2WN2A

Structure of the discoidin i from dictyostelium discoideum in complex with galactose beta 1-3 galnac at 1.8 a resolution.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
254
structure length
254
Chain Sequence
b'AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISCOIDIN-1 SUBUNIT A
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
total genus 63
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wn2A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wn2A01
4DEVA 1UY4A 1UY0A 1F4AA 3NJXA 1XPWA 2VMEA 1DLCA 1CX1A 4BK5A 2VCAA 1JYVA 1H6YA 2B4KA 2EICA 2WZEA 3C7GA 2W87A 3PUIA 4LHSA 4QX1A 1OH4A 4OMDA 4P02B 2E31A 2YC2A 3HPNA 4ET7A 4AAXA 5I0DA 2W1QA 4OYUA 2VZQA 1O8PA 5LA2A 5C7GA 5JUVA 3DYMA 4KMQA 2Y64A 3WEZA 3WF3A 4DXSA 3I3BA 2Y6KA 3C7HA 1JZ8A 1UY3A 4MO3M 1OT5A 2WAAA 3OB8A 1IQDC 2ZEWA 3ECQA 4DUVA 5JXJA 1UY1A 4D8MA 4DUXA 1EUTA 3VD7A 1US3A 2C26A 2Z4FA 1MPXA 2E33A 3FL7A 2HYXA 4QPWA 4IUGA 3VDAA 1O8SA 3WNLA 1OF3A 1UY2A 2J1RA 1NKGA 2J1UA 2J7MA 1XC6A 4RYDA 1J83A 3LEGA 1XNTA 1RYYA 3GM8A 4LQRA 4XUQA 4XZUG 4OZOA 4M4RA 3CDZB 5C70A 2QQMA 2J1TA 4MGQA 2WAOA 5IFPA 1W99A 3NQHA 2W1WA 2KD7A 2PQSA 3VD3A 2YG0A 4GWIA 1TVGA 5LA1A 3K77A 1W9TA 1K12A 3WMQA 2ORZA 3U37A 5C71A 3SEEA 1CZSA 4PQQA 2DCKA 1UMHA 2RVAA 1JYXA 2VQTA 3WNPA 4P5YA 1JZ4A 1KGYA 4E8DA 4JKKA 1JYNA 3E1F1 2CDOA 2DCJA 5IHRA 4ARXA 1UYYA 3BGAA 4XUTA 3A23A 1JZ2A 3MBWA 5IYYA 4A41A 4QB1A 2VZVA 5EJ1B 2Y8KA 5JR2A 5JMOA 3IAQA 1J84A 4UOJA 3WF4A 1GMMA 5HXMA 2WZ8A 2CCVA 2Y6LA 2VM9A 3OEBA 3I3EA 5IJRA 2VC9A 2ORXA 3T0BA 3IAPA 5EIYB 3OGVA 3MUY1 5F7UA 3WNOA 3IB3A 3HOBA 2JD9A 2WN2A 1ULOA 4W8JA 2VZ3A 4JKMA 3OEAA 3WMPA 4W4ZA 5JXHA 2V5DA 3I3DA 3F2ZA 1W0NA 2WABA 4CUCA 3VDCA 2W91A 5LCWL 4JHZA 3DECA 4UI9L 2L9LA 3SKVA 2BERA 3I2KA 3ETPA 4A3ZA 3BN6A 2VZ1A 4P08A 3EB7A 2C4XA 2V4VA 3A22A 2WUHA 3WNKA 3FHQA 3FN9A 1JYWA 1I5PA 3DYPA 2J1EA 1L7RA 4OMCA 2VZOA 3CIHA 3GXUA 1OF4A 3A21A 5DMYA 3CZUA 2RV9A 4M4PA 4QDRA 1WCQA 1UYXA 2ZEXA 2X05A 2VZRA 1D7PM 5HPOA 4DUWA 3P1IA 1TG7A 4CUBA 1JU3A 2RJ2A 4DXRA 3NRUA 3UESA 1LNSA 2LW8A 3DYOA 2HLEA 1PMHX 3NJVA 3OGSA 1CIYA 1W9SA 4QB2A 2CDPA 2VZPA 2W1UA 1PX4A 3JXSA 2VQUA 2Y6GA 3WF1A 3PUHA 4A42A 3T08A 2Y6JA 1HN1A 3T2QA 2JDAA 4XUNA 4LKSA 3W5NA 4BXSV 5G05L 1BHGA 2YFUA 3CZJA 4Z2AA 4CVUA 4YPJA 1JU4A 2XONA 1UXXX 2X10A 4QDQA 4XURA 3ACGA 3T0DA 3ACHA 2WO3A 3THCA 3T2PA 3LQCA 2EIDA 1JHJA 4P00B 1UX7A 1GOFA 2J1SA 2W47A 4QDSA 5G04L 4ZZ5A 2W5FA 4XUPA 1KEXA 2WO1A 4KI5M 3HNBM 3CKHA 4QX2A 1US2A 4JX0A 3I2HA 2VL4A 3HN3A 3LPFA 1JI6A 3K4ZA 4XVHA 2QQNA 3HNYM 4XUOA 2EIEA 1UWWA 1UXZA 3THDA 2Y6HA 3WSOA 1PX3A 3GDBA 3C7EA 2WO2A 4A6OA 4DEQA 4KWUA 3T2OA 2E26A 1GU3A 3C7OA 3LPGA 2QQOA 4UAPA 4L0PA 4Q56A 1NUKA 2VMDA 1SDDB 2ZXQA 4MOAA 2WYSA 5DQ0A 4QX0A 1YQ2A 4CUAA 4QAWA 4ARYA 4BJ0A 1L7QA 1SHWB 3MUZ1 3OG2A 2ZEYA 2VR4A 4GZ9A 3AC0A 2X09A 1F4HA 2WN3A 1W8NA 4MGSA 4RN5A 1K42A 2BBAA 3IIIA 2WBKA 3J7HA 3VD4A 4TXWA 3K4AA 2QBXA 1CZTA 3HJRA 1GNYA 2CGYA 1T2XA 3T09A 4QX3A 2XOMA 1GOGA 3I2FA 2VCCA 3WF2A 4E8CA 3GGLA 3C7FA 2J22A 3MV11 4OUEA 4GWJA 3ACFA 3I97A 4A4AA 1UZ0A 2B9VA 2CGZA 3K46A 2EIBA 4ZY9A 5J1XA 5FUIA 2BGOA 2OKXA 1XNAA 3VDBA 2XHNA 2QQLA 2QQIA 1R64A 2V72A 3MV01 2W9XA 4A44A 4TTGA 3I2IA 3K4DA 2E32A 3CQOA 1PMJX 2W46A 3FHAA 2J1VA 3WF0A 2VTFA 1EUUA 1GUIA 2W95A 5A1AA 4HG6B 2YC4A 3HNMA 2VCBA 3D3AA 5CZKA 3I2JA 4BDVB 3OGRA 1DYOA 5B4NA 2JKXA 2LS6A 3W5MA 3LE0A 3HEIA 2R7EB 2DDUA 1W9WA 1NAEA 3WQBA 1UMIA 4CU6A 4D0QA 3SKJE 1K3IA 3WNNA 2W1SA 3P6BA 3C8XA 3UETA 1W8OA 5DN2A 3ACIA 4JKLA 3ZM8A 2VZSA 1ULPA 2BGPA 3LEIA 2XQXA 1OD3A 2VZUA 1JZ7A 3IDAA 2VJXA 3SEPA 4QB6A 1JZ6A 2WDBA 4PF1A 4CU9A 3WNMA 2VOTA 3A7QA 2VO5A 2YFZA 5EJZB 4DXTA 1JZ5A 2YB7A 1WKYA 3VD9A 1GQPA 4FI9A 5IFTA 1CZVA 4A45A 1SG3A 2ZEZA 1NX9A 2VZTA 2J1AA 2CE6A 5LA0A 1O59A 2QQKA 2W92A 4LPLA 3ABZA 4MADA 4ZZ8A 3CMGA 5JXIA 3OBAA 5JXGA 5DPNA 4PT6A 1JZ3A 2ID4A 4W50A 3K75B 3LEKA 5B4XA 1H6XA 3VD5A 1K45A 1UYZA 4ZXEA 2C9KA 3T0AA 2VMFA 2QQJA 4AG4A 2WQ8A 1DP0A 3UNPA 4CU8A 2W3JA 3I2GA 2BZDA 1P8JA 4BK4A 2JE8A 3EYPA 1GOHA 2VMCA 5CYYA 4CU7A 2W94A 3MO4A 3NNGA
chains in the Genus database with same CATH superfamily
4A66A 3VYPA 5E24E 1RJLA 3MLKA 2ZOTA 2VDNH 5DFWH 1W8UA 2VDNL 5DXWA 3MFGB 1CB4A 1DBAH 4JGYB 3LAFA 1DBAL 5F6HJ 2WQSA 4X83A 1WGPA 4XJ9A 3UGUA 2YOAA 3L2NA 5DJ8B 2W52A 4EVNA 1H6UA 2BWCA 2QZQA 4LHSA 4WI9A 3M1BA 4TNWF 2JQAA 1F1DA 3NESA 4H5SB 1E6JL 4X99B 5DMGC 1JCKA 2FCTA 1JTOA 4LPVA 1ACCA 4JFDE 4CRQA 3MJ8B 4PGBA 4AVTA 5TSWA 2OZ4H 2OZ4L 5B4MC 1LKNA 1U5YA 3GCWA 2E0PA 2APBA 3RUGB 4O51A 5KYWA 3PVNA 4KBZA 3H9SD 5H94B 3WEZA 1P9MC 4CTEA 2H0VA 2BSED 4OCSL 1K8DA 2OL3B 4Q8LA 3K6DA 2R2EB 5FC9A 2E9JA 1MVFA 3RJOA 5C0NC 3OB8A 1PO13 4QKXB 4UDTB 1CF1A 5FO2A 2X4NA 4DZBA 1QGLA 3D0VB 5IOPB 4GW4B 4XODA 4ZI8A 3MV9B 4KROC 3GHMA 4FPEA 1EUTA 2ATPA 2YMXH 2B4CL 3DPRA 2YMXL 2YPKB 2ZKXA 1UOKA 4QU1A 3ARRA 2R1WB 3LPWA 4N3UA 4P5MB 5C6TH 4KWLA 3N41B 1XZ0A 3NEEA 4HJSA 1QI3A 4F7MA 5EC1A 2I27N 3VBUA 1T6VN 4O02A 5T50A 4FDWA 1DQDH 1TZHB 4MSWA 1EJ6A 2R1YA 4BFNA 1VFMA 2GBTA 4LASH 1R1A3 5T5LA 3SPJA 5JQ6H 2DWYA 1S7QB 5JQ6L 3DV6B 5IF0A 