2WN2A

Structure of the discoidin i from dictyostelium discoideum in complex with galactose beta 1-3 galnac at 1.8 a resolution.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
254
structure length
254
Chain Sequence
AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
molecule keywords DISCOIDIN-1 SUBUNIT A
total genus 63
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wn2A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wn2A01
3I2GA 1PX3A 1K42A 3K77A 3C7OA 3K46A 5CZKA 1JZ7A 1CZTA 5JMOA 3HNMA 4QB2A 2VCBA 2W87A 3DYOA 2B4KA 2QQJA 2WZ8A 2EIBA 2PQSA 3EYPA 3T09A 2V4VA 2ZEWA 2YC2A 1UMIA 5IHRA 2W91A 3T0BA 2E26A 1DP0A 3HNYM 5LA1A 4YPJA 3CKHA 3T0AA 5JXIA 4TXWA 1JZ8A 3NRUA 2VZOA 3THDA 2DCKA 4XZUG 1K3IA 3T2QA 1O59A 2HLEA 1WKYA 3C8XA 1W9SA 3I3EA 4GWIA 4RN5A 2J7MA 4M4RA 1W0NA 2J1AA 3FN9A 2V5DA 2W47A 1UY1A 1US2A 1CX1A 1SDDB 2BZDA 2Y6HA 3OGSA 2WAOA 4QB1A 1CZSA 3VDAA 4A41A 4PT6A 2HYXA 2VZQA 2W92A 4A45A 1J83A 2Y8KA 1UXXX 2CDOA 2C9KA 3HPNA 3THCA 2XQXA 3VDCA 1JYNA 2CDPA 5JUVA 2WO2A 3WNOA 4CUAA 3D3AA 5LA0A 2DCJA 2VMEA 1RYYA 2W1UA 2XHNA 3LPGA 2YC4A 2BBAA 4Q56A 4DXRA 1CZVA 3ABZA 1OF4A 3OB8A 1UMHA 1GOGA 2E31A 4LQRA 2W1QA 4L0PA 3UNPA 3MUY1 4CU8A 2JKXA 3OG2A 1GUIA 3IDAA 3OEAA 3A21A 4OYUA 4QX3A 3BN6A 5EJ1B 5DMYA 4JKKA 1PX4A 5JR2A 4DXTA 1JYXA 2Y6JA 3MV11 2LS6A 1GMMA 2J1VA 2J1RA 1L7QA 2J1TA 3GDBA 5C70A 4P5YA 3WF4A 2JD9A 3IAPA 2W1SA 2ID4A 1JI6A 3SKJE 1GQPA 3HNBM 2VR4A 3GGLA 3ACGA 3DYMA 1UY0A 2ZEZA 2EIEA 1UYYA 2L9LA 1WCQA 2V72A 3E1F1 1YQ2A 4LKSA 1JU4A 4RYDA 4KMQA 5EJZB 3MO4A 4BXSV 2YG0A 5LA2A 3ACFA 2OKXA 1PMJX 2RV9A 3DYPA 1UXZA 3WNNA 3SEPA 1SHWB 4MO3M 2DDUA 4AG4A 1O8PA 2J1UA 5B4NA 1UZ0A 1W8OA 2WN2A 1P8JA 3WMQA 3K4ZA 2BGOA 1OF3A 4D8MA 1SG3A 3I3BA 3I2FA 3P1IA 2YFUA 3VD5A 4OUEA 4CUCA 3MV01 3T0DA 2VQUA 2VO5A 1XNTA 5C71A 4JHZA 3A7QA 2YB7A 3FHAA 3C7FA 4D0QA 3C7HA 4P00B 4CVUA 4A3ZA 4BK4A 1LNSA 4TTGA 3HJRA 4KWUA 4GWJA 1H6XA 2WBKA 3MUZ1 4DXSA 3OGVA 5HPOA 5DN2A 2BGPA 3LPFA 1OD3A 3HOBA 4XVHA 3LEKA 3W5NA 2CGZA 1W9TA 2VCAA 2XOMA 1TG7A 4W4ZA 2Z4FA 2VZ1A 2EIDA 5JXJA 2Y6GA 2CE6A 5IJRA 5JXHA 1DYOA 5LCWL 3HN3A 4QB6A 4P02B 4IUGA 1KEXA 3UESA 4DUWA 1UWWA 2ORXA 2QQOA 5DPNA 5G04L 3VD3A 5C7GA 2ORZA 3DECA 3LEIA 2VMFA 4KI5M 4DEVA 1NAEA 1I5PA 4ZZ8A 3K4AA 1F4HA 4MGSA 3CQOA 4M4PA 2WQ8A 1GOFA 3IB3A 2WO3A 3PUIA 1CIYA 3A22A 2YFZA 4E8DA 4MGQA 2CGYA 3OGRA 1NX9A 5G05L 5J1XA 1H6YA 3CDZB 3I2IA 3JXSA 3EB7A 4ZXEA 4QDRA 2VCCA 1XC6A 3NJVA 2QBXA 4OZOA 3K4DA 1GU3A 1PMHX 2WN3A 2Y64A 2VZ3A 3W5MA 1UY3A 5FUIA 4JX0A 4XUQA 3ACIA 1W99A 4UOJA 2J1SA 4GZ9A 3ZM8A 4A4AA 1ULPA 2WDBA 4QX2A 2KD7A 4JKMA 3IAQA 3A23A 5A1AA 1EUTA 3P6BA 4XURA 2LW8A 4XUNA 2XONA 2VC9A 3NQHA 1O8SA 3K75B 3GXUA 2QQKA 4W50A 4QDSA 2VL4A 1TVGA 3OBAA 3J7HA 1DLCA 1HN1A 2C4XA 1JZ3A 2W1WA 4LHSA 3WNMA 3C7EA 1JZ2A 3FL7A 3C7GA 3SKVA 3LQCA 2WYSA 2WABA 3VD4A 2VM9A 2ZXQA 3WF3A 4QDQA 2VJXA 3I2KA 1W8NA 2R7EB 4FI9A 4A42A 2WO1A 1US3A 3WF2A 4HG6B 2ZEYA 2VQTA 4MOAA 2C26A 3CMGA 1GOHA 3ECQA 3LE0A 4ARYA 2VTFA 1L7RA 2X09A 2B9VA 4JKLA 3FHQA 3MBWA 3WF1A 1MPXA 1UX7A 1KGYA 5I0DA 3CIHA 4Z2AA 1NUKA 3BGAA 2J1EA 1JZ6A 2RJ2A 2VZSA 4PQQA 3ETPA 4MADA 3VD9A 3WEZA 1XPWA 3PUHA 1OH4A 1UYXA 1UY2A 4CUBA 2W5FA 2QQNA 2JDAA 3SEEA 1T2XA 4AAXA 1ULOA 2JE8A 4DUVA 5IFPA 1JU3A 2VZRA 3WNLA 2CCVA 1W9WA 1K45A 5JXGA 1JYVA 1GNYA 4W8JA 5IFTA 3ACHA 3WMPA 4CU9A 4QAWA 4BJ0A 5EIYB 1EUUA 2QQLA 4BDVB 2E32A 2VOTA 4CU7A 1J84A 3VD7A 5DQ0A 4BK5A 4DUXA 3I2JA 3AC0A 2W9XA 2W94A 1BHGA 2VZTA 3I2HA 3T2OA 2RVAA 4LPLA 2VZPA 4UAPA 3OEBA 1XNAA 1OT5A 4DEQA 4OMDA 1F4AA 2WZEA 2W95A 1UYZA 3U37A 1R64A 3I97A 3NNGA 3WF0A 1JZ5A 5IYYA 1UY4A 2VZUA 4P08A 2VMCA 4OMCA 3I3DA 4E8CA 2VZVA 4A44A 3HEIA 1JZ4A 4ARXA 2VMDA 2EICA 3WSOA 1JYWA 2WAAA 2J22A 3T2PA 2W46A 4ZZ5A 3UETA 4QX0A 3VDBA 4PF1A 4UI9L 4CU6A 4ET7A 3CZUA 3GM8A 4QPWA 3WNPA 2BERA 2Y6KA 3LEGA 3F2ZA 5CYYA 2QQIA 2W3JA 3WNKA 5B4XA 2WUHA 3NJXA 1K12A 2E33A 2X05A 4QX1A 3IIIA 4XUPA 1IQDC 3T08A 2ZEXA 2QQMA 1JHJA 2Y6LA 5HXMA 4XUTA 4XUOA 1NKGA 5F7UA 4A6OA 1D7PM 3WQBA 4ZY9A 2X10A 3CZJA
chains in the Genus database with same CATH superfamily
3AUVA 3WUZA 1GL4B 4G82A 2IC1A 3JD72 1ODAA 4LCVA 4PV9B 3RY4A 3TJHC 1VBE3 1U58A 4X8CA 3QRLA 3QIBB 2XVGA 4YO0B 4QX8A 2A73A 3AXLB 1OGAA 1P9MA 1WA2X 2CKBA 2FBOJ 3LEVL 1OGPA 5GGRB 3SZ6A 2OK0H 2ZP8A 2VNGA 4A39A 5BZWA 3P0YL 3ASIA 3WTWA 5KXBA 1LO2L 2GITB 5DVPA 2AXFB 2NYYA 2YC2A 5A7SA 2V2XB 2GUOB 1ZBE3 5FO7A 2AK1L 3N7MA 1WWCA 1HZHH 3NIFB 1HHJA 1KXVA 5HYJA 2O93L 4LLVB 3RDTB 4M6OL 5ADOL 4P2RB 2WLIA 3K1KC 3GRWA 1XGZA 2F54B 1E6JH 3VI4A 1PZ7A 5KZCD 1UGNA 1FYUA 5C5TA 3IMNA 1PO21 4AL8H 3IWUA 5G2NA 2WLLA 4YQXH 1JTZX 3D07A 2HLFD 4I4WB 4TYUA 2Y36L 4Y4FB 5FW8A 4NIHA 2VDMB 1JP5A 1RVF1 1MCJA 3SO3C 1CX1A 1U8KA 4CXWA 1H8LA 1SDDB 4XH2B 5GRZA 1KS4A 5D2AA 3DUUA 4H88L 1G6RB 2O6EA 4KRMB 3F05A 4UT9A 4PRID 5EFIA 2Y4SA 3OGSA 4Q4Y3 2XQBH 4R0LC 2JB6A 2R2BB 4A41A 5KBPA 1KNOA 4ONOA 1XIWA 1YEGH 2Y2WA 5EEWA 3ZFEC 4J8RA 1UWXK 2PXYA 2FDJA 1OTTD 1KELL 2RJLA 3BKJL 2EVJA 5GGVH 4QWNA 2X3BA 1SN5A 1C08A 2VR5A 4R84A 1AJ7H 2H32A 5EU3B 5EU7C 3S34H 5CD5C 4NC0B 3GBEA 