2WN2A

Structure of the discoidin i from dictyostelium discoideum in complex with galactose beta 1-3 galnac at 1.8 a resolution.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
254
structure length
254
Chain Sequence
AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
molecule keywords DISCOIDIN-1 SUBUNIT A
total genus 63
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wn2A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wn2A01
1P8JA 2W92A 2VMDA 1GOFA 1UXZA 4A44A 4QPWA 4M4PA 3VD9A 3W5MA 2X10A 3ACFA 4E8DA 2B9VA 2QQNA 3T2PA 1XNAA 4OZOA 1JYVA 3I97A 3I3DA 3LPGA 1W0NA 3UETA 3GDBA 4P5YA 5JMOA 3T2QA 5CZKA 3HNYM 3CDZB 3K46A 3ECQA 4QDSA 1UWWA 2DDUA 3VD5A 1I5PA 2DCKA 4QDRA 1L7RA 3T08A 2W1SA 3C7HA 1OH4A 2Y6KA 4D0QA 2W47A 2WO1A 3HEIA 2VZTA 2E31A 3CKHA 2Y6JA 3LPFA 3WMQA 4KI5M 1DLCA 4BJ0A 1UYXA 2WO3A 1JU4A 4QX3A 3OB8A 1W8OA 5JUVA 3HPNA 3VDBA 1SG3A 1XPWA 3C7GA 1R64A 2YC4A 2EICA 4MGSA 1JZ2A 2JDAA 1J83A 5EJZB 3WNMA 5F7UA 3MUZ1 3WNKA 5IFPA 3HOBA 2Y8KA 1JZ8A 3VD3A 3I2JA 1UY0A 4AAXA 4W8JA 4QX2A 4YPJA 3IIIA 3CZUA 3GGLA 1CZTA 2VL4A 3NJVA 3K77A 4UI9L 3FHQA 2Y64A 2CGYA 4GWIA 1UMIA 4KWUA 2VZVA 1UY4A 2W5FA 2QBXA 4MOAA 3SKJE 2WUHA 2WZEA 3LQCA 1ULOA 1UXXX 5LA0A 3BGAA 4FI9A 3F2ZA 4DEQA 2BZDA 1JYXA 3DYOA 2C4XA 4CUAA 3C7OA 2J1VA 1PMHX 2VO5A 2VMFA 2VCAA 4DUVA 4XURA 4PQQA 2L9LA 2XHNA 4OMDA 4A45A 4JKLA 5JXGA 3FHAA 4XUNA 4BXSV 3UNPA 1UY2A 3OEAA 4KMQA 1XC6A 2BERA 1UYZA 4A3ZA 4E8CA 5DMYA 2C26A 1US3A 4LQRA 1RYYA 1CZSA 3K75B 2OKXA 2LS6A 2V4VA 3MV01 4OYUA 2HLEA 4JX0A 2Y6GA 3I3BA 3SEEA 1O8PA 3WNOA 3SKVA 5I0DA 2CGZA 1TVGA 3A21A 5C71A 3PUIA 2W1WA 4BK4A 1MPXA 3FN9A 4CU8A 4DXSA 3WMPA 4MO3M 1UZ0A 5JXIA 3ACHA 2HYXA 3ETPA 1K3IA 4JKMA 3LEIA 1ULPA 1J84A 2XQXA 5LCWL 3BN6A 5JXHA 3DYMA 1CZVA 2ZXQA 2EIEA 2VZ1A 2E26A 3I2KA 4BDVB 1JZ7A 1XNTA 4CUCA 2VR4A 1YQ2A 1EUTA 3SEPA 2WN2A 1JZ6A 2ID4A 1F4AA 4LPLA 3C8XA 3A23A 2BGOA 1PX4A 2J1SA 2VZQA 3ABZA 3OGSA 5HXMA 3IDAA 2DCJA 1GUIA 4P00B 3VD4A 1GQPA 3EB7A 3JXSA 3K4AA 3T0BA 4QX1A 4Z2AA 5G04L 1UX7A 3WF0A 2VCBA 2YFZA 2W95A 1SHWB 2VZSA 2JKXA 2W46A 3A22A 3C7FA 5DN2A 4LHSA 2W87A 2VMCA 1KEXA 5LA1A 2XOMA 4A41A 3I2FA 5LA2A 4DUXA 1D7PM 3OEBA 4TTGA 1OT5A 1JHJA 1PMJX 2JE8A 2J1UA 3CZJA 4RYDA 3OGVA 3WNLA 3W5NA 4IUGA 1GOHA 3I3EA 2E32A 1W8NA 1JZ5A 3A7QA 3I2GA 2J1AA 2W94A 3VDAA 2XONA 1GU3A 4XUQA 3WF3A 2CE6A 4XZUG 3VD7A 4ARYA 3WNPA 3HJRA 3MV11 1NX9A 2VTFA 4ZY9A 1JYWA 2WBKA 2YG0A 3P6BA 3WNNA 4MGQA 4UOJA 4GZ9A 4GWJA 1JI6A 1UY3A 2BGPA 4P08A 2W1UA 3J7HA 4OUEA 2QQIA 3K4ZA 2RJ2A 3WF4A 5EJ1B 2VC9A 1IQDC 4ZZ5A 2R7EB 3T2OA 1H6XA 2VZPA 2QQOA 4OMCA 4QB2A 3FL7A 4CU7A 3I2IA 2YFUA 2QQMA 3EYPA 3NRUA 2CDPA 3THDA 2W1QA 2W3JA 3WSOA 4A6OA 1F4HA 1OF3A 4QB6A 1UY1A 3IAPA 2V5DA 1DYOA 3DYPA 2VZOA 4ZZ8A 1H6YA 3IB3A 5IYYA 3E1F1 3MO4A 4P02B 3PUHA 4XVHA 1K42A 5C70A 4QB1A 1GOGA 4CVUA 4DEVA 2ZEYA 1GMMA 1T2XA 2W91A 4MADA 1TG7A 4ET7A 2VOTA 3ACGA 4AG4A 4CU6A 5J1XA 2VJXA 1GNYA 1W9TA 3LEGA 2X09A 2WDBA 2VZRA 2QQKA 2VQUA 2E33A 2YB7A 2RV9A 2ZEZA 4HG6B 1OF4A 1KGYA 3IAQA 1JYNA 4RN5A 4LKSA 4QAWA 4DUWA 2QQLA 4CUBA 1JZ4A 3UESA 1US2A 5G05L 3HN3A 1CX1A 2Y6LA 3OG2A 3THCA 2ZEXA 3HNBM 2VZUA 3WF1A 4UAPA 1HN1A 2J22A 2WYSA 2VQTA 4JKKA 4XUOA 3WF2A 3OGRA 5IHRA 3WQBA 5C7GA 3CMGA 4CU9A 3HNMA 4W4ZA 1EUUA 3GM8A 2WABA 2VMEA 3VDCA 3NQHA 2EIDA 1JU3A 3D3AA 2Y6HA 1K12A 1L7QA 1O59A 3CQOA 1K45A 2LW8A 2CCVA 3P1IA 3LE0A 1W9WA 2KD7A 4ARXA 3MUY1 2J1RA 2J7MA 5B4XA 2WZ8A 4W50A 4L0PA 1WCQA 3GXUA 3LEKA 4ZXEA 2WAOA 2WQ8A 2C9KA 1SDDB 3U37A 1W9SA 4PF1A 1JZ3A 5JR2A 4JHZA 2J1EA 2EIBA 1NUKA 1OD3A 2VZ3A 2VCCA 4QDQA 2X05A 1PX3A 4BK5A 5HPOA 3MBWA 3CIHA 2WAAA 4A4AA 5DPNA 4M4RA 1BHGA 2PQSA 5DQ0A 3DECA 4XUPA 5IFTA 5B4NA 1UYYA 3T09A 3K4DA 4PT6A 2BBAA 4XUTA 1NKGA 3I2HA 2J1TA 3AC0A 4QX0A 2CDOA 4DXTA 3ZM8A 5IJRA 1UMHA 5FUIA 3NNGA 1O8SA 5CYYA 1NAEA 4D8MA 2YC2A 3WEZA 2WO2A 4DXRA 2B4KA 1WKYA 2RVAA 2Z4FA 4TXWA 1CIYA 2V72A 1LNSA 3C7EA 2W9XA 1W99A 2VM9A 2ORXA 5JXJA 2ORZA 3T0AA 4A42A 3T0DA 2JD9A 3OBAA 2ZEWA 2QQJA 5EIYB 1DP0A 5A1AA 2WN3A 3NJXA 4Q56A 3ACIA
chains in the Genus database with same CATH superfamily
3B01A 2NY2D 1IQWL 3B8SA 4F58H 1TYEB 2IVIB 4IK6A 2OL3H 4QCIB 4MD0A 2DVDA 3GLAA 2FX7H 2IMMA 3KM1A 4M1DL 4P57B 2OMNA 1TKWA 1ZANL 4X2UA 2P5WA 5I17B 4FFYL 2PHTA 2FL5A 5D4JA 2OZ4A 2Z4TA 1U8IB 2NY6B 2VCOA 1S5HB 4M4PA 1X5LA 4G7VH 2QKIA 3H3PH 1NWPA 1TJHL 2D7TH 2WNUA 4YDJA 3VDDB 2ALWA 1OVPA 2GHZA 3POIA 3NCXA 3TLRA 4IERA 1V7ML 3LQMA 1INEH 4G43A 1GW6A 2GEEA 3BH8B 4FPGA 1IJNA 3Q44A 1AQHA 5A7BA 3KM2A 2VQAA 1KBKA 1VJSA 3LNDA 4GXUM 3DIFA 2NZ9C 1PGL1 1L0XA 2DMGA 4FFWD 2YPVH 4JN1L 4XMPH 4IE6A 1W2UA 2XB6C 2VIRA 3X14B 4X6EB 1I5PA 1V55B 5IHUH 1M2VB 4ONFL 5D4HA 3REVA 3SBRA 4F57H 1ZE3H 3ZKXB 2E53A 5GIRB 2E63A 5HCFA 2DWYA 2NXZD 5AVVB 5HP5A 1G7MB 3PUUA 1U8JB 2GSGA 2FLRT 1Q9LA 4K07A 2R043 5CP3A 3JUUA 2G2RB 