2WN2A

Structure of the discoidin i from dictyostelium discoideum in complex with galactose beta 1-3 galnac at 1.8 a resolution.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
254
structure length
254
Chain Sequence
AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
molecule keywords DISCOIDIN-1 SUBUNIT A
total genus 63
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wn2A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wn2A01
3OG2A 2RVAA 2W87A 5LA1A 2L9LA 3W5NA 1US2A 5EIYB 4W4ZA 4ARXA 4CU9A 1JYNA 3K46A 1OT5A 2VMDA 3C7OA 2WO1A 4A41A 3WEZA 3MV11 4HG6B 1DP0A 2W94A 3NQHA 2WAAA 5B4NA 2VJXA 2W9XA 3I97A 1NKGA 2Y6GA 3IIIA 5JR2A 1HN1A 2J22A 1W9TA 2CGYA 2WO2A 2XHNA 2Y6LA 2VL4A 2XOMA 4BK4A 2WDBA 1EUUA 2VZTA 3HEIA 3C7HA 2V72A 3FHAA 4IUGA 3U37A 2YFUA 4DXSA 5JXGA 2BZDA 3T0AA 4JX0A 3WSOA 4Q56A 1UY2A 1UX7A 4BDVB 1GOFA 4JHZA 2CCVA 3JXSA 3K77A 3DYOA 3MV01 1JHJA 1UMHA 3DECA 3GM8A 4A44A 1W9SA 3HNMA 2X05A 3K75B 2DCKA 2R7EB 3NJXA 4CVUA 3WNPA 1L7QA 4LPLA 5HXMA 4MGSA 2KD7A 3WF2A 5C71A 4A42A 2CGZA 3K4ZA 4FI9A 3VDAA 1OH4A 3HJRA 3ACGA 3P1IA 3VDBA 3UNPA 4JKLA 4UAPA 2ID4A 3MUY1 2WZEA 4E8CA 3P6BA 1JZ6A 5A1AA 5JXHA 2J1AA 2YC4A 4XURA 3UETA 2ORZA 2WN2A 3HPNA 1UY3A 4A4AA 2VO5A 5DQ0A 3CKHA 1JZ4A 5DPNA 2QQKA 2B4KA 3NNGA 4ARYA 1PX4A 3C7EA 5C70A 1J83A 4W8JA 4UI9L 2EIDA 2W46A 4P02B 2RJ2A 2JDAA 2Z4FA 4E8DA 4DXRA 5CYYA 3NRUA 3GGLA 4BK5A 2QQLA 1BHGA 1J84A 1F4AA 1PMJX 4QDRA 4DEQA 2J1RA 4BXSV 3C7FA 3LEGA 4DEVA 2Y6HA 4OYUA 1SHWB 1UYYA 3T2OA 4A6OA 1R64A 4QX1A 3OGSA 4XUTA 2ZEXA 1D7PM 4TTGA 2QQNA 4QPWA 4QB2A 1OF3A 3I2GA 5LA0A 1W8NA 1WKYA 2QBXA 2VZVA 2VTFA 4XZUG 3K4DA 2VR4A 3ABZA 3BGAA 4KI5M 1PMHX 3SKJE 3FHQA 3T2QA 1O59A 1GQPA 4M4PA 3OB8A 2C4XA 1RYYA 3D3AA 1GU3A 4Z2AA 2EICA 2WYSA 1UXZA 2HLEA 3F2ZA 1UXXX 2E32A 2BGOA 5CZKA 3T2PA 3OEAA 3LQCA 4OMCA 4P08A 2W92A 4CU7A 3MO4A 4KMQA 2V5DA 1GOGA 1GOHA 1K12A 4MADA 1JYWA 1JU4A 2QQOA 3OGRA 2QQMA 2ZEZA 3I2FA 2VZQA 4OZOA 3CZUA 3EYPA 2CDOA 3A21A 2W1UA 2RV9A 4MO3M 2DCJA 2XQXA 1KEXA 4A45A 2BERA 3HN3A 1K42A 3LPFA 2W1SA 2LW8A 5IFPA 3T0BA 3FL7A 1JYXA 3T08A 2J1SA 3I3BA 3WNKA 2YC2A 1K3IA 3HNYM 5JUVA 2E31A 1DLCA 1JYVA 2VZSA 2VZUA 2VMEA 3LE0A 1CZVA 4QB6A 1JZ2A 1NUKA 2J1EA 2V4VA 1GMMA 2E33A 3A7QA 3K4AA 2VMCA 4DUXA 1WCQA 2LS6A 3HNBM 4MOAA 4XVHA 2JD9A 3VD7A 3IAQA 1ULPA 1F4HA 3VDCA 3T0DA 4AAXA 4ZY9A 1OD3A 4ZXEA 3I3EA 1W9WA 3THDA 4BJ0A 5DN2A 3NJVA 5IFTA 5JMOA 3FN9A 4P00B 4P5YA 2PQSA 1L7RA 5HPOA 5JXJA 1K45A 1UYZA 3I3DA 4L0PA 1W8OA 2B9VA 3WF1A 5LA2A 2C9KA 4CUBA 1H6YA 1UY4A 1UYXA 4QX0A 4KWUA 3OEBA 2WUHA 4JKMA 1XC6A 2Y64A 3C8XA 3CDZB 3VD5A 2VMFA 5IJRA 1W99A 2ZXQA 4GZ9A 2HYXA 2YB7A 3WF3A 3VD9A 3EB7A 1UWWA 1GNYA 3SKVA 4XUOA 2X10A 1IQDC 3W5MA 3ACHA 4QDQA 3IAPA 4ET7A 3WNNA 2WZ8A 2W91A 3VD4A 2YG0A 3CZJA 1MPXA 4CUAA 3I2KA 1JZ3A 2ZEWA 4A3ZA 5G04L 3DYMA 3IDAA 1OF4A 3WMPA 3J7HA 1US3A 4GWIA 3OBAA 3ZM8A 2CDPA 3SEPA 2VCCA 2W47A 1JI6A 1LNSA 4QDSA 2WABA 2W1WA 3GXUA 4W50A 2VZ3A 2W5FA 3CQOA 4LQRA 2WAOA 1H6XA 3HOBA 2EIBA 1W0NA 5EJZB 5I0DA 3A23A 3I2JA 4D0QA 2CE6A 3PUHA 4ZZ8A 2VOTA 2VCBA 3MUZ1 3VD3A 1PX3A 1O8PA 2C26A 2VQTA 4M4RA 5IHRA 5LCWL 2VZRA 1JZ5A 1SDDB 3I2IA 2BGPA 3WQBA 2XONA 5IYYA 1YQ2A 4YPJA 3WF4A 1CZSA 1UMIA 2VZPA 1I5PA 3ETPA 5G05L 2VCAA 2ZEYA 4GWJA 4LKSA 4XUNA 2QQJA 3CMGA 3SEEA 2W95A 4MGQA 4CU8A 3IB3A 5EJ1B 5FUIA 2Y8KA 1T2XA 1XPWA 1TVGA 3LPGA 3THCA 3LEKA 4PQQA 1O8SA 5JXIA 4XUQA 4LHSA 3E1F1 3BN6A 3UESA 1XNTA 2VZ1A 1UY1A 4QB1A 2JKXA 2JE8A 3A22A 4OMDA 2J1UA 4RYDA 1JZ8A 4UOJA 4PF1A 3T09A 1SG3A 2VZOA 1CX1A 4PT6A 4OUEA 1JU3A 1P8JA 2YFZA 3ACIA 3CIHA 4DUWA 1DYOA 1TG7A 1ULOA 3ECQA 3WF0A 1CZTA 4QX2A 3WNOA 3WMQA 3WNLA 4CUCA 2VM9A 2J1VA 3MBWA 4RN5A 4CU6A 3PUIA 2J1TA 3DYPA 2WO3A 2WQ8A 2WN3A 2W1QA 1EUTA 3AC0A 3I2HA 4QAWA 1NX9A 1GUIA 2BBAA 1KGYA 2VQUA 3LEIA 3GDBA 2X09A 3WNMA 2W3JA 4DXTA 2J7MA 1NAEA 1XNAA 2E26A 1UZ0A 3ACFA 2Y6JA 1UY0A 4JKKA 5C7GA 5B4XA 4AG4A 2QQIA 3OGVA 2EIEA 3C7GA 4DUVA 4ZZ5A 1CIYA 4XUPA 2VC9A 2OKXA 2Y6KA 1JZ7A 2DDUA 4QX3A 5J1XA 4TXWA 4D8MA 2ORXA 5F7UA 2WBKA 5DMYA
chains in the Genus database with same CATH superfamily
1MFUA 2DI7A 3HMWH 3WW2A 5CFCC 1JOIA 1WA1X 1PG7L 1NGQL 4HV8B 1A3RH 1H6TA 1X9QA 2WLQA 5BJTA 3GMOA 3R4DB 1CLOL 4GUPA 1NBVL 4Y5Z0 3AQZA 3QYCA 3BVNA 3BO8A 5FM5O 5JW4M 2CKBH 3RPQA 1QNZL 1JVLA 4GKSB 1PQZB 1AIZA 2WO1A 4GI6A 4Y9CA 1RMU3 2QADB 2QHRH 4AMKH 4N8CL 1AKPA 5EHDA 4KJYB 5FDWA 5FZFA 2RDSA 3T5WA 3QUXA 4CN6A 2XJUA 1ZPUA 1CK0L 1SNRA 3PWPB 4LOSA 4KRMB 4BUGA 3L4TA 4CCJA 5DO8A 4WFHE 2XPGB 2NXZC 3OKLA 3OUJA 3UYPA 1MZ6A 1ZLWH 1QEWB 3FC0A 3FQUA 1UWFA 3EXJA 3BW9B 5AOKA 1DCEA 2ED8A 2GTQA 5ABAA 4F8TA 1E4WL 2WQZC 5I0SA 5ECJE 4N9GB 4NCDA 1H15A 4XCAA 3A4FA 4LLQB 4UINH 5DYOB 4WBBA 2Y6LA 4MLSA 4LXLA 5GKAC 4QPEA 1FMD1 4EZLA 2C1OB 5A6IA 1ZZBA 1JGVL 4JFEE 5H9SA 4WJKB 1KN4L 5JHDD 2OMBA 2VDMB 2KC0A 3TIDA 4PB0L 1MHEA 4X7FC 2XTLA 4UW6A 3FH8A 4NIYE 2W8CA 2WZPD 3OX8A 3FN3A 1W9FA 5FO9A 3ZX7A 1RMFH 2BIHA 3SYAA 1AHMA 2ERFA 3QO1A 3T8XB 4DVRH 2CDGB 3BT2H 2D6KA 2RJLA 2VISB 2A6KB 4Z6AT 1M6OA 3MZTA 5E8DH 4PV9A 4HU8A 3QXDA 4DETA 3TNQA 1A1NB 2FHRA 5HJBA 