4QPEA 5KVGH 3HBZA 5B3JE 1IAMA 5KVGL 1QO3B 5EBGA 3EAKA 4GMP3 3ET9F 3UO8B 4OUMA 3HZMA 3CFDB 3CHOA 1AVAA 2XC8A 1RHI2 2K9FB 1R19A 3BYTA 2A4ZA 9PCYA 1HE7A 4YHIB 1ZLEA 2YAFA 2QPFA 1Y1UA 3BEVA 4PLNA 1AIZA 2AXWA 3GRBA 2KQNA 1ZZ6A 1A9EA 5JHDD 2IG2H 4JFDB 4Y89A 4LNRA 5F9AC 5FYLH 4PQQA 3DGTA 3VD0A 2D3RA 3L3GA 3PP3H 1MEC1 3MV8A 3L3OC 3UFIA 5FPIA 2Y7NA 3AREC 1U91B 5T55A 1NC2A 4YSDA 3IGFA 5J1AA 4D0DA 1O6TA 1JNNH 4COYA 2EXWD 3CLFH 5EC2B 3N85L 3CLFL 3PWPA 1EHXA 1ZA6A 4XUTA 4FNLH 1NAKH 3CFBA 1IGTB 3TIEB 3MPBA 5F5QA 1NAKL 2MCMA 3DO4A 4QB1A 4IOFD 4HJGA 3BVUA 3BUPA 5FPAA 3MREA 4M1CC 2XRAH 4JBSA 5DUBB 2KDGA 3GO1L 2YU2A 2XRAL 3KGTA 3VXMD 5C9JB 1JBJA 5CJBA 4LVOC 5CCGE 5CEZE 5JMOA 3G6JF 4UOJA 1ETZA 3LDBA 3MGOB 1UQSA 4GEJA 3NV3A 1QOKA 1PK6A 4HF5H 1CE6A 2X5IA 1I9EA 4KUCF 1KTLB 5HD8D 4KNUA 4NENA 2JIXA 4JO1L 5C0CE 4B29A 5EIYB 5T1JA 1BF8A 3GMNB 5GZCA 3LOIA 3MPPG 3CZEA 1KTDA 5E2TH 3SDAB 3DSFH 5E2TL 4N53C 1BJ1H 3DSFL 3SKJH 2GIMA 1GTFA 4JTNA 1W72H 1RUPH 3VD2A 3MLSH 3JWOH 1EA9C 1DE4B 4GMSH 4Y33A 2IQAB 3A6CH 3JWOL 3MLSL 4GMSL 4X7DC 3A6CL 1UG9A 4N6RB 2IADA 3WL9A 3ZE2E 3W39B 5F7EH 1KYAA 1F4XH 3DK0A 4CVXB 1UKGA 5F7EL 4WIQA 3PWUA 1FOD3 2WXLA 2IC2A 4P9MH 3UTSE 4HOXA 3HE7D 4YE0A 2WKLA 4EQ2A 4G8EA 4BHUA 1HJGA 1PNGA 2CDGA 4WWKA 1WWYA 4FHBD 1SY6A 3V0AC 3GNMH 4LU5H 2V2TB 3FTWA 3GNML 4ITCA 4LU5L 1LRHA 5FZMA 1U8CB 1WHPA 1E67A 3D4KA 4RGGA 3OLIA 5D7IE 4DWHA 3UTTD 5LA9A 3FB8A 4F5CE 3ZKND 2PCPB 3NAPB 1MWOA 5K9OA 1RZIA 4NWUH 5L2KE 4NWUL 2AW2A 3T6VA 3UK9A 1DUYA 2XTJE 3VDDC 4CC0A 3B9KA 2ATKB 3B83A 4MA1B 4XNZB 1R5VB 1ZS8B 4XMXA 4AGGA 3T3PB 4HUCA 4XR8C 2R1BA 4PJCA 4M4PA 3RIFK 5G5DB 1VGEL 1P2CB 2CGRH 3QRFM 2ZEXA 2OYMA 2CGRL 1BYOA 5E6ZA 4HEPA 4QRRE 2EDTA 1ZV9A 4QCIB 1LHOA 4DUWA 3VBOC 3Q2CA 4NPYB 4QHZA 4PJFA 1H0DB 1RP9A 4RH4A 3SDCB 2P8PA 2OVUA 3ZDVA 3I6GB 4KITB 1PLCA 1ZV5A 3VHNA 5C4WC 4WO0A 1X5AA 5F5CA 1A7RH 2ZMNA 1DVXA 1A7RL 4C91A 2VR3A 3FTZA 1Q8OA 5H2BB 5GIRB 5L8JB 4N9IA 3BIWE 4PGEB 4JFEA 4Z3FA 1JHTA 2IWFA 4Q5OA 4KZCA 5E00A 1GZWB 3JWDL 2FCVA 3OMZA 2XDVA 3LIZH 2VDQB 3LIZL 2Y06L 4LPTA 3RKPA 3I7DA 3B4NA 3ARDB 2DV9A 1VHPA 5C3SA 5AOLA 5D6CB 1V3JA 2KYIA 3O4LD 3LKQA 4N0FB 3ZE2B 4GMP0 5F6LB 2GI0A 3T08A 3RWNA 4MUVA 1D5XA 2Q1MA 1ULCA 3FUNA 3UTSB 4GW5B 2BUKA 4CBPA 3LB6C 4LSPL 1BFVH 4U1HA 4AGNA 3FWEA 4E4DX 5DZOA 1BFVL 1BMZA 3COOA 2XH6A 3EGSA 2W0FB 2WAHA 1E8YA 3FUFA 2EDYA 3K7UA 3S6CA 3ZKQD 1EDQA 1KPRA 1N64H 1R24B 1PCSA 1RIUL 2X10A 4N20A 2Z92B 3NJNA 4QLWA 5D7IB 1A2YB 2JJUA 2ZZQA 4FXGC 4E0RB 1A6WH 4CDXC 1DEDA 4UUJA 1A6WL 2OKMA 1KGXA 1FL3B 2AJSH 4XO9A 4YEFA 3GJFA 2AJSL 5I2IA 2VR5A 2ZYSA 1W8ZA 5C0BE 4HVRA 5B2GB 3KS0H 1JWMA 1E4JA 1CFNA 3BT2H 4KKAC 3BT2L 3IJ7A 2AXFA 4Y4KA 3X12A 4XUPA 3BH8A 4KI5M 3CZSA 3WO3B 5ADPL 3RFZB 1YEJH 3CKHA 4QRRB 1AR2A 1YEJL 1OAJA 2CO7B 2XKSA 3NCJH 4JX0A 3NCJL 3RX5A 4X9YA 4YDKH 3R0NA 5GLWA 2WQAA 3U9PH 1MI5E 4YDKL 3K4ZA 5FGCE 1IZKA 5J6HB 2X53A 4PJ7F 4OHZA 1RUG2 2UZIH 2DD8H 4IMKC 1HDKA 2UZIL 1ETB1 3EH2A 1R3KA 1OA2A 3IPVA 1ZZ7A 2J71A 1GGIH 3GXUB 4BCYA 1XCQA 1RJ8A 2Y6HA 2CL2A 1H3VA 1H1AA 2LE9A 3C7EA 2AVGA 2DQEH 2HCZX 5ISZE 4UZGA 1MHPH 2GNDA 1MHPL 3T2OA 2OTUA 1BVLB 3BP6A 2A6KA 2P3JA 3KPLA 1JXFA 4NUQA 2WNXA 3WFHB 3G5VB 1P5UC 3J7MA 5TTRA 3WDIA 1AXKA 3CIAA 5FPUA 2ZHLA 3UG3A 2AH2A 2WWSA 4NSKB 4XCBA 3IJSA 4GKSA 2P5ED 5I5JA 3TNNA 3QCVH 1IGCH 4M62H 2BCKA 4QX0A 2CRIA 1IGCL 1NIDA 4M62L 4G6FD 3OF1A 2B5IC 3ARFA 4YW7A 2ZXAA 3H85A 4X9IA 1A6PA 1IM3D 1ANUA 4KVNH 1MVQA 3L45A 3GKWH 3USSA 1ORSA 5IB4B 2EIJB 4PJXA 3M4FA 5E1QA 3BDBA 4IEZA 2ZGTA 4Q6IC 1W6PA 3SOTA 4YSRA 1W8NA 2JE7A 5FM5O 1QMUA 3SDDA 1DL7H 3O9WD 2ZABA 1DL7L 5J36A 1ZHKA 4ZMOA 2BNUA 4O00A 5CKMA 4UQAA 5DYFA 3LCPA 5C0BB 4HWZA 1B4JH 5DJDB 3MW2A 4Z95H 5DEJA 5LGHH 3VCLB 1MRDH 2AAVA 5KVFL 2VW7A 4N9OB 5LGHL 1MRDL 3JZYA 4GKXA 2CIIB 1HS6A 1G6VK 1G9HA 2OSLB 3TA3D 2YUWA 6CGTA 3ZMOA 4QT5B 3CXDH 3UYRH 4D0CA 3MCKA 3NSXA 5JI7A 1MI5B 3CXDL 3SO3B 3UYRL 5ESQB 2PWFA 2F5AH 4GLRH 1AGDA 3U7YH 4BQ8A 2GZWA 2F5AL 4JM2D 4JFXA 2GJ6A 3U7YL 3C7FA 4FFYH 4P3DA 3DXTA 3RURA 3OKEB 4FFYL 4GJYA 1ROWA 4I3PA 2VRQA 3QFJE 1IM9D 5C3IA 1UZ0A 4NQEB 3KGZA 5ISZB 1WC7B 3GIVA 2CDFB 1BDYA 1NFDE 4ISRA 1GJIA 4Z7UE 3VDBA 4YFZA 4ZMXA 4K3GA 5FCCA 1U0AA 2YC1B 4OT1L 4ANKA 4BH8A 2EKJA 1CYGA 1XGRA 4H8HA 2QQLA 3J8F1 2ED7A 2F54A 3X11B 3GLZA 1KS5A 2W9XA 5JIHA 5L2JB 2YA1A 1KEML 1UXLA 1X5ZA 4HK8A 4K7FB 3VVVA 4CSZA 5J5EA 1NGPH 5FJKA 2WO2B 2WM0A 2EINB 2WJ5A 2FIKA 1FH5L 3UTZA 1MCQA 2E4FA 1YMMA 4DSYA 3R0RA 3PNAA 4LA3A 1TEFA 1ZVYA 5JPNC 3IDXH 3KZ8A 2VLJA 3IDXL 2KPWA 1P4BH 4ODUB 1I5ZA 1P4BL 3M3IA 1EGJA 1TENA 1E4HA 4P57A 5E2VH 2JG9C 5ALBH 5F9JB 2LS6A 5E2VL 1GZQA 3PY9A 4C57C 3WP5A 2LW3A 3AKSA 5IK8A 4U1MB 4HKBB 3RDJA 3P0YL 3Q2NA 3U48A 1NCAH 3ZQXA 1NCAL 2DQ6A 3QIBC 3OHMB 2Y1VA 4KOCA 2WXKA 4PRAA 1MJUH 3ZZSA 1E5SA 3K71B 4OSUH 1MJUL 3O8XC 3JBG7 4PREA 4OSUL 4FFVD 4JGNA 2HT4C 1BMWA 5AW0B 4I0BA 5T54A 2BVPA 2OR8A 1AR91 1UD4A 3WZ1A 3HBKA 3MX0B 5F2WA 1SJHA 4XZUA 2EDXA 4W9FC 2HFEB 4M7LT 5HCFA 1RLBA 1UC6A 4PRHE 3PF2A 4NCC1 4V1DE 2BGPA 1PD0A 1CD3G 3N55A 4G6AC 3QFJB 4AXWB 3E6DA 1HHGA 1O7SA 4JTOA 4OGXH 2F58H 3D25A 