3UYRH 2BFVH 4HMEA 4NGHL 1JV2A 4DGVL 4HETA 2BVBA 1ZX5A 5EQUA 1RUNA 4OFDA 3L4ZA 1N8OE 3IXTA 2RMU3 1KCVH 3MCKB 5KBDA 3SDAA 4X9BA 1I9EA 5HHMD 4GO6B 4AL9A 5ACZB 2VQ0A 4URTB 1H3WM 1SLUA 1TFHA 1KY7A 1UZ6E 4XP4H 2AK1H 1GHFL 3D25A 1UYXA 4Z6AT 4Q4Y1 3MJ9H 1J0JA 2UX6A 3AWEA 4ZO9A 5EF2A 3HT1A 4WW2A 4QGLA 5FYHA 1ND2A 4UTBL 3WE6A 3BKYH 1YQVL 5SWQA 4B50A 4FQZA 3UBXB 3H1WA 4ISQA 5FKCA 5C0ND 1B35C 2RAMA 1NCQB 5HHQA 3ESMA 5HHOD 4Z7VF 1LODA 2DQHH 4E2QA 2KUTA 3ENEA 4LSTH 4JM2C 2R32A 1YEGH 1ZK9A 4FNQA 5FUOH 1SLTA 5FO2A 1BZDA 3FU8A 4IKJA 3PWJB 4YSAA 3I84A 4W4OA 1JYIA 1R3HA 3TBWB 5DG1A 3C75A 1FG2B 3KCCA 1H8TB 3E7JA 4ZHNA 2BY0A 1UCXA 4Y22B 4PSRA 4EN3A 1IZKA 4NIAA 3BZFA 1IAIL 3ZU8A 4XCCH 5FYJE 1W0YT 3OR6A 4PJ7A 2B0SL 1DEEA 3LY6A 5KYUA 5CJXA 1JJUA 2WKKA 2MJWA 2WXNA 1A9EA 4P5TC 5GGVY 3VD2A 1RIHH 2ZGNA 4Z3HA 2VZVA 5CVRA 3NH7L 5AUMA 5EUOF 4QY8A 1S7TA 5CS7A 3H9SD 4ZU7A 2EE0A 4RRPG 4YZ1A 4GKZB 1OQDA 4E27A 2BY3A 2WZ5A 1J7VR 2PPFA 4JY5H 4L97A 2WZPA 5E94B 1ED3B 1VFAB 2WK2A 3ECBB 4H88H 4E9LA 3EYUH 1KIRB 3OKLB 1QSFB 1LQSR 1H4HA 3JB8A 2BLFA 4HLEA 3CBKB 3QO0B 1P84K 4FG4A 5A80A 3WEOA 2YC1A 4KRPB 5CGBA 3WN6A 4PJAE 1AZBA 2VMFA 2QTWB 1E3XA 4GQ7A 3OUJA 3WBDA 4DUVA 1TFPA 1ZHNA 4N7UA 25C8L 2JQAA 1ADQA 5GM0A 1HB2A 1MRDH 1MCLA 2KPNA 2UX7A 4NOBA 4RH4A 1UYPA 1FLRL 4PBDA 4PJAB 3ZHDA 3POYA 1WP6A 3O9WD 2BWAA 3DPRB 4WEBL 2HWF3 1WBXA 4C56E 1S4CA 4YARA 1A1OB 2VDKB 4MMZB 4BFNA 3KLLA 4BKLA 4KGGA 1IJ9A 1KGXA 2FTAA 3V6BR 2QUOA 4OCTA 4ZONA 4ZO6A 1SYSA 1RUI3 5IVZB 4QMAA 3FZUD 4NCDA 2EEAA 3GINA 1D6EA 3U1SL 5D7JD 2NNXA 1E6JH 2P8PA 2YAQA 2G4EA 3BPCA 3DETD 4X6BA 3B69A 4QKBA 4DP9X 5FPAA 3MJ7A 4WNSA 5J3HC 4R7LA 3DDFA 1KG0B 1YY8A 1G9NH 5T5FH 4LBOA 1NCAL 2A83B 1B2WL 3FCBA 3PDOB 2NLRA 1F97A 1OSZB 4XN4A 3SJVA 1AFVL 2Q76A 2V9UA 4EOWL 5DWUL 1VBC2 2VNOA 2MPVA 5L2JA 4KK8D 4RFOH 6TAAA 5FPXA 5C0CB 1LHZA 4N87A 4GBXB 5HVWA 2E9JA 2ZNXA 4W9LC 3QD6A 4HOWA 3B2MA 1G1KA 2RJLA 4E41B 5BOJA 3L3JB 1Z3GL 2FWUA 3TONA 3QWOB 1E27B 5FIEA 2Q7YB 3GUTA 4HS6A 1L7IH 4KKLC 4PJBF 1YIPA 1EAPB 5T54A 1RPQA 5FGCB 4YW7A 3PAUA 1PEZA 4BUHA 2FK9A 4AYMC 3ARTA 1DJGA 3UBXI 4C83A 2WR9A 2APSA 1YNTB 1EEYA 4AK1A 3O8XD 1BYPA 4YDNA 2F7IA 4R96B 4LBQD 3H9SE 3HUJE 5IJVB 1AX0A 3ZXKA 4JO3H 2RS13 4B53A 1FXZA 4RQPB 1ACCA 4TVUA 1J86A 4F58L 2EIEA 2VSKB 3S5ZA 2ZXGA 5D55A 3SPVB 4PLKC 4PR5A 4MXVE 3R4RA 2CUIA 3NCBB 1KZQA 4YZ4A 2WLQA 1A0QL 1E42A 3HS0A 4Q4Y2 4KV5F 4ALAL 3MOBL 1G6RH 2IPUG 2ID4A 4EYUA 2BV4A 1MFUA 2VJ0A 4UZUA 4U31A 4C56D 1WHPA 2BGOA 4EZHA 2Q8AH 3VBOA 3LH2L 1GGTA 4J6GA 1GUIA 1Y43B 1YI7A 1QVOA 1NPUA 4ODTH 4JFEE 1URLA 1GQPA 1I85C 1FF5A 3MOAH 4N26A 3EOBB 4WJKB 4AMKL 1T03H 2D6NA 3OBZA 5FWJA 8FABA 1VFOA 3PQYB 2FSDA 4EJ1C 4LEXL 4NQEB 1HQLA 1YUHB 5CLWA 1MHEA 1NA1A 2A6JB 2A9BA 4UNIA 3HMXH 1U21A 1QNWA 1P5VA 1WW5A 4HEME 5I19H 2JCCB 3A6CH 4LDEB 2VZSA 2DJSA 4Y5Z0 5DN2A 5EPMA 4PJXB 4N9GA 2W87A 2VMCA 4PPTA 4UB0L 3VXRE 4AQAA 1FAIH 1LO2H 1FVCB 5B3SB 3UMNA 4UIMB 5LA1A 4MS6A 2HP4A 2IXHA 1A1NB 3L4VA 5E8DL 1EXGA 3B2VH 4JE0A 3GXTA 1R083 1XYPA 1HWHB 3NJYA 4N8MA 1OT5A 5J48A 5KBLA 3L5XH 1WFOA 3R19A 1LEDA 1IM9B 3QWOA 5GJTL 5A6LA 1LHNA 2NPLX 2ZGMA 4MMXA 2E46A 3QJTB 2ZKMX 1WBYB 2PTTA 2IXLA 2BOCB 3TIDA 4IRSD 2WWSA 1ZVSB 3BC9A 4M00A 4AGOA 1W8FA 1XGQB 3THML 4DP4X 2AH2A 3P3PA 2X70A 2BNQA 5ENWB 1E4XH 4J23A 4CEWB 3M7OA 4WW2F 5FFGA 4B9ZA 3WJLC 4BQBA 1SBSL 2ZUYA 4QRAA 4KKQA 4UT9L 3E97A 1J9CT 1PK6B 2CIKB 1DSFL 2OR7A 4NDMB 3WNPA 3IJ8A 4Z7OB 5E4OA 2CJ3A 4M0HA 2R2HB 1UOJA 4P14A 2XUEA 3FQTB 1UFUA 1JNJA 1MEC1 2W0FA 5G4OA 1AANA 4G6AD 4YHKH 4N8CL 5LWBA 2WKOF 4F33B 1E4KA 1MCIA 4J5VA 5C3RA 1IBYA 2JB5L 3OKNA 2UYBA 1XIWD 1ASPA 3PWLA 1DGWX 1CD3G 4JQIA 2QQNH 4ZDHA 3DJSA 3LXCA 1L9OA 1QQP2 4NAQA 1DFXA 4N53A 2A77H 4GEIA 3K4ZA 1I8KA 1FPN3 1TIUA 4LSVH 4X4YA 2VC9A 2FH6A 1H6XA 5IATA 3QFJD 2J5LC 3DXAE 2JKRM 1D4M2 2A3WA 1JF1B 1L3NA 4FMVA 4KAQL 4J3SA 2XLLA 5DWPA 3UZEA 3WZ1A 4BKTC 1UWGH 5DZAA 3SGKC 1S55A 1R081 4LLYA 4RGMB 4NIIA 3RVXD 3VGIA 5C09B 3VHRA 4R7NB 1SHXA 3ARFD 4WW1B 5GS1C 3GTVA 3LXBA 3WY4A 2AXJA 3EJZC 3DYPA 3JSSA 1A7NL 5E2VL 5IYYA 5AW6B 3V4PH 2JKWA 2R0WL 2XWXA 2F2HA 1TJXA 1DUZA 5FUCC 1XE7A 4XJUA 4XVHA 3J26N 4Y4KA 5AUMB 3TYFA 1LE5B 4R8HA 2FIKA 3AXIA 1VFBA 1EPZA 2NSXA 2ZEYA 4OJDH 2ADJA 1LKNA 4F5CE 3DX7A 4XP6H 4EIZC 1QQP1 4JW3A 1TG7A 5IEHB 3HC0A 3NGBB 5K9QI 3GSRA 2JB6A 1HHJB 2WLLA 1ZZBA 1M2OA 2AQSA 4OJYA 2WQUA 1KXTB 2JJTC 1D9KD 5DVMA 1ULVA 1X5FA 1J1XL 3IFLL 4XE9A 1A7OH 4M6OL 4K7PY 5IKCA 1OWRM 1O7VA 3LN9A 3LNIA 1V6IA 2Y36L 2WYHA 4QXWA 1Q1JH 1KXTA 1RUAH 4NPMA 4ZRGA 3VCLB 4QHZA 1NCWH 3J4UH 3DGTA 1SM3H 5DAVA 4KRPD 5ETUA 3UT0A 2UY7B 3GK8L 3RDTC 1G0DA 3GRGA 5A3ID 2QVTA 1V6MA 1E30A 5BUAA 3PJNA 1BVLA 3UPCA 5HDBB 4OGYL 4TULH 3SDYH 3NV3A 4IRSC 2ERJB 1DR9A 4GRWF 5I0WA 2KA3A 3E5QA 4R6UA 3SJVD 2CO7B 1XB8A 3ASWA 3MLSL 2VXQH 3IXTB 4QNPF 2R0KL 4M7JH 3DX3A 1AY1L 