1RZ7L 2F58H 3HI6H 5E95B 5TGBB 4PG2A 5J9PB 5D8AB 2BC4A 1TXKA 1OCRB 3GIZL 3UOAB 1QACA 4YC2C 3S96A 4BZ1H 5LXVA 4C55A 5E88A 1S2BA 1UMHA 4Y26A 5GS3A 2YO3A 4H4NA 4FEMA 2OYPA 4BH7B 4TSAL 1Q9OB 3W9DB 1OE1A 4RZKA 3IDGA 3RVXC 3UAJC 4P57A 3ZIYA 4L3EB 5KANG 1A5FH 5EWSA 5E4OA 3CBKB 3X13B 5I23A 4PBXA 3GBGA 2EE0A 3IFNH 5E9DE 5A2LH 3OKOB 4EF3A 4CVUA 3WNPA 3KV4A 3MTRA 3NPZB 3O12A 4XT1C 5FZEA 4KNUA 1ZD6A 3WJMA 3TONA 1RUAH 1E42A 1DBNA 3TO2B 3FCTB 3M3EA 1HEZA 5JZGB 1B0IA 1HZHH 1FH5L 1MCCA 1TZIA 4DHLA 4EO5A 3PJQA 2BUKA 4YOKA 1BD2A 4MSWA 2ADYA 1F90L 2H6UA 3ZO9A 3ACGA 5KYWB 1PDKA 2W9EH 1R1CA 3II3A 4NZUL 3OXRA 3L2MA 5ID1B 2TBVA 5JXHA 1OP4A 5EBWB 5HY9B 4N6RA 2Y3NA 4XZUB 4MV2A 1DQDH 4WI2A 4FQ4A 4HSCX 4C8DA 3W59A 4AGMA 2WZR3 3NJHA 1CFTA 4WM8B 1UY3A 4GWMA 2YR3A 3BKYH 2DEXX 2K8QA 1C8PA 3HPLB 4KXZI 1PK6C 4FNTA 3CZNA 5DMKA 2P5EA 2PO6A 1TTAA 2A74B 2FECI 3QQ3A 3AXDA 1PO22 1FDLL 3L5JA 1XIWD 2HTLD 3BP5A 1OQEA 1GR7A 4WV1A 3S98A 1H2NA 5E6SB 2YLHA 4LOFA 3ZXAC 1U92A 4QHNB 1WLHA 4IEWA 4M7JH 2HLAB 3NFSL 2BFVH 4NIHA 2JDAA 43C9B 3PIQB 2NY2C 4MDRA 5LBSL 1JZEA 4ODHH 5HHVH 1B9ZA 1OGAE 3RAJL 3D69B 1YNKH 3IJYA 1OM3L 1IM9A 1FUNA 2NY1B 2YQ3A 4K3EH 4TMPA 4U1JB 3ZUNC 1Z3GH 5DWPA 2ZXWB 2ZOKB 4P2OB 3T2NL 4CSZA 4LRIC 2Y60A 4XP1L 3TL5A 4YHOH 1LRHA 4OLZH 4QF1A 4FYSA 4YDIL 2E7QA 3GXUA 4P23D 1GZTA 3NA9L 2WJ7A 1AHKA 3WUDA 2ZCZA 1C5BL 1DZQA 3KJ4B 4GH4C 4FQHB 4W9EC 5T1DL 1TR7A 2CLZB 3FTGA 3MDPA 1U41A 1XVSA 4HLEA 3QXTA 3V0AB 2WO3B 2E9QA 3OKDB 2AZAA 1FJ1A 3R18A 5FZKA 3I3QA 2VPVA 2LTQB 2N3JA 4IW3A 2EIKB 1YEDA 4F9PA 2D3NA 2Y2TA 1WKYA 4XF1A 1M53A 4W9HC 5FLIA 1GGUA 1W2KT 3D7PA 3QHFH 3DXAA 4HKZB 4L5FE 4W9KC 3DX1A 5DHXB 4BQ2A 3H85A 3AU1B 3VI3A 1ZA4A 4HWBH 4L99A 4LESA 4ORZC 2XNAB 5CEXA 2V5YA 1LOFC 4M4PA 1IKPA 4GUOA 2UXGA 1SCSA 4Z2AA 3WDWA 2YZ8A 3LVTA 3O6LL 2BP8B 4X7SL 1OSZA 4OIFA 4AKPA 1N3NB 2HBTA 3KW8A 4WNJA 5E5RB 2YD8A 3AG2B 3P30H 4K8RH 5DD5L 3HNVL 1X5GA 1R9FA 3VXQB 3NIDF 2WNOA 4BFFA 3AL6A 4CEYC 2X12A 1P5VB 4LLMA 4X5LA 1S7TB 1KCVH 4EIZC 3WL9B 2WJ5A 1S7UA 4YZ2A 4Z7WA 2ZHKA 2XRAH 4KMQA 3UYRL 1EWHA 5DFWH 3AQYA 2V5DA 4S2DA 4ODXB 3S88H 4AM0A 5F7HA 1KPRB 3VRLF 4O58L 2XH6A 2ARJB 1QDCA 1E4KA 1JGDB 2ARJA 4J3OH 4FNSA 3THML 4XNUL 4X4YB 3NIGE 4IESA 2GKIA 2CDEB 3Q9PA 3QDGD 1H5BC 3OG4B 3SDAD 1AVAA 1NTDA 4UOQA 2P4EA 2DQJH 4Y22A 3MA7B 3PWUB 3WL9A 1W0WB 4B3EA 3N9GH 3EW3B 3TF7C 5T1JA 1P5VA 5E6UB 3FT3B 5BV7C 2N1KA 2NQ3A 4QRQA 1TTFA 4R96A 4Z7AA 2V9QA 4IEZA 4A2HA 3KPRA 4TQEL 3IDBB 1G1KA 3HN8A 2XVGA 2LW8A 4RD7A 2BP8A 3QJFB 4QKTA 4JG9A 2VR6A 2KZ1B 3NIDB 1DG6A 1VBE1 1BVP1 2FBRA 5I8EB 5TK2A 2AVGA 1QOSA 4EZHA 3WTTA 3QUZB 4DOHE 5IHZA 4NO2A 2YK1H 4PJXE 2PHRA 2PAKA 3C6LB 3HS0A 2XA8H 5E2TL 3KVBA 3TH3T 3VI3B 4CMHB 4I01A 3KLQA 4JM4H 2J1SA 3I3BA 1KBKA 2ZXCA 1VBC1 2VW4A 4N28A 5G4OA 1Y3TA 1H3WM 4N68A 1M71A 4OCSL 4XMPH 4XN7A 2DQIL 4GAYA 5A32A 4HFUL 3DGGA 5AFAA 5ACA3 4OF0A 3TT1L 3RTQD 4FXTA 3KM2A 4N9IA 5EOTB 4JFEB 4PJFB 5H94B 2QDNA 3CFKB 2FATH 1VBD2 4WUKL 5B39B 2CLZA 4UF0B 1C8QA 3DGGB 1MS0A 1A7NL 1KJVA 3LZPA 4RQQB 1AX1A 2N59A 1WW4A 4WVMB 3HC4H 2IVFC 1KB3A 3RURA 4MOAA 4XVHA 5ABJC 5FYBA 3S34H 4R4NC 4DRRA 3KPSB 2HWC3 2AABL 1NT0A 1PO23 3C6LA 3HS0B 4ZXEA 3I3EA 3IPVB 3V0FA 4J5VA 4NO2B 2VSMB 4AIZA 2OP4H 2W0KA 4DTGH 1Y6NR 4FTVA 3LB9A 3H3ZA 3DMMA 3QAZB 4TOYL 2W5PA 5T1LD 4GJYA 1PG7H 4XP5L 1INQB 1A3RL 4GAJL 4DAGH 1LE9A 5A7WA 3S0MA 2E7TA 1M7IB 3PIQA 1E8WA 5E23A 2CKBL 1DVZA 1NGWA 1QOKA 2HLAA 4GG6F 3CC5B 1U92B 1D6EA 1HH6A 1A4JB 5D1ZI 3L3IA 1LEGA 3APCA 1HXYB 3BP5B 5HGDB 3PP4H 4N8CH 1KCUL 3B2XA 4XX1G 3OAZK 1UXSA 1WZ1L 3BKJL 1DGWX 3DJTA 3GTNA 4HCIA 3AMNA 3ZLQC 4BWOA 2H2SD 3AKSA 1ONQA 5EQUA 2X4RB 4K8RC 2WFPA 1KPRA 1MFEL 1XC6A 4O7XA 1H6EA 3IPEA 3Q2NA 2AYHA 3E6BA 1CFNA 2J6EH 5HI3D 1RUOA 2BIMA 3NIGF 1S7UB 5HCFA 3LXCA 1UO9A 2YB7A 3WF3A 2NQYA 1CXEA 1W8UA 1E4WH 1MJ7H 1AO7D 4MZIA 4RS5B 4Y5VC 2FHCA 3C08L 4XCBA 4URAA 2IAMA 1PDKB 3W5MA 2ZMLA 3PY9A 5LNDA 3K48A 1F02I 4JTOA 1X36A 4MCZA 2ZF8A 3RNQB 3TCXA 4M5SA 5EF0A 5IOPB 3QUKB 2Q6WB 2FDJA 1EVUA 1F42A 43CAA 2RCSL 1CAUB 4URKA 4CP1A 3OMIB 1BDYA 3JD71 1I1FA 4Q2ZA 3TO2A 4DZBB 1RMFL 1F58L 4HKZA 1BW8A 5DJ8A 3T6VA 4J1UB 5C0FB 1OKEA 2CO1A 3BT2L 4NO5A 4HQQL 3BJLA 4WWKD 4HN0A 2I74A 3QWRD 3QPXL 2CDPA 4JHBA 4L29A 4N2CA 4XNYL 3W9DA 2DDQH 2DQHL 4KKNA 5DUVA 3KL3A 1AHWC 2OM5A 3S35L 1GPOL 3OKDA 5CBAA 4L4JA 5FGBA 2VBDA 5I1AB 1DDTA 3FMGH 4L4VA 4U3XA 4OFKA 2CU5A 3BEVB 1PZ2A 1EZVY 1MCBA 4Z1PA 5EUOE 1W0NA 1OAQL 3ZSTA 5MHSE 2BLFA 3E7JA 3TX4A 1T20B 3L9RA 3MGTA 4M6AA 2A6KA 3JBG7 5FGBC 2PWGA 3BUYA 2YD4A 1ND0A 1CESA 4UTBA 1J9QA 1TU2A 2DM3A 2C4FT 1J87A 5KSUA 1RH8A 3FYIB 3PUHA 3KGRA 3MUZ1 2C3HA 4M8VA 3IJSB 4F7TA 3SDDC 2WLYA 3OVUB 3IJYB 4WTZG 2WR9A 3N41B 3RVUC 5I17B 1RUF2 1FH5H 1N3QA 2L04A 4QRFA 1QSFD 1WBLA 4HSLA 4KGQA 5GZCA 3RJDA 2ZAIA 3D85D 4KG0A 1SLTA 2ZWSA 1WUNT 1INDL 2F8IA 3UV9A 2W9EL 4XBGB 1P6FA 2G4EA 2YRBA 4LVNB 5LG1A 1SXZA 1CI3M 4ATFA 4A63A 4ICXA 4KX8A 3WTVA 1ET8A 4YHLH 2PO6B 3ZHLA 3SBWA 5KYUB 2ITCB 3DXAE 5I1HH 3RKDD 3RZMA 3BUQA 4G6JH 3BKYL 3MYZA 3PWPA 4JFDB 4MA3B 1NCCH 1UQSB 2X7LA 1IKFL 1RD6A 4DOHB 5E9DD 3T0EC 3ARED 