5F9JA 3MV7B 3P0VL 5BJTA 1UW8A 4PJ8A 4AF9A 1Q0XL 3UMTA 4CADA 1BVNP 5TK4A 5AG9A 1YEHL 3MRFA 4KX8A 4WFFD 5HHOB 2HWC3 1AC6A 1Q8PA 3RA7L 4EDWL 2ZGRA 5FOBB 1CD1B 2B9BA 4DOHE 2AEYA 4DNYA 1WG3A 2Z8RA 5LBVA 4GB31 2GNDA 2CO7B 3NACL 2FIKB 5TQ0L 4N90A 3SE6A 5AFEA 1MFVA 4Y1AB 1GUIA 4IGOA 1U41A 5JXEA 4IE4A 1ROWA 4S2HA 4RA0A 4PWFA 1W8HA 4LEXL 3VWJC 1LO3H 3ZZSA 5EO1A 3H50A 5GISL 2OMNA 2ARBA 1TZIA 4NGHH 5JIIA 1H5BB 5I1JH 4QM8A 4LRNH 4BH7A 1IKOP 2I24N 1KIRB 3ZMOA 3QQ3B 3PJLA 4DZBA 2FDKA 3CXDH 4W68A 4FLHA 1UVQA 1J1XH 1GA2A 3ZQXA 1ZANL 1G94A 2ILLA 1UUSA 4G1EA 1HXMA 2B42B 4CCEA 3BDXA 5A1FA 1QZNA 4P2AA 2HWD1 4NM4H 5FYKD 1OLRA 5EC2A 5GGQL 4MZ3A 1ILUA 1BFSA 1PJ9A 1EGJL 5EZOL 2ZEZA 4C1XA 2ZMNA 3FB8A 1CT8A 3V4LA 4L0ZA 4LBQD 3LNDA 4JRXE 2HWB1 1QLFA 1YQ2A 1I4FB 4K94C 1CFBA 4DP2X 4L4VD 3OR7B 2P5PA 3REVB 3LD8B 1QJU2 2FMYA 1VLNA 3DVFA 3H1ZA 5CG9A 1EY2A 3ZDYE 2AGJL 3FFDA 3MFFA 1GHFH 3HTLX 1FIEA 1TJMA 4LCWE 3QJQB 5E6SB 1VBD3 4ZFGL 1LULA 4F9LC 2WTRA 5TDPB 1Q38A 5DG1A 2FQDA 5DK2A 1S9XB 2MTPA 3F6IA 2WYIA 4AG4A 1EAPA 4OFVA 2QSCH 5AKSA 4V1DE 2P3YA 1DVFB 2MMXA 4HUKB 5B3NA 1UZ0A 5IG7B 4LL9A 3LKQA 5C2BL 3ZXJA 1GFF2 4GQ7A 3ZTCC 3HZMA 2I9LA 5ANMB 2WT2A 4IQPA 2YKLH 1ZTXL 2EXIA 3Q3GA 5GRJL 3D82A 4GRMA 1K3ZA 1FGVL 1G1YA 2TRHA 3CN1A 4ELMF 4KO7A 5FC9A 1NOVA 1WZXA 2VMHA 2VC2B 4N2BA 5C0NC 1OMIA 3VBUC 2W9LA 2IDQA 3A7QA 3KPRB 2IXQA 1D3CA 2XH6A 4K40A 3ZQWA 5TK2A 1MRDL 2VISB 4P00B 1BMV1 1P7KB 3UTPE 1OPMA 1YO8A 4O51A 5LN4A 3UADA 2RS32 5AW4B 1SLBA 3OY8B 4BUGA 3VNYA 4KWUA 1XR8A 4P23A 5LBSL 2GN7A 2OI9B 5C0CD 1LO4H 3MF6A 2D03H 2X4SA 2FO1A 4XXDB 1AGCA 1QQDA 3B56A 3BAJA 1BAGA 4WSGA 4CSWA 4K71B 1S46A 3HAEA 3KDMB 3I59A 1USZA 4HFUL 1KPVB 4HCFA 2C9UA 4HDIB 4EIUA 1F3RB 3L5HA 4D0DB 4CCJA 2HPOA 5F0LB 1IFHL 3WIFA 2Y0SA 5FIEA 2W9DL 2HYMA 2WTRB 3BHBA 3HJEA 3MICA 5IAVA 1OSPH 5C6TL 5EN2B 2Y6GA 3NSTA 4MUVA 4J3TA 4UZGA 2IADB 1NCUA 3OG4B 3TURA 4Q52A 4AI7A 1WHPA 3ARED 1IL1A 5CR8A 4JKPL 3PGFL 4M7LH 4HGWA 3TU6A 3SPIA 4AYSA 5LGJB 5CU9A 3NV2A 3RAJL 1A14H 1NCBL 5INCA 2ERFA 4WV1B 1OVZA 4MSWA 1XXNA 5G04L 3B3IA 5FPBA 2EH7L 2G75A 1PBYA 3D0JA 4N2HA 3R8QA 1GSMA 4QXCA 3A4FA 3VWKD 3VBRA 5B1AB 4RL7A 2MNWA 1C8M2 4JC1A 2R063 2Y22A 3T4HB 1D5IL 1XF2B 3NEOA 4BKLA 4G1EB 3IB3A 5F7BA 4F37K 5IATA 4L3CB 1X4XA 2GHZA 2Y5TB 1DCSA 4GKZA 5KXCA 3DRTB 4KK9D 4Q0XL 4FFHA 3W37A 5IOPA 2XJLA 1QTPA 2PO6A 4HU8A 1R24B 4ZYKB 3WFCH 4QI3A 5D7LD 4O2EB 2E0PA 3U2JA 5C3LD 4ZFFB 5IHZA 4M01A 1RZKC 1FPN2 5DD1L 4PSRA 4PJAE 1A25A 4L8QA 2VLJD 3JV4A 4NAJA 1MH5B 3CF6E 2MFNA 5IFJA 1AXSA 1ULDA 5D7IA 4HLZH 3QIUD 4GQPH 4FD0A 4NCC1 3IVKB 2YXWA 3N35A 4RWYH 1XQNA 3CC5B 2ZPKL 3O0RH 3DTDA 4HSQA 2QE3A 3GXFA 1QSFB 4MNQD 1TTUA 1CDYA 2AQ1A 4PBOA 2K3TA 1RUD3 1QHQA 4QM9A 4AI9A 5AYUL 5J13B 3HCVA 1W99A 4O61A 1C5HA 3QIUC 4BIKA 5C0JB 1U2HA 4J3XA 4UIKH 2YSSB 3GS4A 3GRGA 1PLBA 4P14A 2XKNA 3QEQB 2C6SA 1FG2B 1INEH 1G9NH 1L7IL 1DVZA 4NRYA 2G4IA 5F9TA 3RZGA 5FYZA 3FU6A 3S5LB 4NQDE 1IAMA 3ZVXA 3VMOA 3U7YL 1RKRA 3SGKA 3AZVA 1YAZA 1UCXA 1HZLA 3FH7A 5FGSA 2VH5H 3AMKA 2C9VA 3SDDC 2PWFA 3OQRA 4RGGA 2GJ6B 3TH4T 3VXQB 3WENA 3O8XA 4B9GA 5I24A 2DWXA 4O2FB 2ZUWA 1RZFH 1QNIA 3KPLA 1FNEA 4FXKC 3U2SA 5BPPA 1LD9B 4FLOA 2E7QA 2NOYA 2WM0A 2Z6FA 1D4VB 2YQ2A 3BH4A 1LODA 4JKNA 5FYLD 2YXVA 3CLWA 4JL1A 4X6EA 4X5WA 5FYLL 1HN0A 4XO9A 4Y16A 4EPSA 4Y3OA 1EO8L 1C8QA 3UIYA 1RUJ3 3NIDB 3GZQA 3VFUB 3QG7L 3FT3B 4QJ4B 3AP5A 3IMMA 5AVUB 1S2EA 3ZOIA 4EROA 2Q6WA 3V0AB 3WLWC 2XTJD 4KVCL 4QQPA 1IT9L 4Z7VB 2H2PD 4LPVA 4ZDHB 4EBQL 3VSUA 3WDYA 1J86A 4G42B 3ZXLA 2B4CH 2EIGA 1OM9A 2ED9A 2NQDA 5E24E 2R0WL 1ND0A 2XETA 4O4YH 3K6NA 4LLVA 4XXAA 3QQDB 2FECL 3IJSB 5GM0A 2GW5A 1HYRC 2WNXA 4AQEB 5K0UA 3ZXFA 3K81A 2AXHA 3A47A 3UBXB 2XN1A 4JFXB 3GSOB 3HQUA 1NBYB 3BUPA 4ZBJA 4XN1A 5KYWA 3QG6A 4PCYA 3BGMB 3REWA 4PWKA 2DLFH 2GVYA 3X1FA 4I30A 5JOYA 1AJ7L 3DV8A 2VDRL 3MLXL 4IU2B 4NQDD 1QH6A 4LLMA 2F74B 3LX9A 1S5IL 1A6PA 2D7NA 1MPXA 4XC3L 2WNGA 2UURA 1JPFA 2UWEA 3F7LA 4MA8H 5ISZB 1UD4A 2NR6D 1D4M1 3MNVB 3KPTA 2OMTB 5FA3A 3TVMA 5JA9A 5K9OB 1NZCA 4ODXA 4LSPL 4KZEL 5KVDE 1O0VA 4KVNH 2A6ZA 3KLSA 3V0IA 2Z31D 4JN1H 2JKLA 2Y69B 3HC0A 1ZHLA 4GKSB 2GTQA 1RK0B 5D7JA 5F7MC 2W5FA 2ZP9A 4QF1A 3W56A 3INAA 1JBJA 1R093 3VXUD 2C24A 5FKPB 3JV0A 4TUOB 5I6XB 2CY6A 2C9AA 3FSAA 1DSYA 3DX3A 2ODIA 3GSXA 5ILTH 3CFUA 3WJJC 3WKML 4SLIA 1CFQA 2YD8A 3TCLA 3SPVA 1IARB 2FHBA 2OYLA 3VM5A 4GB33 4UQEA 1NGXA 4YDLB 4RGND 1ITCA 4KMLB 1FH5L 4XE0A 2ZD0A 1SJMA 4FHKA 1JNNL 4A2EA 1PEWA 2C7FA 3F7QA 1DCLA 3I6KB 4YZ5A 2O72A 3KJ4B 1ZZCA 1XDTT 3V65A 1TMCB 2AZ5A 3FYEB 4PG2A 4G11A 3KS0J 4JJHA 1HWWA 5DG2A 1A1OA 5FCCA 4RGNE 5I1HL 2F53E 5IB2A 5LUMA 4IOSD 3RZCA 3VXMA 1SBSL 2HFGH 2P5WE 2YAHA 1OF0A 3VWKA 1K8IA 5CBLA 5JSRA 2HWD3 3C60D 1N4XH 2AGJH 4X8GA 2HTKD 4RRPG 5C0BD 3GNEA 1UJ3C 5T54A 5LNGA 5ICXA 1NCWH 3BAKA 3L9RA 4I5BA 1NBVH 5E94A 4ANUA 4IE7A 2Y07H 3DHJA 3S6PA 4KOBA 4XNMB 4P23B 3IGUA 5BY5A 5T5NF 3IJHA 1LMKA 3MNZB 4GG6F 4G8GA 2NQYA 5I0RA 4D9RE 2WMPB 1MCWM 3IDNA 4ZNEE 1OBNA 4A44A 5A33B 4CDHA 2AEIT 1HHHB 2G60L 4Y5YA 1RZPA 2VMDA 2XVKA 1HAUA 4N25A 4ODTL 4EZ4A 2CU9A 3VA6A 1RUQL 