2YMZA 4KRPC 2CM5A 2HKFL 2ZX8A 1ZBE2 4CU9A 1G7MA 1PSKH 2MEJB 3GMOB 4NZTL 4Y1AD 1QSVA 2WW8A 4XCAA 4DN4L 5GRUH 3BIEA 3IDEA 4Y4HD 1VB2A 1NGXB 4X4ZA 2GJRA 2ROYA 1JN2P 3OLIA 4KZ0A 4P2QD 2TUNA 1OXYA 5AG9A 2IANB 1C16B 1K12A 2AAVA 4WSGA 4F24A 2I2SA 1IQDB 5DEGB 3W20A 4FFZA 4AFMA 3FRPG 3QXDB 4DT2A 2VRAA 1DZQA 1XXDC 2W68A 4I0BA 2COQA 2ZSVA 3S5LB 3GWJA 2BP8A 4EBQL 3IRZA 1F6AA 2H0VA 3LEMA 2BSSA 5CUSL 4IEYA 2WWMC 4PJCB 2JECA 3DVGB 1W0VB 5LBVA 5KYXA 5B4XA 1BD2B 1KBGL 2JB8A 4K2UH 2RS52 4PRNA 1MFBL 5C3QA 1UKSA 1VGEL 1TCRA 2A99A 3BVNA 2CRMA 3GC3A 2VC2H 3GEFA 4JR9H 5DS1A 3SOBL 1QFWM 1A3KA 1MZEA 3LEKA 1LXMA 4AYBA 5DUMH 5K5YA 1HZKA 2DU1A 1AVAA 3ELNA 3STZA 2VQ1A 2XRAL 2NT1A 2X2JA 4ZMQA 4CVZA 1N8ZA 2TAAA 4MMXC 4NZUH 3CDZA 2XVKA 2HWF2 2DF3A 1X7NA 4J6RH 2V2TA 4PREB 2JNZA 1PBYA 5FCUH 4JL2A 3PCYA 1U3ZA 2WSKA 5K9KA 1A5FH 5IIEA 1PK6C 1KEMH 4RSYA 3S3BB 4QKDA 3SLIA 5HPOA 1HS6A 2K2SA 4ELMB 2OP4L 4RCAA 4L8CA 1IILE 2A9AA 3QZNA 4Y20A 3VFGH 2YA2A 4JQXC 5FX3A 5E5UB 4GMP0 5F2FA 4O4YL 4OAWB 1ZT7A 5IHWA 3Q9PA 4GG6E 3ATAA 4KROB 5D1ZB 2AKRA 2NY4C 1V3MA 4NKQB 3HBGA 4G8GE 5IQ7L 4ATWA 5F7YC 4QPGA 1DANT 4N3TA 1CN1A 5ESAB 5HY9A 4ES9A 3QNYA 4NQEA 1OP3H 4OB5L 3RVWD 2PELA 1F00I 5IJRA 5MI0C 5I24A 1TPXB 4K7FA 3L6FA 4FADA 1KJ3H 3ULSB 1JHLL 1O8SA 1T0NB 3H3PL 1TQ5A 4FFTA 1DBJL 2WOBA 2A74C 1GQGA 5D1QD 2HFGH 1VCBC 1B4LA 1S9YA 3KCPA 2BUKA 3WN5B 5KG9B 2WP3O 4HDIA 3F5WA 5IHLB 3UYJA 2QZQA 2VISA 1AR62 5IGXL 4TXWA 4EJRA 4GRMB 1XR9A 5C6CA 3ERXA 4DOHB 1XSJA 3VXMD 1BCIA 2RDRA 3LKJA 4XNDA 2R1XB 2ZKHH 3IJ7A 4HJ0C 3SPVA 5GLVA 1S0EA 5EU3A 3BIKB 1XIWA 1LNUA 1EY2A 4BMEA 4YYOA 1SHSA 4YZ5A 4PYGA 3MN8A 4M7LH 3TWCH 4A2MA 1BVP1 5L19A 4KY1L 1OALA 3CN0A 2YPDA 1P7QA 2NMNA 2YSTA 3FSVA 2AJYL 5SV5A 1B6DA 5FYLL 1A14L 4PJIF 4WQOA 2WIMA 4A6YA 4FEMA 5J06A 4NGHH 2F5AL 3N9LA 4KRMB 4JC1A 5IVFA 2HWE1 1D7DA 3RZJA 1CYXA 4BFGA 5E4EB 4WV1C 5SWZA 3VB8A 5LAXB 1RUJ1 3GSUB 2DBJA 1UIJA 5DDJ2 3VU2A 2CJSA 3O11A 4LBMA 3WTXA 2D5FA 4BCXA 5L9RA 3HVNA 1HE7A 3CVDA 4OUUA 1LTEA 5F88B 4B0MM 2W39A 2GJ6E 1XR8B 5BPPA 4KBZA 3NJFA 3FN0L 2HT4C 3REWB 3NCCB 3UADA 1SACA 1NLBL 2RS33 4YSUA 3T2QA 4X6BB 1GJIA 2QADD 2BVUA 2CGRL 1UXSA 3CDZB 1FSKC 3ZIYA 2ZX3A 3V0FA 2AJSL 3AREB 3NFSL 1JDDA 5BNQA 4J4PD 4BQ4A 1JXFA 4E4SA 1MHHB 1U5IA 4LLFA 2PFWA 5I9QB 5KZCD 3A47A 4X9HA 2ATKA 3MGOB 1J05B 4GXVH 2D0GA 3S36X 1VEPA 2P3IA 1DL7L 2XJLA 1G6RB 3ZZSA 4DIQA 1RLWA 3ZHLA 4YHNB 1AQKH 3RRQA 4QHBA 4MASA 1XGRB 1AR2A 3TT3L 1BEV1 4EI6B 1QQDB 4JGZC 3M17B 1ENQA 2EYTB 4HIPA 3ZL1A 3BOPA 1KYOJ 3V6OC 3H8UA 2AK4E 3SCMB 4RRPM 5L6YL 3HT2A 4UOZA 3SCGA 3WV6A 1EV13 5E8AA 3ZFFC 3CAFA 4R3SA 2WBJC 1O4ZA 5IMLA 5K0UB 1QSFE 2XNAB 3GSWA 3VXRD 1QBAA 5FYKD 5IJBC 4YW1A 3QCWA 1GPOL 4AQEA 2MKWA 2Y6SD 5CGMA 1DQQB 2HTLD 2NY7L 2Z8SA 1XPWA 3DX9B 1WZ1L 4Z07A 5DXWA 1IBGH 4GYBA 1XCQA 3L9RA 1Q8QA 4DKDC 2EALA 2L0DA 5A3WA 3UG4A 3R1GL 4X0KA 2YV8A 4LJHA 1HKLH 1S7VA 3POWA 5CN1A 3EGXA 3KNBA 1F58L 3BZFB 4KPHH 4ZPVA 2C6SA 1W6PA 1HJFA 3Q1EA 3CX2A 1QI5A 1X5GA 3I2CH 5J1TC 2UZXB 3JQOB 1R3HB 1U58A 3EJCA 4DW2L 3QACA 2IZWA 3ZLIA 4CEWC 1IGFH 1SN5A 2FSEA 3K77A 4BIOA 1V5JA 2DIAA 1NDTA 5J13B 2D6LX 2WLZA 2QDRA 2DU0A 4N2BA 4I9WE 4UINH 4L2YA 3DDGA 4V1PA 1NUDA 2BH0A 4F7MB 1KFXL 4FJYA 4FVVA 3S2AA 4CSWA 5KW9L 5F89B 2XWDA 1AYRA 3BN3B 3HE6B 4UM9A 1UC6A 2QHLA 4N4YB 4AJWA 4A04A 2EC9U 3VGEA 5EUOB 1V70A 2CGOA 4GJZA 4QKFA 2BSEA 4IDZA 3STLB 4RS5C 4KK9C 4U6VH 3QJZA 3QFDA 1JGVH 4YLQT 4URTA 1EERB 1T1WA 3QDMD 2ZAAA 1A7BA 2JB6B 3L5IA 2YGPA 2WA4A 4AWDA 2F54D 3GIZH 1FX5A 1MZ5A 2C4XA 1VBD1 2VDLH 3QQ4B 3FULA 3JV4A 1M6OB 4Z9KB 1JK9A 3NT0A 5DLLA 3C7OA 4POYA 1UQSA 1MUJB 3US9A 2H26B 2C9RA 1N64H 4YDVA 2ZF9A 3QI9A 2AV1A 3GJEA 1O75A 3ULUC 5I74C 1ZV9A 5A3PA 3QULA 4PRBB 1YPZE 1GANA 2BVVA 2IDCA 1K3ZA 5EC1B 4NN6B 4FTEA 1OD5A 5BW7C 4U1MB 3BUPA 4ZTPH 1IO4C 3C6SB 4E8CA 3LSOA 1BFVL 3AS1A 4GWMA 3QDJB 2VNVA 1KIUB 1PCSA 2AEZA 3QEQE 2LU7A 1ORQA 1KN4L 4BQXA 3HI6H 3V52L 1RUPH 2PHUA 2FJSA 3WD5A 3GS7A 4OHYA 2XTJD 2NW2A 4Q6KA 1PQZB 4KHTL 3BXNA 3CQQA 4FQJH 4UMGA 2QKIB 4HWBH 1Z0HA 5GS1B 4XNYH 4Z7OF 5F9TA 2DLFL 1O7SA 3N40P 4FLRA 1PZUB 4N9OB 2VXVH 3NVCA 4OHWA 5C4WA 1P7BA 2Q3XA 2AHIA 4F2EA 5LBSH 1S7UB 1TOXA 4PGZA 4MJ4A 4F33A 5IG7A 5CGTA 1LOCA 5DUXA 1E90A 1BLNB 2DLHA 4MA1B 1GXEA 3F95A 4TLKA 5D2AA 5K9YA 3MRMA 1G7QA 3LMJL 4WHYG 4GQZA 1U8NA 4UAHA 2CJUH 1TEGA 5ALCL 2IO5A 2H6BA 1ZRFA 3BAYA 4NO0D 2DVGA 3I3QA 3H7JA 2XVGA 3UCRA 5TGBB 4IS6B 2OA9A 2BVTA 2VMGA 4YDLC 2CGNA 4NHKA 4JPVH 5I8CA 2YXFA 3GMMB 3WELA 4OCSH 4I3GA 3THMH 3C8XA 1E67A 2X1QA 4QJ4B 2QTEA 2YAEA 4P5MA 1IKPA 3RZMA 2GC4C 3TZVC 4L2NA 5DQJA 2YPJA 2F08A 5CCGE 4RGAA 1KJ2B 2R27A 1FNSL 3ETSA 2BRRH 1KSRA 4QX1A 2LGNA 2X3CA 3QCUH 2J72A 2X89A 2Q20A 1EMTL 4M1GL 1AVBA 3TN91 1WFIA 3RA7H 3U9PH 4RFRB 4QRQA 1RXLA 3CQPA 4CXXA 4JZOB 1RK0A 2W95A 1B0GA 1CJDA 1QJU1 1QJY1 3VJ6A 3JYBA 1A22B 3CFBA 