2WN2A

Structure of the discoidin i from dictyostelium discoideum in complex with galactose beta 1-3 galnac at 1.8 a resolution.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
254
structure length
254
Chain Sequence
AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISCOIDIN-1 SUBUNIT A
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
total genus 63
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wn2A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wn2A01
5EJ1B 2W3JA 3C7EA 4PF1A 2DDUA 3T09A 3HEIA 2VMCA 3ZM8A 2R7EB 4CUCA 3VDCA 2CDOA 4XUTA 5F7UA 1CZTA 1NAEA 2RJ2A 4LPLA 4QX2A 4PQQA 3P6BA 3HN3A 1DP0A 1NKGA 2E26A 5JR2A 2WN2A 4D0QA 1O8PA 3C8XA 1OF4A 3LE0A 2Y6LA 3CKHA 4PT6A 2VZ3A 3IAPA 2HYXA 3NRUA 2E32A 2J1SA 3THDA 3WNPA 1W0NA 4TXWA 5CYYA 1PMHX 1XPWA 3IAQA 1JU4A 2LS6A 2QQLA 1T2XA 4DUXA 4OMCA 3SKVA 3WMPA 1KGYA 2YB7A 2EIDA 2EIEA 1W9WA 4A42A 5CZKA 1US3A 1HN1A 4QDSA 2B4KA 4QB1A 2ZXQA 2YC4A 4Z2AA 1W99A 2E31A 5I0DA 2L9LA 4A6OA 3HJRA 2CGYA 3OEAA 2EIBA 3OEBA 3LPFA 4JHZA 2X05A 4GWIA 3T2QA 3DYOA 1TVGA 4KI5M 2VZOA 3ETPA 3VD3A 2WZ8A 5JXHA 1J84A 3A7QA 4MGQA 2VC9A 3I3BA 1W9SA 3WF1A 1UXZA 4QX0A 2LW8A 1IQDC 2WQ8A 3J7HA 2Z4FA 4MADA 3I97A 3OGRA 1JZ4A 3CZJA 1JZ2A 1D7PM 5LCWL 1XC6A 2QQJA 2VZ1A 5HXMA 2BZDA 1JZ6A 3DYPA 2C4XA 2VZVA 2WAOA 4TTGA 2W87A 2W1UA 2J1VA 1F4AA 3VD9A 1JHJA 3GDBA 1GU3A 3K77A 2YFUA 1CX1A 2J1EA 2QQIA 3THCA 1OH4A 3WNMA 2QQKA 4W8JA 1MPXA 5JXIA 2VZRA 2ORXA 4RN5A 3WF0A 1CIYA 4A3ZA 2VCBA 5J1XA 1JYWA 2XOMA 2J1RA 3BGAA 5LA0A 3T0DA 3MUZ1 4M4RA 3LEGA 3VD5A 5IJRA 3IDAA 3GGLA 2Y6JA 3WF2A 1K42A 4E8CA 3OG2A 1JYNA 4MOAA 3IB3A 2E33A 2B9VA 2RV9A 1LNSA 1WCQA 3NNGA 4AG4A 2VTFA 4QX3A 3A22A 2X10A 5C71A 2VCAA 3WNLA 3ABZA 2JD9A 5HPOA 3P1IA 4LKSA 5DPNA 1UY4A 4DXSA 2CE6A 4DUVA 1CZSA 1NX9A 5IYYA 4ZZ5A 5C70A 1DYOA 1L7QA 1UYYA 3W5MA 1GMMA 4A41A 4XZUG 2ZEYA 1JZ7A 2VCCA 3NJXA 2VR4A 3K4AA 2QQOA 1GOGA 3SEPA 1DLCA 3E1F1 3EB7A 1PX3A 2X09A 3DECA 3EYPA 4BJ0A 4DEQA 4UI9L 4JKKA 3LEIA 4QDQA 2VZPA 4P00B 4LQRA 4MO3M 2VZSA 1OF3A 3BN6A 3GXUA 2BBAA 4BK4A 4JKLA 1I5PA 1JZ3A 2W95A 4JKMA 4CVUA 2WABA 4P08A 3GM8A 4L0PA 3MUY1 2W94A 2WAAA 3K75B 4OUEA 4GWJA 5EJZB 5IHRA 1TG7A 1PMJX 2VZQA 3AC0A 3SEEA 3U37A 2JE8A 3F2ZA 1O59A 3A23A 1UX7A 2QBXA 2WO1A 2W92A 3DYMA 2BGPA 4KMQA 3UNPA 3HNYM 3NQHA 4P5YA 2VZTA 2QQMA 4BXSV 1PX4A 1JZ8A 4M4PA 4CU8A 3I2GA 1JU3A 1XNTA 4ZY9A 2ORZA 2PQSA 3HOBA 3ACHA 3I3EA 4A44A 2CGZA 5IFPA 2C26A 2VJXA 4XUQA 2VM9A 4FI9A 2J1TA 3MBWA 3T0BA 4OZOA 3OGSA 4A45A 2V4VA 3WMQA 4E8DA 1GUIA 1JI6A 4OMDA 2WO2A 1UYXA 3W5NA 1EUTA 1W8OA 5DQ0A 4QB2A 1GNYA 3C7GA 5DMYA 3ECQA 5JUVA 2VQUA 3FN9A 3HPNA 4HG6B 3WEZA 1GOHA 3VDBA 3C7HA 2W9XA 2YFZA 2RVAA 1SG3A 2C9KA 1W9TA 1L7RA 4GZ9A 3CQOA 1JYVA 2DCJA 3I3DA 3MV01 2W46A 2VQTA 2ZEXA 4W50A 3UETA 3WNNA 3UESA 2J7MA 3T2PA 3I2FA 1W8NA 4AAXA 4BK5A 5FUIA 1UY2A 1XNAA 3VD4A 1H6YA 2Y64A 4W4ZA 1OD3A 1J83A 1BHGA 2J1UA 2VMFA 2WBKA 3OBAA 2WO3A 3T08A 2XONA 3FHAA 4Q56A 4XURA 1H6XA 1CZVA 4QDRA 4ARYA 5B4NA 4CU6A 2KD7A 2VZUA 1EUUA 2WN3A 1UY3A 3SKJE 2VMDA 4BDVB 2W1WA 4ARXA 2Y6KA 3HNMA 2J22A 2VL4A 4CUAA 2WDBA 3ACGA 2BERA 3LQCA 3A21A 3VD7A 4QX1A 2V72A 5JXGA 1R64A 1JZ5A 2Y8KA 1P8JA 2ID4A 3FL7A 2BGOA 3T2OA 3OB8A 4QPWA 2WUHA 1US2A 1UMHA 1OT5A 3ACFA 1GQPA 3PUHA 2YG0A 3I2JA 2WYSA 2OKXA 3VDAA 4IUGA 4DEVA 2JKXA 4OYUA 3CMGA 4XUPA 2YC2A 3WSOA 1YQ2A 3OGVA 3FHQA 3C7OA 1JYXA 3JXSA 2Y6HA 1KEXA 5A1AA 2ZEWA 2W1SA 3WNKA 3WQBA 2XQXA 5B4XA 3I2HA 2W5FA 3IIIA 5IFTA 3K46A 3HNBM 2CCVA 1UWWA 5G05L 1SHWB 4LHSA 4MGSA 1K12A 4DXRA 1WKYA 4RYDA 3LEKA 2QQNA 5EIYB 4UOJA 5G04L 2CDPA 1K3IA 4CUBA 4ZZ8A 4UAPA 4DXTA 2JDAA 3D3AA 5LA1A 3K4ZA 1UZ0A 3I2IA 4DUWA 1SDDB 4P02B 3CIHA 2J1AA 3NJVA 4D8MA 2W1QA 2HLEA 5LA2A 1UY0A 3ACIA 3WF4A 3CDZB 4YPJA 1NUKA 2Y6GA 2V5DA 4XUOA 2VMEA 4JX0A 3I2KA 3K4DA 1K45A 2ZEZA 3MO4A 1UXXX 1ULOA 4QB6A 2XHNA 2W47A 2VO5A 1GOFA 4XUNA 5JMOA 3PUIA 4KWUA 1O8SA 3WNOA 2DCKA 2W91A 2EICA 5DN2A 1ULPA 4CU7A 4XVHA 4ET7A 3CZUA 5C7GA 4CU9A 3LPGA 1UY1A 1UYZA 4A4AA 4QAWA 1F4HA 2VOTA 3T0AA 3MV11 3WF3A 4ZXEA 5JXJA 2WZEA 3C7FA 1UMIA 1RYYA
chains in the Genus database with same CATH superfamily
4HW6A 4GS7C 4FNLL 3X12A 2Y0OA 3EBAA 2GK2A 1E3ZA 2A5UA 3IM1A 4E9WA 2X4TB 3ZM8A 3B93A 3LKRB 3DTUB 1U0QA 2VMHA 1G0YR 4PJ9D 2GBTA 3ZSTA 5BZDB 1XR9A 1P6FA 2J12B 2SEBB 2WO2B 3DEMA 1QUPA 1FZOB 2CGRH 2P26A 3JYCA 3KW7A 4GW4B 2VVEA 2ZHNA 4QGMA 1FZKB 2RS31 3BSHA 4X5XA 4JPIA 4ZMOA 2GBAA 5K59E 4HKJB 4JFHE 5AVXB 5FWRA 3VFMA 3TEYA 1GCFA 4Z3IA 1YFWA 4Y4FC 3RYMA 2NT1A 5L6YH 3MYJB 3DO3A 4LIQE 3R4DB 3HZYA 1NC2A 5MEQB 4GEIA 1OL0A 3STBA 5DS1A 3M1HA 3LOWA 3ZFGB 1J1LA 3BP7B 3UTTA 3VX1A 1AGCB 1KTBA 2AK4A 1N5AA 1OUSA 2DQIL 3VB9A 3W38A 2APVA 3DPBA 4N9GB 5D70L 2WNVC 4FA7B 3FQXB 4LHKA 3QUXC 1C8M1 4WU7A 1ESOA 5CILL 3AG3B 2GUOA 4LLYA 1ZT4A 2GG1A 2WZ5A 3OM3B 3Q9OA 3ZX7A 2ZCKL 3L45A 2GH2A 1PG7H 5DHVA 5DHXB 3MA7A 4YVSA 3OVUB 2QVKA 1ADQH 1N12A 2Z92B 5FKPB 1TVBA 4X7TA 3QXWA 1D5IL 4ZPVB 3C60C 4Z8FL 4XOAA 4Q6IC 1QTYT 1ROWA 1HV0A 3ASIA 4YR6B 1M6OA 4P48A 5DUBA 1G7JB 4M93B 1PO13 3RRDA 3FTUA 5I16B 3RI5F 5L9BA 3K6SA 4AHZA 2FCVA 