1SXCA 3WFCH 3T0WA 4CU8A 2HT3D 4DO5A 3RLSA 5HY9A 3IDXL 4NIGA 4WSJA 1OGTB 4GXUN 1BXAA 1RERA 2Z1PA 3GSWA 1XB9A 3H1MA 2ZABA 1UZZA 5C0AB 4X6BB 1PQZA 1T4WA 5JA8B 4M7JL 2XWXA 2BFVL 3O41B 5IB2A 4BIOA 1BD2B 4OHYA 3GSXA 2AS5M 5LBSH 4U1SA 1TZIB 4ZW8A 5HHVL 1YI9A 2Y7OA 3VU2A 2EXTA 1HEZB 1YNKL 3GZPA 4RYDA 4MBOA 1EX0A 5IIEB 2R27A 5I1LA 1HKLH 1Z3GL 4HCFA 2IQ9L 1KSRA 3W9AA 5HD8C 2WS93 4GW1A 5IJCC 2PETA 3WKYA 4XP1H 1OB1A 3MLZH 4YDIH 4U6YB 4P57B 3IDGB 1BF2A 3R4SA 4PTUA 3ZN6A 3SKMB 4RHV3 1XT5A 4LLYA 4F58L 2BMKB 3GLAA 2PMWB 4Z95L 1JF6A 1ZLSL 5JNYB 2QTVA 3KM1A 3N04A 3IM1A 3QZNA 2JLLA 3MGAA 2F54E 4U49A 1J1LA 4S0TD 3UBXA 1EUTA 4R7VA 3BZDA 5J9PA 4GH4B 3U4EB 4UBGA 4N2OA 3QXDB 3VKLA 4PJXA 5B22A 2X41A 4K7FB 2ZOTA 2CDGA 1FVEB 4I3SH 1NAEA 3VLBB 4ELMA 4TKWA 3SY6A 5HGAB 5BYNA 1I9IH 1ZRDA 4QHKJ 5F9JA 4LO7A 2EYTA 4M1CC 4M3CF 1A6AA 4GIPD 1NIBA 1BQHB 1OSGA 3UKTA 1H3PL 2JELL 1E3ZA 4WI5A 1PFOA 3D9AL 4LHUB 3KH4A 3KCCA 4NWVA 1FBIH 5JLZB 1F8TH 1CE6B 3F2LA 1FPN2 3DIDA 3MI8A 1BIIB 1TTGA 1XDTT 1ZKAA 1HXMA 1LMIA 2PP9A 4G1EB 3H7BA 4K8RL 1H15B 2VAJA 4K7PH 4KI1A 4LLQA 3MV7A 4OUOA 2CIIB 4OJEH 4WCYH 4XETA 4ODUB 2L3BA 1LOAA 4A2FA 4XFBA 1KPVB 5GZNA 3VXSD 1PPIA 3L45A 4FXKC 1A7RL 3TRSB 3UYRH 3S88L 4KWLA 4HYTB 1S7WA 1XFPA 3TO4A 1US2A 4P9YA 1XF2A 1W8ZA 5E08H 5HYJA 3PJSA 1OA4A 5FYJL 3P73A 1KBVA 1VRH1 3K46A 4OLVH 4FPCA 4IETA 3MOAH 2VE1A 1OAYH 3T04D 1PLGL 2R23A 1KFUL 1E4KC 1HI6A 3WEZA 2EDNA 2XCMC 2X5IB 3HAGA 3S7EA 1KTDB 4YXHH 2L7EA 4JY6A 5MEPB 3FFCD 3G5VB 4KKQA 4K21A 1F1GA 2PW1B 3BVNB 4BZ1A 4TQEH 1KXVC 3EZ8A 4FNRA 2V7HA 4GUPB 2A5ZA 3HR5B 4YC2B 1P1ZB 2VG9A 3TBVA 4J4PC 4EOWL 2GITB 4FQ1H 1RUE3 2X6AA 1S9YA 2HUHA 2PYEE 1P7QB 4IRZA 4X6CE 4P9IA 4CXYA 2YK1L 4I0AA 3EO9L 2OXBA 3ECBB 1YAZA 3OQRA 1U8CB 3GJFH 3EGDB 2W9LA 2JDYA 1G9DA 3L48A 4JM4L 4BKTC 4ES9A 1KFGA 5TDOB 5FAAA 3HZMB 5ACMA 3MDJA 2PP7A 2DQIH 4Y1UA 5D2LB 1DJSA 1H5BA 1KENL 3LKRB 5KVFE 3U9PH 2PXJA 2KPWA 4TSCL 4KAQL 7TAAA 5CBEB 2VUOA 1PW3A 2EXIA 2IANE 4UYQA 5DEGA 4IJ3C 2ZGLA 3IF1B 4S10A 1N3OA 1SLXA 5IUQA 2R0ZL 5DDHB 4F7PA 3EHBC 5D21A 2BIPA 4UU9A 1RFDH 2WZ5A 2R2HB 3D39D 3DUSB 1E90A 1KNOB 2AABH 1IMHC 3PQYB 5GRYA 4PJAB 1OANA 2WZ0A 1S9XB 3CZKA 3EJSA 2NY6B 2VIRA 4JHZA 1WAAA 4DTGL 4CSTA 4L4VD 4XOAA 1IOAA 1ORSA 2CMRL 3DECA 4GAJH 2DQGH 4EDXA 5K5YA 2GT9A 5C0AE 2A74C 4Y4FA 2R69L 1OE2A 4AGOA 3AM2A 2HPOA 1NMBH 2E9GA 4FLRA 4J6RH 3WXVL 4E42B 3SDAA 4NRXA 2BV4A 2UYBA 4F9PC 4N9HA 2Z91A 1MFVA 35C8L 1TENA 4YX2L 3PP4L 4PLOA 5A1LA 1KCUH 3BP6A 1MACA 3WOGA 4LO6B 3PAVA 5DEJA 3BKJH 3SDDA 1SUHA 4Z7NB 1ALYA 2WA4A 3GUTB 3SLIA 2BCKB 3DSNA 5T5JA 2NQDA 4NHYA 5CUSL 4PJBB 1NLQA 1DR9A 5B7EA 1HJCA 5C3RA 1KY6A 1GMEA 4I2OA 5AZEL 4XNQA 2J6EL 1K5MB 1IBGH 4AFMA 1JDDA 1E5HA 3V0HA 5HSFA 2RS11 1Y1UA 4K8RB 4KOCA 4QPIB 1PEZA 1LHOA 4CBZA 2J72A 2V3EA 3HE7A 3KCWA 3TA3D 4B5ZA 4D0DB 2JI1A 3MLJA 5LK5A 5BNOA 1UZWA 4U0RB 3BN9D 1A7BA 3OTTA 4U1MA 4L8BB 1RUC3 3FB5A 5EO1B 3GUTA 1YN7A 4Z8BA 2VLJA 2CBPA 1XL6A 1I85C 3O3AB 2GBUA 5C0CB 4FQZA 2LTQC 4M3HA 2VKWA 3DEMA 4QKBA 1W2UA 4ZAKB 3K3NA 1JZGA 3DX9A 2KLSA 4MAZA 3ALPA 1F58H 5E6YA 5AVWB 2M1KA 2ZBJA 4IEPA 4WO0A 5C70A 1I3UA 1SF5A 3AGWA 4FFGA 4JHVA 4OLLA 5HI0A 3IKKA 5DR5H 4QO1A 5F7EL 2OSWA 1QFWM 5GS2H 1KC5L 3STZB 4ZUUA 1ZHLA 4Y4FB 4XNYH 2GT9B 2DQHH 5C0BE 3O6KL 5EMYA 2V2XA 2ZX4A 3BAKA 5SV5A 1GPOH 1RZGA 1WA0X 1UOFA 3ARBD 2XQYK 1GR3A 3IFOB 3EYVA 5ESAA 3IK2A 3VKOA 1USZA 2VIRB 1Y6KR 5E51A 4TYSA 4DEQA 3TNMA 1V6KA 4JRWA 1GQGA 4E9TA 4A67A 1ZHKB 2Y1ZA 3U4SA 3DUSA 1OAQH 1OMIA 4XFAA 1ANUA 1WTLA 3L5IA 5AYUL 1AR1D 3VXSE 3I9GL 2QL1A 3UJJH 1CYGA 2KQNA 3P4NB 3D1MC 5AVYB 1D7PM 2FEJA 2QQNA 2A9ML 1XL4A 4HWNA 1RUH3 4QB2A 1J0HA 4P9MH 1INEH 2YEZB 4Q9QH 2F54A 1ND3A 4QHBA 1QBLL 3K1KC 1X50A 4K4KA 2XBO3 4W6WB 5SX4H 1LGVA 5J5EA 5HV0A 1CGUA 3ABZA 3EGDA 1U8CA 4F7MB 5J6HB 4ZXBA 1MW0A 4P4KD 3Q8AA 1OL0A 4ELME 2VNGA 1FHNA 3KPOB 4X9GA 1VGEL 2DQFB 3PAUA 5I1HL 2K6ZA 3BH8A 3FQ2A 4G7VH 4P2AA 4G6JL 3ETBF 5K39A 5IBLD 2HLEA 1UXXX 5CGYD 3W1ZA 1T04A 3CDYA 3GQFA 1ZS8A 3LKSB 4S0SD 2YRPA 4YAQA 1NCWL 1BLNB 2CBQA 5DAXA 1MCWM 1TME3 2WNKA 3KT7A 2K9UA 2ZUVA 4XWOD 4NROA 1O0VA 2YQGA 3IFLH 4G5AA 3HI5L 1X9RA 4NUJB 4WEUD 1TVDA 1GOGA 3MV7E 3WEBA 5D1QC 4OM1L 5HYJB 4JTNA 4WI3A 3T71A 2NY5H 5GGSY 1ZIAA 5DQDL 4LOEA 4NHUB 2VLJD 4MMZC 5EZLA 2EDRA 2IH8A 1HS6A 4X6FB 1I8AA 3OPZL 4R26L 4NZ8A 2WV3A 4YW6A 4AWDA 4X8JA 3D50A 4PEEA 1HZKA 2WZR1 4ODWB 5C07D 2W1UA 3DHJA 3LQAL 4HCRL 2NLJA 3MLZL 4DZGA 3H53A 1AGDA 5EZPA 4CCEA 2JIXB 2QQWA 1QUNB 1CE6A 4AWJC 1AR2A 5JLZA 1CLVA 2XV0A 1QSFE 4IYKA 5E56A 3MJ9L 1CR9L 3PDDA 4PJFE 4P2RE 3DOHA 5SWZA 3VWKA 4E4SA 2AANA 5J96B 1M57B 2ZTNA 1A6AB 4LNRA 4GQRA 3QZLA 1NQJA 4LDEB 3N7KA 3BCDA 3PJNA 3WLWD 3JBG3 3OQ3B 4NC2B 1ZGLP 3DGTA 2FJHA 3PUAA 2OA9A 4TUKL 2PYEA 5E2JA 2BY3A 3TA4D 2BNOA 4LDCA 2RS13 1K5NA 3M45A 1YMMB 1EANA 3DXAD 4JPWL 4K7FA 3B9DA 2X4NA 3BWAA 1UT2A 4PJXB 4X6DA 5TF1H 1BBDL 4AL8H 1ENRA 1QWUA 3G5XB 1VAHA 2VLMD 1T1WB 1I9EA 4IIZA 2O8OA 3HNYM 2IOIA 5EBLA 1I9IL 3OAUL 4GRMB 3R7QA 4HKOA 1EPZA 2ICWI 1T0MA 2VDMH 5ID0A 4K9SA 1L6XA 4KWJA 2IBBA 3GM0A 4N90E 4EZJA 4UDTB 3VZLA 4NKDA 5JNYA 3FAXA 