3MNVA 4OGXL 2HPTA 1NCRA 2F58L 3H0TB 4CDWB 1EFQA 3OD4A 5AC91 4XB8A 5KSUA 3N06B 1JZ7A 1NFDB 4PJGA 1AP2A 2IXQB 2F61A 4Z7UB 3B34A 4YUEH 3FBMA 4PUBH 4YUEL 3MRKB 4PUBL 4LEOB 5EBLA 4AT6B 3PUQA 5AUMA 4DVBB 3T6ZA 3RI9A 3I54A 1I85A 3D69B 5EJZB 2FT8A 4EWDA 4PS4L 1W2AX 4OFGA 1CDYA 3FO1A 4PM1A 4F9LA 1W91A 5CSZB 1JVKA 4ISVA 4YG0A 3GSVB 1TJXA 3HR6A 5BV7B 1KB9K 2EAKA 4F8AA 3A6BH 1XGPA 2DH2A 3GSNL 3PWNA 1D4M2 3IDYB 4BQXA 1I1RA 2Z8VC 1D9KA 1LJMA 3V9CA 3ISRA 1N2RA 4LE4A 3MEPA 1KLUA 3EJPA 1NFKA 1QLFB 2QQKA 3RWFB 4A3XA 2PPAA 1ID5I 2XQBH 3FZUC 1XF5A 3GMOA 5EOCJ 2XQBL 1U4EA 3R6SA 1F1AA 2GT9B 1AO7E 1E57A 4LDLB 4OCYH 2OI9C 3TPKA 3BD5A 3K72B 3K91A 4OCYL 2IAND 5DK0B 3L1OL 5A2CA 3L7EB 3KBPA 2VVFA 4XVJH 4ZXEA 4XVJL 2ICCA 1T04A 4U1SB 1GP4A 3M1CA 2WT2A 1S7SB 3AM2A 5BXFB 4C0HA 4HXAL 4K6BA 4SLIA 3LWCA 3BIKA 2E6JA 2DVDA 2W3JA 2X44D 4Y5YB 4GKZB 1RITA 3ATGA 3H3ZA 4MB4A 3JV6B 3MYJA 1VE0A 3EYPA 2N7BA 4EN8B 5CYYA 4V1DB 1D4VB 2R1DA 3BSZA 4RMTA 2BY1A 3O2DA 4RZKA 4XNMB 4XETA 1SQMA 3WO4B 4OULA 1N18A 2FX8H 2UYLA 2D7PA 2FX8L 4YIQA 2RJMA 5D1QA 1UY4A 5FUPA 4XAKD 1XPWA 1U58A 3H2PA 4OM0H 3J8F3 2H1PL 1RUC1 1NFIB 1SN2A 4UV4H 3RLSA 3LGRA 1A6CA 4UV4L 3RNSA 1YNTB 1SJVA 3DRTB 3EOAB 1UNBA 1O3RA 3IWZA 3QEUA 1UN1A 1EAJA 3US1A 4KNCA 4O9GA 2ZG1A 5KR7A 3QUXD 4U4BA 5DD1H 5IVCA 1V7NH 2HWZL 5DD1L 4XMTA 4AEMA 4X6FA 4GB9A 4ACTA 4NQTA 4JFFE 1E0OB 4X6EB 4FQCH 4UT6H 4S2GA 1TR7A 1YCSA 4IS6A 4UT6L 3UJOA 5AW7B 5ERWB 2XWXA 5J12B 1CIWA 1DZTA 2Y64A 4ZMLA 4RFT0 4K8RC 2EC9T 3WF3A 4YSSA 1NTDA 1NEZB 1FVEA 2GC7C 2Z4QB 4IW4C 1HHKB 3UEZA 4RHV1 5H9RA 1UCBL 5A1FA 2V9TA 1XD1A 3EADA 4BOWA 4F33B 1X5XA 2P28B 1A22B 4XPAL 4C47A 5CVRA 1QLEH 2B1AL 1YNLH 5MP6H 1AO7B 1J1LA 1QLEL 3QBTB 1YNLL 3RVWD 4C56A 1VGKA 5MP6L 1PZUB 3FH8A 1CWVA 4PS3A 5BQ7B 2NPIA 3BIBX 2Y5TB 1QFOA 1VENA 4A7QA 2C26A 5DS2A 4DKDC 4YM1A 4WW2F 3WKPA 3QG6A 4UU9B 2YARA 2AQSA 1YYCA 2O5ZH 2IAMC 1ZVSB 3FU0A 1QSFD 2WLJA 2O5ZL 3GI8H 3MUHL 4HC1H 4TNEA 5EZLB 3GI8L 3UEQA 43C9A 4E5XG 1NXMA 3BMWA 4XPGH 1NKGA 2BY3A 3NSFA 4I77H 4WSGA 4XPGL 5EN2B 2J1UA 2V7NB 3NP4A 3W9DB 1COV3 3HIFA 4L8QA 3ES6A 5AC93 4ZTEA 3LEGA 3BKMH 3PIGA 3JT2A 3BKML 5JIKA 1HV0A 4Q2FA 3CWGA 4PD4K 3BQUD 1OGPA 3FQRA 2TSAA 4OD2B 3AP9A 2WWMD 2ZGSA 3QH3B 2ARAA 3QAZB 3O0LA 4RFEA 4LO6B 1M2VA 4YSQA 4G8GD 2NSXA 2WB1A 5PAZA 5DRWA 1OTTC 3EO0A 4JGYC 5K9YA 5JUEL 2CBPA 4MMXA 3ALXA 4KKLC 1J9CT 4A37A 3WIIL 5L4JA 1I4FA 3MKGA 3ELNA 2GH2A 5CINH 2DZEA 4XEZA 4KK8C 3VD3A 4N2DA 1PZAA 5CINL 3VFWA 2AC0A 3BVCA 4HXCA 3VX0A 4Y0GA 5HVWA 5BVPL 2IBBA 1BVNP 4KZ0A 4JFFB 2CHHA 2GTWB 3RVHA 5E1AA 1MW3A 2XFXA 1OAQH 3TEZA 4WBBA 5B1BB 2YKLH 2DCKA 1J10A 1OAQL 3BVNA 2PMWB 2YKLL 4X8CA 3INUL 3N1GC 4PJAA 1KGYA 4JKKA 4MXWB 3KCPB 3ARGB 4MYWB 3BUBA 4PJYA 4L9LB 2K3HA 1JW6A 4KRLB 4AMKH 3HAEB 5ICUA 2A74A 5IJDC 5TD4A 1JDDA 2OJZH 2EUZA 1NA8A 3PVBB 1MREH 3S30A 2OJZL 1MREL 1ND3B 1NZCA 1RJZB 4GSDH 1QP1A 1OM9A 2ZIDA 4GSDL 4QRQA 6FABL 1E4WH 3IAQA 3N35A 2HX7A 1XBRA 1E4WL 5M95B 1WBYA 3FCSA 5EYYA 3S7IA 1W16A 3AY4A 4E41D 1AD9B 3K6OA 1BM7A 5IESH 5D5MF 2WTOA 4KKZA 2FWOA 4BFIB 4MLOA 5AWNH 5AWNL 4Z7QF 3PFQA 3BJLA 5FECA 1G5AA 4HKXB 3MOBH 3P9WB 2C3GA 1RUC3 1JOPA 3MOBL 1P7KA 2F74B 3HOBA 1EIBA 2NYYD 1G4RA 2JKRM 4I88A 5E8EB 4NIHA 2ZF9A 4QKDA 2GP3A 3QUHA 1FYUA 1ND2B 1YEFH 4H0HB 1V6JA 2CO2A 3WMPA 5C0DB 4JZJA 5I8TA 3KBEA 4UT9A 3M17B 4A2DA 3BAWA 2WABA 2WZR1 3U0PB 2GTZA 1OOPA 2VOXA 3FT4A 1R3JA 3TO2A 4CDHA 3AVRA 4HOOA 5FOJB 3MRMA 3NCXA 3NCMA 1AJ7H 4YXHL 3QJXA 3VRJB 1W0PA 1AJ7L 3HHSB 4L5FE 3OJMB 2Q7AA 1GCYA 1DYPA 4P08A 3TBYA 3OQRA 4HFWA 2R063 2XG5A 3OZKA 5F1IA 5E6HA 3FRPA 5EU3B 3OKNA 4P48A 1CFQB 1QJEA 2YDEA 5JIAA 3FU8A 4Q2ZB 1VA9A 2PW2B 4ZFOB 3VH8B 1A8JH 1GHFH 4K21A 3QCUH 1KLGB 1BQPA 4JDZB 1GHFL 2R0ZH 4YSCA 4OUOA 2J1EA 2IZWA 1UOWA 1ZGLA 2Y24A 5EBWA 4LCWA 3WAKA 1QHDA 3TNQA 3BKCH 4IMLA 1F90H 2VCOA 3BKCL 5FPXA 1F90L 2JDNA 4BH7B 1RIVH 4WUUD 3D0LA 3TBVB 2PTTA 3EGDB 2QVMA 1ADWA 1H2LA 4OCLC 4MTMA 3IBEA 3KLLA 4LIVA 3EJZD 4CEWB 2OL3H 2P3KA 1T5WB 1GVIA 1F11B 2OL3L 2WXGA 4IU3A 1QSZA 3EXJA 3O1TA 4PSRA 1Y0LA 3TNMB 3HZKA 1PSKH 3V4VB 4X4YB 3DGGA 1BD2A 1N0XH 1PSKL 3GZPA 4WHDA 2ARJQ 4GT0A 3HC3H 5GRVL 3QAQA 2J6EA 2QDWA 2IDTA 3CBNA 1KOAA 3CK0H 3KCXA 1EJFA 1EV13 3NPZB 1IQDA 4MJ5A 1KT2A 1MH5A 1U8LA 1WGOA 4KC3B 2BPBA 2A83B 1RXFA 3IDMB 3C09C 4N8VB 4E68A 3PU8A 4N28A 4HJIA 3L1EA 2R56L 2CK0H 5EV7A 2VY0A 1XH2A 3CUPB 1W15A 2QEJA 5FO7B 1MSPA 3ZOAA 5DZLA 3ABKB 5GJTH 5GJTL 5IHUL 2AEYA 1BHGA 5DRNB 1XNKA 1M3JA 5IHWA 2Q3ZA 2B16A 3CZJA 4AI7A 4BHUI 3AMKA 3GF6A 5JZGA 1MQ8A 1W2NA 5DRXA 3WGVB 2Z31B 4OW6A 1VEPA 3OX8B 4NKQB 3LNGA 1FC2D 4ZFFA 2EIDA 2HWC3 2O1QA 1M7UA 1M7IA 2W68A 4K3JH 5IFJA 3BTYA 1PKQA 2O72A 2XCMC 5K9KB 1EPZA 2ZX2A 1FC1A 2NW3A 4XNZC 4XPFH 4MDRA 3GS0A 2CALA 1ONQB 4XPFL 4M8RA 4WJKB 5E1GA 1AS6A 3VD1A 4A2LA 3L9BA 3RWDA 4ODWB 3VE0A 1MS4A 1MW1A 3VSTA 3ZN6A 1I8MA 2DUQA 4MD5B 1J8SA 4Z3JA 4J6IA 3MFAA 2AXGB 2WXMA 4LFHD 4Y2DD 4L8DB 2G2PA 5DU7A 5FA3B 4ZUWA 8FABB 3RFRA 3UMTA 4NMIA 5C8WA 3SDCC 4MB1A 2GITA 4LARH 4LARL 1FIEA 5GGQL 1H0BA 4IV3A 1IAOA 1CLCA 3DC0A 3BUYA 3SCMD 2OX5B 2Z65C 5DJYB 4G5ZH 3SBWA 1D5RA 