4S1SL 2F5AH 5T5OA 1MCNA 3LV3A 3KHOA 2EVGA 1IKQA 1DVQA 5DABA 4NIIA 4ZFFB 3WHE0 5EOQH 1UZ8A 1DBML 4P9WA 1HDMB 3FRUA 3RVHA 4WVMA 3P9MB 2FQFA 3G5YA 4OQTA 4FLRA 3NJGA 2W60B 1CF8L 1HOCA 4JDZB 4K15A 3ETPA 2VERA 1PVC1 2WZ8A 2BDNL 1N68A 2PTUA 3WFCL 2X44D 5BNOC 5FZGA 3LS5H 1F42A 1RMFH 4P9JA 1Y18A 1W03A 4KBZA 4DT2A 3VDDB 1C08A 3A4FA 4J3VA 2ZICA 3J7HA 2H2SC 3Q8BA 3JD73 2ED9A 4I48B 4XETA 3KYMA 5C08A 4YVUA 4C8XA 1EPFA 5BRPA 3ZIXA 1TJMA 1M6UA 4YDVB 2BS8A 2EO9A 3ECVA 1RUPL 4Z7OF 1H3GA 3ZIYA 2VUAA 3GBEA 2UXGA 1DL7H 3TJEL 1RV6X 3UTTD 4Z23A 2WAOA 2F7IA 2AK4D 4IKLA 4NKIL 2TAAA 3RX8A 2W87A 4PIRF 4MVBD 4CCCA 1U95B 1D7CA 2VUKA 5BXFB 3SOTA 3IDXH 1NCIA 4N0YL 1TJIH 3RA7H 1CL7I 1Q1JL 4QAMB 5CAZA 2W38A 1EK3A 5GS2D 5JHLL 3RNKB 5C3RA 3CDGA 3IFPB 2IEPA 3PXLA 4Y89A 4Q9QH 4N53A 1TO5A 5KVFE 1CIYA 3NJHA 2VCBA 3BRDA 3MLYH 1QJU2 4FOVA 4LEJA 2H0JA 3SGJC 2XUMA 4MQ7B 3IPBA 4LAQH 5CN2A 4F8AA 4XMTA 4H3WA 1E9PB 3SSGA 4FCAA 3V10A 2E9IA 4OCRL 3GB7B 4ZW3A 3HKZA 2WZ6A 4JZOB 4KDWA 1PF3A 3ZFFC 4HN0A 5KUKA 2KLSA 5FYJL 1XGRB 4GBXB 4FXKA 4WVZA 4MD5A 1XCTA 3AP5A 2RV9A 3AXLB 4X5WB 4H7LA 5LK7B 4JG0H 4EPSA 1FFOB 2NCMA 2FSEA 3IPFA 1T1ZB 5ES4B 1LO4L 2B59B 3ABZA 4JANB 2JD9A 4LBOA 3LDBC 2BSCA 3QIUC 4GXUM 2VDLB 4XIOA 5JA8B 3DX8B 3D51A 1SPPB 5T3ZE 5F6HI 2JDNA 5EORH 2MPVA 3FCSB 4LKSA 5AL0A 2W9DH 1BXVA 2JIGA 3TA3A 5KSBF 3UL2A 1X5LA 2AJ3A 1WMFA 5JZGA 5C08D 4G72B 1A9BB 1IC1A 4AGOA 1W16A 1Z9MA 3SD2A 1DVZA 1QW9A 5IUCA 5FZ4A 5IW3A 5C09B 1GKOA 2Z8SA 3SXWA 1WZXA 3M7FB 3P0GB 1SDYA 5IVXE 2NXZD 1AAJA 4HMEA 4Z7WA 5BV7B 8FABA 2IALB 4TNVF 2A71A 2XJUA 2YN5A 2IWEA 1EIBA 2FT7A 1BYNA 2J6EA 3LEVL 2M26A 3DJTA 3QIBC 3ARVA 5GS3A 1KIUB 1LILA 2WINB 2JB4A 4M43L 4M8UA 5DEGB 2P48B 1KCUH 3N9GH 4WEUD 2WFF2 3PWJB 1KCSH 4AIEA 3OBTA 1V70A 5D96B 1RQ5A 5HYQA 4OCWL 3L3KA 2YQ3A 1IGFH 2P46B 2QKIC 3UMTA 4IESA 5BNPC 4FHBD 5E6IA 2VDOL 2WABA 5T1JA 4HEME 1RJLA 1KWGA 2W5FA 1F4WL 3WEXB 4RFNB 5TF0A 4YM3A 3MUY1 3GSRA 3NCCB 3U30C 5BUGA 3UPAA 1EJ6A 2NXYC 4XPBH 3O1MA 5GKAC 1OTSD 4F3JA 2ZSVA 1RL1A 1KJ2H 3GMRA 5EJZB 1JGDA 5IHRA 2FDGA 4OJFH 3SPVB 1Z5LB 3DV4B 4FJ6A 2WQWA 3MLUH 1TSRA 3L4CA 1GR3A 3WN6A 1MEC1 5HY9B 3QAZB 4R26H 2QBXA 5F1RA 1TMF1 4G43B 1PO21 5E94B 5CEZE 3NQHA 4POZD 3GALA 5IKCB 2A2QT 1GXEA 2OT7A 1SQ4A 3I2GA 4QT6A 1RUAL 3LRSB 3QEUB 4IIQA 1ENQA 1JU3A 3SO3B 4CCDA 1XR8B 1MZ6A 4UTBH 5F96L 4XGZA 3V55A 2C34A 4NLAA 1J12A 2O6PA 2X28A 4A44A 4XWOC 2BVEA 4KI5F 4JRXE 5C0CB 3KZ8A 1U93B 3TA3D 1UO9A 1LE5B 2UY8A 3V0WH 2Y2WA 2IWGA 3DSFL 5DJYB 2HRGA 5FGRA 3FTVA 3RPBA 1HXS1 3GJAA 1OOWA 3SCMC 4NWTL 3LN9A 4TUKH 3C09C 1I8IB 3FS9A 1PKQE 3H3PH 4HHAB 4GAYB 4OCYL 4F7CA 3ULUE 4WU5B 1CGVA 2EH8H 3K6IA 1UYXA 2BPBA 3TU6A 3QUKB 2YFOA 1ZJBA 4X4XB 3IDNB 3WFZA 1QACA 1UM4L 1F5WA 4BIFA 2JELH 1P6AB 4I2XB 3ABLB 1LOBA 3DPDA 1CFNB 2WLNA 3LNHA 4AEDA 1MREH 5JHDE 1CDYA 1KZYA 4ZMWA 5MI0C 2E27L 4B60A 1WGOA 4J1XA 2Q3AA 4QHMB 3BAXA 5J36A 3CXFA 2OTPA 1HHKB 4JKPL 3IDEA 5DUWA 1M71A 2XA3A 4C47A 2C9KA 5T5NG 4AQ6A 4XBPA 2OZ6A 4UW6A 1KJ3L 4HT1L 1TQUA 3CN2A 3LQZA 3WIHL 2CYFA 2DCJA 3VZKA 1FJ1B 5EJ3A 4JN2A 4M7JH 4NRQA 4PJFA 4XFAA 3HW7A 5CADA 3ZO0A 5I1EH 1JGLL 3TNMA 5E00B 3TYGL 2ILMA 2AZUA 5DEFA 4QQPA 1J18A 4H13C 5I5MA 1GYAA 4GUPA 3TTYA 2AXGB 4OY9A 3U1SL 2FT8A 3BE1L 3QZNA 2ZX3A 1JZHA 2G2RA 3AUWB 4QU2A 3GI8H 5KTEL 5L2JB 1IAKB 1XNAA 2GNBA 3HAEH 5HHOE 1DO5A 2GQHA 2Z6FA 3MV7E 2ADFH 4QHUB 5IIEB 1LU2A 3RMXA 5CR1A 4PJBA 3O9WC 1O5UA 5AZEH 1DQ4A 2VNGA 4ZO7A 1DBAH 2E9QA 1Q9WA 1MSPA 4OCSH 4ONUA 4HOWA 4M3CF 3HG0A 3ZQXA 4W9JC 1NJ9A 1SBSL 3W37A 4D9RD 2PHFA 5TH2B 3NAAL 1TZHB 4WWID 3KPMA 2BU9A 2DCYA 1E67A 1W2TA 3POGA 4IIZA 4L23A 2FMYA 2R30A 4LDLB 1PZBA 2WVVA 4U1SB 2ODIA 5E89A 3GMMA 3K8KA 1H6XA 1FE8H 2YAQA 1R5IB 3ARBD 4G1MB 5J6HB 4XNBA 1Z0MA 3RJQB 4YDIH 1MQTC 4EZKA 3Q2WA 4Q4IA 3QR2A 2Q30A 3RKPA 1U3HA 6PAZA 5FO8B 5AOKA 4WO4B 5IK3B 5FWEA 5I1IH 3MACL 3U9PL 1MCPL 3O6FC 4YDJA 1F6AA 3HMXH 4BDVB 1EGJA 3MXVL 3LA3A 4H14A 5E4IA 2IVIB 4FD0A 1AE6H 4X4YB 1UASA 3ILQD 5DFVD 4YQXH 3BIWE 2YXMA 3HUJB 5EA0H 2BNUB 3FX3A 3DXAE 4IRSC 5ANQA 3F7RA 1LNUB 4KTEH 1WICA 4MJ6A 5GS1B 4L4JA 1NGPL 3QORB 4BFIA 3H4FA 4JDVB 4K94H 5GRUH 2HFGL 2V7NA 4F27A 3KXFB 2CRYA 2CALA 1TO4A 4OGXL 1L5GB 1AYM3 2ZAGA 4KY2A 4Q4X2 1KCBA 1OAXL 2COQA 3NCYP 3N7MA 1NAMA 2WKGA 5E2TH 2NNXA 5EP9A 1JZ5A 2Z64C 3HIZA 2ZOKB 1F9KA 4YG0A 4PV8A 3OKDB 3MGTA 3LZFL 3QZBA 4QOKA 3GIVA 3HNTH 4QRPE 3WV6A 3H9ZA 4L8DB 3S37L 3W82A 4DKFL 1A6ZB 1BJMA 1KXTB 2ZXWB 3CC1A 1CAUB 4R7NA 1VAVA 1UZGA 2XIIA 4LASH 1KT2A 2F5BL 2C9SA 4JGZC 5LJYH 4XMAA 1EANA 3IGKA 1YEEH 2G5RA 4YE4H 3VFOA 1AZUA 1MELA 2ZUQC 1VFBB 1XXNA 1UKRA 3SPHA 3MLLA 3RFZC 3L5IA 4G5ZL 5CD3B 4NO3B 2XL7A 2MIZA 3GMQA 3ARFA 2CV6A 5ESAB 3D39E 3ZRCC 2D0GA 4JDEA 3Q3GA 4ASLA 4L4VA 1Z3RA 3OKYA 1J3QA 1TE1B 1LWJA 3OKOA 1ORQB 2HG5B 4UWQB 2XXGA 4WI0B 2HRHA 2X1WL 5A1AA 3GGWA 5CWSB 3PFQA 4TS6A 5B1BB 3N7JA 2HT4D 2Y06H 5FYJE 2VC2B 1UZ6F 3QEGL 5B4XA 1BX2B 5IB5B 3RGHA 1YEDB 3RPIB 2J5WA 1TQ5A 5TK4A 3TBTB 3ZKQD 1DGWX 2VDLL 4HLZG 4K3JH 4D3CL 4X7SL 5LNDA 3UJIH 4XDPA 1LK2B 5CJOH 5AYUL 3T3MB 4RYDA 3Q06A 2R041 3ELNA 1ND0A 1EHKB 1YEFH 4Q8LA 3EYUH 