1SHMA 2WMPA 1LHZA 4HK8A 2G2RA 3INUL 4FDWA 4WWID 1NAKL 4P5TD 3AP5A 1F8TL 5IWFA 1M2OA 1YHPA 4H0HB 2GJRA 2WVVB 4FYRA 5KSBE 2OW4A 4M01A 2OVUA 4YSUA 2AI0H 3ZRSA 4UXAA 5LBFA 1PIFA 4ONHA 3PABA 4Y8DC 1W9WA 2Z8SA 3ZDYE 3FU9A 1J86A 5E1AB 1XAKA 3EJUA 1OCCB 3L5WA 1ACCA 1GY2A 2J1WA 3OC8A 1MPAH 3RTLA 5T1LB 3W81A 2AV1B 4LF3B 3GSXB 3LZNA 3TZVD 5IVXA 1BYOA 1B4TA 5JUEL 3KDPB 1K45A 4EN3D 5E08L 2O14A 2XTJE 5DXDA 2D3RA 3WF1A 5JZGC 5JQIB 4U1LA 1ULGA 3MOAL 1OAYL 2DEWX 2D7TH 5D1XA 1OW0C 1CBVH 2GSGA 5LBSA 3WHXA 4YXHL 2JDPA 2NZIA 2HP4A 3JT2A 4UNVA 4I0KA 2X7LB 1PY9A 3FU8A 2OSLA 2ZAGA 3MJ9A 4R9DA 4JNXA 1YPZE 3EBIA 3PNWB 5IB3B 4GRWF 1F5WA 3MRKB 2G9GA 1AGBB 4LK4A 3WLWC 1ZSDB 3L3DA 2MFNA 4FABH 3ZSSA 1HCVA 2XN2A 1N64L 4W68A 1GKOA 2VDOL 2PLTA 2KMWA 1MCHA 4OV6F 2VL5A 1EGJH 2XFXA 3MRJA 4KAQH 3W2DL 5I66A 3QORD 4QY8B 1QJY2 3TO4D 2OAAA 4C0HA 1XHHA 4PJ8D 2Q8OA 3MRGA 1EHNA 2Q7YA 3PCYA 4QRTA 3KLDA 4QMEA 3ATGA 1FHGA 4HOOA 1ZZ6A 2L7JA 1PNFA 2H0EA 1ML0A 1NDGB 1MEXH 4XP6H 1N18A 1DCLA 3SKNA 4CAGA 5LGKA 1IQWH 4J3XA 1CGXA 3OYWA 2EABA 2WWUA 3FQWA 1GY1A 3GRGA 5I1AA 5FZ8A 4Y33A 2RBLA 4V33A 4AH2A 2AV7B 1ITBB 2CMRH 1RHI2 2N7GA 4WWKC 2ZGRA 2W2IA 1FFOB 1CLOH 2F1EA 4L29B 2DH2A 1NBVH 2ESVB 4KXDA 3DO7A 3T4HB 1EBAA 1WYJA 4NO5B 4X8GA 3I2JA 2DFBA 4D0QA 3D4YA 4J6RL 1NCIA 1P4IL 2E9WA 3BSZA 3C5SA 3L7FB 5DC9B 3KF5A 1QR1A 1PY4A 2XT1B 3N0PB 4GB33 4CDGC 3VW3L 4DZBA 3ZE1B 3VFPB 35C8H 5MENB 2YGQA 3ZZQA 2QFPA 3OPZA 4P9WA 3P4MA 4Y1AB 5IOPA 4SLIA 1WGPA 3DWTA 1U8IB 2HVJA 1UB5A 1J5DA 3KLAA 4LCIL 3ZKUA 4DN3H 1T7WA 1IBGL 3AW5A 2YSTA 4YHKL 1CIDA 2UYLB 3QWRA 4L3ED 3T6XA 3RU8H 3WQBA 2OZ4L 3W58A 3CZLA 2YWZA 4K7PX 3VRLE 1S7VB 3P69A 5FY4A 4HUMB 2NT1A 1CFNB 2Y1AA 1PK6A 1UMIA 3FT2B 4BSWA 1Z3RA 2VCAA 4AZUA 1Z1WA 4QU1A 2D31A 1FG9C 1DFBH 2X4RA 1O75A 1G0DA 3VBRB 3EDJA 3M3CA 3HMXL 4CP2A 3MLRL 4XTRD 5B8CA 4N5EC 2X4SB 4PGBB 5EULV 4FOWA 4QXHA 5HGDA 2EXWC 1HXYA 4KX7A 1ACZA 3V6OC 1E40A 5BOZG 4J28A 3DO3A 1GIGL 4HC1A 5BS0D 2MTPA 1HH6B 1D6EB 2X3CA 1CI5A 2VMHA 3GBNL 3DPBA 4GQ9H 1I7ZB 4QT5A 5DR5L 1L5GB 4B41A 2XTSA 4XUQA 1FV1A 1KC5H 2ZUQC 5GGTA 4NPMA 2Z0UA 2D0GA 1CD1A 1NINA 2VXJA 3ZSKA 1AKJA 3MRRA 3CFJA 1D7BA 2F58L 3FQ1A 3HI6L 5CIPB 1BVZA 4RGGA 1SOQA 3LX9A 2H1PH 2Y1VA 3K8MA 4BHUI 1DBKH 3OF1A 4BZ1L 3LKQA 1ODUA 1UD6A 4GI9A 1KXHA 5BO1H 4LOVA 2YFZA 4CC4A 1UZGA 1IGYA 1DYOA 4F7CB 4GG6A 3ECQA 1LO4H 3DV6B 1A5FL 4WVMA 3HZKA 5KYNA 3OF6A 3I9GH 3R4RA 2VM9A 3UJJL 5I2IA 3F95A 3FU0A 1CD8A 1OXYA 1QSFA 4JVWA 3X2QB 4S2FA 2E6QA 2I07B 3JD73 2FYVA 2WN3A 4ODBD 5HHOD 5L8KB 4GBXB 2A6VA 5EC1A 4R4ZA 1FORL 4P9ML 1HZHL 2BGCA 4IS6A 3S3JA 2DYCA 1NEZB 3BUIA 4XJAA 1M71B 3E9UA 1QBLH 4OV5B 4NWWA 3SE3C 1FYTB 3VG9C 1JGEB 2X5IC 2ENYA 1B0GB 2DQUL 2QPUA 3SY0B 1TZHB 3Q43A 3OGOE 5E1QA 1BA9A 5DO2C 4LLWA 3JCIA 3AAZB 4NZUH 1EMTL 5LAPA 4M7ZB 2GI0A 2IH3A 4XO9A 1W28A 4Q9RL 4UQ3B 4G70B 1S9WA 4CSSA 4ZYKA 2WLKA 3WQ7A 1R3JB 5CJBA 4DGWC 1VGEH 5A7QA 4XWGH 5IB5B 3NZSA 4JDMA 2BHYA 3KPRB 2XWJB 3QAZC 4I13B 1XIWC 5I6MA 5IEKB 1C1LA 4R96B 5GJ6A 2LABA 2QGDA 4H40A 5DVMA 5DF0A 2OMVA 2V2TB 3GBFA 2QKDA 2GSMB 4FPHA 5KVGE 5IW6A 2ZX5A 1D5BA 5C0DA 2VNVA 5DJAA 2GCYA 4DFSA 2WBKA 4OGXL 3IFLL 5ETUB 2EIMB 1F13A 2X4TA 4FG2A 5BW7A 2ET1A 3SMHA 2XN9E 4KK8C 5D7IE 2GAZA 4CCNA 2FO4B 3OAWA 2W87A 4FQXC 1VEPA 5EF1A 2L9LA 3EDDA 3USUA 3TAYA 1DQJA 1QQP1 1BAWA 4XNAA 3U0TA 4ODHL 4RMVA 3IWUA 4IJ3B 4PJHB 3V6FA 1ND2A 4HLTA 4ARXA 4DRVA 4R26H 4K3EL 1E6JL 3P54A 1LGNA 2WTRA 1RV6X 4P14A 2XIBA 1FL3B 4PQ9A 4IMKA 1S0EA 1S7TA 1U42A 3T2NH 4PS4H 3TO4C 2BFUS 3C87A 4LLMB 4MD0B 3DF0A 3BWSA 1RZKH 5I9QB 1SXAA 4X80L 4WWOA 4XMTA 3LOIA 3JV4A 3ISYA 2Y36L 3U0PB 3IGAB 4MQTB 4C56D 4RS5C 2Q8EA 1C5BH 3QDGA 2DH3A 1BVOA 3NEXA 2PABA 3QJRB 2QTWB 4XGZA 3STLA 2VQ4A 4B7IA 4K94C 4UQAA 4OZFG 4ZMLA 2Y6GA 3I97A 1CPUA 1J0IA 1RK0B 2DYPA 2QJDA 3LH9A 4QXBA 3WKML 3AU1A 4KBZA 4HS8L 1KB5B 4U33A 2R071 3OKKB 5GJTH 1MDAA 3IS1X 1YEDB 5IP4A 3VL9A 5TF1L 5JHDB 1QNWA 1BBDH 4AL8L 2I25N 2WS91 2J5LC 3QHFL 5IVOA 1I1CA 3KHCA 4PY7A 5ESVA 5AD0B 3AYAA 5K9KB 4HWBL 4KK8D 3DV8A 4X4MA 3MJWA 3IJ7A 1AZCA 4P59L 5IATA 1BMZA 3UDWA 3Q3GA 1AHWB 3C7HA 4Q1PA 2V72A 2A1XA 4RFT0 2ZWLT 3FFOA 3OGCB 4GXFA 1NAKH 1OI6A 4N2IA 2WSKA 5DZJA 4QPIC 3IS0X 1AE6H 2HFFA 3AT0A 1IRAY 4WI7A 4AIOA 4ETQA 4ZW3A 1BEV2 3AFKA 3LSDA 4YZFF 2NW3B 4H3WA 1KCVL 2YOAA 5CADA 3FT1A 1AR61 2F53A 3D0AA 4A39A 2X38A 1KLUB 4A44A 4X98B 3GZKA 4JFED 4O2EB 3F64A 4RX4A 2WXIA 5DRWB 5LBVA 2FD8A 2ITDA 1OW0A 3HHSB 3LDBC 5FP4A 1QBBA 1BG9A 1N12A 2IALB 4XNUH 1QQP3 1T3FA 1JZDC 1S1AA 1T5WB 1LO0L 5F6HJ 1RMU2 2FSDA 1AC6A 2GC1A 2C7FA 4LPLA 4GYBA 4H2AA 2DQJL 4QYOA 5B39G 5IQNA 4XFCA 2IQAB 3H2QA 1CBVL 3WF2A 1KFXL 4APXA 3FOLB 4BFOA 2Q1FA 1OK0A 5I1DA 1Z6JT 3KPTA 4B4RA 4FPEA 1QLEB 3EKCA 1YJDL 2P3IA 4JAAA 3TH4T 1IZJA 3NIFB 2IVIB 2VRKA 3BUPA 1YLBB 4L9LB 3DUHA 1KJ2H 1CFTB 3RWJB 4GT7A 1BG1A 4POZD 5DJXA 1VBB3 4IBZA 4BXFA 4OY9A 4P3WA 1LK2A 2VLLA 1WFTA 2YRLA 5ILTL 2RDNA 2ZPXA 1OCOB 3ZDXF 1DQ5A 1H3UA 4LOTA 2FZ2A 2XA8L 5E2TH 2HMIC 2NDFA 3NP4A 4NQCB 2D6OX 4Q5OA 2WQWA 4G59C 2UWEE 1AZUA 1J1TA 3BPNC 5KOVC 4JANA 1N64H 1O9WA 2BP3A 3K2MC 4QXGH 4OCSH 