2VLLB 2IMNA 3VXRA 1QABA 4XVUD 4HS3B 1ACZA 2YD4A 4I0CC 4MCMA 3AZZA 3DPRC 1OGTA 1UD8A 3C60B 4WWKB 1DGRA 1KPUB 1UACL 2C1OA 5C6CA 1UZYA 1S7XA 3UGHA 4AHZA 3L3HA 1JPST 5E4OA 2WBJC 2B0SH 3FS9A 4IEFA 4E2SA 1RPQA 4CU6A 1ZVFA 3O0VA 3POSA 4AZ8B 2PR4L 5IK4A 4APQB 5E23A 5C5UA 2PCPA 3ZKMC 4GI9A 4JFYB 5SX5H 1AZUA 5E6RB 1G9MH 1L9NA 1CDBA 1BQLL 1MELA 1EJFA 2B39A 2ZQKA 3CZKA 3DRQA 5KAQF 5FWEA 4YFLF 3U7WL 2P24B 4F8QA 2Q86A 2WXHA 3FBQA 4KNUA 1L9OA 2CMRH 1NLQA 2NMSA 4JDMA 3LPWA 4MNGB 2VDPH 2QQIA 3MYJB 4ZUWA 3GSXB 3KPSE 1NFIB 3B69A 2DWDB 3ARGC 4L2LA 4XX1E 4ETQB 5C4WA 1Q3EA 2R041 4IRSD 1J9CT 5GLTA 5B4XA 4EN7B 3NJXA 1I9RL 4GBXC 2YRBA 4PBWD 3HE6A 3DJTA 2N59A 1KT2A 4M3CE 3MNMA 3TFKC 3KNBA 3SKJL 3NIDE 1ZBE2 3CWGA 4LMQE 4ZZKA 2A1WL 4F7MB 3WIIL 1NKGA 4QRUA 3FUIA 1TYEB 2QT6A 1X8MA 4M0NA 2BNQA 3G7TA 4UDTA 3QYMA 2FDHA 2X10A 1QXJA 4CE8A 4HIJA 3K3QA 4ZNEA 4XWOD 1ODNA 5FZ0A 2DD8L 4QUOA 3WF2A 3C09B 1AKJA 3FO2B 1A14L 5KG9B 4RS5A 1AMXA 5FUOH 2HWE1 3CHXA 5E2UH 3UJTL 2WZ8A 4OCWL 1QJX1 4U3HA 1E27B 4GRWE 3O4LD 1T03H 2P47B 3D85D 1UGKA 3IGKA 2K6WA 3JUUA 4NQDB 4WKZB 4C56B 1PNCA 1U8OB 2J12B 2FDIA 4MVBD 3CH1B 5IHUH 4WTZA 4GLRH 2D4DA 3WG3A 3A6CL 1MCOL 4EQ3A 4RDQF 3TBSA 4YM3A 4YUEL 3K5RA 4Q4IA 4L4TE 4JLRA 5I73C 1XOYA 4P9IA 1IQWH 2GG1A 3ABLB 1M7IB 1NWOA 1UXSA 2QKSA 3QDJA 2V6HA 1BOYA 1JV5B 1NUGA 2RH0A 4MAUH 1Y4WA 1ET7A 5IMLA 3CBKB 4U49A 1MFCL 2GY5A 1FZJB 3GSNB 1NIFA 4ES8A 1X7NA 5JWPA 1LAJA 1FI8C 1WLDA 4BHPA 2AAAA 3C8DA 5D1IA 1RP8A 2YPVL 5L4IA 1OAYL 4E41B 3GHNA 2SEBA 2C4FU 1BMZA 3QORA 1NMBH 1EAQA 5I91A 1NC2D 2GSIA 4G5AA 1KCRL 4YEEA 3RWJB 3MLSL 4NIYE 5D9SA 1UOGA 2OR8A 1CFTA 1K9TA 4XBPA 5EBMB 4ZFOL 5CGMA 5FAAA 1NDTA 1S7SA 4FMVA 4K7PL 3WFEL 5IB5A 2WIMA 3MRJB 1I3RB 3QYCA 3TX4A 2Y8KA 1BQ5A 5JHMA 1LOBA 1NCRC 2H45A 3AVSA 5FV3A 4PJXA 4FL4B 2WXNA 4YX2H 4JO2L 2VN3A 4RZKA 3VDCA 3G04B 5AW6B 5T3ZE 4NERA 1G9NL 2W2IA 4RFEA 4FFZH 1FVEA 3FQRA 3LY6A 1WMXA 3MIEA 2VM3A 3NAAL 5DO2C 2AJZB 1U5YA 4ENZA 1FNFA 1A4KA 1VRSA 2R0ZL 3LRKA 2AJVL 5HYSB 2BNMA 2H6CA 4XQ4A 3PPEA 2YEZA 5HCAA 1RULL 1JGUH 1KB5B 1M57B 2HT3D 4WWKC 2A2QT 3LPGA 4LLYB 3TCTA 4AEIL 3NZUA 5L88L 2A1XA 3GMLB 4TRPL 4CN6A 1KTLA 3MLPA 5DUWA 1JPEA 1S9YA 5FZOA 3QXDB 3K80A 4G7YH 1UFUA 3RURA 4A7YA 3NFSH 2WP3O 4F33A 3WT3A 5IKCB 5HHNB 5FUCC 1CLOH 2WNWA 1JV2A 4H40A 3DN7A 4OCRL 3B7RL 1ZHBB 3OTFA 5HYJB 1HQNA 1WICA 3WJLA 5E4IA 4CDQB 2XXZA 2WXRA 3OAYK 3ZKND 1PX4A 2WB1A 5KBLA 3MRDB 4Y2OA 3D39B 2H3KA 5DEFA 1FWXA 1YEWA 2J1YA 3I75A 3IKCB 3LHPH 4NHXA 4ZHNA 3GDBA 3N43B 2VLJB 3QFJA 5BUVA 2YGNA 4P2QB 1ZGLB 3HMWH 1A64A 4CN4A 1VBD2 4I0PB 1MZ6A 1MLBB 3G5WA 2I7OA 2Z3FA 2IFWA 1SXAA 2VXSH 1FNEB 1VAHA 4H5SB 3FFCE 2B3IA 4PJDA 3L1GA 5F3BB 5IMMB 1DZTA 3FSZA 5E6IA 5FLUA 1W2OA 2WQRA 4NZDA 4PJHE 4ONHB 1N10A 3S3BB 3VHNA 3VQLA 2I2SA 3GSNA 2V72A 4R9HA 3FTGB 1RJZB 4X7TB 4LP5A 4K0OA 3L9EA 5DVOA 2JDKA 3BVDB 3V0BB 1DZ0A 5GRVK 3NAPC 2J6EA 3MA9L 5CEXA 1XSQA 2VDQB 1OD7A 4RA3A 2VLRD 4NQVA 5D1ZI 3WGVB 3GSUB 4D3CH 4ZMOA 4ASLA 3TN0B 5K9YA 3AY2A 4JR9L 2AXGB 2W9EL 5DVLA 4JRXD 4DFHA 4ZI8A 3QAQA 4LPXA 5F5AA 1CUOA 3QDGB 4X9FA 3QXAA 3W0WE 1BLNB 3KXFD 2MCPL 3EYFA 2ZACA 3D34A 1QLRA 5FY8A 1I1AA 1DVXA 5EBWB 2JIJA 2WXFA 3GD1C 3KS0H 3QCVH 2FGWH 3L6FB 5B1KA 2Z91A 4F57L 4LCWD 3T1MA 1AKJB 1JRHI 5KG9A 3APCA 4GMSL 4AYDC 1BBJA 4YBHA 4D6SA 3NSCA 2X4UA 5IFJB 1WD3A 4ZFZB 1RIUL 4MJIE 4TLSA 2YPVA 1KJVB 3P40A 4Y5XA 3UT0A 2C9PA 3D4CA 1AZBA 1QUNA 2Y5QA 4N8CL 3SDAD 4HS8H 3W58A 4U0RC 1V3MA 4E9TA 4RMUA 2COVD 4O2EA 3T0DA 3O1PA 3OC8A 3IAGC 2VY0A 4LGPB 4XP1H 5C0CB 5EF0A 4C54A 5FQ0A 1MLCB 3BD3A 2JXAA 2GC2A 1BQRA 3LNFA 5JMRA 1R082 3V6ZB 3Q1SL 4HHGA 4Z0BH 3X14B 3IPFA 3W38A 2LVEA 5ALBL 1TJIL 1JGLH 1E27A 1NGPH 1YNTA 2D7TL 2KLRA 5T5FL 4JRYB 4BK4A 2A70A 3AKTA 4A7VA 2VDOH 2EIKB 1QSED 4AI0A 1DDHA 3M17A 2R4SL 4QOKA 1FYTB 3O4LA 4DXSA 2VCOA 1UB5B 2XTJE 4JVWA 2VOXA 2PAKA 4GIQA 2EDXA 4TVUA 4AMWA 2PCPB 4ZMXA 1KLUA 3GSWB 3HS8A 1ULGA 2APXA 2B5HA 5L7OA 3O2VL 1LP9E 1VBB3 3AT0A 3UCRA 3QNZB 1BZQK 2H4EA 1QZ1A 5IJVB 4NP9A 4UNVA 5LBFA 5T5LA 1ED3B 5D4QA 3N50A 2JKJA 2CE6A 3JUYA 4H44C 3WJMB 4D9LH 5SWZE 3PV6B 5LCVH 1OALA 4AYEC 3IPBA 5IQMA 2LU4A 1X5ZA 3MXWL 4WFFE 2KDYA 4QB6A 2C1FA 3RDJA 1BX2B 4GH4B 1JYTA 4L8BA 1VESA 2G0LA 4RCAA 3O45A 2YMTA 5CP3A 1RIVL 2CDEB 5DPNA 1KV3A 3EF7A 1JK8B 4EN6B 2FBJH 3VRLE 4JFDB 3BGFC 4UYPA 5EHFA 5C7GA 4Z76B 3U2SB 4QXGL 2VVDA 3WHE0 1Q0XH 4U6YA 5FOJA 3PLYA 1FOD1 1ND3C 5AOMA 4J3OH 3M2MA 5CEZL 1EK3A 4K7FB 4L3EB 1F3JB 4ZQTA 4AE0A 5IIEB 2OMXB 1DFQA 1YJDL 5DJCB 1B2WH 1WPCA 2ENSA 4XVOA 3VXUE 1G9ML 3PQYE 3T6VA 4XMPH 5FGRA 1F2QA 1CICD 4OLYL 1O9VA 2MPFA 3NFPB 2XLGA 4AE2A 2QDVA 3DCQA 2Q2EB 4OW6A 1JOPA 4OLZH 4RFNC 4WHTB 3UZQB 4HD9A 2WNEA 3ROLA 2VLLA 5EDXA 2WFPA 4OGZA 3NV3A 5CGYD 4FXLA 4JBSA 2VNRA 1HQ4B 2WFF1 2X2IA 3VI3E 2WLHA 2J57A 2H2SC 4CKVX 1CAUA 4KNQA 4HSLA 5JHDD 2WINB 4JPWL 4FPLA 2P8MA 1OD9A 2X4QA 3VBHB 3NPZB 3AGVA 1KJRA 1M05B 1B0RA 3MREA 3Q5YA 1JHTB 4FNLL 1W6MB 5LXGH 2HFTA 1UM5L 2G2RB 4I2OA 4FRWA 4CXYA 4ISVB 1G6RL 1SFHA 3CFJB 1V70A 1ZOXA 2X7LB 4LFHG 4O58H 4LLMB 4W1TA 2F5AH 2Q1FA 4HUMB 1KXQE 4PJ8B 1PIFA 3WD5H 1WFIA 1U8PA 