2NCEA 1CS6A 2XQ0A 2WO3B 5DDHA 3LPPA 4JS7A 4PJEA 4ZZ8A 4UT6A 3IFLL 4EN2A 3U7WH 4Y9CA 2XQBH 1ZBE1 1QSEA 3VUOA 1PDKB 5J1SC 5MERA 1S4CA 4RFRB 4Q0QA 2X12A 2R062 2UZIL 1IQWH 5E4AA 4KTDH 3V0AB 5ITBH 1V6NA 2Z91A 1CCZA 4NBXB 2H6OA 1OOPB 4MNHB 1E7VA 1FGVH 4O4YL 3LN4A 4D69A 3BVTA 3WF4A 5F3CA 3B34A 3ZL2A 5C0FB 5AZUA 1T6BX 1M7DA 3BGFC 2O26U 1QLEB 3CZSA 2UY7A 3FQYA 4QOKD 5L7XL 1B3JA 1GICA 1RJYA 1R3LB 3VGHA 3VNZA 5BQ7B 3QH3B 4PJCE 4DQOL 3X3FL 4MA3B 2RCSH 1EO8H 2QFEA 3PYCA 1OT2A 5A7BA 4UTAH 4YNYA 1LLAA 3MRJA 2RHPA 2C9QA 4O9GA 1QSZA 3GXTA 2IDUA 1OLMA 3ZXKA 3ARFD 2IDQA 1F6FB 2BNRA 3H85A 4QY8B 3ZFEC 1A8JH 1H0DA 3BP4B 1MRDH 3HI5L 2VECA 2RM21 5HCFA 2VN4A 2RDSA 2YPDA 1W8WA 2F2HA 4MA8H 2VNOA 4JAAA 3Q1SL 4QYAA 4XVHA 2WNGA 2FIKB 1NOFA 3IFOA 1RU9H 1DGWA 4K3DL 4R84A 4RWYL 5IFHL 3LSOA 1S78D 2ESVE 2VRAA 2AJXL 3QIWC 2VVDA 3VBUA 1A3ZA 2DICA 3DA0A 1GKBA 2L7QA 1BV8A 3AWFA 1CGSH 4NBZB 2J8HA 5EU3A 1ND3C 3T0VA 4AYMC 2WWUA 4Z95L 3NJMA 4BMEA 2X5IB 1IGMH 3DKWA 4YUEH 4ZYKA 5IROC 3VG9C 4I0BA 5A2IH 4P2RE 3WKML 1JBCA 4X6EA 3OJBA 2ZGNA 3D34A 2HZHA 1GZWA 2VE6B 1YJLA 4L9BA 4XP9L 5F5QA 4L3CA 5IMKB 4KVNH 2PLV3 5E6SB 4FQZA 1R5WB 3U46A 4WVRA 5L7OB 4LOFA 3FUNA 4HFSA 1EXUB 4KDVA 2JCCA 5K0UC 3H9HB 1BECA 2HTLC 2JDUA 4PLKC 1DDHB 4ZZFA 4MNGA 4KKAC 3W56A 4LNRA 1DQ5A 3T5WA 2Z65C 3B2VL 2D4FA 1FYTD 2NLRA 2BCKB 1MZEA 2Q76B 1RXGA 4CSPA 3BUYA 4NIGA 2P42B 4OUMA 2GTZA 3RL1B 3EF4A 3O1TA 3ZR6A 4BH7B 4BFJA 5FYJU 1JXNA 3VHNA 5JYLA 2PXYC 5AOJA 2Y3AA 1O9ZA 4FPCA 4PLMA 3IDIA 4CMHB 5E5MB 3WUCA 1U8OB 1XU2A 2NP0A 3EO9L 3A4UA 3AFGA 1G7YA 3SKOA 4OHXA 4G71B 4CVWA 3CFMA 3ZKMC 1AZDA 1CX4A 4Y1YA 1HZHL 1Z7JA 3QRGL 2BNRD 2X3AA 3WEBA 2JKIS 3DUHA 3EOYG 4KTGA 2X4SB 4HIXL 1Y7BA 4TTDD 1HIXA 4O2CA 4YSAA 2LAAA 1OAQL 4OB5H 1NCCH 5JIDA 3RYKA 4OZFG 3MW3A 4WI5A 2XBDA 3HC0A 1SYSB 1HOEA 5EO9A 5CNAA 1HE7A 3U6XA 2NNAA 2J43A 2MEV3 3RURA 2WYTA 2FBJL 1MCSA 1RLWA 3SGDI 1GWMA 5HCHA 2EKSA 5D7SL 1WLWA 1QR1B 3U0ZA 4MGZE 1U3NA 2DWDB 2G3ZA 3D0SA 5FMBA 5EHDA 4ZFQA 4FLOA 2ZX4A 4U1LA 4WY7L 4QHBA 2YGPA 4R96A 1K5NB 3NFPB 3U1PA 4EUPH 2ZXQA 3RIAK 2OMUA 3KR3L 4GUQA 3D05A 4ZX3A 1C3HA 3RZGA 5EEYA 2AUYA 3EUDA 5FKAA 3ZFGC 4CCLA 2IBZY 4GW1A 2XBO2 4LMQI 3A6BL 4LCUB 5T1MB 3QQ4B 1XGTA 2DQTH 1PNCA 2VDKB 3SQBA 3KVBA 4PW3A 3VFUB 3KPOA 1EV13 1NFIA 3OHMB 3BVUA 4OI1A 4HEPG 1A1NB 1H8SA 4WUKL 1G4RA 2FSDA 4L3AA 1SEBA 4ONHB 1U8NA 1DZQA 3V5HB 2VM4A 2K8MA 2QVFB 4Z77A 3RG1C 2GC3A 1SHXA 2IOMA 4Y2OB 4UQ3B 4P5MA 1ZBA2 2ZE0A 2XIDA 1DUYB 2NY0D 4HPHA 5I76B 1KN2L 2ZSWA 2HWZL 3HN8A 5K5YA 1IS4A 4QWNA 1RHFA 1J9CT 2C4XA 4IOFC 1WAAF 4M93C 1EAH1 4Y1AA 2YSSA 3FFDA 4DZBB 5CHNB 5E9AA 4G8GB 4TQIA 5FW6A 1QFWH 2EYRA 3Q6FB 4GKNA 2Q8BL 1Q43A 2QMJA 4XBEL 4J3OH 4XN5A 3VI4A 4LT5A 2PETA 4R4FH 3WL9A 2G9ZA 4F83A 3RGVA 1JTOA 4ISQA 3WEAA 3U4EA 4TUJA 5D7HA 1AY1H 3SE9L 2P1YA 3TASA 4OF8A 1AQDA 3W0WB 4AFCA 4TLTA 3MGOB 4L0YA 4P9MH 2VLJB 4WKZB 3CSGA 1DLLA 5DZLA 2XVGA 4JHWH 3NCFB 3UBXI 3TJHC 1JYWA 2AEIT 3VXUD 5K1NA 3Q9QA 1AGEB 3RVUD 5KVGE 2H47C 3L1OH 1S9YB 3DIVA 3IGAA 1IS6A 1Y43B 1NWPA 3NK3A 2WSPA 2ZYHA 4QRTA 3TJPA 4XXPA 1DLFH 1TZOA 3HCVA 3WSQL 3X1GA 4HAFA 5BVPH 4IQHA 5DRZB 5FZ9A 3WF2A 4K9SA 2IPKB 5EU4A 1JYNA 5LNGA 1BWMA 2AI0L 4XE0A 5KSVA 5EFUA 1YEIL 3MKGA 2ZGRA 1H0BA 4XDQA 3ZOIA 3O1OA 4KKPA 4W9LC 2CDGA 2WLIA 2VTFA 4HCRL 3VNYA 1ZV2A 5C0BD 3H7BB 3W58A 5GGUA 2WANA 7CGTA 1EPZA 3DX7B 4FXGB 4PG9B 4JCKA 1A4JA 3WG1A 4CDQB 1CL7H 2CDFA 5L9RA 1LVEA 2LLNA 3RYPA 2HJFA 3ERXA 1V7ML 1GV9A 3K8LA 1X7TA 2IPUK 1HYSC 3CL1A 2LQRA 3WD5H 3R18A 4XR8C 2YU1A 3ULVD 2V2TA 3LNFA 3BSZH 5INCA 3W2DH 4ZNEE 1FPN1 1WBZB 4A41A 2FUTA 3OXSB 4MXQC 5IOPB 2VCCA 1RK0A 3IFNH 3FN0L 1UYWL 1MQKH 4EDXB 4F91B 5GS0L 1OTUD 2AJSH 3OGGA 3TPUB 4G2AA 4DK5A 2BFVL 3QZWG 2CGRL 1KLFB 2PPEA 4HUMB 4JY5L 3CFNA 3CSPA 4AI1A 1NEZG 4P2CG 1TMQA 2VR3A 3B9KA 4M1GH 5DRXA 1RP8A 3CSBA 3MNVB 1E28B 3T77B 3N40F 3UDWC 4GBXC 4G8EA 4LLWA 2D98A 3D25A 2ZTNA 5ACA3 3ALPA 3CZLA 4ZDHA 4PF5A 4KFZC 2D0FA 4QRRB 1GW0A 4PHZA 3GSNA 3DX6B 4L48A 4GRWH 4RNRB 4H2AA 4EXPX 3S9DB 3T6QC 1FVEB 2VDQB 2JJUA 2HLEB 1PZ8A 3TWIA 2HRPH 5FOBB 4OZFA 4ODXB 4A2LA 4RQQA 1EAPA 3DGGB 4L3EB 4ZO8A 1F8VA 5IY5B 4E9VA 3FPYA 2BNQE 4FTDA 4M5SA 4U7MA 5EOCL 2P5ED 3U2IA 2HEYF 2WNEA 4ECNA 2QNKA 3BJLA 3AC0A 3C08H 3PWPA 4DGIL 3ETQA 1Z6JT 2A6KA 4LXFA 2QDWA 1UX7A 3UFIA 5BV7C 5I8CA 3BX7C 2C7UB 5J96B 2B7YA 1VGEH 4D0CA 5EZOL 4XFCA 4UAHA 1JZ8A 2XJRA 3V0VB 4KUCD 3FSZA 1YNTA 4HFUH 5B1JC 1NC4B 2D6LX 4NHMA 1JD7A 3O8XB 1W0WA 4HQQH 4NFDA 3BKJL 4DF9A 3OBRA 1V7NL 1XXDC 2A74A 2LLGA 4XVTL 3UTQA 3VWJB 2VAUA 4NN0A 3S7EA 3PABB 5D96C 4BFNA 1YXWA 4UF0A 1VZHA 3EADA 3ILPA 1GYWA 7TAAA 5AKSA 3A0OA 4HEPA 1B9KA 4XUQA 1AH1A 1GC1L 1AXYA 4WHTA 4RFNC 3TN93 2W65B 2WTPA 4A7VA 1SJHA 5C2BH 1J05B 3FT3B 4FNTA 1NDMB 4HWEL 1MKFA 2UYLA 3KNBA 2K6YA 3Q6GL 4G9FB 4XPGH 3PWLA 4ZMPA 3LS5L 1RMFL 1P5VA 4Z5RB 5DR5H 4BU2A 2EDKA 2DB8A 5EBLA 4BCUA 3BPZA 4UW3A 2XN9E 4XIKA 5T33H 3B9KD 1H9PA 3QJXA 1QJEA 4ZXKA 5LWBA 1E42A 3QAZC 1Y0LA 1H8LA 2VLKD 2Y0IA 4Y3OA 1GSMA 1IQAA 1MAKA 2E76C 1U5ZA 3MJ9A 2NSXA 4K8RB 5C3QA 4HG6B 1MCCA 2APTA 5F1NB 5D7JB 4PGBB 5L8KB 1LHUA 1BBJA 