4OFQA 3TEXA 5BQDA 2MCMA 2QQQA 3QQ9D 3ZQ9A 3BQVA 4N2EA 5JZGA 4OM0L 4PCTA 4C47A 5I74B 3NSYA 4JZOA 1J8HA 4AEDC 3MPPG 3JBG1 2BINA 4W6XB 4U6TA 3U36B 1ADQA 4GJTB 4WUKH 1J9TA 4ZNEA 4XXWC 2CU9A 2GMEA 4IQPA 3Q6FB 1CICB 3QIWD 2X70A 4LP4A 2HX8A 3HC4L 4YFDB 1MEXL 1PZSA 2L4OA 1F3JA 3K6NA 4XHQA 2GW5A 3TEWA 4MHRA 5CYYA 4E8DA 2WCGA 2FGWL 3W39A 1XNKA 4QKDA 1XF1A 5JXEA 2IFWA 2P6HA 5TD4A 4PJHE 4RHV2 5BPPA 5DD1H 5KVGH 1BKZA 2G75A 2O5XH 2OP4L 1AH1A 3KH3A 3D3VE 3ZL4L 4EI6B 4TOYH 1MEC3 1JYIA 3VXME 4XP5H 4UB0L 4P23B 5TGBA 1BZWA 2E6JA 2VDNH 2WXJA 4RA0A 1DQML 2Q1ZB 2UUDK 5IMOB 5ANMB 2BP5M 5B3JE 1T1XA 1UT1A 3CFQA 3HRPA 2BP0B 4XJ9A 4MZ2A 2VISA 2YJQA 3IN0A 3CU1A 3L4YA 5F1SA 1XCXA 3U7AA 2AQTA 3SD5A 1IIIA 1P4IH 3U1QA 4WWKB 1L3WA 2JKBA 3KV5A 1GGBL 2IADA 3WINE 3Q1SH 2WPGA 1DFXA 2GSIA 2HRLA 4LXFA 2BNQB 3CPLB 3L3HB 3QEHB 4ZJ9A 2BSTA 4YVUA 4LUMA 4HF5L 3P77B 4PRHD 1W6PA 4J8RA 2BDNH 1SXSA 2YGLA 1AYN1 5D2NC 1FPTL 1GZQA 3IEAA 4DN3L 1AP2B 2FHBA 2PPFA 1TCRA 2WO2B 4IGBC 2CQVA 3KL0A 2JFCA 3K4DA 1QFOA 4XCYA 1KMGA 5G5DA 1OFNA 4HIQA 1PMHX 3RU8L 2VUDA 2OZ4H 3PV7A 5EO9A 4YE4H 1AS7A 1KYOK 1WIOA 2PYFA 4EQ2A 2KDYA 3OKLB 1TNFA 4QRAA 4M8QA 2XPGA 3CD4A 1RK7A 2VLRB 4NKOA 1DFBL 3DC0A 4Z76B 8FABA 4L48A 2X28A 4WU7A 1AGEB 4JPKH 4J3SA 5D72H 4NAJA 3MV8D 4KJYA 1JCKA 1MW3A 4F57H 9PCYA 1ZLEA 2PQQA 2IUWA 1THAA 2YZ1A 4ZU7A 3CCHB 1GIGH 1ENXA 1WUVA 4M9PA 3ON7A 1XZ0B 2Q2LA 4NQUA 1J10A 3CJJA 3FO0L 4GQ9L 4HQQH 4O2FA 5J7CC 1IV8A 3ARDC 3TEZA 3N42F 3QPXH 4NIKB 3ZO0A 4CDHA 2DDQL 3OGRA 5FPZA 1AZZC 2ZMNA 4LSDA 5T33L 4N43C 4X4ZA 1PSKH 1Q3EA 4JFDD 2ADGB 3FFQA 4LCWB 1SMAA 2NYKA 1DBKL 1UKQA 3EADA 4I18B 3IKCA 5MI0C 2X4QA 3LRMA 2GIMA 1KEXA 2VQ0A 5DFVD 3C60B 4GULA 1JZIA 5FF6A 3LPFA 2K2SA 2AUYA 3WCRA 1LO4L 4H55A 1IT9H 2YD5A 3CN2A 1EVTC 5GSRA 3QUZD 2HWF3 5T55A 4J3OF 1E5BA 4FQQB 4B96A 1FZJB 5I0VA 3MTXA 1T5XB 3EXLA 2AZ5A 5T54A 4XXDB 4LO4B 1ACYH 1BFVH 4NEHB 1CG9A 3MGOB 1U8JB 4QXUL 4NSKA 1FORH 1QJZA 3S7IA 5DJYA 4PWEA 4HZAA 4W4OA 5FYJD 1GWMA 3KL5A 2A4ZA 3RDTC 2D7NA 1WMXA 4AYBA 4I30A 4B1LA 2DQUH 4W9DC 7CGTA 2V4LA 4OVVA 2VITA 5JOXA 4HDIB 2FQFA 5D2LE 5L88H 1B0WA 4ZUVB 3WKQA 5BRZA 4QHLA 3ULUD 4Q9RH 4NN5C 2APWA 4QRRA 1WMDA 2VMEA 3HZVB 2QZ3A 3IXTA 3C8HA 5ICYA 3CXHJ 4HKXB 1YC61 3ESUF 2LS6A 1IKFH 2JKSA 3I8TA 4PF5A 3WFCL 3LAGA 3C2AL 3DETC 2J57A 4JM2B 5ERWB 3O5SA 2FUQA 4QNPF 4LKEA 3IDXH 4XWOC 2R2EA 3ZYOA 4OGXH 4JRLA 3UCQA 4I3RL 5J09A 4P2QD 5JYLA 2VGDA 2PQSA 1ZWIB 3WN5C 2GNMA 5C6CA 2D9CA 2YXMA 4PWFA 3U4KA 4E36A 4L0PA 1X9PA 3A5VA 1LHWA 2F53E 3SDCA 1F86A 1YC7A 5FLVA 2J1ZA 3OKMA 1E6JH 3U9WA 3TTYA 1HKLL 1QQP2 2IQ9H 4M62H 4PJ5B 1UYXA 3LJ3A 2FT8A 2DKMA 4R5VA 5CZXD 5M95B 4QX0A 5E2VL 5JXAH 2X9ZA 4CDQC 3NTCL 2QPDB 2WUHA 1O6UA 4JDZB 4MQ7B 1HH9A 4X80H 4Y4KA 2CY6A 6PAZA 3ARGD 4PJGA 3J8F2 4LFHG 3HE6C 2LT9A 3MUHL 4F58H 3VD5A 1DHKA 4WK2B 4NC1E 4CRPA 5IKCA 5L2JB 2AREA 3D5OA 3RJRA 3KWWB 1W99A 2V5RA 3VBUA 1ZLSH 4N8VG 3IM0A 3ZOIA 4UT9H 3MV9A 3O3DA 2A9AA 2EILB 4U0RC 3SPVA 2K8MA 2E8YA 1WBZB 3WKMH 3FLRA 4HS8H 3UZQB 3BCWA 2V7NA 4XPTH 1MDTA 2GH2A 4HK0A 5LK7B 4NI3A 5GJTL 4PTTB 4BCYA 1LOFA 3QOPA 3IAPA 4TUUA 3F5WA 3AMQA 4ET7A 4FFYA 1H2KA 5K0UB 3AX4A 4U1HA 4KVPA 5FYLL 4M0NA 5JIPA 2AVFA 4GAGH 2JB6B 2UWEA 5KSBF 3PP3K 4LCCA 1AL0G 3AVRA 5I8OL 5CEYB 4P9HL 5D6CA 4DT2A 1WW6A 1OF4A 1YLLA 3IYLW 4JUSA 2BVBA 5LRRA 3T4YB 4P59H 5KS9E 1UA3A 4Z78A 2YC0A 3E6CC 5B3SB 2WINB 4JHWH 2JELH 4QAMB 3D9AH 5G4NA 3S8WA 1GS7A 4QM9A 5DVOA 1ES0B 3HBGA 4WQOA 1WD8A 1AE6L 1BAGA 4PRHA 1S9KC 4X6EB 1VGKB 1HQ4B 2E59A 1D5ZB 4WCYL 5C2UB 1DQ4A 5GZEA 1LP9A 2D7PA 5LKNA 3AXLA 5FZIA 3BKCL 1ZVYA 1TZGH 1G6VK 1A7RH 1IM3B 1OALA 5FZGA 1ZLVH 3HOBA 3PAZA 2OCJA 4BSVA 5C8WA 2W0FA 2LRPA 3V5KA 4ZSOB 1ETZA 3SB3A 4RGAA 4MCNA 1OGPA 4N22A 3NKTA 1ADWA 1DJXA 3C5JB 4OKVB 5E89A 1L0YA 2HT2D 4TLKA 3S37H 1LO0H 1T22B 5IEHB 4HUKB 2Z5WA 3WSQL 5JORB 1MEC2 1PLGH 4NGHL 3GUFA 3QI9C 3DOSB 4IEFA 3FUJA 3B01A 3D4GA 3D3VD 4YHYB 4XCEA 1PX3A 3S5QA 1GWLA 1C7TA 3RL2B 1NEUA 3QQ9C 3DK0A 4FERA 1YJDH 4FXKA 2NY6D 1NFDA 4OGAD 4Y1AD 3VSVA 5HI4D 3Q5TA 4JRXA 4FQ1L 4IKNA 2CGPA 1XX9C 4YHMH 3M46A 3WCYA 5A43C 2H45A 4FPYA 4P9XA 1G7PB 3GXMA 2LM3A 4YMPA 3EO9H 3V4PA 3GEWB 1YMME 5MEOB 5DZFA 2GTZB 3NPSB 1J8HD 4H26A 5D1IA 1V6IA 4FZEH 4LEXH 1CZSA 4QXTB 3VFOA 2GFBA 2P42B 4NUGH 2F8OA 3WJLA 4DN4L 3D0LA 4K5LA 5C0GB 4XUNA 1CXKA 4BWUA 4M61A 4AI0A 1CDCA 1Z0NA 2ENPA 4FJZA 1KENH 4IU2A 3U9PL 3ZXFA 1VZHA 2FAUA 1TQUA 3QZMA 2MPAH 1JD9A 1W8EA 4JAMB 3N85H 4MNHA 5D1QB 4B0MM 4RBPH 2P46B 1TVGA 5EXOA 4N2KA 3J07A 4G8FA 4UTCA 2A75A 2WSUA 1A9EA 4PQQA 4N53A 2VULA 2EYRA 1HJBC 3VRIB 3FNKA 4G71B 3AKRA 1P69B 1WICA 4HIHB 2HT2C 3GXIA 5IBUB 3EHBD 5EIIB 4E2GA 4WO4D 4RFEB 4PI2A 5JHLA 1RFDL 1D6VH 3MRFA 2ZJSH 3P02A 2FGWH 5JR1H 2FSEB 2AXGB 1JZ8A 1Q56A 1UY1A 1ED3A 4QB1A 3I3MA 3RTQC 5KVGL 4IU3A 1CICC 3FYEB 1E27A 1E43A 1BIHA 1CX1A 3ZL4H 1J7VR 1UA6L 1XIWB 1GJIA 1BJMA 1HINH 2DQGL 2VDNL 4IBQA 4X0NA 4H8WL 2Y9RT 4W9FC 4WIQA 5FV2A 4PDWB 2ZUUA 2R69H 3V56A 4PJ6A 1LKNA 3WW1A 2I9LB 3S5YA 1NMBL 3D33A 2EIZB 3WMQA 3WXVH 4OCXL 4JB9L 4CUCA 1EERB 2J1VA 3NK4A 4P3DB 5J6GB 1F6AB 1QRND 3Q1SL 3FLTA 