26A 4RXMA 1WXFA 4TMWA 3ZHSA 2OQRA 1CZRA 4S05A 4HH0A 2DPXA 1OJLA 1W4LA 5ALDA 4JJFA 1KAOA 4LK3A 1T3HA 2OV4A 5CM8B 5FV4A 4HDRA 1FSPA 4Q16A 1E9CA 4F7DA 2F9LA 4UU1A 3HRIA 3F3KA 1D07A 5G1NA 1YQXA 2MR5A 2H1CA 4RJKA 3NHWA 3VO8A 3WDLA 2WMYA 2O3RA 3W5CA 3NDPA 3V8EA 3MWKA 2EGUA 2ENWA 3RUAA 4CM7A 1NLUA 3EAQA 2LKCA 3KQNA 5GZ3A 5JLAA 1O4VA 4WVLA 2BKEA 2XVMA 2WUDA 4XPIB 2VJOA 4N40A 3WGIA 4D3FA 2QMUA 3LL7A 1UC4B 1NFRA 2JIBA 3GCGA 2VYVD 3BE6A 4PAQA 4PAMA 3WIBA 4DBLE 4UDXX 5AM1A 3BB4A 1WS6A 4RFSB 2YHUA 2NPOA 1PNTA 2BZGA 2HSGA 3FKSD 1NI5A 4GSKA 3D6VA 3UV7A 2WUGA 1AQJA 4MKGA 1A8IA 3EPLA 3OT4A 4TYYA 2C1ZA 1XJWA 3DM5A 4ZQBA 2WB4A 1GPLA 2I7TA 1A8PA 1SG0A 1XROA 4IIJA 4LV6A 5DTMA 4CN9A 3JQ6A 1PJTA 2ZFUA 2FGJA 3KFVA 1M72A 3VDXA 3TGLA 2CMFA 1GNVA 3IODA 3F2IA 4CG0A 1SOWA 2BC9A 4MQBA 1QH1A 1GPUA 1OD6A 3CINA 1FS5A 1GFZA 2GAJA 4YAFA 4CKYA 3T1HB 3FYTA 1U7ZA 3I42A 4J0FA 4IZIA 3HCNA 2N46A 5LB2A 1U2DA 1CERA 3F4LA 4QTXA 5K3DA 3JD4A 4ZP1A 3RVBA 4E1VA 3BS4A 3CEHA 1I6WA 2EFGA 4LXTA 5B3AA 2NT4A 3FNHA 5LOVF 3M4NA 1C9EA 2JIZA 4P33A 1PQUA 2W22A 3ITDA 3HP7A 1PKXA 5GOTA 5BSRA 3UUEA 2ID7A 4PG7A 3G79A 1A82A 2NNWB 4TSFD 1ZCJA 3QMWA 1POXA 2WTAA 3BT7A 1P5JA 1A1SA 1PJSA 2DLDA 5K8TA 3I6QA 3O5AA 3HPQA 4F7WA 2L82A 3A4IA 4YAEA 2BFEB 3R6DA 3BWCA 3IEPA 1FW8A 4KAJA 1RXVA 2QPAA 4OXQA 3GJSA 2AXEA 1RRKA 3HYSA 3B2EA 3DUFB 3V4SA 3DHVA 1JB9A 4DUZB 5JJCA 3HFRA 3DLIA 4FHZA 1CUYA 3QWBA 3S2ZA 4EJ0A 3IP5A 1NATA 3K6SA 3PC2A 3PKIA 5CEEA 3D3WB 2BKUA 4PE5B 1J99A 3BK7A 2QM8A 2ZVDA 4LWQA 4LSZA 5TF0A 3V33A 3WWDA 3VR0A 2C4HA 3TNYA 4G8BA 2QBYA 2DUUA 1XJ5A 1PX0A 4E7PA 2PD4A 1VCOA 1EA7A 1L3BA 1LFAA 1NW6A 1PYGA 2NO7A 3CU5A 3V8VA 4AK9A 3UT5A 1O94C 4LZWA 2I6XA 2CLEB 3QITA 4QEKA 4DLYA 3HMQA 1G7CA 1T0BA 5C1DA 2OY0A 1NQVA 