3SO3C 3ZIMA 2IVJA 3NP4A 4JDMA 4NE9A 2Z0UA 4WBBA 5JOWA 5I93A 1HX0A 4KZ0A 2D8KA 1MFCH 1YN6B 2R1WB 4YSTA 1MS4A 1G7MB 3BDXA 1QI5A 1RUQL 2R4SH 1JPFB 2P5WB 2ICWA 3PDOB 2EDFA 2G0KA 3HBGA 3VXQA 2AXFB 2Z0BA 4QPIB 2A6JB 2V7HB 3UETA 1TQWA 1YEGL 3UX9B 1V6LA 3UESA 1DQ0A 3L2YA 1EZUA 3QFDA 3ZRSA 5EHFA 1HSAB 4Y4FD 3TCLB 4I0PC 4ZUWB 5SWQA 2MPAH 3AREC 3IJHB 3RX7A 4BH9A 1VBD2 1FIEA 3CSYB 5LEJA 3CK0H 4J6RH 3S96A 1W8NA 5FZ6A 3M7OA 4R4NC 3WUZA 4LAQL 3W1ZA 4BOWA 3VRLF 1MNUH 4OHWA 1OI6A 5SX5K 4JG9A 5JLZB 2WWSA 3UTSE 3QUXD 4N8VG 1P0SE 2ADGA 3OUHA 1G0DA 4GIQA 1QWUA 4WNQA 5B22A 1BP3B 1P84J 4RBPH 4HK8A 1DDTA 4CUGA 1NCBL 1WE5A 4ZXBB 2I69A 3CLFH 3L95B 3ZUCA 3LEYL 2KUTA 2IMMA 4DKEL 2XMLA 4JFHD 3QEHB 4XABA 1J1TA 4YDKH 5KJRH 5LZ6A 1NMBH 2RH0A 3C60D 1NKOA 4YHPB 1MRCH 2O5NA 4UU9B 2HWE2 4Q4W3 4G6FD 4J3UA 4RMSA 1RUC2 5LDSA 4PWHA 3UL4A 4XOCA 4XB3A 3W9DA 1ASQA 1E40A 1ADWA 1VRH3 4WW1A 1SEFA 5J6GB 3S6PA 2CMRH 5KBKA 5K9KB 1GPOH 1TU2B 2ENSA 2IANB 4G7YH 1E5IA 3QZWA 2UZXB 2ENYA 4JAMB 3OX8B 2WN3A 1NEZA 5F7DB 1HXYA 3TEWA 3AKRA 2VMDA 1EJ8A 3CDZA 3FB6B 4AGNA 4Z7UE 4YHOH 1NUNB 4UM8B 3U4SA 5LA9A 1FL6B 1I9IH 4HGKC 1KGCD 1G5GA 3SGEI 3MBWB 2V3EA 3L5HA 4GLRH 3QIUA 4WQOA 3LDBA 3CUPA 3FONA 5EFIB 4X0KA 5I8OH 2VNCA 3ACGA 4OF6A 2F8IA 2W07A 3DTDA 4DN4H 2H2SD 1OD7A 1BM3L 3KCCA 4MJ5B 4R7DB 3T3YA 3BESR 1QUNA 3GZOA 5FK8A 1ZRIA 1JRHI 1U6AH 1QJY3 4QGLA 1DLHB 2W39A 2C1PA 2NSMA 4KJPC 3BLPX 1EDHA 3JBG7 1LO5A 3MRRB 4B5ZA 3QVAA 4MAYC 4Y20A 1NZRA 1VADB 3OMZA 5I30L 1J1PH 1PEWA 2QQQA 5SWZD 5TQ0L 1WBXB 3WY3A 5ERLA 4FFIA 3SH4A 2IIJA 2WXNA 3ACFA 3HC3H 1P5UC 2DEYX 3AFLA 3G5XA 5IZ7A 5KYWB 2ARCA 3WXVH 1AJKA 1K4DB 1Z2KA 4ZUVB 3UTZB 3I2JA 1UCBL 3GBMH 4HLJA 4AQ1C 4AV5A 5E8PB 5BNPA 2BNMA 2PMZA 3EO1A 4E2GA 4WK4B 1O9VA 1S5HB 4WFFE 1FNYA 2DQCH 4PJAF 3RILA 4F7PB 2E6VA 1ZV5A 5IVXA 1NCHA 1JK8B 4BCXA 5GS1C 5ANHA 3TLRA 4CILA 1HILB 3QORC 2A9CA 1WGVA 1MHCB 4U2YA 3RIFK 4X83A 4Z7IA 5DRWA 1KB3A 5IVOA 4YWGH 4YBQC 4F8QA 4AHXA 2NNFA 4OZIE 3HT1A 3LYRA 5F6KA 2WFF1 2FHRA 4RQPB 3OSVA 5DQ9B 3HNBM 4BZYA 5FHAL 5G05L 3PGFH 5D72H 3L9RA 5TF1H 1S7WA 3O2DH 4JB9L 3VTTA 4QCIA 2PNDA 1B4RA 4WHCA 2JB8A 3IMBA 3FO0L 4XMUA 4CSWA 5CLTA 2GCYB 2VXQA 3SDDC 4CC1A 1ZGLA 4HEMA 1ULEA 4N90D 1NT0A 4PRNA 3FMGA 4M0HA 4YZ3A 3QIUD 1KNOB 3P3PA 2WM0A 4H40A 2GALA 2K8QA 3VSTA 4HSJA 4YGCA 3DRTB 3MRPA 4WNSA 2ROXA 5KUMA 2DTSA 3EO0B 4HX1A 4F57H 2QADB 3ZLIA 4PV1C 1YO8A 2A70A 4Z7OB 1YN7A 2N7BA 4U6XA 4NYLA 4ODUB 4YSOA 1KEGL 4N2LA 3OHXB 3SDAB 1OURA 1HB3A 2KPWA 2BVTA 5ID0A 1IQDA 2D7NA 2GIXA 3QNYB 3T9WA 4XQWA 4GKSB 4JQIA 3QIBD 4NENB 3LIUA 1FA4A 1A7OL 4FS0A 2RS33 1MQ8A 5CJXA 2OAAA 5EN2B 1NUKA 4INDA 1PLCA 2O5XH 1H5BB 1CGUA 4L5FH 2EXTA 4P5HA 1DR9A 5T3ZD 4MXVE 2CDEB 5MP6L 5J11B 4NN5B 1OGPA 3OUJA 4JRXA 4N8VA 3UADA 4MCYA 4DN3H 2EIGA 1EA9C 4R3SA 3VG0H 1IO4C 4RGNB 3ZO9A 4QB6A 3FF8A 4BE5A 1JNLH 1AFVH 1OP4A 3FCTA 3MLZH 4PM1A 3EJRA 4YZ5A 1TZGH 1PKQA 2NXYD 4LLUB 3BMVA 3WNOA 3ZMEA 1C8M3 1DBAL 1MI5E 5DN2A 1K5JA 1WG3A 3V0AC 3LA7A 4G8FB 1O4ZA 1RIUL 3DURB 2PELA 2E4TA 3AW5A 1OOPC 2ATKB 3GKWL 4I09A 5JHDA 3AK0A 1UM5L 3S0PA 1OW0C 3ZHDA 1TEIA 2VOTA 3A24A 4Z9KB 1AL21 4N4YB 5FUOH 4ZODA 2XHKA 3RX9A 1BIHA 4YDIL 4ELDA 1R092 4LA2A 5GLWA 3JV0A 5KSBB 1KCRL 2DVDA 5LBSL 3GS7A 5DURB 1JW6A 3LCPA 2ATPB 2AFNA 4XWOD 5FO9B 4RA0C 2HYKA 5FBZA 3V4PH 3FO1A 2VMCA 3RWJB 5CISA 3CU7A 1KJMA 2FB4L 4URTB 1V6JA 2PCPA 1OEZW 4EN0A 3CZKA 1PVC3 3IJEB 3DIDA 1CZTA 2CLZB 1RHI2 3OR6A 4X8CA 5F3GA 4QX2A 4ELKB 1GIGH 1W72B 1KELL 2R9HC 5DQJA 3OUIA 1XAKA 1IE4A 5J3UA 5JO5B 5JR2A 4K94L 1F5FA 4O7XA 4MQSB 5HHOA 1MQTA 3MV7A 5GALA 4OI8A 3VHRA 3O3BB 3GSUA 1JNHB 3NTCH 3HZVB 1CC3A 1OAYL 5F39A 1GC1C 4W9GC 3CE1A 2JB6A 3EBHA 4AUUA 4PT6A 4YW2A 5J9PB 5E2TL 4FTVD 3O6FA 4ZU4A 3MRIA 3ME0A 4HUKB 1WWAX 5AKVA 3B9VA 4JN1H 3V0HA 1DYPA 3PS6A 3G5ZB 2PHWA 4WW2A 4NRYB 1E4KC 2YGLA 1Q72H 3RWHB 3QHFL 5LBGA 2HBUA 1BSIA 2Z7WA 4FL4B 4M03A 4UYQA 1T3FB 3RJDA 4JFOA 4GWMA 1EZVX 4KK6C 3QHTC 3WKYA 4XC3H 2X53A 3MUJA 1NIDA 3WP4A 1W6LA 2KLTA 2G30A 2HLAA 1GZQB 1S9WB 2DMBA 4OW6A 5AEAA 4ZUTB 2I32A 1PQZB 4AEFA 4A42A 3ZTCC 2O61B 2QQLH 5DWUL 3F7LA 1XIWA 3ILNA 1IAIH 4XJAA 1D2OA 1NANH 3DIFA 2CNYA 1T7XA 5C0RH 3UJJL 1OPGH 2ADYA 4K3EL 4XPFH 3HN1A 1PEZA 1OXYA 3VH8B 4YDLB 3DXAA 5I0ZA 1PD0A 3O9WD 4CMHC 1AXKA 2GJ6D 1OLRA 2DURA 2ICES 2X6MA 1UQSB 1DQIA 2NR6A 2ZAHA 1RUJ2 4N7UA 5CJOL 2LFEA 5FLIA 1YPZE 4QF1B 4AYSA 4OJCA 2HX8A 3QUML 1I75A 5CP7A 4AEMA 4X4ZA 4JFWA 3VD3A 1UWXH 3U83A 4F5CE 5BV7H 1TCRB 1CXEA 2FX8L 2PO6B 3AADB 1JMUB 3NG5A 2YZ4A 3HWJA 4Q4X1 2CLVB 1W90A 1MCOL 2F7RA 5FYLH 4XNUH 4JCMA 3RRQA 4AIZB 2XQBL 1ASJ2 4MXWA 2XWZA 1JPSH 1PJ9A 1GGIH 2EQDA 3HJ0A 2ISDA 1CURA 4JDOA 4N2DA 1JZ2A 4I30A 1ENRA 5HHOD 2OSYA 4QRPA 5F9JA 1HQ4B 3OKNA 5CXPA 1ZHBB 4W4NA 1OAKH 4OIFA 4AVHA 3Q05A 3BDYH 1REDA 3JU9A 2BRTA 2R83A 5JHLA 3O6FD 2VXSL 4URKA 4QXBA 2HJKB 4XNMB 5FUZL 5EZLA 3F12B 4RFEA 3VD9A 2OZNA 3D39A 4RISH 2HT2C 4K9EL 3UJTL 4NRMA 5FZ7A 4IRSD 2CAVA 1NGYB 3PIGA 1RZFH 5IK8A 3H9SB 3SDYL 4DNYA 3AZWA 2ZNWA 3QNXA 4BGDA 3N3HA 4RN5A 5JNYB 3LHAA 2HFTA 4PI2A 1TJGL 3TH3T 4BSJA 2NDFA 1H15A 1KXVC 5DMKA 4OR1A 3VBRC 