3HC4L 3TVMB 4B9GA 2YAMA 3WFBL 1CAUB 4HVRA 1CFMA 3W58A 5T1KD 3SHSA 4AJYV 5IW6B 1KEXA 1LEGB 1IUZA 4RGNC 2XOMA 5DFTA 3DTDA 1VRSA 4WTZA 4PGJA 4XABA 2WKLA 3H42L 3VA2C 5C6TL 2DQMA 3HIZA 3FTGA 2R23B 2JE8A 3H9SB 3FBYA 4I09A 1JZJA 3OKDB 3KPLA 3NIGF 3TVMD 1EHNA 3W5NA 1GOHA 3I3EA 1AJKA 4XPFH 3WIIH 2VUYA 4G7RB 1ZA6B 2DD8H 4P4RA 5IFHH 4JBSA 4NO2B 1QUNA 2AXFB 3QDGD 4WUUE 4BCYA 1JUIA 2PCFB 2CO2A 2JICA 1TQCB 3HPJA 4NXSA 1VAMA 4GXFA 2ZHNA 3NNMA 3OKMB 4TKWA 4LPWA 4P3CH 5MEND 2VW1A 3B94A 2CKBH 1SQ2N 2H1PH 1EO7A 3FQ1A 3HI1A 2G9KA 3ATDA 5HYJB 2X8KA 2IWKA 2K70A 3UG3A 1ZA7A 5HPMB 1GA2A 1QJU2 4LEJA 5CFHA 3ULUL 5GZDA 2IAND 3CFJB 4LGPB 1CFVL 2OR8A 2Z42A 3VFVB 3E8UL 4YM3A 4IGBB 1JNLH 4C8XA 3S48A 4OLWL 3NA9H 4Z7NF 3L3GB 3DJTA 1A8DA 3KV4A 4GIQA 1FRGH 2WXIA 4KKLD 2L7QA 4ZPVB 2NY3B 3AREA 5EIVA 1I82A 4PYHA 4I5BB 1FYTA 1O6TA 4WFEE 2AEQL 4JHTA 4YXHH 5KS9B 4GW1A 1H6FA 4U6YB 1RGSA 2W1QA 3ZSEA 2JH2A 1YYML 4MA3B 1JPSH 4L11A 5JW5B 1C7SA 2E7TA 1UWEH 1WG3A 3TNNA 4YX2H 5M7QA 5GHWL 2QFPA 1JGLL 2IPTL 1EGJL 2VT0A 1U0AA 3V5HB 5BNOC 3H8XA 1SLWA 4R2GC 1C5IA 4GG8B 3WFEL 4RL7A 4MG2A 4AQ1A 4IBVA 1DVFD 2P28B 4AHXA 2XPJA 4JM0A 4JZJC 5LBSA 2IGFL 3JQWA 1WUZA 3QIUC 1HDMA 4JV4A 4HIIA 1J88A 4KVNH 5FFOC 4PGEB 3VXPB 1KC5H 4RGGA 5IF0A 2D73A 1F1DA 4OQTH 5BNNC 2JKNA 4LOUC 3VXSD 5KWRA 4A66A 1QBMH 5FZFA 2FVNA 4GUCA 3THTA 1V3JA 2GUOA 2IOIA 4MJIA 3ULUE 2X38A 1OTSC 1X5HA 1LO0L 2X1WL 3GF8A 3QUHA 5A3IC 3GB7A 5K1JA 3B9KA 4YHNA 2P24A 1S3KL 2Z35A 4XVJH 4GH4A 4R7VA 3V4PB 1BWWA 1MW0A 4OZGF 2JWYA 1LDPL 3C6EA 4RMRA 2ATKB 1J5DA 3O0RH 5E94A 5E8PA 2I85A 4FQLH 2AQTA 2VJXA 3BIKA 4BEIA 4E0RB 2ZOEB 4NO2A 4BZYA 1DJWA 4AEDA 1AXTL 5E9AA 4AQ1B 2A6DB 4D7BA 2OMZA 2E33A 2A9MH 4KUCF 3PGFH 2JI2A 2QGDA 2NYKA 4MCYB 5CKQA 3RY6C 4XMWA 2HJKA 1NE4A 1NQDA 4ZZKA 1S78D 4OT1H 2RV9A 2V8LA 3NK3A 1EDYA 5DR5L 4RN5A 5I8TA 2X3AA 3EFOA 1PG7W 1TVDA 1U91B 1EA9C 1UIKA 2XBO3 3HN3A 2O72A 2EXHA 4GINA 2DQ6A 1R19A 1XV8A 5ILTL 4ZW3A 1XF4B 3LH9A 4YHPB 2X29A 5K9JL 2ZEXA 2FZ2A 4XPBH 1RUD2 2FCUA 3HMXA 3RY6A 1J48A 4LKEA 4UAPA 3GSUA 4PWGA 3TBWA 5KVFL 3A0OA 1MSPA 4JZOA 4PJXF 3BZEB 4Q0SA 1F31A 3SPHA 4JFTA 3KBPA 3H0OA 5F3CA 1FFOA 4TSBL 5EZOH 3JBG3 5BUVA 5CZRA 5JMOC 5FZMA 5FXXA 3VRIB 4FMKA 4P5KA 1IBHA 2YA1A 1X5KA 5ISZD 4BFBD 1YEEL 4FKHA 1S2EA 4TMPA 3N1QC 4L3EB 3KLHC 1AJOA 5C7GA 3MEPA 4Y20B 1W6MB 5F9OH 2BW8A 3HNMA 1F3JB 1KB3A 5IT2H 2VULA 4IGOA 5JPNB 1LU2A 5KJRH 1URZA 2MTAA 3NPZB 4JEGB 1IC7H 1RSYA 3CUPA 3IGAA 3P4MA 4X5WA 4A7GF 3TVMC 4PVNA 3T5WA 4OGAC 3K71A 1W8HA 3ARGC 4CC0A 5EU3B 3PABB 3ROOA 1P7KB 1XGTB 1QSED 3N9GH 4YK4C 2FB4L 2N7AA 5FPLA 3N43F 3ZW3A 1GJWA 2MCG1 1RIRA 4JHWL 5HGAA 5L8LB 3AP4A 2KZKA 3FCTA 3L5WA 3KYKH 4APQB 5F9AC 1RZJC 1RLBA 4IRJB 3SH3A 4J6IA 1PDKB 4HBNA 1KENL 5TJWK 2XN9B 5INCA 2HJFB 2VDOL 5TQ0L 1BLNA 3BOVA 3ROLA 3DGDA 1QMJA 4EWDA 2GK2A 1HE8A 1AZZC 5EO0B 2UWBA 4HLZH 4PJCA 5CGYD 4Q4X3 1SVBA 2J8HA 1IE5A 1NMBL 2WQ8A 5T3XD 1SDDB 1DG6A 3U4SA 4FFYA 5C0RH 3DUHA 1FSKB 4PJIA 5HDBE 2P49B 5DAXA 1M71B 2HRPL 2HKHL 3VA6A 5K9OB 1NBQA 2YK1H 4FLHA 2O1QA 4PF5A 4QHKI 3QXDA 4X5PA 1XB9A 1HCFX 1RZ7H 3LDBB 1BFTA 5DJXB 2PO6B 2BHFA 1IC4H 5C09E 4I8DA 2Z2SB 4JM4H 1RP9A 5CCHE 4F2MA 4CGUB 2ARWA 5DUPL 4L8CB 5ACA3 5DRNA 1QJFA 1ONQA 2ZACA 3AJYA 5FM5O 1FZOA 1QASA 3CIHA 1SMAA 4TUKL 3AY2A 2DQJH 1PAZA 2DH2A 2VECA 2ZE0A 3WQ1A 5JA8B 1CD1A 1W72B 3VGAC 4K3HA 2X5IC 4JPIB 4AKOA 1SMOA 3QHZL 4MCZA 5EOCL 4PT6A 2WP3T 3V0WL 5I15L 5KVEH 1XSKA 4XUTA 1H3PH 5H94A 4LCYB 5HHXL 4JGZA 1FAKT 3Q6GH 5T1LD 1Q3EA 1OTUD 1WZLA 1C1EH 5I73B 3OKOB 1XD0A 5IG7B 4BJLA 5E95B 5EORL 3D8MA 1XSOA 3I6LE 4Q2FA 5D8AC 3L3DA 2EXYD 4L5FL 1I9RL 3NWKA 4DXRA 1ILUA 5BRZB 5DURD 2RVAA 2FO4B 3T77B 1NLBH 1HJCA 4X6CB 4R26L 5JHLH 3BB6A 5DZNA 1IFRA 4LHUD 1HSAB 2FT7A 5F89A 4DQOH 2ZYHA 1DVFB 3T0AA 1Q9WB 2YGLA 2JXMB 4JUSA 2WY3B 2NSMA 3LZLA 1SUHA 4N0UA 3SE4C 3JWOL 2WQZC 4HVOA 1KJRA 3T3ME 1OT1A 1NC4A 5SX4H 1WIOA 2E9GA 3MLJA 1L5GB 1LHWA 1OKOA 3LSOB 4QHNA 4QX8A 2QVMA 2UYLA 3I9GH 1QG3A 3CQFA 1FO0H 4X6QB 5F70A 3D69B 5FWQA 1BM3L 3UYPA 2V5MA 2Z6FA 4A6YL 1JAEA 3NQIA 3QS3A 4PGCB 2VDML 1EZVX 4QOKA 2LOEA 1ZDSA 4I18C 1GR3A 3B02A 4HGKC 1MFEL 3TN0A 1QLEB 1F41A 4LCCB 2TRHA 1FBIL 1WBZB 3Q8AA 3OHXA 3PPSA 2EJ1A 4XF9A 2ICEC 2FEEI 1IC1A 4CYDA 4JZJA 2LFGA 4W9KC 1N19A 2FDKA 2IH1B 1O9WA 4QJ3B 3OXRB 4LT5A 2Y7LA 4HWNA 2MCPL 5J09A 3A6BL 2X9YA 4W81A 4TQHA 5KBKA 1RIUH 3KXFD 2JG9A 3T3YA 5I30H 4OCRH 4AGMA 2GNTA 5BNPB 2EC9T 2PKDA 1N6QH 3BX7C 5LY2A 5FP3A 4LSPL 3AQYA 3BAWA 3VFSA 4UFLA 3A67H 5D1ZI 4AGNA 1XVSA 3BSZL 5FYZA 4KROD 3WD5H 1OLMA 3TS8A 3R7RA 3QQ3A 4AHZA 1CE1L 4MCNA 4G7VL 4MCMA 4KPHL 1V0AA 3NG5A 3SQOL 3FAWA 4XZUB 1MCPL 3EF7A 1FFTB 1LO4L 3GSRB 5IB1B 3OPZA 4DW2H 1QBLL 3MLXH 3VXQB 2ET7A 1IGFL 1TETL 2PPAA 4XE0A 3ZXDA 4IW4C 2VITB 2ZX0A 2X42A 4S1QH 2JFCA 1VCAA 1NJ9A 3U46A 1ZA4A 1JOPA 1FN4A 3QVAA 4G8GA 4XAKD 1SEQH 