4AV0A 1J0JA 2FECL 2ILMA 4PWFA 1SQ4A 3HI1A 5DJ6A 4M3CF 1DGRA 1VBB1 4YNYB 3V7AE 2GC2A 5D5ME 5T1MB 1CD1B 4ILDA 1N9PA 4XACA 4AI0A 3R18A 3MUJA 3JBG1 1H6TA 1K4DA 2H9GB 3WDUA 4UAPA 3KXFA 3M45A 2Q87A 4BM8A 5BNPA 3QJZA 4J4PC 3AX4A 2AEOA 3C2SA 4ODXB 4LL4A 1DDHB 2FEDC 4NUGL 3NAAL 1OB1A 1PG7H 1Y43B 4GRLB 1NLRA 1RUD1 1PG7L 4XF0A 3MO1A 3T1FA 5CXPA 3UBXI 5AW3B 2VDRB 1MCOL 1T21A 1UXSA 2X1WL 3LZNA 4P23D 1UZZA 1DJZA 1VLXA 5F0MB 2ZX1A 5CLTA 2HLEB 5DJAB 5AOKA 1SVBA 4QKFA 4GQ9H 5AAMA 4OJDH 3WHXB 6PCYA 2WZ5A 5CFCA 1C5DB 2BYVE 1JV2A 1XAUA 3IETA 5LAPA 2Z69A 4OJAA 3HLAA 1C7SA 3VZKA 2A0LD 2FQEA 3AG2B 2ATAA 1H1IA 2XTJC 5FZLA 4PJBA 1MPAH 3WDXA 1MPAL 2DMHA 4AJ0A 1EH9A 2OUHA 4JCKA 4PDWA 1WA1X 2H2PC 4P46C 3WDJA 4ZMYA 1RHI1 3ARBA 2ZYRA 2ZZJA 3PTYA 3OWRA 1BIIA 1Z78A 1OSGA 4MHRA 5CHNB 1KXQA 3HIZA 4M7KH 1HOEA 2BS71 3I84A 4M7KL 3U0TA 3C3VA 1OAYH 3FCTA 5CBAB 3IJEB 1OAYL 1SJEB 3WV0A 1HQ4B 3II1A 3RGHA 4OF7A 1E4KA 1K5NB 3SY6A 1GGCH 1WV7T 3D6GA 3LSOB 5LBGA 5A2KH 5ADOH 2IQ9H 2DLFL 3RWIB 4N25A 3TVMD 5ADOL 2XUEA 4RIRB 4XJ8A 2QQPA 4JAAA 1ZNPA 1WAAA 3QEGH 3QZPA 3D09A 4J23A 5GRUH 5CEZH 3QEGL 3J27A 5GRUL 2VN5A 3RZCD 5CEZL 1XNAA 4LLWA 1CDUA 1GNZA 4Y1ZA 1X7SA 2CHNA 3T77B 4PVBA 2V73A 1CZ8H 4F7CA 3O4LE 3QFGA 2VUAA 1CZ8L 4LLFA 3VI4F 4FERA 1NBQA 4WTZG 4TN7A 1XGZA 4JDTH 4YSAA 3VKOA 4HKWA 2BW4A 4JDTL 4JN1L 1SMVA 3HE7B 4IKIA 1USZA 5LXVA 2IFRA 1PMJX 4NN5C 3TBSB 1NDGB 3C5ZD 5I1CL 2VDQH 4J2QA 3BZFA 1ODAA 4YE4H 2VDQL 3VFPA 5HHOD 4YE4L 2XKOA 2VTFA 4B0MB 4L4TD 1EUUA 1AY1H 2IGFH 2VLLB 3CCHA 3K2KA 1G87A 1AY1L 2IGFL 3CSYB 4JKPL 2X9YA 4MJ4A 4YDVB 1GYVA 3GSXB 2HBUA 3BU7A 3UTTB 2P1YA 2LR4A 3AKPA 4E27A 3CC5B 4E9XA 5CAYB 1J0ZA 4FQJH 4ANVA 3KWUA 4ZPTA 3SH5A 3D5OA 5J13C 3Q2WA 2WJ7A 1XF4B 2J8UF 5EFIA 1CBVH 3NRPA 1OD7A 4I48A 1CBVL 1N1VA 4OI4A 4DZ8A 2YGVA 3CZGA 3QO1A 2JWYA 1V6MA 3BP4B 3GKZA 5EMYA 5I82A 3UDWC 1L7IH 3OJDA 1L7IL 4GSRA 1K3IA 3HW7A 2ZKWA 3J7NA 3OL2A 1TJGL 3II3A 4PJ8C 1FNFA 5GSRB 1FAIH 5C0AE 1FAIL 1X82A 1TSRA 3RZWA 3MRFB 4NB7A 5AOMA 3PGDB 3KMHA 1T7WA 1W0VA 4PSPA 3ZMNA 4Z0XB 4RGND 4PW3A 2V7HB 1TVBA 2CWSA 4FPKA 1DSYA 1X44A 3DPBA 3JBG3 1OGAA 4X4XA 2WPGA 4OZ4A 5HHNA 4X5XA 3O14A 4X8NA 4YBLC 1I3GL 1BEV3 1EZSA 2YD9A 3TWCL 3VXTA 4LBMA 1HT6A 2NMNA 3OC8A 1RUD3 4RMUA 3QXUA 3O4LB 3ZZ1A 2VUYA 2ICEB 2WKGA 1GSKA 3IKCA 3KM1A 4PI2A 3THML 4AGQA 2IMMA 2IV9A 1OH3A 5I8SA 3P11H 4WJ5A 2VYRE 3PABB 1H2MA 3UYOD 3GSQB 5BV6A 3ROOB 2VAJA 4JDVB 5KYXA 2DRUA 1TJIH 4BSWB 1TJIL 3UTOA 4ELMA 1FI8C 2DWXA 3BE1H 4MZIA 3VXNB 1W0YT 4JHUA 3BE1L 1BQUA 3I6SA 4Y4FC 1H8OA 3MRHA 4QXTB 2WY3B 1HDMB 2EDRA 2HRPL 4KMTH 1P84J 2D4DA 2PWHA 5KC6A 2RTTA 4BBWA 4LLMA 5KJ4A 4R4ND 4Y88A 2Z93A 1TCRA 2KM2A 1JDAA 2XVLA 3PL6C 4QRTB 3TFKD 2NY1B 2ARWA 2ZJCA 4P2AA 2P7TB 2RALA 3H55A 1VBA2 3VFNA 1UYZA 1KYOJ 1EEUA 1TUPA 1V6LA 3PV6B 2A3TA 2NW2A 1LO4L 3MV8D 5GZOD 3D2UA 4Y2OB 5C3QA 1N6QH 1YLLA 5C0FB 5TFSL 1T7YA 3KL0A 4MNQD 5E6IA 2BZDA 1N6QL 3WP6A 3WX5A 2C3VA 3ZYGA 3QUZA 5T3NA 1T1ZA 5BNNB 2MTPA 4GFTB 1UB6A 2ZHKA 2Y3AA 1FRGH 3FPYA 1REFA 5F7DB 1FRGL 2BW5A 5ICYA 1BXUA 3W58A 5D8JH 3DJZA 3VG9B 3HAGA 1BZ7A 5C1MB 3R1GL 5GPRA 3LN4B 1HWGB 4X5RA 2WNVA 1SMAA 1L6ZA 3QZWB 2EH7H 5F96H 2NSMA 4ZAKC 1AI1H 5AB0A 1JYVA 1AI1L 1KGWA 4R0LA 2CRYA 2H32B 2PW1B 5A6LA 1H6YA 4Y1XA 2OYLA 1T7XA 1T89A 3WKNA 4EUPB 5B39A 5IVEA 1C08B 1A6UL 2V5MA 2JIXD 3ELQA 3F01A 1C4RA 3L2HA 1UUNA 2AANA 4YR6A 5BV7C 1IM3B 3BZEA 4GS7B 3TBCA 1UB5A 1KTRL 2CRMA 1SLVA 3VI4E 2WIIA 4TM9A 4DXSA 1OANA 1QHQA 2ZWKA 5IMKA 4Q9CA 1F4YH 2ICES 4M93B 1F4YL 1PYWA 1W39A 3ZL4H 1SN5A 5I6MA 3RVUD 1OT5A 3ZL4L 3DHPA 1J58A 4Q0PA 1L5GB 1R6VA 4B4PA 4MJIA 1YI7A 3HMWH 3B2XA 3HMWL 4YPGA 1U12A 3LV3B 4WWKD 3KPMB 4BZ1H 4LOTA 3MTXA 2BX5A 4BZ1L 1BAWA 3VBRA 1BXAA 2ZSWA 3LKOB 5I1HH 5ETUB 5I1HL 4JPSA 4YHYC 3ARSA 1KQRA 2PXYC 5ACA3 4AH2B 1UOJA 1QRNA 4PLKC 1WLHA 4HWUA 3TA3B 3FHEA 4LSUL 5KG9A 1GZCA 1O8SA 4HZ1A 2J8UE 4UDUB 1A6VL 1E3FA 4NQCD 3RWJA 1P1ZB 3TJHD 1GKBA 1OF3A 1CVRA 5FK8A 4AQAA 3A4AA 4NO0A 5E4AA 3DUHA 1UU5A 4JM2B 2IXLA 5DUVA 1UH2A 2BNQE 5D2LF 1L9QA 1L0QA 3DUSB 3NN8A 3B9KD 4XHJD 2DY2A 2A6IB 4MSVA 3KV4A 3RA7H 1UTDA 4EQVA 2FDFA 2VJ0A 4IXLA 1K5MA 3O7OA 1LESA 3II2A 4N24A 2Y0SA 3P2BA 4MS8D 1QJZA 3PJQA 4MCZA 3RWHA 3C2UA 1FNHA 2VMIA 1HEZA 4L8BB 4XVSH 4MA8L 5KJ7E 2HBTA 3NQIA 3GSRB 3U25A 3GINA 3VWKC 3KPRA 5GS2D 4U3HA 2BU9A 4S0HA 1AJOA 1BBT3 4ZW8A 3K77A 3ME0A 4KY2A 1OT1A 2VOKA 1KYDA 5F7BA 2Y6SD 3VQ2C 1OALA 1QJFA 5AZUA 3LZPA 1XNBA 5I1LA 1DO6A 1MLCA 5J57B 1DBJL 4GJTB 5FCUH 2NR6C 3PJSA 2PXJA 5FCUL 4U6YA 2R062 3NV2A 4JJOA 3VI4B 1OP4A 3WNPA 3D33A 1PNCA 2VL5A 2QR0B 3EBHA 4AM0Q 1S4CA 1QI5A 2NNRA 4HAGA 4EOWH 1H9WA 3UGXA 4EOWL 4Q89A 3VA6A 1UFGA 3EUUA 4JRWA 1FZMA 3S5LG 1NQDA 1DLHA 2WXQA 2YBRB 5B8CC 1XDTT 3V8OA 3QYMA 3H53A 5HI4D 5BV7H 3MBWA 5BV7L 3LDKA 1S2KA 2X7LA 3NIFB 3J26N 3FO0H 4RNRA 4XPTH 4BZ4A 1X9UA 4XPTL 4FFIA 5IB2B 3P5BA 1IBBA 1ED3A 1JZIA 5GS1C 1HESA 5LNGA 1WBZB 2CU9A 2UUDH 4ZO6A 2J8UB 3FO2A 1BZDA 1DSFH 3EFOA 4HS3B 1BQSA 1AZDA 3H6JA 1F6LL 1BXHA 4HFUH 2LU3A 3O6MH 5DK2A 4FRWA 3O6ML 5ICXB 1VF5C 4QXWA 1QYGL 3AXLA 3BGMA 3LEXB 5MEOA 3F04A 1N7MH 4IYKA 5DD6A 