4IDLA 2J1TA 4IDZA 5ADPL 1AX0A 4BDVA 4YARA 5DMJB 1I3RA 1CIWA 2C24A 3TBYB 5C8JA 4YBLB 2FMDA 2XZZA 4COYA 1SLCA 2CGRL 3O3EB 5CUSH 1EAJA 1CU4H 2BDNL 3TNPB 3I6SA 2Y7QA 4MXVE 1IC4H 5KYYA 4AYGA 2FL5A 2XR4A 1F31A 3MUGB 2FNWA 3KLSA 4PBPA 2WW8A 4EN0A 3RWGB 3T0EA 3VXNB 2HWF1 2OXGA 2WRAA 1C5DA 4PJ7B 1FMD2 4YE4L 4MYEA 4NIAA 1DJGA 4R90L 5D2NB 3ZUCA 3GNMH 2J42A 5C7GA 5IK8A 1UASA 5GS2D 3UTZA 2BS8A 1FNGB 3ROOA 5BRZE 2AK4E 3TCTA 3HC0A 1ZNPA 3MNMA 4PGDA 3UPRB 5FIEA 1OPGH 4NKMA 3V6ZB 1JTZX 1YJLA 2H2PD 1AR1C 5D72L 5CINH 1JZ7A 1NXD1 1VRH3 5D7EA 2NZ1A 1UPSA 3HVNA 4F57L 5C07A 3VXSB 3PURA 1KCSH 3MNVA 3FUDA 4HK3N 2JKLA 4N26A 4YW3A 4OI2A 1MJJA 3EGSB 3FQTB 1ULDA 2RVAA 3BPZA 2J5LB 5IB4B 2P5EE 4LHLA 4QQPA 5LA1A 2C6SA 5KXCA 2E7CA 1QH6A 4QXCA 2H3KA 1MJ8L 3O6KH 1ADQH 2YBRB 1U91A 3AVSA 3A0NA 1PSKL 2E7LC 5FRAA 3FS9A 1QRNE 1YMHB 2YD0A 1RVFH 5AW9B 1MY5A 3ZX1A 3MV11 4HG6B 2UYAA 1RUI1 1TLMA 4B97A 1IC0A 5LBEA 1GJUA 3ZMRA 3QO0A 3DX6B 2DCYA 4PCYA 5C0CE 2HTKC 5B4NA 3BEWA 4LCUA 1P7QD 1DO5A 1KJMB 5L4JA 1NCRB 1WCKA 1M2VB 4N8PA 1T7ZA 2B8MA 2AENA 1ACYL 1BFVL 1F45A 4QXUH 5ICZB 1YFXA 1DYKA 1F2XK 2DD8L 4N0UE 3MNDA 3PG2A 2WB7A 3HRZB 2FLMA 3JTTB 1LB2A 1SXBA 4NM8H 5JSPA 3BPOB 5L88L 1AXZA 3T4VA 5D4QA 1SLIA 3F58H 1D7FA 4L05A 1ZPLA 4MD4A 2JCWA 4UV7L 4LHJB 4WHCA 4A2EA 3MRHA 4X0KB 4ZFZB 4L9LC 3EJJX 3FO9A 5C0RL 1W2NA 3QDMA 2RM21 3ZDSA 4Z7VB 3RIFF 1FNSH 3VI3E 4G7VL 2HH9A 1KCRL 3LHPH 1PX8A 3VXUA 3WHUA 3FUEA 1QPKA 5E1HB 5KS9A 3U75A 3GSUB 3C2AH 1NCWH 1DQIA 5KBMA 3HUJB 1WBXA 1KTCA 5I30H 3CLPA 2KHAA 1EHXA 3D52A 3K77A 4I3RH 4DY5A 2YOCA 2WT1A 4G8GB 1LP9E 1KIPA 3C5ZC 3RI8A 3BAYA 4OM1H 2NN8A 4JPVL 1G1OA 2NY5L 3KGTA 4A6SA 2X44D 4DIXA 3LPOA 1NZRA 4L3CB 4X6CF 3HRZA 1WLDA 1SJXA 3OPZH 4JQXC 1MCQA 1IVTA 1G7LA 2QDWA 2GJ6A 3GJEA 4M62L 4WWPA 1I4FA 2L7QA 3R19A 3PVBB 3ELQA 1FQ9C 5JXAL 1M2VA 3BT0A 2IPUK 3NTCH 4HCRH 4BE5A 3SH4A 5I5RA 5I8SA 2WYFA 2PTTA 3BEWB 4HJTA 4LCUB 5I28A 3EO1B 1KV7A 1RIVH 3DX6A 2IBZY 5E94A 1CR9H 4PCKA 3AP9A 3WFDH 4Q6KA 4O65A 3ARFB 1VADA 3POSA 4Y19B 1AYRA 4EN3B 5A1AA 4FZ8H 3IMMA 4FTSA 3CVHB 4WW2B 4ITCA 3K72B 1BQRA 4D3CH 5A3IC 2A6IA 2EXHA 3UDWC 3NWKA 2VR8A 2VC2L 3O14A 1ZBA3 4JPWH 4QKXB 3V0AC 3G5YB 1VBC3 3UTTD 2H26A 4GAGL 2OULB 5B1KA 2EQDA 3NNMA 3UGXA 4PCRA 5IB4A 3SIKA 1AQKL 4Z7WF 4FKKA 3MYXA 4F2EA 4P9HH 2VDML 2V17H 2QCSB 2WBJD 2VB5A 1SDDA 4HU2A 4NDMB 5C1MB 4IGBB 3HKZA 1LWHA 4ZNCD 1OTUC 4RGKA 3LKPB 4S2GA 2RJ2A 4KVCL 3UO1L 4Z7UE 1JGLL 4YHNA 2AJUH 4U6XA 2LOEA 1FNGA 3DETD 4R5XA 1I7RA 2Z3FA 1PMJX 4QDRA 3FQRB 5JDSB 1E4XL 4GQZA 5KSVA 1VFUA 1AD0A 2OXGB 3D39A 3FCSA 1LM8V 1MPAL 2WANA 4DP5X 2EDWA 5EF3A 5J89A 2ZOOA 3MUGA 4P99A 1K4DB 5JUEH 3AP7A 4FTVE 2XY1A 5LCVL 3UGUA 2EYSA 4DGVH 3O3EA 1U2HA 1OGAB 1GVIA 2P43B 4NGHH 2D7TL 2ZEXA 5FZAA 2DTSA 4PD4K 1WA4A 3FDWA 5AQ0A 4UT7L 2V9RA 2YU2A 4U2YA 1DE4A 1DVFB 2PCYA 2NRDA 5FAXA 1FNZA 4JS7A 4PJIB 1UWXH 1MCSA 3I59A 2DBJA 2E7MA 4RA0C 5F97E 3WP3A 4FI7A 4PY8I 1NPNA 4I18C 5C4WB 5LA0A 4AK3A 2I9LA 1K2DA 1SRDA 2WXFA 1SYSA 2CPUA 5ENWA 1G7QB 4OCRL 1BPVA 2ARBA 3F3HA 2XG4B 1PG7W 4YHML 4HS6A 2IXIA 1SQ2N 1UD8A 5K1JA 4I9WE 5CAYB 2D2OA 4M1GL 3LN5B 5EU4A 3T2QA 3WHTA 4HISA 5JOZA 4X5RA 3IDMB 3ZLIA 3K6SB 2C4XA 1KGXA 2YPVA 4FZEL 4LEXL 4YVNA 4Y9FA 4DN4H 4U36A 2P44B 2B4CC 1QJY1 3L3OA 2OA2A 2VLRD 1B3IA 4HHAB 4OZFA 4CMHC 2BGOA 3V5HB 4MXWA 2MPAL 2BH0A 2VDKH 2CGNA 3N85L 4FQXB 2XX0A 4MLIA 2WQ4A 3ZHNA 2W92A 4OIAA 3VU1A 3DI3B 4CPBA 1NCBH 1RJCA 1JXNA 1TMF3 2DMCA 2UX7A 3K6IA 4JRYB 3TZVC 3FQXB 4LBJA 2FYYA 1W8FA 3GZAA 2QQKH 5E2UH 3RB7A 4XP6L 5C9KA 4CEYA 3B83A 4MCYA 2XG5B 1D6VL 1IQWL 5TF0A 3MRBB 1CAWA 1RUD1 2ZEZA 3B9KD 2I26N 4JCLA 4KJWC 2KLTA 1O9ZA 3SYQA 3FZ3A 1LWRA 1KIRA 1YYCA 1KPUA 4DS0A 4F83A 1UA6H 4CADB 1SLLA 4L0YA 2OCCB 3W82A 1HINL 5T5OA 5DRNB 4H8WH 1CVRA 3C60D 3NGBC 4X6DF 4L4VE 1L7LA 3FTWA 3AREC 2MPVA 1R5VB 3D87B 4YH6A 3HAEB 5LCVA 4Y19E 2MOVA 4DJMA 4IHOA 4JB9H 2QVIA 3FL7A 4AZ8B 2K6YA 5JPMB 1JPFA 1MWAH 5KVEE 1NCQA 5CNAA 4QRPD 4KRPC 3I6LD 3VW3H 1WZXA 2H4EA 2LFEA 4PY8J 5JQ6L 4JFDE 3ZXKA 5ADPH 3LDBA 2D73A 5PAZA 4OHZA 1LGBA 1Y43B 2CJTA 5FA4B 2HWD3 3M7OA 2VW1A 4CZSA 2CGRH 4DSYA 2WD0A 1JNJA 1LD9B 1CU4L 3C5JA 4OKVA 2VJ0A 4LCIH 2B8OT 2F7PA 5B2GB 2IGFH 4WEMB 1JG9A 4HUUB 2RS31 3DGDA 2HJLB 1RPKA 4NO0B 4B53A 1JRHI 2JB5H 4GRLD 3VD2A 4GSUA 1PVC1 1S0IA 4YHKH 5HHQA 2C5DC 3RUGF 1X7SA 1RUJ1 1IM3A 1W6LA 2BVPA 1WWAX 1YIPA 2CXGA 4LLDB 1EO8H 4MZ3A 3ZW3A 1JYVA 2VZSA 4N90D 4R90H 1JFHA 2IG2L 3GNML 3UTSE 1HLCA 4FVVA 2CHNA 3HE6D 1JK8A 4ZFOA 4HUUA 1LL1A 1BZQK 1D5ZA 1AGCB 3AB0A 1N59A 1OV8A 2NSQA 2Y25A 1QPPA 1OPGL 2DUPA 3HMXH 5CINL 3MLRH 1W6QA 3QACA 4B4QA 1FWXA 4N1HB 1T5KA 3O1MA 4DKAA 5DN2A 4WZFA 4U4BA 4ZQKA 5E8AA 4LCCB 3GBNH 2CV6A 3FFCE 4P2QB 4Q6IB 1QLRA 4RAUB 5EBMA 2J12B 4D7TA 4PH8A 1OD7A 4RGOH 4QOKE 1MJ8H 4L8SA 1DZRA 3WKPA 2YN3A 1NOAA 4PVNA 5EPMA 1I85A 3FXIC 1THCA 1T0OA 1K3ZA 2H1PL 1KIRB 1RU9H 1XMEB 1RK1B 1M7UA 3BH9A 3SDXB 3RWCB 3T1FA 1MS5A 1EAPA 1UY4A 2RD0A 5BO1L 3NW4A 3QFGA 3MV9B 4PJCB 4V1DA 4MCYB 1CAWB 4FQPA 4HUWB 3VBUB 4Z18A 2GJ6E 4LAQL 1FLTX 5IKCB 2XQ0A 1XMWA 4PJGB 3QT2A 4YVSB 5DI8A 3LKNB 1HDMA 2VECA 