2BVEA 5FW8A 3GMQB 4GW4B 5C0FB 2CIKA 2FIKB 2FCTA 4G11A 1A34A 4H40A 1HHIB 5IMMB 2RMU1 5GGTH 5FAAA 3W9DB 3MI8A 3QISA 1LK3L 4P4KB 1XGQA 4FHJA 3QJRB 3VBFC 3L9RB 3UJQA 3OLGA 4KWKA 5A2KH 2ZX4A 1AO7B 1MEXH 1O0VA 5A2IH 1R64A 1ZNPA 1H9DA 5F7EH 4WW1A 2ZXAA 2ZOWA 4R7NA 1ZHKB 4CILA 5EULV 4COUA 2Z4QA 5J8OA 2PPCA 2WCPA 3EJJX 3BD5A 3B7RL 5E8NB 3IBEA 1CFSB 1WIUA 1BV8A 1NGWA 2GJ6A 3HRZB 2R042 4HKJA 4ODSH 2NXZC 5C07E 4JGNA 2ZXEB 3RWJB 1BPLB 4JQTA 2EKSA 4Q9RH 3EH4B 4LMQI 5CBAA 3HW7A 3HBZA 3NIFF 3GGLA 2DWTA 2DCYA 1E4WL 2XG5A 4HT1H 4R5XA 5I2IA 1UATA 4AQZA 2H8PB 3WIAA 5IOPB 1S2KA 1R0AH 4KJYB 1A2YA 2D31B 5C3TA 4CAGA 1IBBA 4JG1H 1ULGA 3IDIB 3IDYC 3II3A 5KSBF 1C8M3 4PRHA 3WDIA 3U9WA 4MVTA 2E3VA 1QVOB 2OKMA 1CXKA 1YEGL 1T7ZA 4TQ8A 1LNUB 2UY9A 2YUXA 3OVUB 2R072 5FDWA 1JFHA 4I0AA 3ILRA 2V9TA 1IGJA 3MV8E 3QR0A 3H2QA 4ODUA 4OF6A 4TLSA 1FL5A 5BS0B 1JN6A 2FQEA 4M3CE 1PYWB 1SY6H 2VISB 2X4TB 5SX5K 1H15A 4UF7C 2OSLB 1SBBA 3MUJA 4M3CB 5F1OB 4B9FA 1I1FA 3DJZA 5HJDA 3EGSA 2O6CA 3IDUA 2WSUA 1A7PH 4OQTA 3T0EE 3K2IA 3G08A 3KXFA 3O11B 1OQOA 2VDPL 1CFTB 3BVXA 2YWYA 5I75C 4DP1X 5C2BH 1PZ9A 5GSVA 2OL3B 1O5DT 4HC1L 5A1FA 1TJGL 2A0LD 3GUTB 5EZPA 4C4KO 5FC9A 3H55A 1YO4A 2UXVA 2XV0A 2EVXA 3Q2CA 1XDTT 3DMMB 4U1LA 2JK5B 1O91A 5E2TL 3UNPA 3OEAA 3HR6A 2DQUH 3MODL 3LCYA 4HSCX 2QEJA 2VDLB 1P1ZA 1Q8PA 5E8EB 1MHEB 3KYNB 4JL1A 4KC3B 3WL9B 1CT8A 3QNZA 4NZRH 2AS5M 1NA1B 3FUKA 4L4TA 3KPOA 4HWUA 1TNNA 1FL6A 4NJ9L 4PGDB 4V1DB 4OZ4B 5AZEL 2E8YA 2HLEA 4D0DA 2AEPL 2VUOA 2XACC 4ZJ9A 5C7XH 2BNOA 1NMAL 1E57A 3UROR 3TJHC 5JOXA 3JU9A 1NCRA 3QJUB 1ZXQA 1H6EA 1OZUA 4XC1L 3QIUA 2H3NB 4MDJB 4Z7VE 3D18B 4HXBL 4FPJA 2G5RA 4OZFH 4YPGA 1J3QA 5D1XB 3L3HB 3K3NA 3J07A 4M7KL 1TTCA 4JFZL 4P2QA 2P8MA 2XTJE 4XNAA 4ZODA 1CDBA 1K5MA 4HJUA 1D7FA 4WWKA 4KDTA 5KYXB 3PWUA 5ESQA 3VYPA 4PBVC 1NDGA 1BQLL 1E50A 2IH3A 4LLMA 5HHOA 1ULPA 3I59B 2FDIA 5GS3A 2ENRA 1ZD6A 2X12A 4G9FB 2XR4A 3EYVB 3W56A 4WHTB 5AKTA 3WOGA 4R4FL 2X89D 1IBDA 4ORGB 4AQTA 1A6VH 1RJZB 4IMLB 3RGVB 1UKTA 3OX8A 4ZFGL 1Y9QA 2HG5B 3Q8EA 5ADPH 4Q9BA 1AX2A 1YQ2A 2XJKA 2RMU2 5TFSL 2GFBA 2WN2A 2WRAA 4JFFD 1SDAB 2WA3A 5CWSB 2YU1A 2J1KA 2XBO1 2OJZL 1KIQA 4FQ1L 4LSQL 1IS5A 3J8F3 4XOBA 4E4ZA 4RESB 2Z79A 1ZREA 2CO3A 3GPEA 4UI2A 3TH4T 3VD4A 1X8EA 2BFGA 4R83A 3TA3A 3LA2A 4AM0A 2ENPA 3ARDD 1F86A 4U1HB 5DJ2A 4O51B 4YBQC 1I1AB 1BW8A 3OKOA 2ZXBA 4CZSA 1KPUA 3RWGA 3BPCB 2BNRD 2WSVA 4AH2B 5J11B 1PZ8A 2YMXH 2PMZA 1IG0A 3E6BA 4OFKA 3G5YA 2JKXA 2IWGA 4UZSA 3N9NA 3II2A 2WZPD 5KHKA 3GDCA 4H8HA 1KCLA 5L7XH 5CSBA 4XPAH 4ZFOB 3VFUB 3PUQA 1T4KA 1JVLA 3NA9L 5KBPA 2F1AA 2WC7A 4K0OA 1SPPA 2RM23 3DVGA 1RZIA 1C9SA 2QZ3A 4AC4A 4Z5RB 3V6FB 1NM4A 3AAZB 3IFPB 2NY5C 4RX4D 3GHNA 4YDLB 5JR7B 3BKJH 5LGKA 5SV4A 3B6SA 4I4WB 1CXEA 1W8NA 3MLWH 2CO1A 4KK8C 4KK9D 3T1MA 4L3FA 3AXLB 2R1YA 4YZFF 2W94A 3C5ZB 3C8DA 3VDAA 4CTEA 3P54A 4OLZL 5FKAB 4QPIA 1M71A 3QK0A 3AG1B 5HSFA 3P2TA 5I8EA 5D2NE 1JNHA 5FUZL 2E76C 3PNWA 1J3RA 2VTFA 5LGJA 4G72B 5FOBA 4JJOA 1DVTA 5EO0A 1YUKB 2Y5TA 3ISRA 3BN9C 1DVFC 1NFAA 3RAJL 5FYIA 4WI6A 3USUA 3TZVA 4AVSA 1SEBB 1WWYA 2JG8C 4RBPK 3IMMA 3KMHA 3G9VA 4IRJA 4ODWA 2VLRA 2ET1A 2CV6A 1NCCL 1BQSA 3FUNA 5FJHA 1MWAB 4ZZ5A 1UT1A 3RQ3A 1XGTA 2VZPA 3EJKA 2HWD1 1QFWH 4HJTA 4X4KA 4AEMA 4FXLA 3T4AA 4XVSH 3QEUA 4XP5L 4P9YA 3Q5OA 4XC9A 1M4KA 2F6BA 3ILDA 3MNMA 4JRYE 1KNOA 4OLLA 1UY1A 3QDAA 4HXAH 3GMNB 3GUFA 3HN8A 4NM8H 3VCLA 3MLPA 4HPOH 3WDVA 4LLWA 3KYMB 3O6FD 3B3IB 4OSUH 3C08H 3T65A 3EXJA 3RURA 1VBC1 2DM7A 3F05A 5AL0A 2PHWA 3OD0A 3P9LB 1IGTB 2ZTNA 2GQHA 1J9TA 4JGJA 4MUVA 4QTIH 2VB5A 1E9PB 2DQTH 3RE0A 2TBVA 4N53B 5T1DL 5KYNA 2ZUWA 3NBNA 2RJKA 5G2NA 3T0EC 1HRI3 2ZUQC 2YEZA 4AEFA 1IBZA 2ZCHL 1FQ9C 3LZFL 1ERNA 3F7LA 4FL4B 3IKCB 3WJMB 3WINE 4OKDA 3GI8L 4FG2A 4M56A 4NJAH 1M3IA 3ET9F 4TSBH 5EZOL 1T2XA 1ZKAA 1WWWX 1D2PA 2VLRB 1UOBA 1XNBA 3WVJA 2LLLA 3N06B 2DICA 4Z95H 2RALA 1J1PH 2HLFC 2IAMC 3IPBA 3QB7C 4IKIA 1RULL 2WHVA 1DQTA 4AYSA 4CU6A 3GT6A 3IB4A 4L8BA 4MA8H 3DRQA 2OMYB 2VZRA 1BZEA 2Z8RA 1XB6A 1ZYBA 5EU6E 4YHIB 1NFDB 4WM7B 3LKPB 3U6RA 1BMWA 4UMSA 3O3BA 1NEPA 4XVTL 2VN6A 4LORA 2C5DA 3BUQA 2IALA 1JHTA 4EI5D 1T1YB 1OT2A 2J1YA 1G87A 4GRWH 5C0BE 4JVWA 4GUPA 4X7CC 3P4OA 5T5NF 1VBC3 3AFGA 4CUBA 2LTQC 3EFDL 1H8TC 1JF1A 2YD6A 3IJYA 5AW5B 4QTFA 5LGHH 4ZOCA 2N01B 5TQ0H 2CU5A 1S7SA 3D2UD 3NIFB 3VXPA 2X53A 3DX8A 3OPTA 5EBLA 1JWUB 5FZGA 2Q0ZX 5TE7H 1HN1A 2Q7NA 3VAEA 1WPCA 2YLHA 2ITDA 4UBHA 2YRLA 4OF8A 5I16B 1B88A 2X3BA 2QKSA 2VQTA 2NZ9A 2F61A 2EXSA 5BJTA 1BLZA 1AYN3 3HJEA 2EVIA 3BVDB 3TT1H 1D5XB 3RX5A 5LA9A 4FL4C 1C8M1 1IC4L 1WFNA 1X5ZA 1BVZA 2O30A 2VMEA 2XQYG 3F00A 3GM8A 3GK8H 5DUJA 3UAEA 1CD0A 1T2QL 5CLXA 5ICZB 3A5VA 4MFHA 4IRJD 3O8XC 4CBPA 4IU2A 1EHLH 4CN6A 4MYPA 4I85A 4Q7DA 5FHAL 3ZHKA 1K45A 2XLGA 3L3GA 1UCBL 1G7HB 2WWKO 1X7QB 4BGLA 5ECGA 3FJSA 2B4CL 4EXPX 5HYJE 