3I59B 3N04A 1H1IA 1XIWD 5T52A 3PL6B 4MA8L 2ZZQA 3CJIB 1HNFA 1BZOA 1NL0H 1ZA7A 3PDDA 3ZDYE 2Y6JA 3L6FB 4JLRB 4M3CB 1FZMA 3DXAD 1OQOA 3KCYA 1MEC3 3WT3A 5JIQA 2M1KA 5BOJA 3LVTA 1TMF3 1GS8A 4LQ1A 3W57A 3RYRA 1GJWA 3R06A 4QXTB 5DC9B 5IQ9A 5MHSE 1PO23 1EYBA 2J1KA 1V00A 2R061 2RHEA 3LKPA 2ZUVA 5C0JA 4K23L 5I1KL 4RS5C 4F7ZA 2OP4H 3BVVA 1KG0A 1SJXA 2QKDA 2P7TA 3VZJA 3AVEA 4RMVA 1MS0A 2PWEA 1OM3H 3JYBA 5A40E 3RWDB 2VB5A 5JOPD 5DYFA 1FCGA 4MCMA 4UDUB 3MOQA 1ILUA 5LGJB 4IV1A 4ZZ5A 1KGIA 5C70A 1DYOA 4KVNL 3B5TA 2ZKHH 4QRPD 1ND2A 4XZUG 1HXS3 3NSDA 4ZQKB 2VR4A 3RTLA 1INDL 3MTRA 4PRPB 3F7PC 3LKQB 3LD8A 3VSVA 2JVUA 4NIAA 5I5RA 4G3YH 2P8MA 4MNQE 5DJCA 2Q6WA 5TFSL 4CP9A 3EB7A 4DOHB 3DHUA 4NO0A 2LLLA 4XFIA 4XCCL 3VGAC 3N2JA 4RRPM 5FZAA 3CVBA 2YLKA 4X5QA 4Y22B 3P77A 3GXMA 1ZLEA 4Q7DA 2YGMA 4YLZA 4H88L 3I54A 5LN8A 3I75A 3NPSC 1QWRA 2Y36H 3JZVA 2DQFB 3HMWH 2BBAA 4M48H 4OIIL 4OI7A 5JIAA 1SFPA 4N8PA 4WEEA 4UF7C 2EAAA 3VW3H 2WWJA 2OZ4L 4I77L 5FY1A 2YAHA 4CDQC 1YQ6A 2ESVA 2W94A 3FYIB 4WO0A 4HJJL 5GSVB 1Q8OA 3K75B 1PCXA 2E74C 2X29A 2WXOA 1F0LA 3PHQA 2K9UA 5LN4A 3L9YA 2N4IA 4JHAH 1CTOA 1JK9B 3I9GH 5JIUA 4KQ0A 3QDMB 3FU0A 3I6KA 3ESPA 2JIXB 4P2RA 1XH2A 2C3XA 2UZYA 3ARGA 3BOVA 3SPGA 1N1VA 1T5XB 4CDUB 3VBHB 2VDRH 4F7TB 3BPCB 1A1MB 3CFDB 12E8H 1T0MB 4QRBA 3RDTA 4FO9A 5E8OA 1PGRB 1NUGA 4K4KA 5IMMB 4N3UA 4U1MA 1W3XA 5CFDC 4Z76A 2ORZA 4XMXA 3SLIA 4IOIB 4ZO6A 3QEQE 5E4EC 3SKMB 2HVJB 2QZQA 1CAWA 3TF7C 1MUJA 2VN6A 2ITCB 2ZUYA 3OB0K 5BRZE 3O41B 1RMU2 4GYBA 4I1PA 2QR0A 4UT9L 5A2BA 1WUNT 5I66A 3V65A 3QIWD 4AQ8A 2O1QA 3HS0A 1QBMH 1DBNA 1T1XB 5I8KH 2WO2A 1FZOA 3MRFB 2X7LA 1ULCA 4FSJA 4HZAA 2B3RA 1EUTA 3U0PB 4NQDE 2F6AA 4KK9C 3WIHA 5IROD 5AFEA 5C6CA 1EERB 3ECQA 2XTJB 4G9FE 3KV6A 1F2XK 2VQUA 5IHUL 2X4OB 5FZ1A 2V5RA 5HJDA 5KAQG 2HFFA 4DO4A 1MIMH 2B45X 3O8XC 4DZ8A 2FGZA 4GNKB 4L37B 4PJ5E 1CLVA 5D7IE 2D3JA 3RL2B 4PWEA 3D30A 4FTSA 4HOOA 1CB4A 2WKOA 3VWJC 2VY0A 4I2OA 4R4FL 2HTLD 4PLKD 3HNVL 3JWNH 2BSED 5C1MB 2UWEE 4KKAD 4AV4A 5GRVL 2CSPA 3WO4B 5HJ3A 1AY1L 4R0LA 3REVA 3FUQA 2JDKA 2YK1L 3DL3A 3V2AR 5IREA 4JE4B 4XFGA 2Z92A 5KBDA 2J7MA 3CN4A 4P9ML 1J8KA 3IJYA 3OC8A 1G9NH 3V5KB 1F31A 4FPEA 3S37X 4JGYB 2QPFA 2XBO1 1X5MA 1KPRB 5I16A 1ZEAH 5DJ8B 1ACYH 3L1OL 2ZAAA 3ROLB 1TENA 3ZKMD 5E8EA 1ZRFA 2PYEE 3IB4A 5EMYA 3C6SB 3IM0A 4LOEA 3LSEA 2PW2B 2WBKA 1TNFA 4K8RC 1B4LA 1LP9B 3EGDA 1ACCA 4ZAKB 4MV2A 4O02B 2XVLA 2VC2H 4U3XA 3JTTA 4ODHH 4YAQA 3NKGA 2KDGA 3ARRA 5I0XA 5CG9A 4NAQA 5K1VA 3QRLA 1FV1A 5ANMA 3QI9B 3DXTA 4WM8A 1ZBA1 5DAXA 4YBLB 3WV0A 4JDZA 1Z9SB 4U0QB 2XONA 1L9NA 3QG6A 3BW9B 5DGRA 5C7XH 5KN5A 4LBJA 5ADPH 3QPXH 1CL7L 4BQ3A 1QRNE 3LGRA 2EYSA 2ZOTA 4XZUA 1DGLA 4QPIC 3VFVB 1CVSC 1XTMA 4H26A 5FS5A 5DG2A 2C9AA 5F1KC 4G7RB 3AU1A 1Q0XL 1P7HL 5EBMB 2CTVA 3W2DL 1KBGL 1MLBB 3RTQC 4TVPH 1IARB 1TZIA 3W39A 4PTUA 4QNPE 4O2EA 3T1MA 35C8L 2CNAA 3BTXA 2B2XL 1XE0A 3K51A 4WUUB 2R043 2ZJSH 3UC0H 2IXKA 2W1WA 1ZS8A 4QKNA 2NRDA 3MIHA 5D6DA 4I18B 1MJ8H 4HJUA 4LPUA 3OLDA 1QLEH 2D2CC 2W0KA 5I1JH 1YY8A 4DTGL 1ZBE3 5FPIA 3B43A 5A6LA 2FAUA 4G7VL 4P05A 1WDAA 1GTNA 2NMSA 3BWUF 2Y33A 1KIRB 1BPLB 2E8YA 4M5YH 3ZKNC 5IR1B 1OCWL 4Q0PA 5B1AB 5JIPA 2YD3A 1J88A 5C6WH 4IOFD 4ZUSB 2B5IB 1BZEA 3WHXB 4EVNA 1R1A2 3EO6A 5BNNB 1REFA 5FYIA 3E6FB 3VQ2C 1R5VA 2VL5B 4KQ3H 5F7WC 3HLAB 5DZVA 3IF1A 1VSCA 4Z7QF 3UDWA 4WZ9A 1I6XA 3PUHA 4JTOA 4U6HA 1OP5H 2GP3A 3IS0X 3JZ7A 3LMJH 4XPTL 3ZL1A 3IWUA 3ZKYA 3AXLA 4X5WA 4XO9A 3PGDA 4XN8A 2Z7YA 3SGEH 4BZ4A 1T1ZA 2GC7C 5DF0A 5DJ0A 3LKNB 1F58L 4APXA 3JV4A 3M1CA 2KC0A 1TETL 1S7TB 3NZUA 5LGYA 1O7SA 4ZNEA 3ZXLA 4CVXA 2DQDL 1M4WA 3FFZA 5C0DA 3G6JF 2C3VB 3TJHD 3L1EA 1J5IA 1M1XA 1P7QB 2RM23 4XW3A 2XYBA 4B1MA 2IGTA 4FOMA 1ZTXL 1E6OL 4LKEA 3WNKA 1A9BA 2WVUA 2YD5A 3GIZL 3QNZA 2UVFA 3TBSA 2X41A 2JDHA 3S34H 4M7LT 25C8H 1FL3A 5C2BL 1OIOA 5CSZA 3V8OA 3CX5J 1SHWB 2C3HA 3PV6A 4OSUH 2GMEA 4Z7VE 3ST7A 4FZ8L 4Z3EA 4HJSA 1M05B 2WINA 5EIYB 5B1JA 5FKBA 2X4UB 2YAOA 3K5RA 3S3JA 3D3AA 1PMYA 3MX0B 4UNVA 4U1JB 3T4YB 4OM1L 1EVTC 5LWYH 5HHNA 4TLGA 5F97E 2JDZA 2BNQA 3ECBA 5E2UH 1HYSD 4NC1E 3CIHA 4GQRA 1RVFL 2CIKA 4GALA 1NCGA 4FFZH 3T65B 4NPYA 2PTTA 4LCYA 3SN6N 4MXQD 3NAPA 4NN7B 4GMTL 3UYPB 1OVZA 4RGGA 2R4SL 1O6TA 3ISWA 4OZ4B 1OAZL 3DVGB 3BQUC 4Q52A 4LT7A 1MHEA 1CD0A 1KQRA 1W6NB 3POIA 1I3GH 1ZIAA 2AP2A 2V2XB 1ZSHA 4QUOA 4YPJA 4RQPC 2DL2A 4JHBA 2W2IA 2XJSA 3HBZA 3GHEH 1HL8A 3OMNB 2Q87A 2HRLA 5IB3B 1G6VK 1K45A 5A7WB 1HQWA 1K4CB 4CXXA 4NC1C 1PNFA 2EAEA 2FT6A 1OP3H 5IKCA 3WDTA 3FQ4A 2TRYA 3DBXB 2EDEA 1CYGA 4HWNA 3JTSA 3N6YA 3WLBB 3ZE2B 2DLEA 3VXRA 3VGEA 1O3SA 2ALWA 3S48A 2VAAB 1RIHH 2QADC 2ZWSA 4PVBA 1U93A 4UMGA 4W4OC 1OGTA 3RNQA 5ELIA 2XN9A 3CLFL 4RGNE 2C4FU 3CCHA 2VW1A 1VIWB 3LZQA 3OHXC 3SDAC 4YDKL 4V1PA 2UX6A 4ZPIA 1CN4A 2WLKA 1I8IA 2HKFL 5TPWH 2JG8A 5EBWB 1MRCL 1N3NB 4HHAA 2WGXA 4GAYA 4I0PA 1FUNA 1LQBC 1WUZA 2ZYSA 3ASWA 3AREA 4QGTA 4F20A 1P84K 5C07B 3VFRB 3FE5A 2ARJQ 3BKCH 4BE3A 1GYKA 4AQAA 1XOYA 2LRPA 3F58L 5BZWB 1H5BC 2CMRL 2WHVA 3ZX1A 2OJZL 5DT1H 1LECA 1UMIA 4NI6A 3HHSA 5J11C 3C8KA 4NN5C 5F3HB 2VDNB 4JPKH 1MVFA 3UYRL 