2Z34A 1SZNA 1MCEA 3MV7D 2W07B 3NVQA 3UBXG 4X9HA 4PJ5A 4FKHA 1UWWA 3M3OA 4BPZA 4E2OA 5F7AA 5L9RA 3V5HA 4MXWB 2D3JA 2DD8H 1PVC2 2IZWA 1QQDA 4K3GA 4ZUTB 4N2AA 3KYOB 1UZVA 4GY4A 4PJ7E 2W91A 3VFTA 3AJYA 3H3BC 4NM8L 3N9LA 2E9IA 2F7RA 5FY7A 3QORB 3S5ZA 1XOYA 2VW6A 2XFGB 1OAJA 3WDXA 1HC1A 1EMTH 2K7QA 4OUMA 2ADJA 4UV7H 5HI5D 3KE0A 4OZHB 2GC2A 4WVVA 5C0RH 1JCVA 2EDOA 2AXFA 3GPSA 3EOBB 1UX6A 1FNSL 3CXDL 4Q2FA 1KCRH 3LHPL 4XWGL 4EUPB 1OIOA 3MR9B 4M43L 3TVMA 4EN7B 4F33B 4HIJB 3SEPA 4UUJA 3V7MA 3ILNA 3H7YA 2WWMD 5DMGC 1F6FB 1ZA3B 3NSDA 3VM7A 5CA6A 4Q8KA 4HBCL 3EJYC 4ZOAA 4LLFA 2FIRT 4QHLB 5BRZB 1OGAA 4FCAA 2VOVA 5LWYL 3RGHA 1JS9A 3MGUA 3WP5A 3GBEA 4ZUVA 2EIBA 4BFBD 1U3HD 3E6FA 2UZYB 5FMOS 3D8MA 1AXIB 3G6JE 4ONUA 2UWBA 3ES6B 3HZYB 1EK3A 3IRZA 4D0BB 2ZXAA 4UIMA 3TNNA 4N0RA 4ZPIA 3D39B 1FV2A 5DJYB 4MD5B 2EVXA 2QLYA 2ZWYA 4NSKB 4KI5D 3PQYD 1BZ9A 3RWDB 2V37A 4Y3OA 3GXTA 4JO5A 4PS4L 3UL4A 3T8VA 4PRID 4YS4A 1FT9A 3LA7A 1T5XA 3AZZA 3WZ1A 1RZKL 1JGIA 2P5WD 5SWZD 2CZNA 4KUZL 1XE7A 3CSYA 4HIXH 5GSRB 3BVDB 5EZWA 5I1GH 1BLZA 1D2PA 5L36A 1RIVL 2Y36H 1H3XA 3RX5A 2HWB1 5HI5C 3ZKMD 4IGBA 3ZJAA 3MJ7B 5LW9A 3WFDL 1A34A 4OZGB 3QFJA 4XO8A 3DROA 3SODB 3S2AA 3IKCB 4I18A 2VDQH 4LOUC 4UI2A 4DVBA 4ZMWA 2RDQA 4D3CL 4LCWA 2Y38A 1RUH1 1U95B 2PA7A 5F89A 4Q0VA 1RUJ3 2VC2H 1I5PA 4OGZA 4J2XA 5IVCA 4M5ZH 4M8RA 4LVOC 1PMYA 3CFCL 3ZDZE 5EN3A 1HSAB 2YPLB 2W95A 2MNGA 4DP1X 3NIDE 4YBLC 1UZ8B 1I6XA 4NFBA 1XZ0A 4NE9A 1VBD3 2ZMKA 3PGDA 5D1QD 2V17L 1VRH2 1JE6A 1NXMA 3V0JA 3AFGA 4E27A 3SGEI 3O4LE 3C6SB 3DVFA 2O61B 1TUPA 4IE0A 5E94B 2E6VA 1IBDA 2DVBA 2IANA 4L8DA 4HONA 2VR9A 4WU7B 3F85A 3FT9A 3MBED 5C0ND 1REEA 3MQIA 2AJUL 2YMOA 2EKSB 2GC3A 3BAWA 1O3SA 1L9RA 1SQMA 3F12A 2HVBA 2CKNA 1OPOA 1NG0A 1E4XH 2MTAA 2YAQA 5IQLA 4OUEA 1JU3A 1KYDA 1X3DA 2P7TB 4Q4W3 3ACIA 1OH3A 1BMGA 4HZLA 3E9TA 4IEVA 4PRBB 2A9NH 3LZOA 3N6YA 5D4IA 3LWCA 2Q1EA 1KIQB 5LCVH 2H8PA 2PP8A 1L3JA 2P28B 3P77A 2FMYA 5DZ9A 4GWNA 3ETTA 1AZVA 4FF9A 5DU7A 1UU4A 1N2RB 1LJ7A 1QTSA 1VF5C 5ALCL 2AMGA 2RFXA 2V0AA 4UT7H 5AW7B 3D07A 4LKFA 1E2ZA 1XF4A 1FFTB 3B9VA 3VTMA 4WWKA 5EEYA 3BZEA 5KS9B 3WDHA 1A6ZA 1FN4B 2ZCLH 4ERSH 4F15C 2XXZA 1KLFB 4DXTA 2HWF2 5E9NA 3QJHA 1KJ2L 3OHXA 2HMID 1XNAA 2E26A 3QDMB 2WM0A 4HWZA 3FO9B 2BVQA 4U1IA 4M1GH 4XMIA 1K4CA 5B38B 1B6DA 4PLJD 5ILTH 4NNXB 4XMUA 1TEGA 4EI6A 4ELDA 5MEQA 1JHKH 2JV6A 2Y33A 1S78C 3DXTA 2YEQA 4AG4A 5F1NA 5F44A 4XPAL 2VRAA 4YHZH 2JXMB 4KDTA 1EZSA 4H8VA 4Q4Y3 1M05B 4ZZ5A 4QXGL 4XXAA 3IRCA 2EUVA 4XUPA 2O72A 3RVTD 3E6DA 4XO5A 4OM0H 2E7BA 3WN5B 2NY0D 2C0ZA 1NY72 1A66A 1T7XA 3OB0K 2ORXA 2R4SL 2DLFL 3U36A 5DMYA 1NCRA 4BFIA 4RR3C 4R7DB 1BEV1 5FS5A 1HCFX 3O2WL 5C0IB 3KPLB 1RJ8A 1PZDA 4WRLA 4KXZH 2IXQA 3BLBA 1ZS2A 4L8CA 2HN7B 3B7RL 2G2NA 2PWEA 3H9ZA 4E9LA 1YYML 2EO9A 4Q1RA 1DJYA 3FFCA 2RR11 1TLKA 1WFMA 3BYYA 1I9RH 4IKIA 4I3GA 5DD1L 5F3IA 2O5XL 3AQXA 4A41A 4QOKA 5DTFA 2OXHB 2OQ6A 2VLLB 4UB0H 1V7MH 3ZKNC 5I0XA 3QUMA 1DQMH 4HX1A 5E70A 3H54A 2XJPA 1VLXA 3LGRA 5HYJD 3BSZL 2RTTA 2C3WA 4UT9A 2X1WL 3K3QA 1E8XA 1FIGH 2G0LA 4AVHA 2EDQA 4V1DE 5FYZA 5T5FA 3FQNA 1MWAL 3LXAA 1GGBH 2FT6A 1HN1A 2CAVA 3FULA 1WDAA 5GZND 5C07B 5LAXA 3AS2A 3EJZC 4QYOB 3VXSA 4AMXA 1AYN3 5E0QA 2V8MA 1GA2A 3JQOB 4ACPA 4NKMB 4HF5H 1XR8B 5DHVH 5EU7E 1D9KB 4KRPB 5DWUL 5I1KH 5KWYC 2IALA 2ENQA 4M4RB 2GI7A 3UTZB 2HTKD 1FPTH 3HKFA 2ITDB 4CMMA 1RVF3 3O0WA 2AEIT 2JWPA 2JB5L 5T3ZE 4Z07A 2X4UB 4X98A 1C5DB 4PJ7A 2D6NA 4MJJA 2WXOA 3IFPB 1EO8L 3F7YA 1XTMA 2IG2H 2C7UB 2WXPA 2NW3A 4F8PA 5BVPH 4GAZA 4Y9EA 3U37A 5AOMA 4PIRF 2BZDA 1UOKA 1TCMA 3KPMB 2ISDA 3T0AA 3HT1A 3R4UA 4M3CE 1RLWA 1JHNA 1O7FA 1ZV5A 1QFWL 2D4FA 5ANHA 5EEXA 1GWKA 4JPKL 3KV6A 1FL5B 1DJZA 3HC2A 4EI5D 3PHMA 3SH5A 4FNUA 3ARRA 4FAGA 3Q9QA 3Q3GB 3AT8A 2VMJA 4UQCA 1Q43A 1RZIB 2K45A 1JPGB 2BNRA 4MVTA 1I31A 3MV01 3JXSA 3QUYD 2ITEA 4LEOA 4V2VA 5DABA 3EDKA 5AD0A 3FO0H 1E28B 4MRCA 1YUHA 2BFUL 4H44C 4Z3GA 1QXJA 2XUMA 1QBAA 5T33H 1HN0A 2LAGB 1XIWA 3JTSA 3OY8B 1R083 4Q6IC 4MGSA 5JOYA 2EC8A 3G6JA 2ZHMA 3HZ3A 4N2GA 5C71A 4I87A 2QPSA 4IRJB 5K8SA 4KZDL 1JERA 2AXGA 3B5GA 1QG3A 1SBSH 4M02A 4A42A 1QLFA 2CGZA 3K4ZA 2J4WL 4JZNB 5AAWA 4LAQH 4OVUA 5FR3A 2XC8A 2F74A 1CJPA 3LD8C 1IT9L 1UD1A 3IGAA 1WAEA 2FUTA 3WS6A 3U0PA 4GLRH 2J55A 2QKSA 1A4KB 3OKEB 1HX6A 4K1ZA 4UNUA 1KYFA 3GEFA 5SX4I 4MD0A 3IJHA 4N0YH 4N2LA 2YD2A 3VWJB 2UUDH 1BBT3 2KERA 1F3DH 3GTVA 1PBYA 4JAMA 4PJ9A 1FL3A 5A6QA 1GC1H 4IU2B 3MA9L 4PJCF 2ADIB 2RHPA 4X7TA 2WVSA 3QFJE 4G6FD 4KKBD 3ZE2E 2HWD1 5C0GA 1JWMB 32C2A 5IVFA 3U0TB 3ZZLA 5J36A 4L2NA 2JJSA 1UH2A 1GL4B 4LCWE 1VMFA 2A83A 2FO4A 2VJ8A 3USUB 5DAPA 4R9CA 3ARGB 3VTAA 1UC6A 4S0HA 2X2IA 5ETUA 3TVMC 4K71C 1G7PA 4Y5SA 4GO9A 1NH6A 1PNCA 3T2TA 1CICD 3QIWB 2JJTC 4PLMA 3CXDH 2PHTA 3NFNA 5EEWA 1Q8VA 1EZVX 1S7XB 3DMMC 4M43H 3WIAA 1EYBA 4N90A 4X6RB 1BEV3 3O4LA 3IB4A 4AK1A 4Z92B 3ZYJB 2ENRA 1ZHNB 1J84A 4X99A 4MJIB 4LL9A 3UIYA 1RUKL 1WP6A 4M03A 4NLAA 4X8XA 1NC4B 5F1IA 5IBTH 4X9YA 2VCOA 2Y5EA 2K46A 1L7IH 4GB9A 5DJ2B 3EJYD 4S1DD 1ZZ9A 1B0GA 4LZKA 3DIFA 3OZ9H 3V5KB 1VBD1 2GSYA 4E0RA 5CMAB 1R3HB 3L2LA 5DLML 1JF1A 