2HWZH 1G43A 4TSCH 4MNHA 4XWGH 2ZPKH 1TZHA 5AB0A 1S7QA 1EEYB 4NENB 1CVRA 2FR4B 5HHXH 2FZ1A 2Y6TE 2O61A 4LO9A 4WW2C 1FMD2 4LO7A 2AI0H 4W6XA 5CHNB 1L0YA 1ZTXH 2FLMA 3DO7B 1H2LA 4D8OA 1YQCA 1YUDA 1OLZA 1AC6A 4MNHB 4K23H 3EHBC 1TME1 3F58L 2C9KA 4M7ZC 1K5MB 3HPJB 1BAWA 1RU9L 2ITCA 4XNBA 4F9LA 1YG9A 4NNXA 1EJOL 1HKFA 1QLRA 2ZUVA 3CE1A 5DHVA 5KOVC 3VZNA 1INDL 1NC4D 1UEYA 2A6JA 2ZWLT 5E6UB 1WLTA 1NCTA 4JHZA 1RITA 1F4WL 4YG6A 4MDJA 3RHWF 1UOKA 3UC2A 4LCIL 2FEDC 4L3EE 2YEVB 1OAXH 5GGSY 1GICA 3LZZA 1IGJB 5AL8A 1OOAA 4QRPB 4N5ED 1BVNT 3DBXB 4LKCB 5EA0H 4YZ3A 3ALPA 4GJYA 1CESA 4U0RB 4KMTH 4ELKA 1Q43A 3ZIXA 1MCCA 2OIIA 1ODUA 1WEJH 2NXZB 4OZ4A 4LBLA 2DTYA 4G5AA 3IDIA 4P46A 2R0LL 2LVCA 2CK0L 4AQSA 3DUUB 3KPPA 4JPQA 5BJTB 3O5SA 5IY5B 1CT8B 2G0LA 3QNZB 4GAYA 1NAMH 3V95A 3N7MA 5F1KC 1ILSA 4BM8A 1DBML 1S7WB 4GSXA 1WQVT 5BZXA 2PYEB 3BGFC 3TGXA 3FB6B 2MOVA 4ONOA 4A6YH 1NKGA 3I2HA 2CDEB 1UACH 3AC0A 3IPEA 3WS6A 4J8QA 2CDOA 4WM8C 4IE5A 4HKJB 4O00A 3VTMA 4MWFB 3GRWA 3R7QA 3LYRA 5C2UB 2WT0A 2YC2A 4PJHE 3CPLA 2AQNA 1R3LA 4XI5D 2ATAA 4P2RA 4S1DD 1S8DB 4HS6B 3P0VH 4RRPA 4TYUA 5HHPB 3OJBA 5ISZE 1JXGA 2J88L 4NO0B 2B4KA 3RYRA 3ECBA 4DVRH 4BFEA 4DFIA 6FABH 3SJVE 4Q5OA 2VSCA 1WMFA 4XXAA 5ELIA 5F7DA 4TUJA 2A5ZA 4D94A 3OMZA 5C0DB 4QY8B 1EJFA 3B34A 2Z7ZA 3O6KL 4TTDC 5T3ZE 5A40E 2B9UA 3U30C 5ANHA 3IFNH 3FAXA 4IRZH 4Q6IB 4HJIA 4PCTA 3T2NL 4MZUA 4PDWA 1U8NB 4JO4H 1RZJL 3AABA 1NZIA 1J0ZA 3AM8A 2IXCA 2YPLB 3EG9B 2BSDA 2W92A 5KUMA 3TO4A 3ZDXF 2JDHA 1I8AA 2ZYIA 1SYSB 3BPNC 1UXZA 3RJRA 3WXVL 2Y07L 1R1ZA 4KXAA 1G4MA 4WTZG 2P5WE 4JLRA 4KXBA 2PHDA 1JVOA 1HINL 1PD0A 1J5CA 1CQ9A 5HYQA 4QPWA 3KJ4C 1WAEA 3AKQA 3DV4A 4YOKA 4V1DD 4YWGL 4Y26A 4PUBH 3IJ9A 3LS5L 3UTSD 5KXEA 4Y4KC 3RTQA 3R6SA 1MIEL 2FJFB 4ANUA 3FUQA 2WUCL 3DLQR 1MRCL 4HS3A 1IM3B 3UTTB 4K1ZA 2AQ3A 3U30B 1JYVA 4FCAA 5FY8A 1Q94A 5E8NA 5FS5A 1OSPL 2VXTH 4GUPB 2R9HC 1PPIA 1IV8A 1N7MH 1MY7A 4WO0A 4XN1A 2OTWB 4YVWB 4L2LA 4EN9B 1B4RA 3GDBA 2G9ZA 4QXHA 1MCOL 1A14H 3SZKC 3H2WA 4AM0Q 1YNTF 3GHBL 2X1XR 3SDCD 4UFHA 2YXSA 2ESVE 3IN0A 3MNDA 4B9CA 2IAMA 3N0PB 4XFIA 5DZ9A 4PJ5D 2DDUA 4N24A 1YEDB 3K8LA 4X80L 3T6XA 1PIV3 4Z92B 1ZVYA 3WFCL 4TVPH 3OHXB 2YRPA 1WBZA 4LDCA 1BZ9A 1NMCC 4E41E 5DRZB 2WNWA 2YIHA 3FBQA 4HHAA 1JZGA 5DQDH 3HUJA 1CVNA 4LEOB 2X0WA 2D98A 1ZGLP 3O0VA 1GYAA 1N5YL 4U1KB 4IQPA 1NFIB 3VX1A 5I1LB 5J6GB 4LUMA 2DEYX 3A4UA 1DQLL 2E7DA 4J4PA 2NNAA 4G9DA 2NY5H 1NC4B 2QGEA 4UTAL 3KQRA 3OHMB 4Z3EA 1PY0A 2A75A 3T6ZA 3QFJE 2UVEA 4FLQA 3S98A 1XF5B 3ILPA 3NDZE 2WO3A 3KF5A 3FSAA 2GU9A 1W8OA 3L4YA 3ME0B 2PNDA 2OI9C 1AKJA 3QFJB 4I4WA 2IANE 3LJ3A 3N1FC 3V7AG 3VMOA 4GT0A 4AENA 4AGLA 4E9TA 3C60A 4HUVA 1MS4A 1PZAA 4N5EC 4D9LH 5CZVH 3L3DB 2A9NL 1V8HA 5HGDA 2AC0A 1GNZA 3BEVB 3MUZ1 2YFNA 3MNZA 1CN4A 4LFHD 3VRLE 3CSFA 1JI1A 3WNKA 4UT6A 3HOBA 2IAAC 3WNJA 1HHGA 2BDRA 4IE4A 4HF5H 1BD2E 2QSTA 2Z8VC 5BXXA 3GLDA 2FBJH 1DYKA 3MBEB 5JW4Q 3LRGA 4WUUD 1AO7D 4KRLB 4IOFD 2Z31B 2VL4A 4PJHF 3M7FB 3UGGA 4MCZB 3MRLB 1MCDA 3DOIA 5EEZA 1BLIA 4PP2A 2X4UB 2IV8A 3Q8CA 5DHMC 3KWTA 1TNFA 3EQEA 5DJCA 1XBDA 1A21A 4EBQH 3TA3B 5MEPB 2XZZA 1BAFH 5CJQL 5GLWA 4XTRC 4LHJB 1NLDL 3ARBA 1ZZ6A 3SKJE 1T1ZA 4X6CE 5E0QA 1KBGH 3DTUB 1W0OA 5LVEA 2R8SH 1E40A 4Z7QF 3MRDA 4HU2A 1O7FA 2E7MA 5CIPB 1BBDH 3U14A 1N1VA 4FI9A 1UL9A 4TZDA 3KLQA 4XMTA 3HFFA 1AL21 3DF0A 1A3LL 3B1TA 5AAWA 4MQTB 5CJ5A 1HXS3 1QOTA 5JOEA 4Q8LA 5EWIL 2ZXWB 3BP4A 5JMRA 1AR1D 4DKEH 2XU9A 4WHTA 1TCMA 3BH8A 2AREA 1SMVA 2D7OA 3V0IA 4EZLA 4NP4H 2F19L 4H20L 4X99A 2X4QB 3ZIWA 2NQDA 4PJ7E 4YDJB 3VDDA 4NUGL 1ZZ8A 1BBJB 1T89A 2ARJB 2G5BA 4PQQA 3SMHA 1F02I 2D6OX 2HB0A 4TRPL 3CFIC 2JG9C 3EO1A 3CLFL 5HI5D 1HIMH 1D5BB 4E68A 2ZJSH 5DZFA 3SGDI 1FUNA 3ML8A 1HQRA 1H8VA 5FK8A 2GG1A 1ZLWK 4DEPB 1JWSB 1CD1B 2WCSA 2X88A 3AYDA 1BXXA 1KPUB 3GIZL 3KLAA 5F7LB 3TTYA 3K75B 5DABA 2K1MA 2F53B 4NFDA 5IMKA 1PHMA 5C5UA 3H7BB 4XH2B 3K8KA 4Z0XA 4HFUL 4JRLA 5JNYB 3MU3A 1GL4B 3F3HA 4FQIH 1AZDA 1R3IH 1QMUA 5ICXA 3FSOA 1UTDA 1REFA 1KBPA 4GB31 1HB4A 2W0KA 1HDKA 2JDNA 2JB4A 3VGFA 3K6NA 2JKJA 2ISDA 3QXAA 5GRWA 1BQKA 4TS6A 1KBWA 3VRIA 5C9AA 1QRNE 1ZV5A 1YYCA 2NNRA 2QR0B 1EHKB 2ZCKL 3BPNB 3N6YA 4NYLA 5C71A 1GWLA 2A71A 4XHBA 5GLZA 2OZNA 4P9HC 1O4YA 5A7WA 4DFSA 3RNQB 1PNFA 4G9FA 2QQWA 3WG3A 3E2HC 2X4RB 1YNKH 1NFDF 4MNQB 2C1PA 3T0EB 4FDWA 1QLFA 3VXMB 2WUBL 3BAKA 4WV1B 1A02N 3S5AA 1ZLVK 2ARXA 2MPAL 4S2SA 1ZA3B 4NNYA 3D4GA 8CGTA 4JRWA 4ETYA 3UZQA 1F13A 2Z31D 2WFF3 2FWLB 4META 4CUCA 3IWVA 3SC7X 4U1JA 2BSBA 2QQKH 4MDIA 2GC2A 4XEZA 1AS6A 1E3ZA 3IDNA 5D7JB 5AC91 1CB4A 1ZE3C 2I32A 2RTTA 4G7YL 4ODUB 4PTUA 4AXWB 5E16A 2BVYA 1BF5A 1JCVA 1YRKA 3L2MA 4J27A 1DQKA 2BMKB 3CFCL 4WJ5B 5HYSB 1AYM2 5T1LB 3IGFA 1KCWA 5HD8D 1NC2B 4HAKA 2HUHA 1UM5L 2X4SB 35C8L 5KTEH 2DQEL 3DPDA 4PWKA 5E1IA 3T0BA 3MW3A 2OQJA 5D1ZD 4Y1VA 1IAKA 1UJ3A 3DN7A 