5EXTA 3TBHA 5K8JB 1H3NA 2G5PA 4L0DA 1Z3CA 3MIZA 4CT5A 2XGOA 3GAAA 4QU5A 3ROTA 4CDMA 1GNTA 4DLPA 4CM9D 3U09A 1CUCA 3T7SA 1J8VA 4G4GA 3BJEA 3R5KA 4JVLA 1DRJA 1CJTC 2GZ2A 4AC9A 5JARA 4NYIQ 4TLDA 3SWWA 3IELA 5AT1A 5K1ZA 1UADA 4FCCA 4IX9A 2Q1UA 4FHDA 5ARCA 4CF7A 3FI0A 1LRLA 3U4AA 3GVHA 4RESA 1DC8A 2P2SA 4YWHA 5KYUA 4F2WA 4B6FA 1YOBA 3EMDA 2RCYA 3FAZA 3KSZO 4LZZA 4TT3A 3IQHX 5GJWC 5FWYA 3T12A 4ZU1X 5IWCA 3HY3A 1NJGA 1C7QA 3HR4A 4YCSA 5HRAA 1QP4A 4WZBB 3PXGA 1W30A 2I9KA 3H9CA 1NVFA 1IHUA 2REOA 2E6UX 3H1FA 1CDDA 2CVQA 3BXXA 4Q01A 1W5EA 3H87A 4ZT5A 4KV9A 3OSUA 1U7DA 2ZE7A 2HDWA 4N0QA 3L04A 1QFJA 4HWRA 3EIEA 4L4UA 3VPCA 1Y8QB 3FSEA 3K6KA 2MTBA 3CG0A 4PGAA 4MMXB 3ZXSA 3LZCA 4M8NE 3WLFA 3WRXA 2CB9A 1M9NA 1FOEB 1RWPA 1FJ2A 2BEWB 3F6RA 2P35A 2WJHA 1L7BA 5LQMA 5JXJA 1E63A 4QVGA 4BVHA 7YASA 1UPXA 3IT3A 4O4JF 4L78A 1H4QA 1D6JA 3WP0A 4I6JA 4LNUB 5JNRA 3C0KA 4Z51A 1YZNA 1DMRA 3PNQA 4K3VA 3NIFB 3KUUA 3Q85A 5E7QA 1LTHR 1V5WA 3N7UA 5I51A 3W5JA 2A5LA 1XMQB 5AVJA 5EJGA 1DC7A 1V7ZA 2B8JA 2EIHA 3BBLA 3CVXA 1KORA 1Q5PA 3NDRA 1EZ1A 2BRUA 3WWZA 1MGPA 3GAZA 3M3DA 3T3MB 4FSXA 4UQLA 4S35A 2IYYA 4RPIA 3EFHA 1CHDA 3GFSA 4RL4A 4DCVA 3VPFA 3QOWA 3WL7A 1XRMA 1IWOA 1ISFA 4NDAA 3JD0A 4RFLA 4J3FA 2ZJ5A 4Q4JB 5JASA 2I4RA 3LF1A 5FPSA 2O19A 1FDVA 3L7YA 3MNFA 2XKAA 4A03A 5ICMA 4ZAGA 4DW8A 2VFAA 4I14A 2P68A 2ZS9A 5EIBC 1RIIA 2AKAB 4ONEA 4OQPA 5A5FA 1THTA 5DHSA 5FL7D 3KHSA 4N7RA 1WHTB 4BQNA 5L53A 5JO9A 1N25A 2QRMA 2D4HA 2BE7A 2CUTA 2WWRA 4HGRA 2NO1A 2QTVA 4NE9A 3U7FB 4RKYA 4WZ6A 4EKYA 2QUAA 4MMZB 3W2GA 3KOMA 3QKRB 4WN9A 3TFWA 1R37A 4OI0A 1NVKA 4P35A 3RCBA 1EHIA 4HB2A 4TKLA 3QI7A 1GXSB 3VMMA 1MJHA 5ALKA 3HSSA 2QSZA 3PFBA 3PJEA 1EXDA 1CU1A 2HB6A 3FTPA 4EF4A 4UAUA 5DXJA 2ANCA 2Z1NA 