1A47A 2PWDA 4PW9A 5I6OA 5MHSD 1W8TA 5AAMA 3T3YA 2VUJA 4JKWA 1S0CA 1PGW2 4DO6A 4KY1H 2OJEB 4BV1A 5FM5M 3QGVA 5E2VH 1H9VA 1TSHA 4XPHH 4ES8A 1G84A 3HG5A 1ASJ1 1OSEA 4PLJC 4PRHB 1W0YT 4WUUB 2YUWA 1U30A 3RDJA 4E4HA 4XHJD 5I1GL 2P34A 4MMXA 3HZKB 1UOVA 2AW2A 1E9PB 2YD9A 4FTEA 3F8UB 3O1VA 4H1LB 1IGYB 4H0LC 4ZDHB 1N1VA 3D8CA 4UT9L 4QLWA 1TVHA 2BX5A 3NGBB 5GZOD 4BGLA 1HE7A 1DVTA 3BGFB 3BYWA 4XPTL 1O3TA 3BVXA 4LMQI 5EEVA 2VXRA 3D3AA 4ADIA 1QJU2 3C09B 2EUZA 5K0UA 3CFJB 1AKJB 3D3VB 3MRRB 3QZWA 4DPCX 3JU9A 4PWGA 3MRPB 5FYLH 3TIEB 3KLHC 2ZAHA 2K78A 1S9VB 4WNQB 1DUYA 3US9A 1BVKB 3MHZA 1PCSA 5CF3A 5I8OH 3LQCA 4XDOA 3T2LA 1GANA 3ZSJA 4A7YA 3WD5L 1AO7E 3ULVC 3MO4A 2QVTA 2IWEA 2W88A 4B9GA 3AB0C 4BUQA 2R49A 3D05A 4JHWL 2VLME 3WXWH 4DP8X 4PGBA 2EVIA 4ADGA 4MUVA 5AZ2L 1LEIA 1KB5L 4MMYB 3OAYH 4RGMC 1UD3A 1KXQA 1EXHA 3U78A 4LL1A 3VHPA 4HGWA 3DBXB 2X2YA 3MN8A 1UOLA 1I9RA 1DQ1A 5DEFA 3T3MF 2P6CA 2UY9A 4LEJA 3BKCH 3MJ8A 3KXFB 1TZGL 2OQJA 3IETA 1QWHA 4MDJA 4ICWA 1XCQA 4G6KH 1A4CA 1G4RA 3ALXA 4PWKA 3VGAB 5C3OA 4GP5B 3I02B 3JD72 4KJQC 4BFNA 4QDQA 2A9NL 3PXJA 5FY5A 3R1GH 5IREA 3MICA 4EWEA 1U8IA 1MFCL 3JWOC 1ZWIA 3S37L 4N6QA 5CEHA 3E38A 3FRUA 1QOTA 2XICA 4PRIE 2OUJA 3WSQH 3JWNE 4EI5C 1BQUA 4BELD 3M2MA 3G6JF 1A25A 3SDDD 1ZZCA 3SQBA 1CIUA 4CCLA 4IRSA 3BISA 1MVUB 1ODAA 3DKHA 3C5SB 4FI8A 1HQRA 1HRV3 5FGCB 4JG1H 4ERSL 1WFNA 2R4RL 4MDIA 3O0RH 2ZE0A 1GZ9A 1M7DA 4Z77B 1NMCB 4PCSA 4AH2B 4X42A 5JHDE 4HKLA 1DANU 1JHKL 1JP5A 2ZF9A 4F3FB 4Y1YA 1BXXA 4LIUA 3VKMA 1VBA2 4XPAH 4YHZL 4YJZL 1GYUA 2C9VA 4YK4B 5GGSB 4NUGL 3A7QA 4YWGH 5FGRA 2VMCA 1FATA 4AGRA 2D3PA 3JSSA 3PXLA 5F7DB 1RLBA 3V2AR 1YJDC 3V8OA 3MRDA 2EKJA 1NDGA 2E3VA 3BUDA 3CTTA 3IMVA 3ZMEA 2B9AA 3OAYK 2RB8A 3C5ZB 4BK5C 5EUKA 5ADOH 7PAZA 2H32H 2HWZH 1DGRN 3IU4H 3SDCC 2AJ3B 1FZJA 4GEJA 2ATFA 1XSOA 2XV3A 3BVCA 4QGLA 3DN7A 2LU3A 1V00A 2A6XA 5I66B 1CFQA 4XMAA 2GPZA 3K6FA 4TVUA 1OF2B 3B9KC 3RWHA 3UROR 1PO21 2ZJSL 2IAMD 3VQLA 5JR1L 1SPPB 3FUKA 5H37G 5F6LB 2X4QB 1PNDA 4G6ML 4JFPB 4N5ED 1QJU1 1M06G 4KJWD 1R75A 2HEVF 1BV8A 5CKMA 4JJHA 5D9SB 4NJ9H 5ESQB 5BNNA 1V7ML 1C1FA 1UCXA 1A4BA 1QHPA 2PTUA 3BQUB 3BTAA 2WXKA 5I82A 2HRHA 2OR8A 3CC1A 3VMOA 3M3QA 1G6RB 3CK0H 3BSZH 4W9JC 5C08A 5C9AA 2OSLB 3R05A 5DSCA 3IJEA 3U79A 1TKWA 4OCXH 4W9LC 1HK6A 1IJNA 2ENJA 3CCHA 2KH2B 2TSAA 5CCJA 1QHOA 1VBC2 2HG5B 2DWDA 2HYXA 4DP6X 4WDIB 2FD6L 1AZRA 1O6SB 3P3RA 4XUOA 4WUUE 2H2SC 1AGEA 2LVEA 4QOKD 2DU1A 3ITQA 4Q4V2 1LLAA 2EXYD 4M8UA 4Z76A 8FABB 1BZDA 3BHBA 5DWUH 4XN2A 4HP5A 1CUOA 1CBJA 4RMTA 5I1KL 1IC4L 5DQ9A 3HS9A 5IJDC 2ERJB 5J1AB 1FXZA 4P5HA 2N0MA 1MPXA 3LNDA 4HA1A 3EBAA 4UDUA 4UT5A 4A3ZA 1DGWA 4MAYA 3TFBA 4NRZA 3NJFA 1XBDA 3LS5L 3VXRD 5L7OB 6TAAA 1UGNA 2WLJA 3N7MA 3RVVD 4OI0A 2QFRA 1T83C 1RIUL 4OCWH 4NPJA 1TCRB 4P04A 1JUHA 1YY9D 2GG1A 3QNZA 1EV2E 3RSJA 1AR71 4JVPA 4MNGB 3NDYE 3K6OA 3W3BA 1W6PB 3APFA 4R4ND 1Z78A 5D5MF 2Y0IA 4JFXB 4U1GC 2RALA 3B2MA 2DURA 1V55B 3HCVA 1LNSA 2YYOA 4MMZA 5A7EA 4QDSA 2GSIB 4PG2C 1ID2A 3JYBA 1J8KA 1LENA 1KCSL 1NICA 1HILB 4TYUA 3RILA 5C0BA 5ID0B 2WAOA 2LW3A 1PAMA 4KTDL 3PL6A 2FDFA 4AENA 3L3KA 4KMTL 4XH2A 2MRYA 2AAVA 3KQRA 2BWAA 3CDFA 2JKNA 2LQRA 3U10A 2EO1A 2LU4A 4HCRA 1MZFA 1ADQL 1HWGB 1JS4A 2DWYA 2XN9A 1K5NB 2YD3A 4UM9A 5D7IA 1VE0A 3MMEB 2H5UA 1YEIH 1RVFL 2WNVA 1TZ8A 3ASNB 4Z3TA 2JKRM 4FFWD 2WP3T 1SBSL 2GC4C 2Z1KA 3N7LA 3GT6A 1M3JA 2OW7A 2BZCA 5IV2B 1R093 2CG9X 5SWZB 3WIHA 4ZXBC 1XSRA 1HAWA 2VZRA 5CKNA 3LEXA 3WTXA 2JIXA 3VBHC 3RKDC 4BCZA 3VB9A 4C1WA 3KF3A 3CSBA 1V54B 2ENSA 2QKIB 3LQZA 3ZFGA 1FFRA 1JNNH 4N0YL 1J8HB 1KYOJ 3VBFA 3TBTB 1GC1L 5BNPA 5BZXA 2BK8A 3ETPA 2FB4H 1N5YH 2GIXA 4Y2OA 4LKSA 3FSWA 3MX0A 4I89A 3LKJA 1J59A 3SZ6A 4NUMA 4MGQA 1QBMH 4GSDL 5FUIA 3S5LB 3WDVA 3F58L 4F15B 1BX2A 3D48R 1MRDH 4NUJA 2ZOEB 3BAXA 5F7KC 5BVJB 3FU7A 4KRNA 3KLKA 4G80A 3LDRA 4YW7A 3RWJA 5GGTL 5A6XA 4ZMZA 5HCAA 1XF5B 4X4ME 1BZ7A 3MCKB 1TDQA 4P06A 2FR4B 5DMIL 2H1LM 3VFSB 5KVFL 1BK1A 2BSBA 4K71B 1HNGA 2IGTA 5CWSB 4OVEA 3SCGA 2NUPB 3QCTH 5B1JA 2I45A 1FGVL 3ZPYA 4UAHA 3SPIA 4CDWA 5IT6A 3FOLA 1QNIA 3K2KA 3QIWC 3FU6A 3N1GC 3ZIMA 4WKZB 2VABB 2JVUA 3CFEB 5I30L 1S4CA 2WFF1 4I09A 3PUUA 5IBTL 2YFNA 1KXQE 4Q52A 1MR5A 3UT0A 1G7YA 1B90A 1U3HC 1L7IL 4X4KA 2YBGA 1KV3A 3QXAB 4KJPD 2QV2A 4JPVH 4KVNH 5DGQA 3DI2B 3CLEL 4O2EA 2IEPA 5DLMH 2JB8A 1TEIA 4OHXA 2R56H 1LECA 1VERA 4KY1L 3PLYA 1UYPA 2HRGA 2XETA 2Z8RA 3DYPA 4QTFA 4GXVL 3GZEA 4ZO6A 3NQIA 2F7IA 3M7FB 3DMMD 2VQUA 5AB1A 3P0YH 5HI4C 4U2ZA 1DBBL 4JHAL 3SHRA 3WNMA 1BWMA 1N1SA 4OGYH 5DFTA 2NR6C 1OT4A 1NLBL 3CZFB 3J2PA 5GZGA 3IU3A 3MREA 5H37A 4HETA 2AKRA 2FE0A 2CBMA 5INCB 1E67A 4FZ8L 5K9KA 1VB4A 2R30A 4WO4A 3O8XB 4KDVA 3MBWB 3ZYFA 3ZHFA 1BBT1 5KXBA 3EDEA 4ZBJA 4FPKA 5FHAH 3CXHK 4CVWA 1JOJA 2ALAA 1RL3A 3NAPB 3BGFC 2DLEA 5DJDB 1IS6A 3OKKA 1L7TH 3GRWA 5AW5B 4QX3A 1AQKH 4J3BA 3ZHDA 4D8MA 3EGXB 5IFAL 2W0XA 3WD5H 1IAKA 3CV5A 5GGRY 2WCSA 2NY2D 3CZUB 1GTNA 5L2KB 3O4OC 1Q0YH 3O3AA 2IAMC 3WEXA 1KB5H 3FTVA 4KVCH 3UO1H 3CMOH 4GO8A 1LDSA 1N6QL 4ZS2A 4N7IA 1AGFB 1JGLH 2M83A 3NCWA 5F2SA 2BIIA 3TYFA 1JYNA 3P9MA 3C8KB