3ZU8A 2XL9A 3J7LA 3QUZA 3WJJA 1YMMB 4YOKA 5FXCH 2PYTA 5DCCA 5CGYC 4AL8C 2Z7ZA 3SMHA 1RK0A 4Y5VC 1IVLA 3GSUA 1FVDA 4GUCA 3O2DH 2XFXA 5L0QB 4S0TD 5KBMA 1AR63 1G9MC 1O8SA 2QZQA 1UZVA 1DR9A 32C2B 4OQTH 1P7QD 4PW9A 2IXKA 3ES1A 2XG4B 4KPHL 3PQYA 4AGOA 2QFPA 1QHDA 4HKOA 4XCCH 2Q6WB 4AMKL 2WVUA 3V0AA 4XO5A 4CCNA 2A4ZA 4LUKA 4WWOA 2ZUVA 4U1MB 1P4BH 2HLEB 2E7AA 4RH4A 3NSJA 1KCUH 1PY4A 3FLPA 4KZCA 1Y9GA 1WEJL 4HCRL 1U8MA 4M7ZB 4RGMB 3RIKA 1LD9A 4MMZC 1PSKH 3VFOA 5KHGA 2FVNA 2DBJA 3MRQB 1IS3A 5D4IA 5LDUA 2R7EB 2ZCLL 1IMHC 3SHRA 3BT2H 4E68A 2UY7B 4A1RA 1ET5A 2BNRA 2P5EE 3KWUA 1T1XA 2EEAA 5KBKA 4CVZA 1HHJB 3S98A 1A7OH 1W05A 1EHLH 1OCWL 3ZFGA 1UENA 3P4NA 3KDMA 2UXVA 4XPGH 1QVOB 3I59B 3BXNA 3QI9D 4NCC2 4I3RL 3LE0A 3ZRSA 3MA7A 2X2YA 3WKPA 1R092 4TQ8A 3OLEA 1RZ8B 3GUTB 1FDLH 3C6LC 3RBGA 3O41B 3FHIB 3I9GH 3SJVB 2WLMA 1OGAB 1R34A 1BZ9B 4N43A 3M1OA 1B6DA 5CS7A 5ITFB 4Z7QB 4WKXA 4AGLA 1I3GL 4HFUH 2LALA 4IV1B 4GJTB 4AVTA 5KJ4A 3AS1A 4JN2B 3GBNH 5CIPB 3RVTD 1Z2KA 2VTXA 3IU3B 4D0CB 5GRUL 3FU0A 4OV6F 1KXGA 2YGMA 5I0WA 5KSBA 2H1LM 5KVFH 4WI3A 2BVEA 1CLZL 4YBLB 1EAH2 4CDWB 5F0PB 1WBYB 3FCBA 2JB6B 1LEKB 1TQVA 2ZWSA 4U1JA 5HGAB 3S0MA 1J05A 1KBWA 1RUKH 2UZIH 2IH9A 4Z7UB 3NPSC 3U0PB 3ZKQD 4M6MH 5FA4B 1ZA6A 3ZOAA 1KDJA 1IE4A 5IBLC 4YARA 1ND2A 1EVTC 3W11C 4XHJC 5H9SA 5IFHH 3NAPB 2JE8A 4R7XA 4BRVA 5HP5A 4APQA 4DB5A 4MQ7B 1RZJC 4AZ8A 1DQLH 3ZFEB 3MBXL 4L3CA 4YHLH 5D1XD 3DL3A 2VZRA 2CJSA 1AHKA 3Q9QA 4LKFA 4P46D 1BYHA 4I9WD 2EYTB 1SF5A 3QFDB 4G5ZH 5JXGA 4XDOA 4CCDA 3J27A 5A6ZA 5KSAB 3DX7A 5EPAA 1F8VA 3S37X 3UL2A 1KJ2A 1MI5A 4DH2A 4F58L 4QAWA 3RTQB 5JHLA 4XCAA 1BK0A 3CZLA 4XNAA 5C3PA 4OZFB 2XZQH 3ALWA 2A6XA 3PVEA 4OFKA 3ABGA 2GK0B 4NO2A 3PWNB 4X5XA 2VBPA 1WLTA 1PZ5A 1KCBA 5C0RH 1F18A 2J6WA 2YUZA 3WN5A 1WDAA 3VGAB 1J87A 3UTSA 1WT5C 3MA9H 1BHGA 2XA3A 3GZKA 4GKZB 4M6OH 4U0RB 3FQ4A 1T6GC 3QH7A 4RAVA 1KXVC 4X7DC 1LYQA 3QHFH 4FKHA 4GW1B 3S3DB 4L5FL 4S1DD 1AR71 4FTVD 2A83B 2A6WA 3VHRA 3HOGA 4Y5XC 1HRV1 2EEFA 5JLVA 5T3NA 2XWDA 4HX1A 2OQ7A 1RXFA 4Q4Y1 4H26B 1MS9A 3K8MA 1DJYA 1JZIA 3ZIYA 1UY4A 4LU5L 2BO0A 3TT1L 3X13B 2P52A 3KHQA 3BALA 4IGBD 5CSZA 2P8MB 5AVVB 5DMKB 4PAZA 3W81A 4PYHA 3TZVD 4XCFL 3WEOA 1OI6A 4YBLC 4CDWC 3GMNA 4OD1L 5LBSA 3HZVA 3FULA 3LH8A 5DVMA 2EVFA 5LWYL 2AUYA 5L2KD 1JPTH 1TNMA 3MIBA 1H3WM 4K3EH 2RS33 1T80A 4N8CH 3WLUA 4LL1A 3O6MH 4U7KA 3DRTA 4UCFA 2GNTA 3V64A 2APBA 3QJFB 1AHSA 2YPDA 4PF1A 3E6HA 3H3UA 5B1JC 4ETQA 1CFQB 2EDBA 4LA3A 4PRHA 1JWUA 4DP1X 1YC7A 3QGVA 1SGKA 1TMQA 1YY9C 2X89A 4RMVA 5CN1A 3UIZA 3ZN6A 1PVC1 4KBBA 4N86A 2VERA 1N47A 4YZ2A 4X4XB 2VSMB 1EFQA 2C3HA 2OV0A 2ZAIA 2YFOA 2CUIA 3M45A 5D7SH 1HHGB 1RUF2 5INCB 1AFVL 1UZ6E 2W3JA 4MX3A 2BVOB 2JNZA 4LIQH 5MHSD 5M0TA 3EJJX 4KVCH 4KDTA 1RH8A 3OKNB 3GBFA 1HQRA 3ULVC 3N9QA 4EBQH 2A3XA 1BG9A 4KAQH 3U75A 2WNUC 3MUGA 2Z35B 3POWA 1YXWA 2ZPXA 2RS11 1HJFA 4E9XA 4YC2C 1CTNA 3LN4B 3FFOA 4FNPA 1MEC1 3AAZA 3MXVL 1PL3A 4GW5A 1RLWA 5HXMA 5JXEC 2Z2SB 3VUAA 3QP3A 4J28A 2FJGA 3G5ZB 1KDMA 3ARYA 2ZGNA 3ZTJH 1CESA 4OI0A 3CXDL 3K77A 1FYTA 4NQSA 2IDFA 2NYKA 1PY9A 2D7PA 5CZKA 2I07B 4I1PA 1BZ7B 2EO9A 3CZUB 3R0NA 4XTRC 4UIMB 3J26N 1BVKB 3DYOA 1FAIH 3T2NL 1RZKH 3T09A 5FEBA 2W87A 1FFQA 1N0LB 1TZGH 4YDZA 3ZYJA 4LCWA 3D39D 3Q0HA 1W0YT 2VXTL 4M43L 5EZOH 2ZEWA 3WS3A 3FBMA 1KIPB 3HB3C 3KLKA 4MD0A 4YGAB 5DSCB 4KJWC 2XJSA 1YSOA 1JHLL 1KC5L 4IRSC 2IXQB 1D9KD 1W6PB 4K5OA 3HMXH 3J2PA 1JZ8A 3FT3A 4UZUA 2W0XA 4FVVA 4AM0Q 1NOLA 4P2CG 4NLHA 5E7BA 4NKMA 5I30H 4LEOA 3T2QA 1O59A 4ANXA 2BNOA 2O1AA 5AB9A 3K71A 4JDTL 2ADFL 1JDAA 4PJBB 5I1AA 2GBAA 5IW1B 1P7HL 5IG7A 3VKLA 1SXSA 1YN7A 4CVWA 4E9YA 1EAH1 2VO8A 1MCEA 4EWAA 1NEUA 1CICB 2V5DA 4F8NA 3DX9A 3ZW3A 4K8RC 2PMWB 1QLRB 1B88A 4B1LA 1DQML 4HJEA 1G86A 2E9WA 3U0ZA 2P8LB 1FH5H 3AS0A 2ZTNA 3QDGA 4IS6B 5GZCA 4QHMA 2X1WL 4L29B 2R83A 1ZNPA 1GP6A 2ORBH 1V5JA 1IILE 2A6VA 1M9SA 3U9UA 1N68A 2WQSA 4D9RD 4HAGA 3QCTL 4HJGB 5D5MB 5AB2A 4N2LA 2CPCA 2R69L 3FQTA 3QNYA 1KDKA 1TNFA 1U8NB 3MODL 3V95A 5I28A 4K9EC 3ARVA 1YLLA 2GH2A 2CR3A 3RDIA 4JHBA 1OE3A 4JFPA 4DOUA 1DBAL 5E9DE 3SISA 2E86A 5KTEL 1M71B 1KPRA 4IRZA 5LA0A 3S37H 1CR9H 2A7BA 1SDWA 3D3AA 4FAGA 5FZIA 5J98B 4TUJB 3IVKA 1RYYA 3WP6A 4DGYH 4ODHL 3HBPA 2ZGLA 1SJVA 4WVRA 3V4PL 2YC4A 4P9JA 4GULA 2QQWA 3SKOA 4FPEA 4LSTH 4UW5A 4QR7A 1W0VA 4LBEB 1XB6A 2H9GB 3ZY7A 4LQRA 3HG2A 3MUY1 1I8KB 2ZX5A 4PG9B 5DR5L 1QYGL 2BRRH 3D0LB 4MQSB 4QX3A 2Y06L 1G43A 1RZQA 4FYSA 3RHWK 4OGQC 4AK1A 2NT1A 1ZA3A 4XOEA 3VTAA 5JIUA 4DEWA 4Q4Y2 1RHFA 4P46B 4LOFA 3RTLA 3D85B 2ITDA 5A2JH 4ZTPH 5FO8A 1FNYA 3B93A 5CJQL 1UM6L 1MCBA 1IKQA 4OM0H 4NQXB 3QUKA 4C8XA 4OLUL 4BIFA 3GHMA 1PMYA 1CVRA 4WU7B 3VN4A 2QCSB 1AD9A 1QFHA 4EKJA 3DUUB 4MRBA 3AKSA 3WIHA 2EDMA 1TQBC 5DI8A 5DJ6B 2VR4A 1MRCL 2XZCH 4GRWB 4KXZH 1L6PA 3WFDL 2OS2A 1FVCA 3JVGC 1TFHA 4L8BB 1POV3 2VNOA 1NIDA 5EUKB 3C9NB 3H2WA 3MGTB 3IYLW 2Q8AL 3WTTA 3BH8A 1CF1A 4CP9A 3HG1E 3WJMA 1MFBL 4DZ8A 1E5HA 1LEKA 1V05A 3ACFA 3FUDA 1HQRB 2BPA2 3D2UD 1U8IA 4BSVA 3MW4A 1HQWA 3RX8A 1AIFB 1V7NL 4QRPA 3FUKA 5BVJA 3CJIC 1WLHA 3AKPA 2A9DA 2V2XA 3W82A 2EKSA 