3KLKA 2P2KA 4MGXA 3A67L 5FZBA 4FQIL 3B5HA 1XYOA 3ZN4A 4RGNC 4YHOL 3USUA 1HHHA 2DJUA 2GFBA 3DGDA 5C5UA 2Z4QB 4HMDA 5HI0A 2X9ZA 3NH7L 4QPGB 1ZHLA 3DHJA 4MB3A 5EEWA 1FAYA 1NAEA 3I4IA 5E1AA 1XQNA 5I1CH 4KQ7A 4RZCB 5GZFA 1CJYA 2VR8A 5GJSL 5AC92 1AIFB 3VGFA 5DG1A 5AW0B 1I5ZA 3RIFF 2WN2A 3H42B 3C8XA 4BKLA 2I26N 3D7PA 3QJFA 4EI5A 2I9LA 5G4MA 4AGMA 5GXBB 4K7FB 1J0YA 3UTSA 2C0ZA 4UOW0 3CEWA 1JNJA 1EAH3 3V6FB 4WTQA 1J9RA 4GP4B 5L2JA 1AYN1 3GMPB 3V64A 1SJEA 2WXHA 5JOEA 1OM9A 1SXNA 3MJ8B 1UWGH 1Z9OA 4PY7B 3VXRD 4W9DC 2A1XA 2YGVA 4LSTH 3AYEA 1RUC1 4JPVL 3WXVL 5C0CD 5FYZA 4EDWH 2ODHA 4XPAL 2J1YA 4MSWA 2J73A 5BS0B 1PMHX 1QH7A 4LSPL 2B4CC 4AEEA 2XKPA 1C12A 4CGUB 2BW4A 2FO8A 1S7VB 3OQRA 1NEUA 5SWSB 1YRKA 4N0UE 1N47A 3N85L 4W70A 1GYCA 3TBWB 3B6SA 3BH4A 5I0WA 2EEBA 2XC8A 1FRGL 4PJFF 4U2AA 5T5FL 4LCVA 4I0PD 3DPRB 3NA9H 2XG4A 3ARED 3OJDA 4YW6A 4B53A 4JDTL 5HXVA 3IZOA 2XLLA 1JGEA 1FVDA 4G1MA 2OPCA 4FYRA 4HV8B 4R4ND 4Z7UA 1P9MA 2GTQA 1TPXB 4MAYA 2W52A 3V4UH 4X8PA 4FFTA 3KPSB 4YWGL 3D82A 4LKCA 3EH4B 1AQMA 3U25A 5FO8A 4YW5A 1RHHB 1NCWH 2AV1A 5ESVB 1P5UA 3JVGA 1FMD2 1T6WA 1JHTB 5D72L 1I3HA 4HIJA 3JBG2 3T2QA 3O2DL 4AE1A 4XBGB 1M53A 2HLFC 2IQ9L 2E7HA 3QO0B 4PJBF 1VACB 4AQ1A 1Z7S2 4X4YA 4MGTA 2X89A 4Q2ZB 5E1QA 4KG8A 2W0PA 2QJVA 3A7QA 5DJDA 5IESH 1WYJA 3I3BA 4Y2NA 1RUD2 5JOFB 3WF1A 1YNLH 1AJOA 1S2KA 1UXZA 1W8TA 5DXWA 4DVBB 5H4ZA 5A2AA 4X4ME 1LNUA 5FP3A 4MADA 3PUSA 5GS1A 1RUMH 5GRJH 2Y5TB 4F57L 2YHJA 3HN5A 3I97A 3MROA 3MYXA 1PD6A 4XCYA 3ZN6B 1ZY9A 3QNFA 5LB6A 3BO8B 1ZT1B 3FXIC 1L5GA 4BRJA 3BCWA 1FPN3 4KNCA 2QE3A 3R0NA 2VDQH 4NC0B 1W8EA 1DJZA 3WTUA 1OT4A 2YEQA 3HG1B 1WUVA 3D52A 4FVVA 4YLCA 3BUCA 2I74A 5C0AB 4YZFE 3IMRA 1A4CA 2BC4B 1ERNA 2BVQB 1ONQB 3OKLB 4PGJA 5KSAC 3SDDA 1R3JB 4FQCL 4GRMB 4YDLC 5BXXA 3K77A 3NIGF 2JXMA 4QTFA 1Y4WA 2Y1AA 1I9EA 3T8VA 3WNXA 4Y5SA 3VXME 4L99A 2QGBA 3SJVE 5A2LH 1JV2B 4LPCA 2GJRA 2HX9A 3PQYA 3WINE 3ETBJ 4PJ7B 4F2MB 2NQYA 3IJSB 2VXRA 3X1FA 4OZIA 4JJ5A 4B0MB 1XH1A 1FNLA 5C0GB 4QHZA 4EV0A 1JDAA 4HWUA 3E6DA 4HCRA 3I02B 4P57B 1TZGL 3SPIA 5JDSB 1ORQA 2HG5A 3EJZC 2GSYA 1R3KB 3X11B 4X80H 2WBJB 4MAYD 5DZFA 3O11B 3CPUA 4MTMA 1A7NL 3Q2LA 4A7YA 1MJJA 4G42B 5AOLA 1ZRDA 2QQKL 4LARH 3LIGA 2IDFA 4TSAL 1SZNA 3JSSA 2WXFA 1GZ9A 2EDBA 4E4HA 3BN9C 3NNGA 3U10A 3Q8EA 4D8PA 3T2TA 3SYPA 1IKNC 5ECGA 1OWWA 4BISA 1ZA6B 2X89D 1J3RA 3WN5C 1DTUA 4XJ8A 5LCVH 2QVIA 2QGCA 7FABH 5CKMA 2F7OA 4PLOA 1BLNA 4HXBH 1RI8A 1YQVL 3FQ1A 1UZVA 2VMGA 3CFQA 4IMKA 1KTCA 1E6JL 1UM6H 2ID5A 3I74A 1AX0A 1ZTXE 1CGWA 5EOCJ 2L4OA 2WD0A 4E41B 1LHOA 1VE0A 5FW8A 4D2NA 3V4PL 1BW8A 2YU2A 1GMMA 4JFSA 1E4JA 1F11B 3HLKA 1NIEA 5CIRA 3QC6X 3L9JT 4OHYA 4MHHG 5H35A 3ZPDA 2ITEA 4JRYB 1T7YA 4N25A 3SEPA 1OOPA 2CO6B 5K9OB 2ZGOA 3OF6A 1RVF2 4MXVA 1NXMA 3PL6C 2CPUA 3NNLA 4C56B 4FPYA 5J7MA 2ZF9A 1GIGL 3O45B 5E2VH 1OW0A 1PFCA 3AWEA 3D69B 4MD0A 3CJIC 3QPKA 4BJ0A 2K4WA 5T54A 4ADGA 3E1ZA 3FK3A 3MTXA 3SDDD 1OBNA 3HVNA 1KC5L 4WFFD 2ZG1A 3KCPB 2RQEA 1I7TB 1BBT2 2IXCA 4MO3M 4F7MB 1N64L 1AR1B 2AERT 2DQJH 4AQ2A 3OG4B 4NZJA 4LSUH 1KCKA 1MI5A 2QTEA 4XB7A 1JWSA 3IEAA 4DETA 1I5PA 4PRIE 5GGTH 4QKBA 4YHIA 5E8DL 5FY0A 5E70A 4E9LA 5DFAA 5T5NF 4FOQA 1BZDA 5GIRB 1O5DT 2BSSA 3K8MA 4QRAA 2VISB 1TTRA 3E9UA 5D7LE 4ADJA 1KBBA 5HYIA 1N1SA 4ANVA 1U5YA 2JB5L 5J13B 4FAHA 3UIYA 3KL5A 2AEYA 3U1XA 4B6ZA 4S1QH 1GJIA 1JMXA 4EYUA 4HG4K 3BZ4A 2FIKA 2OW4A 2WQRA 1CN1A 3U37A 3X1BA 3J8F2 5FGSA 1R091 1FFPB 3A23A 1QFWM 4XC3L 2ZOEB 3KHBA 1DANT 3FF7A 2XUEA 5C9KA 1E8WA 4ZI8A 2YROA 3I9PA 1ECYA 4ZUUA 1I1AA 3T1FA 4OLWL 2KBGA 5CU9A 4M4PA 1QLRB 1UU4A 5CFCA 4RHV1 1U4FA 1QVOB 3UGFA 3INUH 2E0PA 2G0LA 2NY7L 3F64A 3QDME 1L0PA 4HD9A 4MDJB 3WS6A 2XVBA 2PQSA 2JNZA 1RHI1 1G9FA 1QDCA 1E4KA 3H6JA 3RZJA 5IFPA 4TVPD 2VJXA 3UP6A 3QQNA 4F15B 5HDQL 3BU0A 2WCGA 3PHMA 1DQDH 1BJ1H 3PHSA 4L05A 5D1XB 5H9SA 1MCLA 2H1PH 4I87A 5IHWA 5JTWA 4Z0BH 1QSVA 3H9HA 5A3IC 4PJIF 3W20A 2MNUA 3SO5A 3B7UX 5FXZA 1HCYA 1A47A 1TEFA 1G7PA 4KRPB 1Z9PA 2X6CA 3E0GA 1S55A 2GJJA 1GGIL 1YAIA 2N7SA 4KMTL 2PCXA 1FN4B 3OJMB 1O7FA 1UC6A 3WKPA 1L7IH 1XMEB 2FLMA 2XUWA 4ATWA 4BH7A 1OA4A 1TT6A 1WAEA 3SY0B 1WIUA 4CDUC 2N0MA 3V9FA 3BDYL 3VBHC 4NQEB 3PP4H 1G87A 3LB6C 1AKJB 3RWFA 2OCFD 3PAUA 4XE9A 1GGBH 2BUKA 3EOBB 1IM3B 3D08A 4LCCB 1AHMA 1KIPA 1UA7A 3S3CB 1TJXA 2X4SA 3NT0A 5A1LA 1EEZB 2ERJB 3HE7B 4IBYA 3QQXA 1RUOA 1VAHA 3WFEL 4QJ4B 2JCCF 1NE4A 2ZEXA 4FI7A 1K5MA 2Q7NA 3OPWA 5FLHA 5K1JA 1LDPL 5JORA 3F6IA 1F6LL 4QHKI 3E6CC 3H8OA 5HGHB 1UATA 3ENEA 1I1AD 1HZKA 5CO1A 1RUJ1 1T7ZA 4HUVB 2WYIA 3NZ8A 4LAJH 4ELME 2BW8A 2ATAA 1RZ7L 1L7TH 1YPZA 3VFPA 3W21A 1A7RH 4KVCH 5HSFA 4F2FA 3IDMA 4JQVC 1NL0L 2AQ3A 2J5LB 3AZVA 2ZYIA 1DQLL 1D5BA 2XTJC 4M7LL 1VPOL 2C9RA 2YMTA 5IM7A 3QCUL 1LQSR 1HH9B 1ASJ1 5I8TA 3NNJA 1LEIA 2AVGA 1O9WA 1I1FB 2VLRE 2QTVA 4HPOL 3VFUA 2WJ5A 4KK6D 4DGYH 5DZEA 2CWSA 4A2UA 2VKWA 2WWKT 1T20A 4DIXA 4XURA 1SDDA 3WO4C 3GS4A 4EF3A 3DROA 1KXVA 4AL8H 1POV1 3VBRA 1L6PA 4U6YB 4HWBL 1NZCA 4CDWA 2ZKHL 4AZUA 3VKMA 3FFCE 4ALAC 5DJAA 5F7NC 5I76A 1ZANL 4KVPA 4JGYC 5GGVY 2WFF3 3K2UH 3KLAB 4I13B 4XZ4A 5DZOA 1V9U2 15C8L 