5J2UB 4PCAA 3DBLB 3TZBA 2QJRA 2P2NA 3UK2A 1Z2EA 4YUZA 4RGBA 5DI9A 4FOLA 1D2EA 4PBTA 5F9MA 4B83A 1XDZA 4R83A 4CF6A 3D1JA 4G89A 5TDHA 4AF8A 3QNWA 4FOPA 4JT8A 2PKWA 3OE7A 4M38A 3NG1A 1J0EA 3EQ7A 4YB8A 1NM5A 3T9CA 1C0LA 1KJZA 4LX8A 5BWCA 1UODA 4WESB 1NIPA 4MA5A 1P9LA 3S1AA 2JGFA 4WI1A 3RUEA 4PLYA 4ARBA 2BDTA 3I62A 5I4BA 4EBBA 4GLOA 5J43A 1BXRB 1V35A 1C5KA 1JH9A 1HE1C 4OHXA 4ZCTA 3GOHA 4M1OA 3VU0A 4HRXA 4TRRA 5CD1A 4ETWA 3SOPA 1V6AA 5KNBH 1L7XA 3UTCA 5KNCH 1N2ZA 3CH5A 3WBFA 1EB8A 2BJWA 4TWZA 4DARA 3C4QA 1HORA 1Q11A 1VP9A 1F48A 2RGXA 4I8XA 4Y2TA 4LBWA 4QAQA 2OFXA 1MX1A 1XCJA 2JDIA 4PTLA 5BSUA 5BQPA 3B1VA 2Y93A 3H2ZA 5KBYA 4O0LA 4JR1A 4QU9A 2ZYGA 2PO7A 2YIDA 3S81A 1ODTC 1OYYA 2EQ5A 3ZH9B 4C4TA 5AKLA 2G7ZA 4RS4A 1JL3A 1A4IA 3OP4A 1NLZA 4TUYB 4LWOA 2VSXA 3IKMB 3T7RA 2Q6OA 5C3UA 3PUHA 4M54A 1GAXA 2AEJA 1YA6A 4PANA 1Z7BA 3JALA 4M37A 3VYTB 7GPBA 3RG8A 1U2TA 1E1CB 5CD9A 4MRRA 2YNMA 4KLRA 2PSHA 4KMMA 3HKCB 5A5GA 1B3RA 2A4KA 5LNK1 3LX8A 1CQJB 4BIMA 3Q8WA 4QJBA 1VYTA 3MJFA 4DKJA 1ZISA 1PT8A 3MUOA 3WWEA 4NCHA 4GKKB 3ANMA 1JEYA 1BN6A 3KUCA 1B0UA 5ALHA 4R54A 2WUFA 2YL2A 5ALGA 2QZSA 4DR7B 1ZL2A 2XDQB 1VIYA 1PNVA 2HZ7A 2ZSDA 4B47A 1XTVA 3P2YA 4ZJZA 3EFOB 1U8AA 3KSDO 3PITA 4G5XA 4DR5B 3VR4H 1HRKA 2WHPB 1L7OA 1PBNA 2OESA 1T4GA 2YHAA 3LDAA 1GGMA 1DL5A 1G5FA 3OG9A 4YONB 3WNVA 4A5SA 1PCXA 4L6AA 4DABA 4N4AA 4YQEA 4UCQA 4PINA 4G0MA 1XG5A 4W5HA 4QUAA 2GJ9A 4PGFA 3KIPA 1EVLA 2Q4RA 4GXRA 3ZZ0A 2ZUCA 1U4NA 1K7FB 3WGKA 2OQVA 2ZRDA 2BBOA 1UDCA 3LOQA 3IIJA 3H5WA 2VNIA 3G2PA 2VDLB 4LJ4A 4P3XA 2JGNA 3AEQA 2HIHA 3PQCA 3HRHA 5LNK6 4V0QA 2PV0A 2KE5A 3BN3A 4MUEA 4HDOB 5CB4B 1A50B 4EWLA 3P2JA 3D0QA 4ZYVA 3V8BA 4TOIA 2QZJA 1T4CA 4G6ZA 4YMGA 1C8BA 3SNKA 4J4HA 1E5QA 4D6XA 2JLCA 1KI6A 