1K5NB 4OZHE 1UXZA 4WWPA 4NC2B 4Y5Z0 3RMYA 5E6YA 3WNNA 1AGFB 1PD1A 3NIGE 4PN6A 3CNAA 5GS0H 4PP2B 4L97A 3PWPA 4DFIA 3O11A 2ESVB 3TXAA 4KQ4L 3O41A 2HMIC 1NAMB 4YO0A 4F93B 3QJSB 4L0YA 4XPFL 4FP8H 5IB3A 1DVSA 2ATKA 2WN2A 3QO0A 2B5IC 5FHAL 5EB9A 2DF3A 3QUMH 3R1GH 5JOFB 1X5KA 3CFJA 4AYFA 1XNBA 3ZX7A 1IO4C 4JCMA 3GFUA 1UD3A 3UERA 4EZLA 5DF0A 1U0AA 3CSGA 3N42F 3QDJB 1W04A 1N6UA 5HI3D 4IDZA 5EORL 2H2PC 3MV01 2JDYA 3LZZA 4RISL 4FPYA 4QQHA 2QKIA 2R1WB 2WSKA 4FPJA 3VBFC 2IH1B 1FNHA 1FPTH 3RE0A 3HPJB 4NVPA 2X9YA 3QWNA 3OR6A 4N68A 4AYGA 2DQCH 4TYSA 4NQQA 3P3PA 1UD5A 3SCMC 3M46A 1FZMA 1XL4A 5GXBB 1RI8A 4PQ9A 3U9UB 3RUGB 4KRPC 3EFOB 1ULVA 5FZBA 3Q43A 4AIZA 3RGVD 1W8TA 2Q1MA 5FZ1A 4E9VA 4K23L 4KMTL 4N8UA 3DHMA 1KYUA 1QFWH 2NY1B 4NXSA 4YHIB 5DUJA 2QNKA 5BS0A 4K5NA 2D98A 3BYWA 3KLDA 1VFBA 3NIFF 5FYKL 4JO3L 2DL2A 4UANA 4UOQA 3WW1A 5HHXH 3LS5H 3CMOL 1URXA 2IFGA 2VW4A 1E0OB 3GXNA 1HZHL 1D6EA 1EZUA 3JWNE 3OPWA 5FXZA 2WLYA 1E28A 5FK9A 3DJSA 1JUFB 2EKSB 4NM8L 5AVWB 4W4ZA 4RR3C 5JXHA 1E43A 3LRSB 2XQYK 5F9OH 1EX0A 1M6OA 4UTBH 4XNQB 4FABH 3AKQA 1IL1B 1K6QH 1NSNL 3THPA 5CVRA 1F86A 4FI7A 2Z7UA 2SBAA 4WEBH 4HEMA 4ZUWB 2E7TA 4RGNB 3IIIA 3BZ4B 3EJYD 3L5WA 2QQKH 2HEWF 2Y36H 4PJIB 3U4BL 4AFAA 4AG4H 2VMFA 3C6LA 5EU6D 5DZLA 4P46C 1I8IA 4GA9A 1YRKA 4M1DL 4FPOB 1XF5B 3ZN5A 3F58H 5D1XC 4G6JH 3ZDZB 1KZQA 3B9KA 3FPYA 1SPPA 1MZYA 2VXUH 4LCCC 4M4PA 5DFVC 5JZ7C 1WAAF 3AUWB 5F3HB 2BTVC 2C0ZA 4GJZA 2PPFA 3IM1A 2JCCF 2AV1B 4AR2A 1YVLA 3PUIA 2DLEA 4MJ5B 4X4YB 1NYWA 4UU9A 5C7XL 1E40A 3D7PA 1MR5A 4Y1AA 1CIWA 3GZEA 4XP9H 2HB0A 5BS0E 1AFVH 5DWUL 3T1FB 4ZX6A 5J1XA 4QHKI 1OZTG 3RIFF 5BNPA 2GI7A 3LHPL 3TPUB 4P48A 2PHDA 1IKFH 4PY8I 5CIPA 3L4TA 3T2TA 1HH6B 2A0LC 1XC6A 4I01A 3KLHC 1IAII 3FPXA 4C59B 4J4PC 4RMBA 5ETUA 2K2SA 3N36A 5LK7B 2G5BA 3BVXA 1FNGA 4F2ME 5JPNB 2RS12 4YL9A 4YSCA 1JYIA 4XP6L 1TEIA 4RFEB 2HG5A 5C8CC 1AYOA 5F89B 5DRWB 2AGSA 1T0MB 4G6FD 4JPVL 4AKPA 1PCXA 3B9EA 4KJQD 3V56A 1IC0A 2JLLA 4X50A 4YGDA 5GGRY 4APQC 1QY4A 2W65B 4DRRA 1LO3L 3V4PA 2HYKA 1WHOA 2PR9A 1PFOA 2KD7A 1AQKH 4TNWF 2J2ZB 1CFTB 5EBMA 1S7VB 1RZKL 2X4TB 4PBVC 1KBKA 5A1AA 1EDQA 3JB8A 4Z7NB 4XP5H 4C55A 1EHKB 4UM8B 4DT2A 2AV7A 2WNKA 2PYFB 2LW8A 5FAXA 4X8PA 4RFOL 1RURL 5D5MA 2VC9A 2WXQA 1FFPB 5I9QC 4FG4A 1QI4A 1UH3A 3PIQA 3Q01A 1OE2A 2Q5BA 3ZO0A 2ATPA 4X4MA 2HFEA 3ZMEA 1IC5L 1SVCP 3GJBA 1RIRA 4B50A 1TVGA 3KHOA 3WEXB 1U91A 1H0DB 2HT4C 2JQMA 4XBEL 4OV5A 4HUWA 3GPEA 2EYRA 4KRNA 5I0ZA 1G9DA 2V5TA 1W0OA 1TQSA 3SGKC 1HXYA 4NB7A 5JDSB 1SZBA 2IBBA 5SWZB 2RE9A 2XN9D 3UFIA 2XQBL 4AZUA 1FP5A 3PMEA 4GW1A 4K1YA 3OKOB 3MRGA 1F00I 4PLOB 5CUSH 4QDQA 4DZBB 1LLAA 3H9SA 4C56A 2ZJCA 1QRNE 2CRYA 4KKQA 3WN5B 3D0VB 4HUUA 3ZXAC 5E16A 4HG6B 4QXTA 4H0IA 1H8TB 4YR6B 4YG3A 3BQUC 3EGSA 1JF1B 3DXUA 4EEEA 4PJ5E 5DDJ2 3ARFD 5HI4D 3ULUL 1EAH3 4GH4C 4LORA 1FLTX 1KEMH 2AQQA 4P2YA 1OAJA 2RACA 1MFEH 2IQ9L 3H8NA 4X6BA 4DKEH 4Z7NF 3OPUA 2NYYD 1A4CA 1RUI1 3QPQC 4B96A 5JUEL 2G2RA 1JGIA 4ZTEA 4TN9A 2EDWA 1RHI2 3ZHNA 5EEZA 3GZAA 2F7QA 2QQNH 3OGCB 5E8EA 1JOIA 5D6CA 1HRI1 5DWPA 4UQ3B 1VKXB 5EOCH 1UX7A 3O2VH 1NM9A 1CQKA 1T2QH 5E08H 4PF5A 4QGMA 5C0CE 5DC4B 1NUKA 2B08A 3EYSH 4JQTA 1WA0X 1LILA 1COV3 4IDJL 1CQ9A 4TQPA 4MADA 3LN5A 1KJ3L 2Z7WA 4FOVA 3VGBA 4PGZA 2OTUB 5CEXB 2CR0A 1NJ9B 4UZSA 1KLGB 4YLBA 4G8GE 3KZ4C 4QPGC 4KX7A 2P24A 3TF4A 4HS6A 4C47A 2IWFA 1EZLA 3D3VB 1E42A 1Z3RA 2E56A 3HE6C 1ZSHA 1PIV3 5MP6H 4IXLA 1AS7A 4CRQA 5HI0A 3O0LA 3RNKB 1HB3A 4URAA 3EOAA 3ZN6B 3RWJA 2K9FB 3V6FB 2HPTA 2OW6A 1G7IA 3FQNB 1WGVA 3ZKYA 1OSPL 5C6TH 3VFMB 3FT2B 3FAWA 4IDLA 4W4NA 2CM5A 4LSSH 1DBNA 3M7FB 1BQHG 1F4XH 3FHEA 2W39A 4UT7H 1IC7H 4LFHD 3OG6B 3PNWA 2OLDA 4FLQA 5AAWC 4CEWC 2BSTA 3D4YA 2F4PA 3FRPG 1M7IA 1UXSB 4Q2ZB 1YNAA 3AG1B 2XY2A 3T1FA 5AB1A 2B2XH 4DUXA 1W8UA 3B4NA 3BKCH 4YW4A 4MJ4A 4AEEA 2WTPA 3MZTA 2JG9B 2AJUH 2IANE 4M7KH 2CGOA 2Z69A 4U36A 4XIOA 2FYYB 3P2BA 3NCYP 4LPWA 1Z9SA 5DMKA 3BN3B 4WUUE 3VGEA 1DQ5A 5D7LA 4FYTA 5LRRA 2JI3A 2YZ1A 4PRBA 1KB5A 1UM5H 4XC1L 2HWC2 1FRGH 1MFCH 3ARRA 4AQ8C 5AC93 5I0SA 3STZA 3KPQA 1JZ5A 1N64H 4BQBA 4E9LA 2FX8H 5GHWL 1T5KA 3BC9A 4NIAA 2UWEF 1VZIA 3CVDA 4PJ5D 4JPQA 3AITA 2KUTA 1JZ4A 5GRJH 1QWNA 2QADC 1S7QA 4MCZA 3N5AA 1EXHA 2CSPA 4GB32 4R8WL 5I1CL 4PJXB 4YFEA 3AQDA 1F3DJ 1UMZA 4ABUA 5T52A 4GKLA 3OKDA 4EO5A 4XFGA 5FY5A 1B0WA 4G7QB 2HZHA 3N06B 4ZT1A 4F2EA 2VG9A 2IEPA 4OVUA 4X98A 4BFEA 5IB1A 1VGKB 1PLGL 3GJAA 3IGAB 4QKTA 4Q2FA 4XACA 3HE6B 3MCLH 1FPTL 2F8XC 1BFVH 3Q48A 4X4XA 2F4LA 1EMTH 3FF8A 1A6AA 4IOSA 4K7PY 1ACYH 2DQCL 1KJ2L 4FQPA 4UI9L 2Y60A 3G7DA 4XCCL 4K55A 4PB9L 3VW3L 4XO4A 3E1ZA 2IXJA 4M1CC 4JV4A 3MX0B 4IBLT 1TTCA 1MQTC 1NA1B 5IQLA 2A3YA 3QJFA 2ICEB 1DANT 1SY6L 3OKEA 3ZTNL 3VBSB 1HSBA 2XKUA 2OTWB 5KJRH 4LO8A 4KUCF 5FYCA 2DYPB 4HFWB 4HZLB 3MRCA 4KFMA 4ALAL 3FNKA 4TRPH 4SBVA 4MB4A 4URTB 3PWJA 3WNKA 4P9HH 4WFGE 1YQ8A 3H9YA 3ZT5A 1OCZB 2WOBA 3CFBA 4QX1A 1ORSA 4S1QH 3DF0A 4L8SC 1OGTB 1NOFA 3C60A 5F7EH 1JPFB 2UWEB 2VUOA 3CV5A 2JG9C 1XBRA 1OARH 4FQXD 1KQRA 2I27N 3RGBA 2OXGA 1NKOA 4GT7A 4LHUG 3H1MA 4ZXKA 4PFEA 3HN8A 2HVBA 3DXAA 3FN0L 