1CDCA 2MTAA 2YPLE 3K2OA 5FREA 1I9JH 4G3YL 4NZUH 4DZBA 5CHNA 1IUZA 2COVD 3M8OH 4YIQA 2A99A 3DNKA 4M3JA 5FFGA 4ARXA 5BYNA 4UQIM 4IERA 4RS5A 4HC1A 1B09A 4J8RA 4AM0B 5LBBA 3VKOA 5FQ0A 5SV8A 3N40P 1OKEA 1U8QB 3KBPA 4ZAKC 1CIWA 2JDYA 5E95B 5J56B 4AGVA 4G6AC 1PZ5B 3VD7A 3HMWL 6CGTA 1UOVA 3F01A 4WUUE 1XRUA 4XBQA 3QI9C 4GWNA 4QD2E 3MGOA 2TNFA 3VW3L 3JXAA 2ZWKA 2KH2B 3BIKB 4O58H 1TTUA 1BIIA 4KOCA 3ULVF 1S7QB 2ED7A 1MFDL 4H25B 2A5ZA 1BOGA 2J4WH 3IBOA 3J2PA 3P3RA 4LSRL 3TBBA 2HTKC 1CFBA 5BMFH 3O0WA 4JHAL 2WMPA 4IEPA 3GJFA 4K1YA 2CCWA 2IPKA 3AZXA 1RUE1 3A6CL 1WZ1H 1A6WL 1SN2A 5G4NA 5HDOA 3AMKA 3VI4F 3KVDD 1C5BH 2NQDA 2VDRL 2XACC 2YAMA 3EJUA 4R9HA 2O6EA 4SBVA 5CD5C 12E8L 2CO1A 1I1EA 5DO2C 3TBDA 4NUMA 3ZZSA 4UT5A 5FP8A 4I18C 5JXAL 4YXLH 3MLJA 1YQ2A 4N2KA 5CIPA 3NJJA 2EVFA 3DX0A 4HBQA 5GHWH 1JYXA 3JXSA 3O1SA 1ZWIB 2VUCA 4MNQA 1KB5L 3PJSB 2EEXA 2R7EA 5FYTA 4YHMH 2Z93B 5AVPA 4RIRB 4BYYA 3MCLH 3KWUA 4C4BA 3O4LE 4YL4A 3MV8B 1H19A 1CDHA 3CHRA 1HKLL 4IBTA 3K46A 4L2YA 4UM9B 5FECA 1VMHA 4LEXH 5T5JA 4BM7A 3NV1A 4EDXA 2B5IC 4GI8A 3OAUH 5FY4A 1J5DA 4DXRA 3MLKA 5BNNC 3TEXA 4K5OA 1IS3A 1Z5HA 1AL23 2W0LA 4XB8A 1CFTA 1K8DB 1OGAB 3SOBH 4BSWB 1TXKA 1HHJB 2BSBA 5DK2A 3T77A 3MNVA 1E28A 1W72H 2HJLB 1XX9C 3CVHB 4BZ2A 3QGVA 5CFDA 3W9AA 2Q2EB 1D6EB 1UZ0A 1WBYA 4UUJB 3BP6B 2ZMLA 4NQSA 1IM9B 3W0WD 1E57A 2WW8A 3ZZQA 3D9AH 3MRHB 5HP5A 3VGGA 4FJZA 4R6UA 2DBLH 3WIFB 2HLEA 1NFAA 4WTWA 5F3BA 4YBHA 4P2QE 1VLNA 4LO6B 1UWFA 4XNXH 3V6ZA 1BG1A 2XFXA 3AP4A 2IXQA 3TVMB 2GC0A 4LBEB 1I8LA 5AL8A 3SDXB 4XC1L 3ZGIA 1T4KB 2IXIA 4IV3A 3GD1C 3MLTA 1PIFA 4EZLA 2ZGSA 3HAEA 3EXUA 2NUTB 4UINH 4JPWL 2WLMA 3US0A 1JXKA 5A3MA 3TBVA 5D8AC 1W9YA 5IVZB 4EE2A 1BOYA 3WW4A 4XH2A 1I8MA 4W6XA 1FDLL 3QEQA 1WK0A 4EAEA 5JW5B 4LOTA 1O75A 2XZAL 4Z18A 5CAYB 4NQXB 3ECUA 5BO1H 2BQPA 4WZFA 5BRZA 1AGBB 4Y9GA 1ULOA 1SXCA 3N36A 3S97C 2PKDA 3D06A 3MRGB 5FWQA 1PL3A 1Q90A 4P4KA 3UYOD 5FUCE 3U4BH 1AVBA 1F45A 4XTRC 4YW4A 1JGIA 2EILB 3FBQA 4PR5A 4J1UA 1V54B 2Q7YB 4DP4X 3BPOB 2XSKA 5ICZA 2XV3A 5C7GA 3NABH 4NQDA 1EHXA 4NPLA 3X1EA 1OSGA 5LBSA 3DCQA 4OLVL 2GK0B 2VQ1A 4RAHA 4XXDB 3ZE2E 4ZFOB 2X87A 3FDWA 1JPGA 4ZSOE 5F88B 1XGUB 4AQZA 3O6MH 3MOBL 4G9FA 4CMMA 4DVRH 5ADPL 1R3IL 1CLOH 3LZZA 3RUGB 3L4XA 4HK3J 5B21A 3BH9B 4N8CL 1VBC2 5E1GA 3L3GB 4PJ5A 5D7IA 5JXJA 4E2QA 3ULSB 4LBQB 5FUCC 1FNHA 5IHHA 5JR7B 3VYNA 3IGUA 3T1LA 1YNTF 4C90A 3UGXA 4N6QA 2UWEA 4ONFH 4AZZA 1UB6A 3D09A 5FRAA 5C07E 2A3WA 2V33A 1DQ2A 4GG8B 1T1YA 3DV6A 1C16B 2QL1A 2ZJSL 5TE6H 3MREB 3UC0L 3IKWA 1AXSB 3US1A 5K33A 4HH8A 4L3ED 1YN6A 4FPKA 4P3CH 5ISLA 2O8QA 3K72B 2FRGP 4Q4X3 2BK8A 4OD3H 4ZFGH 5K59F 4IS6B 4AVTA 2VIRB 2YZ8A 3HN3A 1N4XH 4JTNA 1HQRA 3LFIA 3UAAA 3AM8C 4HJGA 3CZFB 3CZNA 1O8PA 2Z5WA 1XSJA 1FFNA 1HSBB 4KK9D 4GMP1 4UQAA 2QVMA 3TCLA 2PYEA 4A68A 5JDBA 3FU7B 3RTQA 2FWOA 5EPMA 3SYAA 1NA8A 1SXZA 2OVUA 1CG9B 1BZWA 3GINA 4HIPA 3V5DA 3O8XD 2DTMH 4QU1A 3KYKL 2J1SA 1HJBC 3VWJD 1PY9A 4LMQE 2YWZA 4ZG1A 3DOHA 4PJ9B 5JLZA 1IPSA 3E8UH 1QRNA 4O51B 5DSCB 1JHKH 5TD4A 1YVLA 3LMJL 3R6SA 4WI4A 5DA0B 3ZKSD 1RJ7A 1JVKA 4NQDD 5DD0L 4YEFA 2R0HA 2E9GA 1GRWA 4QPGC 2WZPP 1U8HA 1UGNA 4K7PY 4PG2C 2EIDA 2EIEA 3WX5A 1BZ7A 2ZUWA 4R4BA 1I1YB 4G9FD 4NUGH 4ZD3H 1N2RB 3CLEL 4YHPA 4DGUA 1MS5A 1KSRA 1MJUH 3LJ3A 5IBLC 2DD8L 2R2HB 3QUMA 3OR7B 2P37A 1Q9OB 4GUOA 4A6SA 4JY6A 5TE4H 1FFTB 4N20A 5E7FA 3S6CA 2L9LA 1JRHL 4WV1A 2UZXA 3SKJH 3Q8CA 2B1AL 3FB5A 2IXJA 1U4EA 3EYSH 3S34L 1MVEA 2EXIA 2QSCL 1VENA 6FABL 4JHZA 4K8RD 4UFHA 5EEUA 3QJHA 5LGHH 3P5BA 2CBMA 3FB6A 4P2AA 5A16A 5FYMA 3MIFA 1NSNH 1Z3GH 4JREB 2R063 3H7LA 1RFDH 3CZUB 3KPSE 3TZVA 5DC4B 1QLFB 1S9XB 4I4WB 4HK0B 1CXFA 2QHRH 1WMEA 1MF2L 3INAA 1R1A1 3D85A 4JM2B 4B9KC 2K7QA 3NFSH 3CXDH 3LZOA 3D48R 4R7DA 3KVAA 3NZHH 4FFZL 1XZ0B 3SYQA 4PQ9A 4WENB 3TEUA 3H3BC 1XYPA 5A6ZA 3RTQD 1X3DA 4UBDC 5DYOB 1T2QH 3DPRC 3TNNA 4ZMAT 1CD1B 2BHFA 5LY2A 2G9HA 1MEXL 2NNCA 2FJSA 1BFVL 3MRRA 3ZMNA 2VDPL 2WIMA 1QZNA 4ICXA 5K8SA 5FP4A 3IMTA 3LWCA 4I9WD 5B7FA 3GHEL 1OLZA 4NP9A 1XR9B 1RUH1 1DQJA 3KYOA 1CX1A 1JOPA 4NUPA 1PVXA 1MFVA 2A9BA 3HG1E 3V95A 3TNPB 5CMAA 4QKFA 5BOZG 1WFJA 2KQNA 2B8OT 3QYNA 4X5XB 5JXIA 4JPIB 4YSDA 4AWDA 4HJ0C 3ARXA 2QEJA 5AKTA 3VFMB 3ZKND 4FPOB 3P73A 1SLTA 2XRAL 4E5XB 3HZYB 2EXWC 1NC2B 1JK8A 1GZPA 4NNYA 1H6FA 1S7SA 4GAZA 4Z7VA 4F9LA 3BQUA 3UTTB 1MHCA 3JT2A 4AKQA 2AK4B 1N5AB 3DJZA 4KHTH 3JQXA 3K3OA 2IAND 4YVWA 5FZ0A 3DPBB 5AW5B 3OD4A 1UA6H 4JGMA 3B9CA 5AAWC 4WU7B 1WCQA 2XXMB 3FUMA 3H2WA 4G6KL 5JUEH 2GUOB 4LLYB 1NMCB 1ZT4B 3EBGA 3P0YH 4DRVA 1RERA 1OSPH 4A2MA 5D93B 5CCHE 4IE6A 2EXHA 1AOHA 3BKCL 1ZRCA 3MA7B 4YVSB 3EJPA 3RWCA 1TVBB 4OBRA 1FNSH 4L8BA 1A9VA 3POEA 5KHGA 5KHKA 1HNGA 2PA7A 2YRBA 3D1MC 3JV5A 1QXJA 1UL9A 4DXSA 3DRTA 4DS0A 1M6OB 5DUBB 1CBJA 3L3DA 4MG2A 1KDKA 1QOSA 1NX9A 1CFVH 3KM5A 3P0VH 4W4OA 2Q86A 1HVXA 4YSQA 2YWYA 3VHOA 3ZE0F 4HLTA 1IAIM 1UKSA 4N2AA 2ZEYA 3LV3B 3POBA 3BKYL 3I2OA 3K4AA 1E3XA 2BY3A 1HRI2 3LTVA 2WBJC 1SY6H 2ICEA 1BVNP 1MW3A 3OLGA 5ALBH 3FRUB 5J98B 2OZ4A 1I8KA 4NP4H 4AMXA 3TCXA 2WNUA 1KDIA 4Y2LA 4D7YA 2UXTA 4JKKA 4WVMB 3S3DB 1BVOA 