2QJWA 4BOYA 3N7TA 4WN3A 1OZGA 1VHDA 3A7EA 3BMNA 4A2CA 4KR7A 4G0PA 1L1EA 4EZEA 3PHIA 2NTJA 4PM4A 3WZ2A 3A4TA 2YWCA 3C1OA 1ODJA 3V1MA 3AY6A 3ENQA 5AOCA 5FKJA 2DKNA 4IP0A 2PK3A 3T0GA 4CEIA 5C31A 3PI6A 1AH2A 1SHJA 2RHHA 4LAFA 4MH0R 4KBYA 3B2NA 5JFGA 4CR7A 1H5QA 1WCV1 3LBYA 4Z9YA 5LKRA 1EFAA 2YXPX 1D1QA 2PWYA 4PONA 1OROA 1Q95A 1R00A 1R9MA 4Q7LA 3VI3B 2OPHA 3DDNA 5BRNA 1N8NA 4PQYA 5SY9A 4J6EA 3A0UA 2ID8A 1NN5A 3BXGA 3M6WA 3D6JA 3QK7A 1SQ0A 2R25B 5AMXA 1N5JA 2RGNC 3T0FA 1G9TA 3MCWA 5GGYA 1DRWA 2FDCA 7MHTA 1X14A 1Y6QA 2QRHA 4FFOA 4NFLA 4UPDA 4CN8A 3IPCA 4PSAA 2OYRA 3MJSA 4RKRA 3EEBA 4WT7A 5DDIP 5LZ7A 5JFTA 2B69A 2OKCA 4J49A 5JECA 2RKBA 3BX1A 3TB6A 3IDQA 3HKEA 4B45A 4O29A 4ANFA 4L8VA 2H4ZA 1TPYA 1WVIA 5BN5B 1MOPA 5F7JA 2J9XB 1XP8A 5EKTA 1XEXA 4EGSA 3F0TA 4OK5A 4JQZA 2XE4A 2ZM5A 2F9FA 3A26A 1COWA 1HFKA 2G9VA 3ND5A 4AS3A 5L4LA 2HQSA 1Y81A 3P52A 2M1XA 3L1JA 2HJVA 3EG9A 1BMFA 2V8BA 1DIOB 3IHLA 4FDTA 4Q1CA 2EJCA 3WGNA 4WL0A 2LXNA 2XQIA 2PQ0A 4FE7A 3DLHA 4RD3A 4MWDA 2O5VA 2ZK7A 1RRVA 3CNBA 3GCXA 1TO2E 1O6GA 1TYBE 1UUFA 1Z17A 2YXBA 2WWXA 4KG7A 4MRMA 2QZ4A 3NWOA 4X92A 4NS4A 2VH5R 2I4TA 1UF9A 3E9EA 4XJSA 1U7HA 4PQEA 2Z3ZA 5FFNA 3NPAA 3RTBA 3TAHA 4BKPA 3PGXA 3EC1A 1JT9A 2G25A 2PL3A 3K1JA 1PUIA 2GCOB 3L49A 4JSTA 3P71T 4D26A 3K9QO 4OB6A 4XCXA 1W46A 1G18A 1ZEMA 4IMJB 3K16A 3DULA 3K32A 3A3NA 4W5QA 5DB4A 2OCBA 2JB9A 2J9ZB 3EEIA 3JARA 4WKCA 2REXB 1MUUA 3NVDA 4CU5A 3GZTB 5TV2A 4QTZA 3N2IA 4LYYA 2V9CA 3AM4A 4HNAA 5COAA 4YRCA 1FUEA 4TX1A 2AJTA 3HB9A 3P9QA 5ESWA 4CLXA 1BE6A 2LWIA 4RADA 2W2KA 3A70A 3TTWA 1FVOA 4CV3A 4E5NA 3FLBA 3GLGE 3A3KA 1FP2A 1VFPA 2Z2JA 3EIOA 1CW2B 5IFKA 1J49A 3KKMA 3KYDA 2HMUA 1DUSA 1H9AA 2M2IA 5B1SA 2J3QA 3GC6A 5SY6A 4YRIA 3JSAA 2X23A 1NSTA 