3WHXA 2WJ5A 2VDRB 1M2OA 3NIDF 5F9OL 3V4UH 3N85L 1P2CB 4E41E 3TJHD 4V2WA 4PW4A 5BPXA 3WQBA 4LSUL 5I0VA 4K3GA 5KSUA 1M2VA 1CGYA 1XR9A 1JGDA 3FO2A 1EHAA 3MOAL 3CJXA 4MXWA 3QG7H 3O6KH 1D5IH 3OWRA 2QVTA 3ZYJB 3S7GA 1PKQB 2EC9T 4XMUA 1E5YA 1VF5C 5BNQA 3H3PL 3MNWB 1YPZE 3R4DB 3SJVD 2ZKLA 1AYM3 3V52L 4NBZB 1CAWA 3NNJA 1QSEA 1SHMA 3DROA 2JDZA 5FUZL 4BA6A 5IP4A 3RKPA 4L4TA 1RUKL 2UZIL 1Q94A 3PY9A 3QIUB 4KWLA 3EUUA 4M6ML 5IVOA 2A5ZA 4YFWA 5A2AA 3MRQA 1XD1A 4O9GA 2QV2A 3II3A 4OQ1A 2F0CA 5DO8A 4O7XA 4LL4A 2VQAA 4NZRL 3D25A 2ZUUA 5D93C 3HR9A 3II2A 1FN4A 1UWEL 5C0AE 3UTZB 1J0ZA 4HPHA 1EZSA 4CAGA 3IGFA 4X99B 3QK0A 3ES4A 1GS6X 3L3IB 3EW3B 4TL4A 3L5JA 5AYUH 3DTXA 4HETA 1OHZA 5K9KB 4WEMB 5CCGE 1CG9B 5GZND 1M3IA 2YEQA 3CU1A 2OMWB 4GSRA 3AFLA 2VULA 4BH9A 4MXVF 2XG4A 4GKNB 2X8KA 2JTYA 3VBFA 4YHOL 2GC1A 2NN8A 1E4WL 4NO0A 5FK7A 4W9FC 4NQTA 1FMD1 3US1A 3EGXB 4IV3B 4U6XB 4WI0A 5KC6A 1RK1A 2OL3B 4JDVA 2WS91 2PTVA 3NZ8A 4PS8A 4D0BA 1ZT1A 2BC4A 5LGHL 4U1NB 4U4BA 2K46A 1CK0L 1ETA1 3HBZA 3HHSB 5GRYA 1A7RL 1NLBL 2WNVC 2ROXA 2PW1A 5A3OA 1IE5A 1H6EA 1YPZA 4K8RD 4TULH 2DCJA 2P1BA 1RZ8A 4XNMA 2EAKA 5ID0B 3CN3A 3JWOH 4EI6B 4G9DB 1TKWB 4UAOC 2UZXA 2EP6A 1PVHA 1HCZA 4Q56A 4W6YA 3GTTA 4ISVA 1MH5A 2ARJB 2R042 5LQBL 3P30L 4I3SH 3ABZA 4FQCH 5FECA 1H3UA 1DQ2A 4PY7A 1TCRA 2CU5A 4HC1L 1KIRA 1DDTA 4QMEA 1SJHB 4QEGA 4G6ML 3RKDD 3TVMD 4L0PA 3VFRA 4CU8A 4Z6AT 1TU2B 3IDAA 1S7RB 4DSYA 4YAQB 1W3VA 3PXLA 2XTSA 1TZOA 1KB5H 2D44A 4NDMB 3HG3A 1YPZF 1I1FA 2VDMH 3D0AA 2KZBA 5FZAA 1NCRA 2XIDA 4MLIA 3PUAA 1DZBA 1U3HA 1YNLH 4G6KL 4BGLA 3FO0L 1MJUL 3HVNA 4Y4HD 4KFZC 2WSUA 2UY6A 3AXIA 4XP4H 4AJYV 2BH0A 3NESA 3FZUC 4RR3A 3S3SA 2ZOLA 2G75B 3DHPA 1GQPA 3H9HA 3HNBM 3WY3A 1CICA 4L3AA 4NS0A 4PRIA 5E6IB 1EFXB 1GGYA 1SLWA 4ZS7L 1UY0A 1YI9A 3A4UA 4R52A 5ECJE 4ATEA 1MEXL 3AY4C 3D09A 4OBSA 2Z31B 3PS6A 4KNCA 5JUEH 4L8DB 1T2JA 2WL1A 2YBRA 2BZ7A 1ZLWH 1DZRA 1NIBA 2CWSA 4LVNC 4HVBA 3VL8A 3NZ8B 5E9DA 4O2FA 4XMWA 1CJPA 4KMQA 3IEAA 3OV6A 4N53A 2WUBH 5FBJA 4LARH 1A2YA 3BTYA 2YA2A 3RWEB 3U46A 3JXAA 4PRAB 1AZRA 3UGXA 3EOBA 1SLTA 2RM22 4L11A 2QGBA 3GBML 4WTXA 2XG5B 4KDVA 1QLEB 2OMTA 3PHOA 3LZLA 3GMPB 4D7PA 1WW5A 2PXYD 4HKXA 2ATFA 3S7IA 4G83A 3B34A 1Z5LB 3DIVA 4J7RA 2ZAGA 1K4DB 3LXCA 2NY5L 3QCUH 4JPSA 5HYSG 1TT6A 1ZTMA 5IKCA 1NEZA 3PABA 2E4FA 1OVSA 5FWJA 4BHUA 5A3IC 1BWMA 1MF2H 1BIIB 4TMPA 2ZUTA 2ZUXA 5JPMB 5KUKA 2YAEA 3NEEA 5ETUB 3JB4C 5LJYH 4OF3A 1KENL 4XJ8A 2CD0A 3MRNB 2BW8A 3O6FC 5JVVA 3GZPA 4QRAA 1TSRA 2BS9A 4JM4H 1R6VA 1AR1B 4RETB 1DJGA 3A6BH 3KCWA 4KBZA 2XYCA 2VN7A 3V9CA 5ID1A 2VDKB 4Z7WE 2GTWA 3FTXA 1QSEB 3DROB 4JHZA 1QF3A 5ERLA 3LXAA 4JFZL 3JV4B 1N5AB 1M56B 2QR0A 3D3VE 1KMGA 3UBFA 5JLZB 4Q97A 3AZWA 5CU5A 5J6HB 1Y07A 5E0FA 2CM6A 5D1XB 5H9QA 3MUJA 1FBIL 4GRWH 4JZJC 2YRPA 2ZOKB 4LLAA 3D8MA 3V5HA 4A3ZA 1LNSA 3PTYA 4TVPL 1QR1B 4IGBC 1PAZA 4HMCA 2J4WL 3QD6A 2BYVE 3FT4B 2NSXA 1PLAA 3PU3A 1BBJB 3RVHA 4WI4A 1MHPH 3VI3A 4N8PA 1JWUB 3WTSA 3USSA 5DUPH 4JPKH 5J57B 2HWF1 2ESVE 4L1SA 4M8QA 4NUGH 5E56A 2NUPB 1YO4A 3KWVA 5F6IB 5IQ7L 4RR3B 4XBGA 3RL1B 6CGTA 2VZ1A 1VSCA 3S5LA 3H1WA 3KBPA 1PSKL 4MMXA 5LCWL 2ICWB 3GYDA 2QQUA 3HN3A 2X6MA 2PPEA 1RMU3 4IUGA 3VFWA 3LDBB 4QRPD 5IV2B 1OA2A 1KG0B 2BXZA 3AG4B 2ZYIA 4GUOA 3P77A 3E5QA 4HVRA 1QI5A 2APSA 1DLFL 1GZPB 2ENJA 4QIRA 3VD3A 4NPRA 4GQZA 2FNBA 4PJGE 1ZTXH 1VFMA 3Q06A 2DMBA 2OMZB 5IEKB 3ISRA 2ZXEB 3MX0A 1L6XA 1EMTL 4LCCB 5CEZD 4ZZ8A 3OUJA 1NY72 2ZXAA 2NTFA 4R2GB 1A78A 3EZ8A 4W6YB 2CMRL 3ARBA 1UWYA 1YEIL 2X1OA 4K07A 5T3ZH 4RS5B 5TF1L 2OYZA 1RUNA 4K7PH 4PD4J 4ZD3H 1U33A 2NY4B 4TTDD 3UZEA 4E8DA 3ETTA 2YBGA 3NN8B 5LNDA 1GBGA 3OMNB 4F8OA 2YD3A 3C6EA 4QX5A 2AJSH 5KJRL 5MEOA 3QRGH 1VBB2 4AEDC 2Y7SA 5L4MA 4ODXB 4OZGA 3TVMB 5DD3L 5HVFB 1I3VA 5J1AA 2YWZA 2WR9A 4BMEA 1CFSB 1V7MH 1PQZA 2F54D 2NXYC 2IOOA 1TQCB 3CSBA 1OAXL 4UDUB 2NR6C 3NRFA 4I1NB 4QKXB 3NKGA 4F83A 1NL0H 2MJWA 3M1BA 3D48R 3RGVA 3SYPA 2H0JA 4OUUA 5FUCE 4M6NL 5IMKA 1SHWA 5IBTH 3L13A 3NFSL 2FQPA 5F3EA 1R3IL 4EI5D 2OSLB 2X4NB 5DFAA 3NJZA 5IK8A 2ARJQ 4FTEA 1IC1A 2BIQA 2VUDA 4FAHA 4P57B 3TH2T 2A0LD 1SEFA 4ZMNA 3ZM8A 1GYUA 1XSOA 1Q9OA 3WDTA 2EC9U 2IWEA 3PNRB 3ZHDA 1IAIL 2OXBA 5BRQA 4N0CD 3PNWB 2UZYA 2FEDD 5CZXC 3UYRL 1U8KB 3P9WB 2JB5L 1HRV3 4DGIL 4XPAH 5D5ME 3PHAA 1LK2B 4WFED 4MD5B 1QFUL 5CJOL 5ABDE 3AACA 4JGZA 2ZWLT 2ZABA 3SKMB 4WM8B 4PY8J 4AIOA 1BCXA 4QDSA 1E4XH 4YXLH 3NT0A 3UH8A 1AF9A 2YY1A 1EHNA 1A7NL 1QASA 2NW2A 4HG4J 1WS7A 4IKLA 4D7BA 1JZEA 2MNUA 1NQDA 1UXWB 5FY0A 2NY7H 2ICCA 4P2QD 5JPMA 1VBC2 2QZ2A 4PGEA 2RDSA 3FE5A 5FFOC 2BOLA 1KYFA 3MLSH 4AEHH 3BUDA 5KUMA 1VACB 1IM9A 1PZSA 3EO1A 4IRJC 3Q8FA 3QJRB 3IJEA 3C6LD 2OJ1A 5B21A 4AXWB 1T6WA 2VM9A 2PYEB 4N2FA 3JBG1 3N9PA 1A6VL 1TVHB 2CK0L 3ASOB 3CVCA 4XJAA 2YXMA 2AXFA 4HXBL 3QUZD 2I74A 4BQ1A 5DABA 4XCFH 3AFGA 1LE5B 1CZ8H 2XKNB 3QEQA 5HJ3A 1YG9A 2DQIH 4UM9B 4W6XA 4KK6C 1A8JH 4BQCA 2YLHA 1HKFA 2X89D 4AUYA 4BK5C 1G9HA 4WK4B 1I7ZB 1MCKA 4PBPA 3D12B 2BWAA 1HX6A 3VD2A 4AV5A 2WLNA 2Y7QA 3OGGA 2VTFA 3KJ4C 2CAVA 2DVDA 1AQDB 3KPMB 3T0EE 3ULVE 4Q29A 4MGIE 2PW2B 4UQIM 5IR1B 2GFBB 