4P3WA 3MXVH 4LDCA 1YLBB 1SHSA 2W0KA 3PHOA 2I32A 1U95A 3QAZC 5CLYA 1EV12 1HRV1 2JD9A 4HJ0C 3UT0A 5LEJA 5EDXA 2W65A 3C60A 4XAKE 1I3VA 2EDMA 1G7PB 2B39A 2J3SA 4XVUD 4ZUVB 1QJY2 2K6ZA 4MGKE 1QVOB 3VYNA 1W0NA 5I0SA 2W91A 4ENEC 5JLZA 3KMDA 4N1HB 2NY7H 4UI9L 1LNUB 1TTAA 4PWIA 3R05A 1A3ZA 1Y6KR 4PJDF 4QPGA 3ZSJA 4IKJA 4MYEA 1UA6H 1G9CA 4XCCL 1UA6L 2G0KA 4GIAA 1ZLVK 3TZVD 4M61B 1FNGB 3IN9A 1RLWA 3MICA 3U75A 2F9BT 3CH8A 4R7DB 4PJ6A 3B9DA 4YHZH 2DEXX 4YHZL 2AK4A 4M5YL 1MVEA 3L3HA 2RH0A 5FF6A 2V3FA 1LP9A 2JF1A 1BCIA 3ARGC 1SFNA 2PFWA 4KI5D 2VUJA 2WBWB 4HCRH 2H6OA 2MCAA 1AD0B 1QFUL 4WKZB 3CIHA 4QY8B 4CXYA 4JQIA 1DYKA 1KIRB 3CFEA 3VM5A 3S9DB 3IGAB 3MRGB 4CDQA 1LWJA 5IBUB 1E2ZA 1I8AA 1UM6H 2IPKA 2NTFB 3HZVA 1VIWA 1AR73 3IJYB 4Z7OE 1E3XA 3HUJF 3CFTA 3H3PH 1FPTL 3LKNB 2FQDA 4YJZL 2X4SA 3JXAA 2X05A 3MNZB 4KU1A 2X2IA 4X6CE 2GUYA 5DJ0B 5DG1A 3UADA 2V6HA 1KB5B 4UQ2B 5IROA 3W37A 5JO5B 3HZYA 2VLRE 1QPXA 1QSFE 3EXUA 2RJ2A 1LO5B 4NNPH 3CH1B 2BC4A 4NNPL 1P9MA 4TSBH 5IK3A 4I1PA 1XRUA 4Z82A 4BKTC 4TSBL 5BNOB 3K6NA 3WE6A 2E74C 3RWKX 4R6UA 5IMOB 3PYCA 4RL7A 1XU2A 4ZW6A 2FBRA 2TRHA 1SOKA 1SJXA 1TPXC 5SV5A 4F7TA 2WWJA 2R2BA 4NRXA 4G8GE 4B3VA 5GXBB 4PYGA 3USUA 5FYJD 2EYTB 5EPAA 4U6TA 3P02A 2A6DA 5D2LE 1T1YA 5KBKA 3U4EB 4E9QA 3FU5A 4AHYA 2GJ6D 2JDAA 4IE6A 2VNCA 4CRPA 5D8AA 3NMEA 4TLTA 3UGEA 5FPBA 4XAWH 3QUXB 3POGA 2N0MA 3F7VA 1WWWX 4XAWL 1O5LA 5DA4A 1HB1A 2YMZA 4JVUA 3Q9OA 3R4SA 3SLIA 4YPJA 4B95C 4JFYB 3H8RA 4D3CH 1Z7S3 1FN4A 2X12A 5J1TC 3IFNH 1MVUA 5E23A 1I7ZB 3GSOA 1ZA3B 3U4KA 2QPEB 4XMLH 5MEPA 5HVHC 1GGBH 2F54D 1SF3A 3MAWA 4OM1H 4DOHE 1GGBL 2CUAA 4YW3A 4OM1L 4O2CA 3NYKA 4H2CA 4R9HA 1Z66A 4YBHA 3WIHA 2HJFA 1QJX3 4QNPF 2BHFA 3TCLB 4QM8A 4GRWE 5C86A 1R093 4Z7OB 4H25A 3OLDA 2J57A 4JL2A 4FJ6A 1KEXA 4HISA 3RVTC 3HNBM 1P84K 3TX4A 5I6LA 4NO5B 4X6CB 2JVUA 1YMMD 1CPMA 4MXWH 2XT1B 1M6UA 3KVQA 4MXWL 3I2OA 3BTZA 5KS9A 2VLJD 2VLRB 1FATA 4OLEA 3U4BH 3CL1A 1QSFB 5C9AB 4BCZA 3U4BL 2A9NL 4AYDC 1ZHNB 4LKCA 5I6KA 2OJ1A 5GGRA 3HAEH 1OP5K 2DLHA 4JHVA 5DMKB 4AGMA 2BJMH 4GW1A 2DN7A 5INCA 1YYNA 2BJML 1JXDA 3EHBD 4LSDA 1I1FA 2J1ZA 2V37A 3OKMB 3RQ0A 1VDGA 1VZHA 3WE1A 4G8GB 1UVQB 1PVXA 4IDZA 1F4WH 4L0PA 4QWWD 4PLJD 1F4WL 2IBZX 4BDVA 3M3QA 2Y7QB 1F3JB 2X87A 1Q4NX 5D2LB 1QOOA 3FSAA 2TEPA 4QXVA 3NL1A 2P8MA 1AGBB 1JTPA 4X8GA 4UOW1 5C7ZA 2C9RA 2J1YA 4O2FB 2VM4A 3P4OA 2FHRA 4ZMWA 4Y22A 1A3LL 3WJMB 3B7TA 4LIQE 3RNQA 4MNGE 2VITB 3HE6A 3AC0A 5AOZA 4MGIE 3LRHA 2X09A 4KX9A 2AI0H 2Z31C 5KAQF 4XB3A 2AI0L 2G5UA 3U10A 2DQUH 1Q9OA 4JFOA 2DQUL 3P4MB 4LOVA 3V6OE 2OV0A 4OHYA 4MGSA 1K42A 1MWAA 4BXVA 4FS0A 2AKRB 4PJDE 4WO4D 3MROA 3IFOB 4PCKA 3ESOA 4MJJA 5LWBA 4DOHB 3LDRA 4HZAA 2IALB 3GYRA 4FOWA 5L0QC 2XI9A 2EEBA 3BPOB 2P24B 3L7FA 4M8QB 4FQZA 3ZDYE 5DG2A 4WUUE 2I25N 5D7JC 1GYCA 4GRWB 4YDZA 2FDKA 2OMXB 3BIAX 1KXTB 3V4PB 3HJRA 5KBDA 5LBBA 1HI6B 3ZSLA 1QSED 1W8HA 4KJWD 1JZDC 3POHA 3ETTA 3W9EA 3ECWA 1AMYA 4RAUB 3ZTEA 4ZFOL 2ADYA 3VFTA 1TSHA 4TUJB 5T33H 1OLMA 5DHXB 5T33L 4E41B 4ZT1A 4M5ZH 3IIAA 1YDPA 2VQ1B 4COVA 4L3FA 3MRRA 3WJJA 2K78A 1ZZ8A 1HVXA 4P9GA 1CCZA 5FUNA 4WW2C 4A4AA 2UXTA 3T4AB 1C5CH 4N22A 1Q0XH 1O6SB 1C5CL 5JSPA 4U1LA 4ZY9A 1N3OA 4UFKA 2QMKA 4WDIA 1SEBB 2UV3A 4OGYH 1SHWA 3BXNB 4YAQB 3V4VH 3BUIA 2YA2A 1BEV2 3V4VL 4GT7A 1C1LA 2EC9U 3SD5A 3GMLB 2WR9A 5KANI 3NQKA 3AS0A 3TA4D 4GRLC 1R64A 2QQIA 5GZEA 1U5XA 4DP0X 1NJ9B 2W0LA 4XABA 3MJ9H 1NUFA 3MA7A 2C5DC 3VXRA 2XA8L 4UQIM 3S4SB 4TZDA 3H9ZA 3WEXA 1WRFA 3DETC 3TF7C 2H8PB 4MNGB 1ZWIA 3BLKA 3ULUF 3ZXFA 4DTGH 1ODNA 5I19L 4P99A 4DTGL 1FLRH 3K8MA 1FLRL 3SGJC 5DAWA 2Q76A 3GIZL 2XJKA 3RWGB 3HPLA 4CYDA 1YY8B 4AQ8C 3GB7A 2VUCA 5A6XA 1A1NA 2EXYC 4PJDB 1WUVA 3RGBA 4JDEA 1KTCA 5BZWB 4L5FH 5JORA 3RI8A 3OMIB 4PEEA 4L5FL 3OAUH 4D6SA 1X5HA 1OZTG 3OAUL 3ZDYB 1P6AB 4WUUB 3OGJA 4FTBA 1K8IA 2PO6A 2YXVA 4ZTOH 1NCBL 3FTGA 1M71B 4L29A 5D93B 4ZTOL 1CJPA 2XMLA 1H4HA 4LBKA 3F12A 4GUOA 3L4ZA 4BUHA 5E16A 3V6ZB 4AEIH 4G42B 4E4HA 4D9RD 4AEIL 2FGWH 3KLHD 2OTWB 2FGWL 3EG9A 5DEFA 3ZK0A 4FQXC 4ZNEA 4QNPE 3ZM8A 4Y1AA 3AADB 2VISA 4CDXA 2AMGA 1LWHA 1LD9A 1ZY9A 3FFDA 4HKZA 4JAMA 2RFXA 1F2NA 2EAEA 5DHVB 2X6UA 4P2QE 4RSUA 3ON7A 5K39B 2BJSA 3H3LA 3NP3A 4TUOB 1JNLH 4HBQA 3MLRH 4H8QA 3CDGB 4OB5H 4MHHG 4X5WA 1UHVA 4OB5L 4P2RE 3QH7A 5FIXA 2BP5M 3E0GA 2PYED 2X9ZA 4R3SA 2EH8L 4QX8A 4BQWA 4FQLL 1O4YA 4TRPH 1CFMA 4DXTA 4TRPL 1WZ1H 1CAUA 4DKAA 3T0XA 1WZ1L 4KG0A 2QKIA 1V55B 4ZD3H 5DXDA 4HVOA 1FG2B 4JE4B 1NX9A 3CFJB 5ECJE 1HXYA 1UO9A 2VZTA 2XJRA 5EYXA 5HHVL 3QJQB 4KNQA 4Z92B 4NZUH 1SBDA 4AL8H 4NZUL 1A3RH 3T2LA 4AL8L 2VDOB 3D50A 2D7OA 3ZKNC 1QBLL 1UASA 4X0KB 4ZTPH 3CG8A 3JVFC 4ZTPL 5JXGA 3SE4C 2Q8EA 2VDRH 4F3FA 4N43B 2HB0A 2VDRL 4HK0A 2HTKC 4OFYD 5C6WH 1PIV2 3K75B 4R52A 4LE8A 3ZSKA 3B01A 1NC4A 1OL0A 2DW5A 3HQXA 4EJRA 4ALAC 4GXVH 3B02A 3ZXGA 4GXVL 4KJPC 3SBQA 2DWEB 4ODVH 2FR4A 5BO0D 4IQHA 5I8EB 4PRIE 1OSPH 1OSPL 5E6UB 5ACA2 4F37K 4F93B 2Q3AA 2YD8A 4JR9H 3STLA 2VTXA 4Q6IA 1AXZA 3ATFA 2ESVA 1A6TA 1ZKAA 1NIAA 1NKRA 3TIDA 2XN9E 2YN3A 3SCMB 4HMEA 3VG0L 1W6OB 1N59A 3S5AA 2CSPA 5KBMA 4G8FA 3MO4A 3SE3C 4Q14A 