1I10A 1E1RD 2RJ3A 4P4TA 2QRVB 1OXSC 1SCUA 2Y1GA 3NAZA 3VHLB 3OHMA 2R65A 4M99A 3G6WA 2BI8A 1IZ7A 2B8WA 3CE9A 3ROQA 5BRAA 1THZA 3U7IA 4ZI3A 4N9QA 3O8DA 3OQIB 3Q7TA 1TNDA 1ILEA 1JKXA 1YZYA 4ROSA 4DOMA 1SVNA 2YYZA 3K5PA 4Z7NB 3VOTA 3KB2A 4KAXA 3A1VA 3HNPA 2Y9MB 4JLOA 3TOSA 9LDTA 1ZK0A 1VRWA 2XOKA 3QVTA 3WKAA 2G71A 4C7XA 1X92A 2EFJA 4KQJA 3STVA 3ICQB 4O2AA 3H1BA 4LF6B 1C0EA 3VDRA 4BE4A 3ZYZA 4NBRA 5KPJA 3EBLA 3UAZA 4I1SA 4RIEA 3N59A 3HCEA 4XVQA 1OLUB 4WW0A 4LW8A 1RHJA 2MR6A 5KOHB 3O2QB 3WLPA 4JLDA 2OV6A 2JFXA 4ALLA 1T8WA 5H4GA 1BXGB 4NENB 3DDCA 5LJLA 4J16C 3HSYA 2WJZB 3RS7A 2HCFA 1QE3A 2X9LA 1G5PA 3C8DA 3K1AB 3LUPA 1UXHA 3DEIA 3SKYA 4TL7A 5F76A 2FZEA 3HP1A 3EW9A 3D3JA 1FMJA 4QOGA 4KHPB 2DTEA 3FCXA 3TDKA 1XWIA 4BJ1A 4XUDA 2FSPA 3ZZUA 2DYKA 4GXTA 3V00A 1QGUB 5D01A 4PPFA 2V1UA 3L77A 2H65A 4EKNB 2JANA 3O90A 2CFSA 4C04A 4FFPA 5I8PA 2I8CA 3SI7A 5GVRA 1U4SA 4ZAZA 4NJOA 3NI2A 3U4HA 1SUEA 2O2SA 1ZRNA 5DEIA 1QH8B 3QBEA 4EFLA 1I0LA 4UHDA 1E9DA 3H5TA 1J42A 5D86A 1UT5A 2Q1WA 2JAXA 2OMKA 5HCNA 1IULA 1YRBA 3JTMA 4JS0A 4OMCA 4UDOA 3T1QA 2GXUA 4FNGA 1PZFA 4L4SA 4L72A 3DOHA 1QLJA 3ZY2A 1LW6E 2HLPA 2VBIA 4E07A 4GF5A 1Z0AA 2J6BA 3C3WA 3IMGA 4K40A 3SYLA 3GARA 1QFZA 1BXZA 1R18A 1NP6A 1SQ6A 5JAHA 3A6PC 1Z4QA 4QLAA 3AHIA 5LP6F 4B5LA 4IZOA 1DBVO 4JB8A 4XYMA 1T2AA 3B82A 1R0WA 4K46A 4UHHA 2UVPB 4BWYA 1O95A 4BU0A 2VC2B 1EQ2A 1RQLA 1BCRB 5B3LA 4LN1A 1SXJC 3O7WA 2H31A 2JAUA 3KJHA 1UM9B 4MVJP 4MRPA 4NXMB 2I34A 1EBUA 3P0IA 4YAUA 2ZQ5A 3JVUA 3CONA 3PK0A 1T34A 2BT4A 1KYQA 4CZ2A 3G7NA 2BYTA 1HGXA 1RI5A 2IOFA 1UBFA 1XCLA 1NFFA 2HAEA 4N12A 5JO0A 5KWVA 3LCUA 5T3UA 1ORWA 2GA8A 2YIMA 4KLCA 2PJDA 4NHOA 1NI3A 3MW8A 5KNLA 1QIIA 1E6UA 1F5NA 1JTEA 1SCQA 2GPYA 2IYOA 2AN4A 2Q2QA 2JK1A 2X6RA