3NP4A 7FABH 3POIA 3OL2A 2YA1A 4HUXB 1FV1B 1KGYA 1TETL 1XCQB 2W0PA 4P8QA 1KLGA 5AW3B 3SQRA 3U4EA 3UP6A 1PG7L 1PYWB 2F53D 2MOVA 4AUJA 5I1LB 1AR93 3SH5A 1TTRA 3ZYZA 5C0IA 1IQDB 4I3SL 1XPWA 1A7BA 4LBQA 4CDUC 4PRPB 4UM8A 4BK8A 4WJ5A 1KD7A 4G6MH 2EH8L 2QQNA 2PLV3 2XU9A 5JIHA 1RGSA 3ECWA 2ATAA 1ZRRA 4WO4D 5K33A 3VBSA 1G4RA 5FPUA 4Z7VF 3VA2C 1N12A 3LQAH 4PREB 2WNUA 3C5ZC 4PJGB 1ZS8A 5MEQB 5K1JA 1B4RA 2QUOA 3FX3A 4EJ1C 5I6MA 3MIFA 4CRPA 4HN1A 4PJ5B 2IQAB 1YC61 5BXXA 4JG0L 1PF3A 1BQHB 1GSKA 3MBED 3X12B 1KELH 3LMJH 4FQ1H 3PHMA 2CBMA 3BKJH 4YPGB 4B9ZA 5GGVL 1KBBA 1W6MA 4N0RA 3TNPB 3N44B 1W6NA 4J3SA 2XXCB 3ZDYB 1FJ1A 1XT5A 5JZGB 2BNUA 5LGYA 3FB7B 1Z9SB 1ENSA 3BRGC 5JW5B 4CU7A 4AUUA 4AL9A 1Z6JT 3GJFH 3F7KA 4Y4HA 5F93C 4FPKA 1WWAX 3RA7H 1ANUA 5HHOE 4ENED 1IGCH 1KBGL 1YEEH 3KPQB 4PP1D 5I15H 4JHVA 4MJ5A 2G2PA 4QXGH 4HKJA 4X4YA 4NM4L 5I1KH 3WW2A 5F7NC 2FUTA 3WFZA 1E5ZA 3ZFFB 3AQXA 1LESA 2FNWA 2PABA 2WZEA 5T1MB 1S7UA 3AZYA 4YZFE 4IGBA 5K9QI 5AL8A 3RRQA 1YJDH 5EIIA 2BUKA 2D6PA 5ALCH 4RGKA 5JIDA 4WO4A 2EE6A 3MTRA 1PKQE 2P26A 3CXHK 4JQVA 4PJHF 2XVBA 2NDFA 5ABJB 1P69B 4NPYA 4QRRE 2VE6A 4R4BB 4XCEB 4K7PX 5ILTL 1UIJA 2OFQA 5AVRB 4G8EA 4OI2A 1IEAA 4R5TA 2VXQL 4DGWC 5GZNA 3GB7A 4XF3A 3GSRB 4DFSA 5K8SA 1I1YA 3EBAA 3N44F 3BAIA 3OZKA 4QJ3B 5CADA 3QO1B 1S7WB 4X7SL 5ALBH 5CP3H 3C5ZB 3WN5C 4F2MB 4F7TB 4J5VA 5FPAA 4NN7C 4B41A 3K91A 1A34A 2VLRB 3DGTA 4GXUM 1Q9OB 1F6AA 4PG2C 4S1SH 4HFWA 5DEGA 4HMEA 1MQKH 3QQ9D 3TYFB 3VMPA 1MWAA 4A7TA 1RUOA 3WNPA 1AR73 2LLNA 4P2RD 3VVVA 3WL9A 1UB6B 1GZWA 4EV0A 1IGML 3CDZA 1DQKA 4AMXA 4BPZA 1M53A 1R3HA 2E33A 4K3UA 5CHNB 4BE5A 2AI0L 2QSCL 4JPKL 4IBUA 3T77A 2ZNWA 4KQ3L 4G3YL 3WG2A 5E7FA 4NUGL 2AEOA 3I50H 5IZ7A 2BFUS 3Q6GL 1I4FA 3HPJA 2FX9L 1Z5HA 4B7KA 3KS7A 4WM7C 3KD4A 4OCNC 9CGTA 4XPVA 3PUUA 2UV3A 1PG7X 4NENB 1RUE2 3QEHB 3VBUB 3EOTH 3MFGB 2PLTA 5TDNB 3TBWB 4P2OD 3TBWA 4CMMA 2XKOA 4J1XA 2JJSC 2ZCKH 2VGDA 3T8VA 3BYTA 2B45X 1MWOA 1YEKL 5C0BB 3EAKA 5I66B 5ISZD 4N85A 3URFA 1EXUB 3ARFB 4N6RA 3LKRA 4PVNA 1WIPA 2YAQA 1NC4D 1SN0A 2ZCLH 2MRYA 4X9IA 5LBSH 4FEIA 4YW5A 3T0BA 1LO4L 3IDIB 4DIQA 4JANA 4X5QA 5HYIA 2Q30A 1QRNA 2PR4H 4ZD3L 4F5CA 2H0BA 2NCEA 5JDSA 2ICWA 3RS6A 1NC2B 5JSOA 5I6KA 5JZGC 1QXRA 3U7WH 1K3IA 3A5VA 1SACA 3G6AB 3GS7A 4MRCA 2ENQA 4OF8A 1E65A 1NGXB 3EADA 1WGOA 1W9SA 1LE9B 4UAHA 2RS13 3VXME 3BSGA 1V6JA 4RSUA 3NH7H 4Z9KB 3WE6B 3SNMA 5GZDA 3TV3L 3L9JT 4PMFA 5AL0A 3WS6A 4CEYB 4Y5VB 3V5KB 1ENRA 4WQOA 5BJTB 3CK0L 1Q43A 4G80B 1K5JA 3UBGA 1CXKA 4BEIA 4BGDA 3FTYA 4M7LL 5DXWA 1RAMA 3ZUCA 1FYTD 4WM8C 3U6XA 2P17A 5JOPD 2D3SA 3VSTA 5ANHA 3VXQA 4B6ZA 5DHVA 2EH7H 3ML9A 1F4XL 4FOMA 3HN5A 4QCIB 3VDAA 2Y0OA 4XVTH 1ZRUA 4NUQA 4ABVA 4E41D 1O3SA 3EJSA 3I75B 5LG1A 2P5WB 1FL5B 3HPLB 4N2IA 4FF9A 3W9DA 4OIFA 3OBRA 5KHIA 3AB0A 2DQHH 3BD4A 2BHFA 2F53B 3BX7C 4FFFA 2M83A 5K93A 4PJEB 3BKCL 1VPHA 4WLCA 1B3JA 4K6BA 3ZX1A 3G9VA 4YHLL 1U8HB 5GJSH 2E74C 2EEDA 2NY6C 3G08B 1QPXA 4TSCL 1PMIA 1B4LA 4IIQB 2HH0H 1O4ZA 5F2WA 1RUAL 5FYJD 1QFUH 3I54A 4XFIA 2XHNA 1G84A 4NZ8A 4OZIF 5F3HA 3GI9H 1NC4B 5GGSY 5BO1H 3VXSE 1QSFA 1E7UA 4POUB 3QEUA 4QKNA 2ZIDA 2FYYA 2WO2B 2WLQA 1TIUA 2R0LH 2YLKA 2ED7A 1RVFL 2E9QA 3AP6A 3VFPA 4JO3H 5EJ3A 1TVBA 4BZYA 4AWJC 1GICA 3KXFB 3VL9A 4WHYH 3TIDB 3QDGD 2A6JB 3A21A 3DJ9A 4B9IA 1S9VA 5DDJ3 4I9XA 3CHOA 3VFOB 2X29A 1EHLL 4NHYA 4R4XA 1OCWH 1U8QA 4QYOA 1WZ1L 5C08E 5IOPB 2J1RA 3KBEA 4Y4YA 3OAZH 3DKHA 4BA8A 4LF3B 1T21B 1WZAA 4HMZA 5CKMA 4H25B 4IS6A 1N0XH 3I9IA 3MR9B 1JI6A 1FDLL 5J3HD 5I26A 1LO5B 4LHUD 2UYAA 3C5ZD 2CJUL 4LKCB 3TT1H 1QJU1 3Q1EA 3L5XL 2AQNA 4UINL 1YEDA 2LU3A 4XO8A 4ELME 5EOQH 5F6HJ 2P8PB 1DJIA 2GMEA 3TB0A 4W81A 2NT0A 3F58L 3WO4B 1QPPA 3D2UA 4FFVC 2NMNA 4R4NC 2K9ZA 2R0WH 1RZGB 3BN9D 2GJJA 1QJY1 5EJZB 2FD6L 5AVQB 4HKZB 4PRPA 3FB6B 1ZVHA 1GJWA 1AYRA 1AJKA 1QJX3 4LBLA 1HCFX 4JJ5B 2V3DA 4FG0A 3RVTC 4OIAA 3UTSD 1HHKB 4ANWA 5I5RA 4WHYG 4QPIB 2PTTA 4G43A 1HE8A 3ECBB 3DYPA 1L7TH 3FN0H 2H32H 4F9PC 4AOFA 3RZHA 2CDFB 3QPKA 4P06A 4KGQA 4XOAA 2R30A 4MO3M 1CFVH 3IPEA 1TFPA 4U1KB 3T71A 4Q5OA 2XWTA 3FUMA 2DJUA 1JHTA 3CFMA 5D7SL 1O8PA 2J1UA 4OI7A 4IQHA 5IUQA 2UZXB 5DTFA 2NZIA 5FB8B 5T3XH 4QHUA 1EA9C 5MEPA 5ITBL 3KL0A 4KVNL 4DKFH 1ECYA 1O5UA 4JG0H 1KB9K 1ORQA 2IXCA 5L9RA 4IMKC 5ESVB 4P23D 1CO1A 5FS5A 1NMAL 2QKIB 2R1WA 2Y1AA 4I18B 5F7DA 4CEWA 1JI1A 3BGFB 2DJSA 5C71A 5HDBB 4WDIB 4GRLD 4NQCE 4HLZG 5FO9A 3RQ3A 3ZSLA 4R90H 1C28A 4Q4X2 3QUYD 3C7HA 1Q9LB 1S5IH 3DXAE 3AK0A 2V8MA 4U3CA 4W9KC 4WWNA 4IV3C 1QACA 3ILQD 1N0LA 4XP5L 1Z5YD 4U31A 2ARAA 3W57A 4QXKA 3DX9B 4OT1L 4Z7UE 5CEYA 2DYCA 4GFXA 4RS5C 4JO4H 3O11B 4PCSA 1HHGA 1DLHA 3WX5A 2ESVD 3KVQA 3UC0L 3I6SA 4D6QA 2BY1A 3MRKB 4PVBA 2RALA 3QQXA 4GLRI 3HI6L 1SDAB 1X5FA 4LU5H 1NFDF 1QJZA 3HOBA 4LEOB 2VOKA 4X80L 1KGXA 4N0CC 4QRPB 1SNRA 1WLWA 3DVNB 1KC5H 2EDTA 2ID5A 3K74B 4PW3A 3BZEA 2WO7A 1YYML 1DL7L 3AAZB 4GW5B 5DJDB 5GGVY 1NH6A 4OD1H 5FLVA 4FQLL 1QQP3 2Z4FA 2EIDA 2UWBA 1REDA 3VBHC 2HWZH 1X9UA 1M6UA 3PHQB 2WRAA 2K7QA 3BWZA 1N4XL 1HJCA 1OB1A 4YJZL 4KHTH 1Q1JH 4PJEE 1OUSA 1J8HB 3AMLA 3N3HA 5ABZA 5DJ2B 3O9WA 1LGNA 