2GW5A 4YXKH 3HEIB 4P2QB 4KKNA 4ANWA 4YXKL 5FYTA 1LQBC 1T0NA 3WFCH 5A7EA 2AQNA 2HZHA 4RDQF 3WFCL 1NG0A 1BQHB 1UY0A 4TYSA 5L4MA 1KIQB 1NAMB 3C5JA 3I75A 1LEDA 4NM4L 4L4VA 2R59A 4PV9A 2PTMA 5L19A 4N68A 5DA0B 1S9VB 3K3QA 4RR3A 4OI7A 4GH4A 1BX2B 2F4LA 5HCBA 4A1RA 5KBLA 3BSGA 2DTWA 3DBXA 5A6YA 5DDJ1 2P8LB 1F35A 4AI1A 4JJ5A 5ID1B 1IKFL 3D51A 4OV6F 4P23B 1NPUA 5CP7B 5IBLC 2LLLA 3AW5A 4A7VA 2ALAA 3ZVXA 2WUBL 3CFMA 2RD0A 4RS5A 5DI8B 5BUAA 1LEIB 1SXNA 2VIRA 3RDTD 5HP5A 2O5NA 1PPIA 3WD5A 2DQHL 5L9RA 2YPVH 4BKLB 1OT2A 4DO5A 4JN2B 2XLAA 2RCSH 2APVA 4I13B 2JCCA 2LGNA 1KELH 2NY1C 1E6OH 3FB6B 3S3JA 5CU5A 3UCQA 1F9KA 5C0JA 4ZS7H 3AJ7A 4PRDB 4HWBH 1CLZL 2CKBA 4JG5A 4OLUH 4HWBL 2YYOA 3F95A 4OLUL 3DJRA 2Q86A 1G9NL 3CPLA 4HX1A 4HKOA 3HS0C 1XYNA 2DQFB 4UIMA 4Q6KA 4YM2A 1GPOL 1LEKB 2OTPA 3N0AA 3VFMB 5DSCB 3A67H 4NPLA 4DIQA 4CW1A 5KYUB 3A67L 4PRIB 2AHIA 4PJCF 1TYJA 1WLTA 3KDPB 3DVGB 1WS7A 4J25A 2CLVB 2VLMD 2WSKA 4DPAX 4JFSA 5F89A 1T80A 2CQVA 1T03H 1ZYBA 2D7MA 1T03L 3IDUA 5JPNA 4PJFF 4NQXB 2Y07H 3P0VH 2Y07L 4RGNE 1TZ8A 4JVPA 1BFOA 4LLVB 1EEZA 1FFRA 1KXGA 5C09D 3VG9C 4ALAH 2O61A 3NJZA 3TVMB 2Z0BA 1SN0A 1OF0A 4CNIA 4KK5D 1CAXB 1MAMH 4LF3B 2JG9A 5I1GH 4XRCB 1MAML 4DHLA 2A9MH 4M4RA 5I1GL 3HKFA 3RZCB 3QIUA 2A9ML 4AITA 2QQMA 2AJVH 4KKBD 4PP1D 5IHZB 2DFCA 2AJVL 1EZVY 1KIUA 1NKOA 2I24N 1YY9C 3J07A 1S1AA 2XJVA 1WCDJ 1GJWA 1QATA 1UT9A 4RX4D 4KHTL 1Z9SB 1T20B 1BD2D 3O8XA 4QTHB 3QS2A 3IDNB 2WFF3 3PTRB 2XPGA 1K12A 2DUPA 1Q5OA 1HZKA 4NC1E 4GOSA 1MCDA 1ZVNA 2AV1A 4DIXA 5FCSH 1NDMA 5FDWA 1ZLDA 1RJLB 4OU3A 5HHOB 2F6AA 2OZJA 2UYBA 1JK8A 1UD8A 4RAVA 4ZBJA 4EZMA 2JB5H 2JB5L 1A1MB 1CWPA 4IV1C 2AITA 1JOIA 3VSVA 5IWLA 2R69A 3WCYA 1RZQA 4QOKD 1BQKA 1EO7A 1HAWA 5EEYA 4Y2NA 2VZVA 4OZHA 2OZ6A 1MFCH 4N9GA 4GYBA 1JXNA 1MFCL 1WVZA 3NUKA 4HUNB 2I74A 3RIAK 4M3CA 2JFCA 3MV8E 4XHQA 2QQVA 1WCBA 2BGCA 1Q8SA 3AQDA 4O51B 5KYWB 1Y07A 1UWXH 2CCVA 2VE6A 2Y6LA 3AZWA 1K8DB 1DEEA 1PY0A 1J18A 2YAOA 3QNYA 2A6YA 3Q7JA 1ACYH 2JJWA 1ACYL 5I1DA 4UAOB 1LTEA 3IAPA 3PWPE 1S5HA 2KZBA 2KPNA 4LCCC 4FQHA 2X4NB 4RGNB 3ROLA 4DZBB 1MCFA 3VKMA 1Q9LA 2IOIA 4WK0B 5BJTA 3WNOA 2ATPB 5B7EA 3DPRB 3PAZA 2YGLA 1T83C 3SGEI 3PGCA 3V2AR 2V0AA 4RGOH 3OGGA 1XZ0B 1R5IA 4RGOL 1XE0A 4A6SA 4TQ8A 4F7MB 3VU2A 3GMMB 5AOIA 3VBUB 5JDSA 4HAFA 5GJSL 1IL1A 4O02B 5FLJA 4CCEA 1JH5A 1RC6A 2NPLX 2HEVF 5FPZA 3RDIA 2BSTA 4JW3A 2R1YB 1AXSA 1ZT4B 4HWEH 1QF3A 4HWEL 5JR1H 1B0RA 1DBML 2BY2A 3DROB 4H1LG 1MJ7H 5K59F 1QR1A 5E2JA 2XU9A 3HAEG 5IF0B 1HLCA 3ME2A 3U2SA 3E1ZA 3FFCA 3QQ4A 3LEVH 1XSOA 3K51A 2H32H 1G43A 3LEVL 2AZ5A 4E2GA 4EUPH 1O6UA 3C8DA 2OXBA 2JIGA 3FU3A 3HMXH 4PJXF 5HV0A 5JHBA 3FZ3A 2XWEA 1FGVL 2V2XA 3WS6C 1DVTA 4TQIA 1GYWA 3MIGA 3MLLA 5C08A 5AW1B 3D87B 2JTYA 3SGKA 5C92A 2R6QA 4KBBA 5JOFA 3FSVA 3BEVB 5EP9A 1VPHA 4ADGA 1IC7H 2X3AA 4YZ5A 1ETA1 4NYLA 2L4OA 4LNRB 5HBBA 3BN3B 3L3GB 3QHFH 4UNVA 2ZCLL 2EDLA 3MV8B 3QW9A 3MC0A 3QHFL 3IDGB 4MMYB 5ICZA 3KV6A 1NC2B 5BUVA 3WW1A 4U1IA 5AW5B 1HIXA 2R043 1NWOA 3GGWA 3U46A 1RZJL 4D0DB 5J1AB 2V3EA 4LHQB 4WI8A 1VFBA 5CEYA 2AREA 3NRUA 4UW3A 1LNSA 1P53A 1RVFH 3PWPB 5F3GA 1ZA6B 4Y19D 2D5FA 4B4RA 2JJSA 5LGJA 3DYOA 3CFBB 4DN4H 2V4LA 4CKQA 3JD72 4DN4L 3ARBD 4I0PA 4PJCE 4Q58C 2HFFA 2W2IA 2H0JA 1E2WA 4ATFA 3QULA 1JRHH 1IFGA 1JRHL 1PX4A 5DUXA 3NZHH 1ZBE2 2PHFA 4L0YA 3NZHL 4PJFE 1VBA1 3N9PA 2IGLA 1ETZB 3LDBB 4A42A 1UQSB 3HJ0A 2P4EA 1WUZA 2Y6JA 2HWE3 4META 2ERJC 4P5RA 1PK6B 5TH2A 1CE6B 3VH8G 5FGSA 2WNUA 3WVJA 2IAMA 2KS0A 2DQGH 5E7BA 5L6YH 3W5NA 4LKSA 4NENB 4OCXH 2JIXB 3MGTA 1I7UB 4JFEE 5IFHH 4MB3A 3RPIA 1KTDB 4EMZA 5IFHL 4Q9QH 2A6XA 5DUMH 5IJKC 1OK0A 4XWOD 3PUUA 1UXXX 1VBE2 4XURA 5CKQA 4KI1A 3ACHA 1EBPA 3HQRA 5ALCH 2NY0B 3AU0A 2YEVB 3Q6FA 5ALCL 4AUUA 3WL9B 2IADB 3GHNA 1VB9A 5A3NA 1ZPUA 3NVCA 3U6XS 2APXA 3PWUB 3LA3A 1CXFA 2RG4A 3GHBH 4FA8A 4Y4HC 5D4QA 1F3DJ 1ULVA 1BFTA 3FT2A 3GHBL 4X80H 2Y69B 4G8EB 4X80L 2CDGB 4WWKB 5T5FH 3BAEH 3ZKMD 3ARYA 3BAEL 2Z7WA 5ABDE 1QFWL 4HSJA 5F2SA 2X4TA 1JXJA 3OB0H 2KMWA 2X42A 3SZKC 3FB8B 2K6YA 4XUOA 4YHNA 4NQCB 2TBVA 5B1CA 5K9OB 1E28B 1RZIB 5C2BL 1AYRA 2D4FA 3SJVA 5HDQH 4CL7A 3WSOA 1J05A 1AG6A 1EEYA 3L5WA 3W38A 1AJKA 1DQ6A 1LHWA 4WHTA 3B9KB 4QJ4B 5DVOA 1SPDA 1FL5A 2HKFH 1SYSA 3TPUA 3STBA 1TZIB 2HKFL 3GSWA 4R9CA 4PJCB 1WYJA 4F27A 5C3LD 5FB8A 4JM0A 3BWSA 2Q0ZX 2QQOA 2W88A 3T8VA 4UNUA 2Q7NA 4MGYE 2ZXQA 4G9FA 4NBYB 4PJFB 3QA3A 5E89A 1VFUA 4PJGF 3D39E 4U6VL 4OI8A 3ZTDC 1QW8A 4CUAA 1QHPA 2WD0A 3QUYA 3QUXC 4MX7B 5HYJA 3AUVA 3ESUF 3FQUA 1V7ML 5AVRB 2L8AA 1GBGA 5E5MA 2W08A 1WTLA 1N3PA 2X40A 5HDOA 3S37X 1JHTB 1TCMA 1KBWA 4ATTA 3UAFA 5IUQA 2ETEA 5JNYA 1VRSA 3RMYA 4DKEH 4PYHA 1IO4C 3SPCA 2CH8A 2J2ZA 3DOSA 3LH2H 5CZXD 4WCYH 4H14A 4G1EA 3DXUA 4LPYA 4A6YL 1EAH3 2XWDA 3LKQB 1WIUA 1ZBA2 4HEMA 3APDA 1DQLH 1RVF3 3TOJA 5A70A 1DQLL 1MCLA 1VADA 1AFVH 3OAZK 3AYDA 2BTVC 1AFVL 3DA0A 1W2KT 1OTSC 4U1HB 1DHKA 1HYSD 2CGYA 2YR3A 1KGJA 3CZFB 4Y16C 5IVZB 3U82B 4HV8A 2JDHA 4FFZH 4PJXE 2CTVA 4FFZL 2MNGA 1P1VA 1CICA 3MRIA 3I2FA 5CJOH 5LN4A 3DV4A 3WF2A 5CJOL 1HSBA 3D0AA 2O14A 2GNMA 4UUJB 1AZBA 5IVYA 2E5EA 3GJFB 1A34A 