4LOSA 1MCEA 3V8OA 4GW5A 2FYYB 1FWXA 4LRNL 2FCVA 2VCBA 3VXUA 3BYWA 3KPRB 3QDHA 1A4CA 3VBHC 4OLXL 2VQ4A 4R4BA 5GRZA 5JZ7D 3DV8A 4CCLA 2AZAA 4GT7A 5CBEA 4IEFA 1D5MA 1P4IL 1QSFD 2I5YH 1YSOA 2WXMA 1A7QH 2FQFA 2OMXB 4N20A 2EIZB 3KH3A 3CH1B 2P7TA 4FD0A 4N8VG 1N3OA 1CK0H 1TMF3 2A6XA 1X9QA 1SHWA 3ASNB 3DIDA 3F7YB 1DIWA 2VW0A 3A4FA 1OARH 4JM2F 3VQLA 4RMUA 4C54A 1JGEB 1KGCD 1RHI3 3LCPA 4U6XA 3KL3A 5EXOA 2COVD 2W5PA 1JRHI 1QNZL 4B0MB 5FYJD 5JW5A 4QM8A 5GZCA 2E7LC 5LW9A 2CDFA 3KCWA 5I1KH 3IWZA 2E6QA 5IUQA 1EMTH 3VFWB 2ZS6B 3TEXA 4I5BA 1MREL 4PJDE 3U1SH 2WWMD 1VGKB 1OTTC 3OWEA 4YFZA 1YJKA 3HJRA 4FAAB 1WCBA 2KS0A 3RYMA 4L4VE 4K7PX 3P6BA 1IARB 3H6AA 5IK3A 2UY6A 4HANA 2V3DA 2MSPA 3BSHA 2WKOA 3KPMB 4JZNB 4ZFQA 4C4KT 3VN4A 2PW1A 4IV3C 3J7HA 5DRXA 5DMKA 4PVLA 1TMF2 2QQIA 1ZTXE 1KJVB 3BKCH 1IEHA 1S0CA 4PGEA 3IDMA 1SZBA 1OGTA 2QQOA 2WS93 1SJEA 3SKUD 3ZXGA 3VACA 1OGSA 4MXWB 1NGWB 1WZAA 4TQEH 3V8CA 2IWEA 4JDTL 1COBA 1HT6A 2W3JA 3ZT6A 1F4HA 4KZEL 2MNWA 2Z91A 2KLSA 4HX1A 5EO9A 3TZVD 4G9SB 1XCTA 4U2AA 5FMOL 3DTXB 5HHMB 2BIMA 3ZFEB 3D3VE 4WO4B 5HYFA 5I18H 2W9DL 4G59C 4LLDA 4QWNA 5DUBA 2OSXA 3DO3A 3WDYA 4GIOA 4GW1B 3N3EA 2V5SA 3ARDC 4NRXA 2E6PA 3HHRB 3PP3H 5HI0A 1BVOA 3SNMA 4K3DH 4TXVB 3ARUA 3E8UH 3T0WA 5C70A 3ZVVA 3BIWE 2NQYA 4BA8A 3CFBB 3M6DA 1CAUA 1X9PA 2B1HL 4MQXC 1FLRH 4FTVD 2F7OA 1FN4B 2Y7OA 4G8GB 4H0GA 1R3JA 4JFPB 4Y4FB 2OMTA 1E6OL 4EI5A 4QQHA 3QC6X 4Q9QH 5IK5A 1L5GA 1NOLA 3OUIA 3HE7A 1EVTC 5I0UA 3TCLB 3ACGA 2V5TA 1DFBL 2X1OA 3F83A 3I6LD 5CILL 4NROA 3OB0H 1RVF2 4C8DA 1KPVB 1JZIA 5DZOA 4PDWC 1SJHA 5A6XA 3I74A 1ZIAA 2OMBA 1PKQB 3F12A 3GNMH 4PRPB 1IM3D 4KQ0A 4UM8A 2ZX5A 4LIQH 2QQKA 1DQDL 2VY0A 4RHV3 3H7YA 2YD1A 5DC0A 5GGVL 2PHXA 1OF0A 4OZIB 4UTBH 3SBQA 2ATPA 2VR9A 4G8GD 4CE8A 1AR83 2QJDA 3HBKA 3AU1B 3ZFGC 2K7PA 5HHVL 4P99A 3U1PA 4Y5VA 2E4FA 7PCYA 1JE6A 4LBKA 4W6WA 3L48A 1FV1B 3RB7A 2YLKA 5IVYA 1ORSB 4HUXB 1VFBB 1NBYA 5B38G 1ACZA 3P3SA 2RG4A 4WM8A 1FVEA 1NGPL 3WG7B 4I2XB 1ND0A 4JQVC 1RSFA 1IS6A 4OHVA 1ZS2A 2NUPA 3UC0L 4K23L 3T3PF 1TZ8A 1RUF2 5CAZA 2B77A 3S35X 3RIAK 3AVRA 4GKYA 3B4NA 4RA0C 2VLLA 4YZFE 4XGZB 4LBEB 3BH4A 3EJSA 3L3KB 4P49A 4GJTB 4WKZA 3CVIH 2O5YH 1Q8MA 1MPAL 3MRRB 3CG8A 5JXEA 1AD0B 2HT3D 4XF0A 2DM4A 2WVSA 2KLTA 4YO0A 4IHOA 3V4VL 5ACLA 4N0FA 4P2OA 1GY1A 4IEQA 4GY4A 5AVTB 3MNWA 4KHXH 3KZ8A 5DJXA 3LDBA 3GHEL 4RSUA 1DVQA 4LLVA 3ZSSA 1M1XB 5TH2A 1QRKA 2YUVA 1I4FA 3JV6B 4AT6B 2V7NB 2J1RA 3MRBA 4L1LA 3HS9A 4UOQA 2OUJA 3GXPA 2QDWA 2Z93A 3DO4A 2GC7C 2ZD0A 2WVTA 3TBVB 1ZSDA 1RL3A 4WM8B 1Y9GA 1CDYA 1NBYB 2WXHA 4CDQA 4COVA 1BQHB 1ZT4A 5LBBA 2ZGKA 2V4LA 3NIDB 3OKKB 4R2GB 2IV9A 4X98A 4BQ6A 2WAQA 2D3PA 4MH0E 4XC3L 2NMSA 5JQIB 3W81A 4LVNB 4D9QE 4FXKB 1TJIL 4QRPD 3U37A 2KQMA 2MFNA 1BXVA 5KVEE 3U2IA 4NQCE 5KSVA 3N9GL 3P73B 4OFGA 4D0BA 5GJTH 3ROOB 1KULA 5CEZD 5J13C 2E9IA 3FZUC 1WBYA 1GYVA 2HAZA 2PTTB 2QL1A 4LLVB 1NUKA 1WMXA 3O12A 4WVVA 4B9IA 6PAZA 4FZ8H 2VH5L 2B8OT 2CLZA 3MNVB 4YE4H 2K7QA 5DGRA 1FNEA 1G9NL 2ZYRA 4N0FB 4AZUA 3V0BA 1IGCH 1KPVA 5LN4A 3MYXA 2NW3B 4AL8L 2ADYA 3UGFA 5DLMH 2Y0IA 3ULAB 3RL1B 2X5IB 4E9XA 3U36A 1S0DA 1BM7A 3LRHA 4PWFA 5C0RL 1CXLA 3L3KA 4U1GB 1OCWL 4FP8L 3T09A 4X0NA 4ZSOA 2QQLH 1MH5B 1RZ7L 4CP2A 4AVBA 2WL1A 2WXOA 4H2AA 5CZXC 3D0LB 4P2QE 2XIIA 1YEJH 3BFOA 1Y6NR 4OJEH 8FABB 3EGXB 3KNBB 1BYNA 4UCFA 1CDCA 2XA8H 4U7SA 3N42F 2DV6A 2JSFA 3SPJA 3VFOB 4HPHA 2JDUA 2F54A 3BCFA 2Q86B 1NAEA 3HUJF 2X87A 3X1FA 4AGGA 1ORSA 1J0YA 1XGPB 2H1PL 1LL1A 1GGUA 3BAJA 4XCNA 2Y72A 3M1OA 1XTLA 1HAWA 4L3AA 4NWUL 3BVUA 4YEEA 1IVTA 1E5HA 3VWJD 5CIPH 4F3FA 1UZVA 4QX7A 3ZMOA 3OBRA 4FNLL 4PJ8C 1PGL2 3RGVC 1DYZA 4L8DB 4AEDB 2O5XL 2HBTA 4ORZC 1AY1H 4BHUA 1A7NH 1YQ8A 5JXJA 5F7BA 4WI0B 3VBSB 1SY6A 1HH6B 1TLMA 2QQJA 4LQFL 5EIYB 3PVBB 4KTEL 2G0KA 4LIVA 4QPIC 4Y2NA 3NJXA 1H19A 3FE5A 2IBZX 4LAQL 4J25A 3ACIA 5LBCA 5FTTC 1HESA 5HHNA 3AY4C 2FQDA 3OJ2C 2ADDA 4Q27A 5CD3B 3X1GA 3PS6A 1VLXA 4MJ6A 4ZMWA 3SXWA 3GI9H 4PJ8A 3C60D 1BXAA 2EYRA 3CFDA 3QH3A 4JB9L 3VXTA 1HL9A 2F53D 3CZUB 3CLEH 1DYPA 3MPBA 2JKLA 1WA6X 3T2TA 3AUVA 1VBE2 3AG2B 5JUEL 2Q3ZA 1VGKA 1GFF2 1ADQL 5DD3L 1XNAA 2DURA 1OOPA 1MFBH 4JFUA 1F2NA 4XN2A 4X0KB 1L0QA 1TMCB 4KVNL 3BPSA 2GJPA 4JFOB 4ZBJA 2AEYA 1IU1A 5DUBB 3LHPL 2W88A 2YOAA 3BZDA 3T4YB 1HEZB 1UD2A 1YYLH 3D0JA 4IJTA 1U33A 4HZLA 1JGEA 2ZOKB 4ACPA 1BAGA 1U8LB 3DX0A 2D7MA 2VLRD 1E2VA 3QC5X 5IR1B 4L9BA 4P5HA 3O1MA 4H5SA 2OXGA 1LD9A 4XFGA 1AHSA 1RH8A 5F6KA 1S5IL 4P2RE 3EJRA 1UKRA 1YJDC 2CG9X 3DPBA 3VFVA 3KHOA 4E0RA 1ULDA 2NSQA 4KNTA 3ESNA 1HWWA 1FPTL 2RS32 4LQ1A 2DPKA 1WCKA 3MUGB 1IFGA 4BE3A 3D3VD 3VXUB 1QQDA 4UU9B 4YHKL 2BSED 4NOTA 2JG8A 3AADB 3OCPA 3J8F7 1VIWB 4OV5A 3O0LA 2MNJB 1DBAL 1GS8A 4GQRA 3B9CA 4FP2A 4YGBA 2D03H 1LOFA 3ITQA 3ULVD 1DCSA 3WD5L 1NLDH 2IADA 3WS3A 4WJ5A 3OB8A 2IBZY 2P5EB 1FNFA 5CJBA 5IB3A 5A3NA 2QSCH 