1A5FH 1MHCA 3ZDYF 4EI5C 5GLUA 4GO8A 4PI2A 2P5EB 1ID2A 2VMJA 3UDWC 4XXDA 3AL5A 3X17A 1UG9A 4EI6A 1VP6A 5LY1A 4BELD 1NAEA 4PWIA 2Y6SD 1EGJA 4HX1B 1OM3H 4TNFA 1FL3B 3CQOA 5IHWA 4MXWB 1DDLA 1GSLA 2D5FA 1ERNA 4MZ2A 3B43A 3P73A 5FY9A 1P7KA 2AACA 4QPGB 1XB3A 15C8L 1PQZB 2CL2A 3LNEA 3LKSB 3OXRA 1AHWA 4A2FA 1NCWL 2AAVA 3EJZD 3FCGA 3P0VH 2Z4TA 4EN2A 5GS1B 1NX9A 4KAQL 3ZTDC 1UACH 1N1TA 2HEYF 1MG2C 1CFNB 1WBXA 4F7ZA 2D9QB 2NX5D 3D52A 5FZDA 2CIIB 2VLKB 3GJEB 4C83B 2EF6A 2IBZY 2JD4A 2Y7OA 4HIEB 4K1ZA 1MHHA 3STLA 1FNAA 4LCUA 4P9ML 4PM1A 2IF7A 4IRSB 1DVFD 4Q4W3 2GIMA 2HVJA 1HJBC 3HG5A 4PJ9A 1B90A 3OQ3B 4HK3J 4NAMA 5GGSA 4L1LA 4DQOL 4AFDA 1AQ8A 3LDKA 4ZUSA 3RZWA 2XUEA 2DI7A 1A1MA 1EJOL 1NEZG 1OB0A 1RZIB 2D9CA 2B7DT 3KAAA 3O0XA 5EF1A 4Y1XA 1CWVA 3K2OA 4Q4V1 4FEMA 3CH8A 1PS3A 2RHEA 1Q9KB 5GLVA 1L3NA 5JOZA 1GTNA 4GQQA 5SV3A 1J1XL 1CJYA 4JKMA 4E42B 2XXGA 2X0VA 4NN6B 4CC4C 3PP3H 1F2NA 1IAOB 1A8ZA 2W1NA 4RQQA 5FF6B 3WIIH 4ZUTA 1H6TA 4OZFA 2M1KA 3U36A 2DWEB 3L95B 5BVJB 2VVFA 3NYKA 3MMEB 4HKBB 2WIIA 4COUA 5AC91 3D8CA 4A3XA 3IIAA 2YAPA 4HIHA 1YNKL 3IFOA 5EFIB 5JOFA 2EE9A 1LHNA 4M7KL 3USUB 2J56A 4YGVB 5EWIL 3IN2A 5J89A 2X88A 3D08A 4LHSA 4FG2A 3I2CH 3GEFA 3ILEA 5T3XD 2Q8AH 5KSBF 1WUVA 3GYRA 1C1EH 2I07A 3A3YB 1J1OH 1MJ8H 1S7UB 3D18A 1SM3H 3HE7B 3M8OH 3F7YB 3A6CH 4Q6IC 1PGL1 2WABA 3BVNB 2G5UA 1QVOA 1NUNB 1FZMB 3QZPA 4AQ8A 3G5ZA 3ZE0B 1O91A 1ZLUH 3ZFFA 5B39B 5L8JB 4WU7A 1E8YA 1FUNA 3LZFL 2OMYA 4M7LT 1X44A 5EPMB 1GMEA 1QWHA 5DEJA 3W1ZA 1HH9B 2ERJC 4NKQB 5E2UL 1X9TA 2Q4SA 4A2LA 3KYOB 1CD1A 3AMNA 1JMUB 2CTVA 2GITA 3ECQA 3BUTA 4ZG1A 2A9CA 1X5HA 4U6HA 4OIIH 2YMXH 2ZKXA 3RU8L 1BFVL 1XGUA 4IEUA 4X6EB 1DGWX 4WUKL 1L7RA 5D8JL 5DGRA 5J11C 3J8F7 1EEZB 2B9VA 1QKQA 4N0YH 4RX4A 4Z7AA 5DUUA 1OAQH 2L8AA 3HE7D 4QD2A 5D8AB 4OF7A 3UEQA 4BHUI 1C16B 1ZA6B 4F7TA 4MAYD 4Z2AA 2R4RL 3HKFA 3SBRA 2GJ6A 1QEXA 5DRNB 1UOLA 3CSPA 4JO5A 2BCMA 3GSRA 1AOHA 4NQCA 5JOWA 4PIXA 3TYGL 4XBPB 1A2YB 1RVFH 3OKYA 3GXMA 1NJ9A 5E8AA 3IS1X 1B35A 3CQPA 3SEEA 3QNYB 1KIQB 3AJZA 2BP0B 1X7QB 3BLBA 4J3OG 4YG6A 1ONQB 1GR3A 5FKCA 5B38A 5AFBA 2P4EA 3UC2A 5C0IB 1JGUL 3JWNH 4OFGA 1HT6A 2ZT9C 4AQ1B 1MCRA 1UA6L 4UB0H 4B27A 3WFEH 3BW9A 2R29H 3M3QA 1DUYB 3KPNB 4G7YL 3SDYL 3WEMA 1BA9A 2NX5E 1LQSR 2XN9A 2I9TA 1PZ8A 3RY6C 2BHZA 3PGFH 1F5FA 1HL8A 3MOAH 5H9PA 1M4WA 5AVXB 4P2OA 2Z93B 3OJDB 5B7EA 5I1IL 3CSYB 3FUFA 2A74B 4PJ8C 3TBSB 2KA3A 4LSQH 4OLXH 3VJ6A 2C7UB 5CJXA 4CU9A 1XNKA 5GRWA 1D6VL 1MZZA 2ICWI 4F1SA 4X8JB 5DFTA 3N9MA 4WY7H 4QTIL 4BINA 1AP2A 4GAJH 1CU4H 5GS3A 1YFUA 1CDGA 4FADA 5HJ3B 1HKLH 3PWUA 3CVHA 5DVNA 2VLKE 3HE7A 4P9YA 2JG8C 5JZGA 1VALA 1BPLB 1VPOH 4LBEA 1BAWA 4Q2ZA 4QY8A 4WFGD 3RLSA 3UP1A 3VBOA 4M1DH 1RUH3 4CSTA 1W9YA 4CMMB 4Q0XH 5T33L 2DKMA 4TNVK 4G9DA 5TDNA 3RAJH 4FTVB 1CL7L 3JZ7A 4F8AA 1R081 4IEPA 4NZRH 1QJY3 1YN7B 2VCMA 4B8EA 1B6UA 3QUML 3R1GL 5DFVD 4BJLA 2FLMA 3PL6C 5LBEA 4Z76A 5F88B 5DQ9B 3LAFA 2KDGA 3NJJA 3VXTA 4HIQA 4LK7A 1YN6A 4F8LA 3W9AA 3WSOA 4DN4L 4FXGA 4U6XA 1ID5I 4WI0B 5CG8A 1Z7JA 2VXSL 4LBQB 1CN4A 4AK2A 3RTQD 4PJAA 2OK0L 4ZONA 5DAPA 1IQAA 2PYFA 2WLJA 5FA4A 2LV4A 3LAGA 3LCYA 5KSAD 3LOIA 2WQXA 3GIZL 1XCQA 3GRWH 3ISWA 3KYKL 4MX7A 5FYKU 4ZMYA 3AROA 3I7DA 1L9SA 3H3ZA 3NIGB 1M4KA 1QFWL 2VIRA 1U9KA 4N5ED 4YXLL 2BVPA 5HYJE 1BZ7A 5LGHH 2FUQA 4F58H 3CZUA 2UUDH 4J3OF 2C9RA 1H3VA 1NANI 2WWOA 3TN0C 2V3FA 3ETBJ 1NBZB 5CJBA 1N1VA 5FK8A 1F2XK 1YAIA 4F15B 2IGLA 5CFCC 1T0PB 2YGQA 4B7LA 1EP0A 5C8CB 5EF3A 1MNUL 1JK8A 4YSDA 3ESPA 4ADJA 2TEPA 1ZPUA 3CDFA 4YEFA 4CDWA 2NPIA 4YHZL 1NTDA 3ATAA 4O51B 5B8CB 3PUQA 1SLLA 5FY1A 4Z5RB 2QVMA 1W2NA 3RWGB 5J12B 4OZGB 1HH9A 5FYLE 5ICYB 4M9PA 1X5YA 2XZZA 2K70A 5ITFA 1JOJA 2EUXA 2Y7NA 4Y2LA 4XN9A 5BZDA 1SLIA 2YD2A 4FLRA 3U4BH 2FH8A 1ZMYA 1KYAA 3SPCA 2EVIA 4ZY9A 5F1OB 1T5XB 4O2CB 2DLGA 4ZW7A 3VCLB 3I2GA 3NL1A 2DU0A 3ILNA 4TWTA 5C3SA 1K42A 1CDHA 2EXWC 3FO0H 3ZYIA 5B38G 1VMFA 2FCUA 2X5IA 3SDAB 3M17B 1J3PA 3H56A 4M8RA 4K3EL 3SKMA 1W2AX 1S0GA 5HBAA 1XH2A 2VCBA 2A99A 4GSDL 4YE4L 3O0WA 1JCVA 2IAND 4BQ9A 3EYPA 1KRIA 2XWRA 4Y20A 1QLEH 2GSMB 4Q1PA 2BSRA 1CD0A 2NQCA 2VDOL 5ECGA 3TEXA 3NSFA 1VBC1 1LGVA 3KMHA 2F68X 4CPBA 1M1XA 2WAHA 5HGBA 3N7KA 32C2A 3PHSA 3QBQA 5FPVA 4GW4B 4TXWA 1IGIH 2IOMA 5E51A 1T5WA 4OZHA 2VLME 4CW1A 4UTAH 1SMDA 1WCBB 1M6OB 1N7ML 4XNQA 4H20H 2JJ6A 3NV4A 3UAFA 4MNQE 4P57A 2Q3AA 4ZXBA 2HTLD 4RDQG 1NCJA 3IS0X 4PJ7A 1UEMA 4P05A 5FK9B 4PIYA 5D7KE 5JW4Q 4RN5A 1MKFA 1BFOB 3LRLA 5HDRA 5KVDL 2OX0A 1LU1A 4I2XB 4XHXA 1NGYA 5IBUG 3ZE2B 5E2TL 2C9QA 4XMPL 1P7QB 4DN3L 5H35A 4M3CA 4Y4KD 4UT6A 1BD2B 5D7JC 4LCIL 4TOYL 4N2CA 2K78A 5HVHB 4ZS3A 3LFIA 5HDWA 1R1A2 1ETZA 1JOBA 3FWEA 2XJPA 3HC0B 1OW0C 2KPNA 3NGBC 4L8SB 3WLBA 1GP5A 2HYXA 3RVXD 1H5BA 4P59L 3O3DB 4U1GB 4Q0QA 4JTNA 1AP2B 1YMMD 5ESVA 2QLYA 4R2GD 1HRV2 1PYWA 1U92A 1ASPA 3J07A 1S3KH 3OR6B 5MEPB 3U0WL 1JD7A 1KBGH 3NUKA 2JLPA 2F74A 4RMWA 1VCBC 2Z93A 3OJDA 2RS31 3JZVA 1F97A 3IDYC 3RDTD 1C1FA 2WO2A 2XWTB 5F7AA 2GCYB 2QV4A 4M5YH 3ARUA 1LHVA 3TVMC 3PXJA 4M1CD 4KI5C 2W1UA 4IEOA 3ZKMD 3QH6A 3QO0B 4HK8A 3GJFB 4TN7A 2CXGA 3TA4D 2VR3A