1XSJA 4HUKB 4LHJB 3TU6A 5I2IB 5FYUA 2RDNA 3ACFA 1FXZA 1JWMB 3DIFA 4F37F 1I9RH 1SDDA 1CFNB 5HJ3A 5HI5D 5FUIA 3X12B 4Y4KB 2AXFB 1KB5H 3P4NA 4BGDA 5LW9A 4LKEA 1KB5L 3BH8B 1J3RA 3MR9B 1UD1A 3FUOA 3EFDH 3EFDL 2XACC 1H3PH 2YKKA 1SQ2N 1CR9H 3B37A 2BDNH 1H3PL 2W0PA 3MV01 1CR9L 2GJ6E 2BDNL 5CZRA 5EU6A 5LB1A 1TYEB 3SC7X 1FWXA 2DL2A 1MCSA 3K8LA 2ED8A 3IPVB 2WIMA 1HK6A 4YZ1A 1XCQB 2WLLA 5AFBA 2Q2EB 2GNTA 4R5XA 4P14A 4KDWA 5H4ZA 4Z23A 2WB7A 2OTUB 3BP6B 3NGBB 1U3YA 2A6KB 5CLZA 2ZMKA 3K2OA 4JREC 4HAKA 5DZVA 3D3AA 3A4DA 4CC1A 2D93A 3IJSB 4DERA 3TNNB 2MNJB 2EA7A 2F54E 5APAA 2BCKB 4IEYA 5JR7B 2YPJA 3PURA 3ARFB 4DZGA 3LKSA 5HDBF 1W9WA 1WH0A 3QEQA 4YVSC 3PXLA 4PJXB 1HEJC 4KNSA 4W9LC 2DDQL 1YMME 4QXUH 2LTQC 1EAOA 2BP0A 2OMTA 4QXUL 1W6PB 3P6BA 2NDFA 4AEHH 5KJRH 3LXCA 3V7AG 2VLJE 4AEHL 5KJRL 3E6BA 3SDDB 5I18H 2GSGA 4X7TA 5D2NB 1KFUL 5I18L 3U0ZA 3UAJA 1ZHKB 2X4PA 4MJID 1I7RB 4FC3E 2BNUB 5IFAL 3RBSA 1AR63 3VM7A 4S2FA 4HWZB 3N4MA 3GBGA 4LKFA 1MJJA 3TYFA 3VGDA 2XWRA 3NK4A 1YRZA 2F68X 4Q4Y3 4XBNA 5F9WC 2JEMA 1JMXA 2NSQA 3QJTB 1LAJA 2WP3O 2Q1FA 3W0WD 3NVQA 1U8QA 5BVJA 5KN5A 3N40F 2Y38A 3FT1A 5ABJC 3WGUB 3QFDB 4D0CB 1WZKA 3MCKB 5IJCC 3T6QC 4XIKA 2E75C 4M1DH 1AGDB 3I2CH 4NO0D 3B2DC 1DF0A 1UL9A 2IIJA 2GJ6B 3I2CL 1ECZA 4JFXB 4P3DB 2D6MA 5DUUA 1H3UA 3MGUA 4FI9A 2UY7B 1BLNB 1SG3A 1FO0A 2HWF2 2YV8A 1YJLA 3P3YA 3CFQA 4YVNA 2VWEE 4EN3A 1G5GA 1HFUA 2B9AA 4H0LC 1G9ML 4WI2A 5T1DH 3HFFA 5T1DL 3N43B 4PJGE 4MVBD 3MA9H 3V6OC 3WTTA 3MA9L 1O59A 2W92A 2C9PA 4MADA 2ZSVA 3ILPA 4BH8B 2CZNA 1UH3A 1XGRB 4YX2H 1YHFA 3POJA 4HMZA 2V5RA 3DX4A 4YX2L 1UWFA 1WISA 2OYKA 2AQRA 3WTWA 2F54B 1JWSA 4J4PA 3BGFB 4W4NA 1BP3B 4AQ1C 4DGYL 1AXIB 3H9HA 4Q4X3 1OWWA 4N8UA 5J98B 5GS3A 1P4LB 1MNNA 4GG8A 4YDMA 1DLFL 2QSQA 3GXDA 1IAKB 4QRBA 2QQJA 3LZQA 2HRLA 1J1PH 3L3IA 1J1PL 3F7YA 1YMMB 4N1EA 4GAJL 4HPOH 4F8NA 4HPOL 1ZVHA 3FU7A 2DM4A 2VLJB 4G59C 4XOAA 2JE8A 1WA0X 3QJSB 5FZGA 5GRXG 4AJVA 4P57B 3RIAF 1MLBB 1GZQB 1IGYA 3D08A 4GRWH 5AKSA 5E5RB 1MCJA 4PJEF 1ML0A 4K3EH 4KRPC 4O5LH 2GUOA 4PTTA 2JK5B 4K3EL 3V4PL 3MJWA 4EN2A 2JG8A 1BOGB 4W4OA 3WP4A 4MRBA 3EHBB 1BZQK 3NSDA 2WQZC 2EYSB 1ET7A 4P46A 3PXJA 5TE7H 4FP8H 1ZDSA 3O3BA 5TE7L 1F3DH 1IBHA 1LQSR 4FP8L 3C7GA 4OQ8A 2BVPB 5DVPA 1IIIA 1OEZW 4XP6L 4OMDA 4XZUB 4WEBH 5FY9A 1FVDA 1HHHA 2V9QA 3WFZA 4WEBL 3ZYPA 4YSFA 3LS5L 4F1ZA 5FOBA 1S9XA 2ZWNA 4KMLB 1HHGB 1U6AH 1G0XA 4BZ2H 1PZ3A 3NSJA 1ZV2A 1U6AL 4CDGC 4IETA 4BCUA 2WZAA 3D25B 2OMYA 3NH7L 1XSIA 3SN6N 2ITCA 5D1QE 1NCRB 4LO7A 4PCRA 5C0IA 5KSUB 1QXJA 3KPOB 5A43C 1AR1C 1Q1JH 3BAJA 3O41B 2B7DT 1Q1JL 3ZGIA 4CE8A 3ZFEC 1MCNA 5EBLB 1FPN2 4FX5A 1XGQA 4MQXC 5AUMB 1AHMA 4NRQA 3VSUA 2XIDA 2ZKHL 4WO4B 2VRAA 3PHQA 1V0AA 1TNRA 4LIQH 4PVMA 2D73A 3N50A 2JXMA 3RL2A 1Q90A 4MBOA 2ZKMX 4ODBD 4Y9FA 3LVEA 3ZT7A 1AIFA 4G80A 2HWB3 2N59A 1XGPB 3WFEH 4QHMA 1RUF3 4XF1A 5TGBA 1D9KB 4ZOAA 4S1DC 5FYLD 4D9RE 1INDH 1N2RB 1WEJH 1INDL 3VFGH 3VFGL 2FH8A 1IKQA 1S0DA 3GMOB 3PVEA 2FLBT 5HDBE 1UH4A 4MV2A 1CT8A 1X5KA 2A73B 2WLIA 1PO23 1EEQA 1T0PB 1ASOA 2P44B 4C56E 1F86A 2H3KA 4R9AA 4XUQA 4FOYA 1RUOA 4GKOA 4PR5B 2FO8A 4UOQA 4AUJA 1S2EA 2AEWA 5F7WC 5DMGD 1KWGA 1OVSA 3TV3H 4Y20A 5F3EA 4NKIH 4POZC 3TN0A 2EEAA 2J1WA 4CCOA 1WWCA 3UDWA 4DH2A 2AJZA 4KUZL 4GEIA 5B4MD 2KD7A 1LVEA 2J1KA 2CM5A 2YG0A 4BYHA 4Q4V3 3B00A 3URFA 4AHXA 3IDCB 5LA1A 4PJ8A 4I89A 5DHVH 3MYJB 4XO3A 1S55A 2JX9A 2P6HA 3DURB 2WS93 3UJIH 3DXAA 5C0ND 3UJIL 4AVKA 3R06A 3RSJA 2R15A 1DJHA 2CJUH 1Y7VA 3CIQA 3JTSB 3NABH 3NABL 2CJUL 2R0WH 2GQHA 2UYLB 4PRNB 1OCZB 2R0WL 4YIQB 4KROD 2YGNA 3F58H 1CX4A 4FG2A 1R082 3F58L 3G6JA 1U58B 1CVNA 3OKLA 4TLFA 4UFLA 4AYID 3U7WL 4ZW3A 2EXJA 1FV3A 5LK7B 4LP8A 2CO6A 2CLZB 1GTNA 3QEUB 4L0ZA 4CCJA 2DYPD 2EVGA 4M48L 5BYNA 2NQ3A 4UYPA 2QDVA 2OSXA 4AL9A 1CFSB 1GL4B 1ND0B 4X6FB 2CDEA 1A4AA 1OPGH 1OPGL 2PCXA 5JR2A 4IS6B 2VDOH 4AIXA 2Z79A 4XN9A 4BEIA 2VDOL 5E51A 3WUWA 3EDFA 1DGLA 1ZLSH 1GZPA 1WF5A 4NP4H 3DO7B 1PIGA 4NP4L 1KGYE 4PJAE 1FVEB 5GGTA 1EK3A 2H5UA 1YAIA 3GZTB 2JDPA 4MASA 2WZPD 3ECBA 5C6CA 1G86A 3T0BA 4V33A 1TETL 3E5UA 4INDA 2ZUYA 3GZAA 4FI7A 1OFNA 5IAVA 3H7BB 1VGKB 4NPRA 1GC1C 1BM3H 4JK0D 2E56A 1EQWA 2GK0A 1BM3L 3O6FA 2VZ3A 2VERA 2Y36L 4LT5A 3AG4B 3QG6B 2WSVA 1ZHLB 3P77B 2V4AA 3BU0A 2AQ2A 4CVZA 3DECA 3ARED 4W9CC 4HOZA 2ZS6B 3AS2A 4W9EC 3W81A 3I2DA 2V5SA 3I2KA 3ES6B 3MNDA 5AAWA 3ETPA 4A3ZA 5CBLA 4DKTA 5FJHA 3FQRB 4NCDA 4XN2A 4X7CC 4ETQA 1NAMH 3UGGA 2ZACA 3BH9A 1NAML 3BEWA 4GAGH 4RFEB 3TJEH 1M2VB 2WCPA 4GAGL 5F70A 4EIGB 3VL9A 1DCSA 3EO0B 2P9RA 5LLIC 4MMXB 4M1CD 3P9LA 2H0FA 4KKPA 1AQDB 5I71B 2YEQA 1I4FB 3CN1A 1G8WA 4D7TA 3ULVF 3ULUC 1VMHA 4I0WB 4COZA 1H8TA 4F80A 3CZUA 1UEYA 5CISA 5D1ZA 5D96C 1UYXA 2IVIB 3I59A 4PJBF 1OCRB 5T3XD 4NHKA 1DANU 2CCWA 5E1AB 2XFXB 2EC8A 3BVNB 5CEHA 4MAZA 2OCJA 3OBZA 4GP4B 4PJAB 3OTTA 1U9KA 2VLME 5ANNA 3SB3A 5JOXA 4EZLA 3ZO0A 2RM23 2TNFA 3IB4A 3BPNC 3L9RA 4LCWE 2YXMA 1U8NA 3CDCA 4OHWA 2MNWA 2WYTA 2XFGB 1E7VA 1A7NH 2Y1ZA 4IBSA 5ECGA 1A7NL 2A74B 3HI6L 5IV2A 2IXKA 1S5IH 1ET8A 1XBDA 4TVUA 1S5IL 2G9ZA 1JIBA 3JSSA 1P4UA 4QRQB 5DS8A 5GGSA 3JXSA 2DPKA 