1PMIA 1SPDA 2HVKA 4FABL 2R59A 2C5DA 4GJYA 4J25A 2VZSA 3WG2A 3BWSA 4JRYE 4NKMA 5IB1A 2CDEA 5HHPA 2J2ZA 3CAFA 4G80A 4G7SB 5JQ6H 1Y18B 3QZPA 3V79C 1GY1A 1F3DJ 1N5YH 1C08B 1PPIA 2X4NA 4CEYB 4ALAH 3DJ9A 3KYMB 1O6UA 5C08B 2R1XA 1I9RH 2UVEA 3TO2A 5F8PA 3JWDC 3S35L 4HS8H 1YFXA 5EV7A 4WHDA 4EROA 1UWGL 1AHWA 1DJSA 4GWJA 4LSTL 3CVIL 2NXZB 3MO1A 4RZKA 3BQUD 4EDWL 3G7DA 5FZHA 2BJML 1SLVA 3G04A 3F2ZA 3PLYA 5IWLA 3DURA 4O02H 1ACZA 4BA0A 1JVOA 2W92A 4LBMA 4PS4H 5DMJB 3VFTA 5JI7A 1G9CA 4BXSV 3NA9L 3R7QA 2G60H 2XBO3 3BOWA 5CINL 4XNYH 3ECWA 4A55A 4UT9A 5DZPA 1OCRB 1P53A 1U91A 3DETC 4BFEA 1UG9A 2XXFA 3CDGB 3K2IA 1AR1C 3LQAH 4Z2WA 1VRBA 4N53B 2E5EA 4AY0A 4Y9BA 1FVCA 3WLWC 4EO5A 5C9AA 3T4AC 2QADD 1V8HA 2GVYA 1AYRA 3NQIA 1OSEA 3O3EA 5AC91 1X5HA 2AJVH 3T0BA 1WS7A 3U9WA 1EEUA 3Q2NA 3GS0A 1ZBA3 2V4VA 3SDAD 5JWPA 1TTFA 5IESL 4EIUA 1C5HA 1LB2A 3QFJE 4XHQA 2XBTA 1RZPA 4MD5B 4TRPL 3KGUA 3JUUA 4KAQH 4KXDA 5EIQA 4F8NA 5I1DA 3GTVA 2FSEB 2UY9A 3VD1A 1W8OA 4GSDH 5DQ0A 4LFHG 1NQDA 1JTZX 3OSKA 1VESA 3HS9A 1JNHA 1XXFC 4IK6A 4WVVA 4ZRGA 1MZFA 3TA4D 2RDNA 3MODL 1GOHA 1KZQA 1X9QA 1KULA 2W9XA 4ZS7H 2AJ3B 5JZGB 2X2YA 4RGND 4N0UA 1UIJA 4GOSA 2HBTA 4XP5L 1H3UA 3D2UA 3FSOA 1WWBX 4K7JA 3QP3A 3KPRB 5C9JA 4F15C 2H0EA 5HHMB 3SE4A 3ZW3A 1YY9C 4KXBA 5D1XC 1F3JB 4Z7WB 8FABB 2KS0A 2F8XC 4HYTB 4NIYE 3QUZB 2VPVA 4HFWA 2Y3NA 3Q48A 3WJMA 5FPUA 2WJ7A 1A3LL 1MFAH 1ZA3A 4AIXA 3N1MC 1CD3G 1WGPA 1GZQA 1S9WA 4CCOA 4E27A 1VZGA 4MVTA 3QJUB 1N0XH 1F00I 1XSOA 4KRPC 1FMD1 2IXHA 5HYQB 3OGJA 3JBG1 3L3KB 1PG7W 2DEWX 3DX2A 1VB4A 1D6VL 1Z7S1 5E6IB 3VTAA 1A3RH 2OBGA 3SODB 3GHNA 1RJLB 1LODA 4LSQL 1DQMH 1JOIA 3HG3A 4ZX4A 1RUD1 5FYVA 5KSAA 1NFDF 1TG8A 2JJTC 3GSRB 5DURD 3E8VA 2LE9A 4X4MA 3LXUX 2Z9TA 2ZSVB 4QKTA 3GMRB 3LVEA 1JGDB 4WW2F 1TQCB 1HAUA 3O81A 2MWCA 5KJ4A 1ED3A 4LCIH 2E47A 1O5LA 1UH4A 4OLUH 5AVQB 3UBFA 4JVUA 2ERJC 5C3OA 3RU8L 1JGVH 4HF5H 4NZ8A 2NW3A 1E90A 5F93C 3RY4A 1R1CA 2ZP8A 4NKOA 3FQNA 3EYVA 1C5CH 4CU6A 2EVHA 4IIQB 4CSSA 1HQ4A 1T0PB 1FBIH 1FAIH 1RURL 2FH6A 4MRBA 2GN7A 4PGZA 4KROB 1FLRH 4J3XA 4M61A 4ZJ9A 4GG6E 2GIMA 2F19L 3VXMA 4HZLB 1LL1A 3R1GL 4FYTA 3SJVA 2R69H 3PXHA 1UHVA 2HLFD 3OZLA 2EDRA 3PP3H 1A6AA 4BQCA 3GHMA 3C2AH 4ZBJA 2IWGB 3WN5A 2JSFA 1BCIA 1TJHH 1HJCA 4Q4Y1 4XRCA 2WDBA 2YC0A 4IEOA 4F7CB 1G5AA 5LAXB 2X9WA 3RWEA 2VGDA 5GGVH 4I3SH 3HAGA 2M8XA 4LVEA 5EPAA 5E1IA 1A5FL 2HKAA 4TLFA 3PMSA 5DUXA 2DOCA 3THML 4C59B 5MENB 5JNYA 3L4VA 5IJKC 1FZJA 4AEDB 3V0BA 2AJYL 2V72A 3N9PA 2GAZA 2W0FA 2L0DA 1A6TA 4A2EA 4BGLA 2F74A 4ODVL 3FU9A 2PHRA 4W6YA 1DJIA 1W2KT 5F1IA 2ORBH 4BQ8A 3GJBA 1Z0NA 1M71B 1QY4A 5KSAD 4XBPB 5D6CB 4W9KC 1GQPA 1X50A 3T8XA 2C1OA 4PWFA 2WYSA 4YDNA 1SBFA 3LQZB 3ZHNA 4U1GB 1A65A 5AOZA 2JV6A 4MMXA 2R29H 4JN2B 4PJFB 1LDSA 5DUJA 4K55A 3RDIA 5F8RC 5K93A 1BVZA 2I60H 3S5YA 3TNMB 3E2HB 5FJHA 4B4PA 2YC2A 4Q4EA 4DNLA 4RSUA 1PTZA 1JN2P 4TOYL 3B7TA 4GUPB 1RVF1 5HDWA 4KWLA 1G1CA 4O00A 5DD5L 2PR9A 3EJZD 2XICA 4NO4A 3SQOH 2MCMA 2G2RB 3ETSA 1VR3A 2XPGA 2H1PL 2PW1A 3VU1A 2QHLA 3N3EA 3I2HA 2WCPA 5F5CA 3S57A 4PJBB 4R8WH 3BN9D 1X5JA 1AZRA 4HXAH 4IEFA 4JHUA 3VXMD 3MJWA 1Q9WB 1L6ZA 3SJVD 4JL2A 3NO8A 3RZCA 1T89C 3E7JA 1SDWA 2JMRA 1NJ9B 2B77A 1EO5A 2GI0A 4PRIA 2M83A 1NIFA 1UZZA 3THPA 4X6DE 3MV8E 4HZFA 1ZZBA 2B46X 2JDAA 1MY5A 4NNXA 4W6WA 3LRGA 5F2WA 2E7LC 1PIGA 1N59A 2WVVB 4NRXA 5D7LA 4HVOA 3GMMB 1IC7H 4G9SB 3H9SD 1KTKE 1XCWA 1JYTA 2DMHA 3OLEA 2JFCA 1P4LA 2XH6A 2H3NA 3J8F1 4N24A 3M6DA 3GBGA 1G84A 1U3HB 1UIKA 4EXKA 4BYHA 3RBGA 4OFYA 1BKZA 4PD4K 3PL6D 4YDJB 1F6AB 5CP3A 4U1KA 4PJCF 4ISVA 3B3BA 3IT8A 3H55A 2FIRT 2DKUA 3FT4A 1V55B 2X0WA 3QDMA 5K9QI 3FO9A 4H8VA 5E6ZA 4LEBA 4HH9A 5KOVC 4MCZA 1UXLA 3OZKA 4I3RL 4MJ6B 4K3UA 1IKFH 2X2HA 3DGCR 1DF0A 3CFDA 4Y1XA 5AW6B 3IKCA 5D1ZI 2V7NB 2QPSA 1AYN3 1GOFA 3ZJAA 3BWZA 3NV3A 1CZ8H 1I7UA 4MMYA 3BAYA 3TYFA 4QHOA 1OZTG 1PNDA 1NAMB 1KLGA 1RUC3 2HVJA 3EFDL 4LQFH 5CU1A 2WXPA 4KBPA 4LRNH 5JI9A 4M7KL 1J87A 2ZF8A 4PV8B 4OCLC 3MGTB 4QOKB 3GIVB 3FC8A 1T66C 1UY1A 1KCVH 3WDWA 5FC9A 4PRPD 1NZIA 4LFHD 3PUQA 3L7FA 4M9PA 3TVMC 3JB8A 2JCWA 2D2OA 2D6KA 4N43A 3ZL4L 1KT2B 1C57A 3MRFA 3ZDXE 4AL8L 5HYJB 1PW3A 2KPNA 4IDJH 1CMOA 1H2NA 1YNKH 4GXVL 3UO8B 2CQVA 2RA1A 2WFPA 3GMQB 1DANU 3ARFB 2OUJA 3NDZE 2DYPA 5D7LD 2RGSA 3Q3GB 4JDEB 2F1AA 1W6WA 4HISA 3F7VA 4L4VB 4RGOL 5F89A 3RUGE 3OKOB 3LS4L 1CXIA 5FYKH 1W8FA 5KW9H 3GGWB 1TME2 4IBQA 3RL2A 4XCEA 3D0LA 5IQOA 3I6LE 1I31A 1X4YA 1XNDA 1MIEH 5A3ID 4TQHA 5F2FA 4GB32 2JK5A 1HH6A 4ORFA 4E2SA 3BPOC 4ELMA 4JRAA 4X8JA 4X0NA 1ND0B 3IT8D 3O2VH 4UTCA 4N68A 3AY4C 5DDHB 1R3HA 3QDMD 2OX0A 2JIXD 3K0WA 4PJEB 5AALA 5FCUH 5AENA 5GZNC 1HI6A 2O4EA 2ZUUA 1A25A 2WK2A 3GJFK 4KITB 1A4KB 1QSEB 4PB9H 3LB6D 3H1ZA 3KPPA 5MERB 1IC4H 4JO1L 2HWD1 1AO7E 3IE9A 4ZMZA 1FIGH 2VLRA 3QRBA 1EEYA 5T5FA 2Z91B 1OALA 1X9PA 1KTDA 1E0OB 1O6VA 4Q0XH 2PW2A 4EIGB 2VWEC 1IJNA 3FW6A 4LSDA 4IW3A 5FYBA 2EDXA 5JMCA 4IEVA 4OVEA 1AYOA 1M7DB 3VV1A 1YA5A 3QI9A 2UY7B 3SKVA 3MN8A 2V5MA 3ZTNH 4A7GA 1LJMA 1ZLDA 2ZWLT 3FFCA 1NCOA 5TDPA 5KG9A 3R0RA 4YXLL 2F0CA 1V9U1 2G9FA 1AXIB 3O2DA 4XAKE 5GHWL 2YPLA 3DRQB