4H0GA 5KYNA 4Y26A 1WBYB 3FCSB 5KOVC 5FFOC 4Z0BH 2A3XA 4QAMB 3VBUC 3VLBB 3VBSA 2PXYA 2EDOA 5CNHA 1W6NA 1TU2A 4QHNA 4OCTA 2RS11 3ZN5A 1W3VA 5LBSA 1T5KA 1BJQA 1MCHA 3EYUH 2BHUA 5I73C 5EEVA 3CJXA 4MCYA 5FECB 1UYPA 2C1FA 2A99A 3V79C 1UACH 1P7KB 2YAPA 5D70H 4AG4H 4B3NA 5D70L 4AG4L 4PBOA 3NCWA 4OFDA 4B96A 4ELDA 1QDCA 2PHXA 5DFTA 4PJ7A 4JZJB 1KD7A 4GIPD 1BVKA 4MWFA 1GOFA 4B41A 5F93C 2GTZB 3ZSMA 3P3TA 1W03A 4OVVA 3CSTA 3MRMB 1EP0A 3A5VA 4WW1B 4HIEA 3VXRD 2PPCA 3D5OF 4GINA 5HI3C 5FP3A 5FYVA 3TBYB 1CTNA 3FXIC 4J3BA 1CDBA 4W6YB 5F1IB 4AEDC 4XO8A 1OCWH 1W9FA 1NANH 1OCWL 1VPOH 3OKNB 2WHVA 3HN3A 3OF6A 4GKNA 4IU2A 3RNKA 2DQDH 2WW8A 2R4SL 5J6SA 2DQDL 2NR6A 4XT1C 1KS4A 2QQNA 1T2QL 3X1EA 5KSBA 3ASOB 4NQQA 2PLV2 3MLPA 2YIHA 3ZIWA 1EZVX 1PKQE 2RHPA 4H8VA 1ZGLB 5EBWB 4LCWB 5E2WH 4JQRA 4IMLB 1U8IA 3NZUA 4TN9A 5E2WL 3GRWA 4BM7A 4LEJA 1X5GA 1QWRA 3X29B 1C5BL 1KJVB 5B8CA 1GIGH 3D0LB 5C09B 4LHUA 1DBNA 1YI9A 2PTTB 3T4YA 2E26A 3LB6D 3WG1A 4D69A 1FNLA 4KPHH 3ZR5A 3M2MA 5JMOC 3ZYZA 5TDNA 1FVCA 2APSA 1F42A 4HZFA 4UYQA 3LNFA 4B9CA 4AF9A 2EXTA 2V2WA 1PK6C 2X5IC 4PLOA 1B0IA 1BREA 3I9GL 3HZKB 4X6DF 2ZGLA 3ZXKA 3DGGB 1BD2B 3B2VL 4UWQB 1ZIBA 2ZHNA 3FFQA 2WZPP 2BVBA 4WV8A 4FLSA 4DESA 4ORGA 1IE5A 1IQDB 4MJ5B 1KT2B 1U8LB 4JCWA 2OM5A 3RVVC 3WG7B 3BWZA 4KKAD 1X9TA 2X89A 2NY0C 1LOBA 5EZJA 1WBXA 3L4UA 3KXFE 2F7IA 4RN5A 1TG8A 3ZYRA 5FW7A 3QQ3A 4O02H 4FI6A 4O02L 3SCGA 2KQMA 4KTGA 4I2XB 3DWTA 4N9HA 4I85A 3HNTH 2WXPA 4R96B 1DQMH 3HNTL 5E94A 3T65A 1DQML 2D98A 2N4IA 4OLVH 4QOKB 3M1OA 4OLVL 4OCRL 3ZKSD 4XJZA 5C07A 1STMA 4D6RA 3KF3A 2VXQA 5DRXB 2XOMA 5E03A 3JUZA 4MFHA 4HT1L 2BP8A 1VRH2 1OE3A 3AABA 4K9EH 1MHCA 4OZGF 4K9EL 5SX5H 4ZFFB 2A6WA 3GI9H 3Q3GA 2NNFA 3IDJA 3S36H 2V09A 4KRNA 2EDNA 4E9TA 4ZHNA 1M7IB 5EZPA 5IFJB 2Y34A 1PKQB 4PJBE 5JTWA 1KFXL 2NW3B 3I97A 5B3NA 2G3NA 1CONA 2VOVA 3PRZA 3H42H 4H1LA 1S9WA 4XFGA 3RWDB 2IFGA 3VE0B 2OKXA 1I8MB 3ZN6B 1KEGH 2E27H 1KXQE 2QHRL 3PMSA 1YZZA 1XGYH 2DYSB 4ZUWB 1KEGL 4BPZA 1XGYL 2RS13 4OF3A 4LQFH 4LSTH 2GITB 4LQFL 4LSTL 1NM4A 4U1NA 2X29A 3ZYHA 1OM3H 2V72A 3A3YB 4IV3B 1IAOB 1KN2L 5LCVL 4QF1A 2EDQA 3BUYB 1LYQA 2B3IA 4JCMA 2WZ6A 3CQOA 2QE3A 1JPGB 1HNFA 5AVSB 3UBFA 4AVBA 4HLJA 1SGKA 2YGPA 4EIBA 2Y7LA 1UD6A 3HI1B 5DJ6B 4UILL 1WAAE 2ROYA 5HJBA 2WVSA 4IBWA 4Z76B 4J6GA 3SE8H 5DCCA 1CK0H 3BOPA 1GZHC 1K4DB 3BP5B 1K72A 2WINB 3KXFB 4L4VD 2KH2B 2E7BA 2ZXWB 3OM3B 4PJHF 1IGOA 5B7MA 2BNRD 5E8AA 2VH9A 3N9QA 1OB1B 5F3FA 2EE2A 1KPUA 2XBO1 2Z34A 3MO1B 3FU9A 4X7EC 3T1FB 4BA0A 4S10A 4DP2X 1T21B 4JG0H 1UXSB 5FZ8A 4Q9RH 1KJ3H 4AQTA 5MEQA 1QWUA 2NNAA 1SPPB 4JRAA 3HG2A 5HDWA 4MKMA 4PB0H 1JNJA 2W1SA 2XR4A 4ACPA 5FBJA 5KSVA 2WNKA 3WYRA 3LZRA 2K0RA 5I0TA 4KGJA 4LBAA 1FNYA 4ABVA 5CFCB 2Y2WA 1XSRA 1XH0A 2VZSA 1VP6A 4JQTA 3LN5A 1AVBA 3LEIA 4FKEA 4EDWH 1HWWA 3BKJH 4YS4A 4EDWL 3ZQ9A 3BKJL 3VMNA 1UWGL 2VH5H 5DF0A 3AS3A 2JDZA 2VH5L 2Z91A 4Y4KC 4PDWB 1FNEA 1R5WA 3ARBB 1OARH 1DVUA 1BIIB 1OARL 4KJYA 4NKDA 5F8RC 2AENA 5JAXA 3OCPA 4HUWA 3H50A 3U0TB 4KWJA 1YVLA 1ZLUH 4BINA 4IESA 2HA1A 4BZYA 4I3SH 1OAZH 3N9GL 5H4YA 1UZYA 3IGLA 4HSQA 3P3PA 3L13A 5EEWA 1CGYA 4LSQL 4ZMNA 4PVLA 4Z2WA 1JYTA 1J5HA 3N5AA 5HGAB 5JZ7C 3UCRA 1OGAE 4ES8A 4Q27A 2DQJH 4ABUA 2DQJL 1AR81 4BRVA 2YRLA 2V5TA 1YFWA 5T5NF 4LLWB 1S3KH 3JD71 3BPZA 3QIBD 2RMU3 3TASA 3DX8A 4BLIA 5ESVA 4F7CB 4HH8A 1BQLL 1Y6MR 3O8XD 4AM0A 3UYJA 1SXAA 2HT4D 2Z8WC 2GBVA 3LZFH 2AJ3A 3VWJA 5J7CC 3LZFL 4L3ED 4AKPA 1EHAA 3ARFC 2ALWA 4ZX5A 2WV3A 1QAWA 2P45B 3V95A 4EYUA 4H7VA 3B3QE 3BZFB 2WGNB 4G6AD 2K7PA 1W6MA 4NHLA 2RR13 3CCHB 3SD2A 2XLGA 5I0ZA 2BFUS 3JUUA 2D7FA 1RUF2 3SDDC 3WG2A 4WWNA 1ZK5A 1JERA 1BEXA 1VBE1 3FQTA 1IC0A 1JNHB 4NQDA 4ZPTB 3B7UX 4LB8A 3MCYA 1D7CA 4K73A 1JK9B 4YG3A 4IEQA 1TZAA 5CBEA 2B9UA 4AW4A 3EBRA 2ZT9C 3LQAH 5D55A 3LQAL 4LLDA 3OJDB 4MX3A 3WKYA 1IAII 1E5IA 4LMQE 4FPCA 3IPEA 1C16A 1CYWA 15C8L 4L18A 1W9XA 3GJFH 4KXBA 4KG8A 1CE1H 3E6HA 1MRCH 1CE1L 1PL3A 4CMHC 1WQVT 2LHAA 4CAGA 4DVRL 1DBKH 1VFAA 2F18A 1BAGA 3KM2A 4M9PA 1DBKL 1H9VA 1W0VB 4C58B 1HQWA 1D5ZB 3FZUD 1KUMA 1TVBB 3C8KA 3AM8A 4OCMC 1BXXA 2DJSA 4JJHA 2WS92 3DPBB 5J9PA 1OGAB 4X4XB 5CLWA 5AW6B 4X5XB 5HHNB 4WW2A 3VA2C 3ZXEA 2BIIA 2ZOEB 4MKTA 4WM7A 3RAJL 2Y6KA 4FP3A 3SDYH 4KTDH 3V6FB 4OF5A 3SDYL 2Y7OA 4KTDL 4XF4A 2XBO3 1A3KA 4NPMA 2VSDA 5HPMA 1XR9A 2EIKB 1B2YA 1RJYA 3DCQA 4BE6A 3IKCB 4Z7VF 2ZEWA 4EZ4A 3BGFC 4D8MA 5EWSA 4Z1PA 2AABL 3KE0A 5JW3H 3ZDSA 5JW3L 2FATH 4PY7B 2FATL 4BD4A 3G04A 3IMRA 2GC4C 5KYXB 3WTYA 4QPWA 2CUMA 4FQIL 4ELMB 3AMMA 4M5SA 3FFCD 1XL6A 2BOCA 4Y5XA 4H40A 4F2ME 1TQ5A 4Y5Z0 3EJSA 5EZIH 5CD3A 4OZFA 5EZIL 2PYFA 2Y3NA 1V00A 3SKNA 4XTRC 4HPYH 2DYCA 2MOVA 2VKWA 1OO2A 4HPYL 3SGJA 3DVIA 5SX4I 5BRQA 5DT1H 2Z93B 1TCRB 2DMGA 2XKNA 4MJIE 1R4XA 5DT1L 4Z77B 4IGBA 4QX7A 3H1ZA 4EF3A 1P7HL 1ZBA1 1HE8A 3VFNB 3QZNA 4OUUA 1YHPA 3OKKA 1I9IH 1T0OA 4XVTH 2J1TA 1I9IL 1JYIA 4IJTA 2Y23A 3D2UB 1QRNE 4RDBA 5IIEB 3A0KA 4XFHA 2PQSA 7FABL 2H6BA 4CPBD 3CXFA 4K8RD 2XUMA 1T1ZB 4HU2A 1UB6B 1CURA 2VC2B 2NM1A 2RB8A 4OY9A 3UG4A 1N3NA 2BSDA 2LAGB 4FQXA 5IB3B 5C71A 4GAZA 4B0MM 2PWEA 4WI3A 4EE2