2V73A 1OIOA 4K9JA 3RDTB 4E9RA 1LEMA 1DBNA 4OLYH 3N2JA 5CZXD 2VUKA 3COOA 2CAKA 4YMPA 2P3KA 2WLIB 1ZT1A 5JW3H 1AXZA 1DUYB 4XCNB 2EXTA 3MJ8A 2ZGPA 4HFSA 3F6LA 1J5OL 4L4TE 3CFTA 1E8ZA 4G8AC 1L3JA 4BQWA 3ATBA 4YGCA 5C3PA 5IVVA 5IQ9B 5ACA2 2PP7A 1F35A 1UB6B 4H20H 4JFED 2YC0A 3D85B 3TVMA 4HV8A 4DVBB 3ULVH 4ZPIA 2ZG1A 4ADGA 3CZUA 3NAPA 4M5YL 2VC2L 3E8VA 4HEMA 4ZSOB 2BO0A 3H6JA 3HCVA 4LHUA 3M1CA 4XF4A 1BECA 3CFJA 3QIBD 2O14A 2Y64A 1CGTA 2XZAH 4DEPC 3ARVA 2X44D 4MNGB 1M4WA 1UMIA 1N2RA 3MRIA 4KKBD 4XP6L 2JWPA 2DRUA 4LASL 5JDBA 1CYGA 2NW3A 3NZHH 4Q4X2 2FD6H 5IAVA 1QWHA 1W72H 3QP3A 3UIZA 4UW4A 2WKGA 2CAVA 3NRQA 2QHRH 4IGBC 2VM4A 4XIOA 2DKMA 3HZYB 1ND2B 4BUQA 5I8CB 1SLXA 1TQWA 3KGRA 4FQIL 2JDPA 3NN8A 2K4WA 4ZO7A 4F8AA 1A7OL 1N5AB 3BGAA 4M6OH 3DUSA 3HC3L 5I8KL 2TEPA 3PFUA 5SV3A 3OSDA 2XY2A 5DMJB 4ZX5A 3U48A 1MLCB 4NX0A 3G04B 3FPXA 3VNYA 4HC1A 1F3DH 5I1JH 4GI9A 4HH9A 3TV3L 4AUUA 1BQHA 1ZT4B 4CDQB 1L4IA 1CLZL 1KXVA 3ZZQA 1CX4A 5I1GL 1I3GL 2R4RL 1FFRA 4HGMA 4X99B 1YN7A 2IDUA 2QADB 2XICA 2I9TA 4LCWD 3FQRB 1RUML 1ZJBA 4GXVL 5B7FA 1WAAE 1FGVL 4HBCL 4KO9A 1YEKL 4OF5A 4YR6B 3TA3C 4BXSV 1DL7H 3GZPA 3N1GC 1AIZA 5CLTA 4Z7VA 1IC5H 2F58H 2GSIB 5D5MA 2N1KA 3MLZL 1SJMA 2ZMNA 3R8QA 4RGNB 4XB3A 4OYUA 3MV01 2ZKHL 4EMZA 3S37H 3NFNA 5A1LA 5CFAA 4XVOA 1J0HA 3BT2L 5AENA 3I3BA 2NXYC 4QYAA 4ZTOH 3KS0H 5CR8A 3WNOA 3N55A 1UT9A 1B9KA 3W39B 2WQVA 1OE3A 3G5VB 2JKBA 2BVPA 2BP6A 1ZS8B 3SOTA 1H8SA 1OE2A 1I9RH 3S8FB 1AL0G 4IGPA 1A9BB 2ZKNA 4XPHL 3FN9A 3NCFB 4GQQA 1RUG1 5A6YA 2NTFB 4RGOL 1W6OA 1LYQA 3S36L 2A6WA 1YPZA 4OLXH 3WW1A 3L2LA 4G3YL 1SDWA 2WO7A 3VV1A 5FHBL 4OKVA 1DZBA 1TCRB 3U4BH 1DQML 2NY3D 3JV4B 3ZX1A 2G60L 4A7UA 4FJZA 3S5YA 1AOHA 1GZPA 2B14A 5DHYB 1RHI1 2V7NA 4OFVA 4TSAL 3I9GL 3BOWA 1NGQL 3R0NA 2EZ0D 1XNTA 3LRLA 2X2YA 1A25A 3O2WL 2AV7B 1AHKA 4P59H 3TN0C 1P5UA 3CC1A 5TF1H 4HXBH 1SLIA 3IT8A 2CGRH 5DEGA 2C4FT 2IG2L 4GNKB 5FZ7A 5FCUL 3TL5A 1BBT3 1FBIH 1I5ZA 3MRCA 2PXJA 4ZYKA 3K6OA 3PJSB 4KI5D 4QXGL 1YMHA 2IQ9L 4PQ9A 1KOAA 3MRQB 1JXDA 5D2LF 5FYKH 4Y1YA 5D7LA 2CZNA 2HG0A 1U36A 2GITA 4K8RB 1H9WA 5H8DA 2V09A 4KUZH 4KMLB 2XPYA 5I0YA 1MACA 4YRDA 2GJZA 1IKQA 1AGDA 3GJFH 3X29B 5TK2A 3RVHA 4Y3OA 1P5UC 4R0LC 3FTUA 5I23A 4W6YB 4GQ9L 4LAJH 4JGYB 4Z1VA 1KCVL 1UOVA 3MBEA 4KKAC 1TSRA 1NTDA 1FVEB 3PWVA 1ZBE1 1QAWA 4TPRH 1MS3A 5IJDC 5T8IA 1MUJA 3WTVA 3HOGA 3WR0A 1XH2A 3LPOA 1M42A 4KXDA 4JDEB 5DA0B 2O6PA 1AGFA 4JRYA 1KEGL 3J7MA 3T0VA 4D8PB 2J2ZB 5TK4A 1XSIA 1RIVL 2B1AL 1FYTE 1LWJA 2ZOTA 4EN8B 2OYKA 1EDQA 4DJMA 2CCLA 1OAQL 4MLSA 1PEWA 2FECI 3QOPA 2DQHL 3ZXAC 1OY3B 1OGTB 4XZUG 3JWNC 2E7CA 5DRWB 5C0AE 2L7EA 3E2HB 1Z9NA 5KXCA 3KPNA 4B4RA 4Z7WE 1F2QA 3S8WA 4EN0A 3NABH 4OZFB 3V52H 1JBJA 1IPSA 2JCCF 4YDZA 2EYSB 2MCAA 2IXQB 2BGPA 4PJGE 2NX5D 3EG9A 2VSMB 3Q9OA 4YWAA 4XWOC 1E6OH 2VUJA 2Z1PA 1NLSA 4Y4FA 3GTTA 3P4NB 5B22A 1RUC1 4YVSC 3FCSA 3EJTA 5F9JB 2B0SH 1NEZA 3HE6C 5E5MA 3EH2A 3MRGB 5FLUA 3WFZA 2XQBH 3WF4A 3FO0L 5E0FA 4PDWB 5MHSD 3EOAB 1YC8A 1DGLA 4WKXA 3V2AR 2R0HA 2GSYA 1OT4A 1VPOL 4QYOB 4WNQA 1P9MA 2EO7A 3HNSL 1NEUA 2QQMA 4WUUA 3NRUA 3N44F 3RGBA 3A6OA 4MNQD 3WSOA 4PW9A 2BX5A 1JZEA 2YGMA 2G2PA 4MMXB 3AM2A 3FN0H 1KB5A 5DO8A 5EC2A 1VRH1 1PW3A 3FYIB 3KHCA 4JFDB 4NVPA 4BIKA 3VQMA 3UTPD 1KTDA 1MS8A 4X8XA 4LLYB 5EBGA 2OZ6A 4CRPA 1OO2A 5D9SB 5F0LB 2E0PA 5TE4L 1S2BA 2ZAGA 1DJYA 1PFCA 2XJPA 2DYCA 1XH1A 1CL7I 2CDEA 4MJIE 3UJTL 1GHFH 4XW3A 3JVGA 2ZCLL 2X4PA 4GO8A 4XNMA 4CCJA 5F7KC 3K6SA 5DRXB 1VSCA 1T04B 3PLYA 3PWLB 4P2OD 3TBYA 1NBZB 2ZUUA 3B56A 2AABL 1CFNA 1KTRL 2IJ0C 3P02A 5C08D 4UFMA 2OQJB 5TQ2L 1B3IA 2VOTA 2O5ZH 3AXHA 4GAFB 4I9XA 3RUGE 2Z31C 1AXIB 3CDCA 4N0UE 5SWSA 4ELKB 1M7IA 4Y1UA 3VD1A 5A6IA 1CAWB 2XH6A 4U36A 3M88A 4TUOA 3H3ZA 3S4SA 3D39A 1TF4A 4V1DE 2FATL 3RUGB 1MQKL 2J25A 3NJMA 3HI6L 5DD0L 1RMU3 2IXJA 2FGZA 1B2WH 3TWYA 3QPQD 4ZPTA 1HRI1 1X5YA 1AFVH 2FDGA 1FC2D 1FNGB 1K8DA 5IEKB 3RWDB 1M05A 5E2TH 4N0YL 1SDYA 4Q0QA 1EEZB 4UILL 4JVUA 3US0A 2D3RA 5IJVA 3U78A 4CUGA 1JTTA 1ETZA 4NQDB 3QUKA 5IVXE 4B5EA 1CX1A 3JWOC 4FEIA 1RQ5A 4BSWB 3H3UA 3ETBJ 4LVHB 2EIZA 3GMRB 2VZUA 2K6WA 1FZKA 1BQ5A 2WMPB 4DP0X 4QHOA 1ZMYA 4I18B 4PTTA 3VKLA 4P9LA 5BO0D 4FA8A 4MHRA 1Q5OA 5FO7B 4JO5A 5GZEA 2YUEA 5FZAA 4K7JA 3UGEA 1FGNL 1CMOA 1H1AA 1C5DB 2DDQL 2PW2B 2BDNL 1COV2 3NAPB 3WUDA 4NQCD 4Y16C 5L2KD 2YA0A 2BPBA 4QPYA 1LO3H 4F8NA 2VERA 2F7PA 5BRZD 3UTOA 3M3QA 2KL6A 2XG4B 4D9QD 5F2WA 1EUUA 3O6LH 5CINL 2Q76B 5K9KB 1MWAL 4K94L 1N12A 2EDLA 5EBMA 25C8H 1JNLL 3ATEA 4PJDB 2MEV1 5EF1A 2DQGL 5T1LA 4N9HA 3TCXA 4LVEA 3F85A 2WLIA 4YHMH 2YD3A 3P1IA 1J5IA 1WZKA 3JVFC 3AZVA 1RZFL 1QSEB 5IT6A 1MCWW 4YXHL 2X2IA 4DEWA 5AQ0A 1H3VA 3GLZA 4PR5B 4ZFGH 1EAH1 4QT6A 5FYJH 4CPBA 2YGVA 3PE9A 3VI4B 3CJJA 3M70A 2BOIA 1KJLA 2VO8A 2HCZX 3FRUB 5E1AA 2XBDA 5KAQG 2DVAA 3LIZA 3PHAA 2GMPA 4OD1H 5EG6C 1FNLA 4K5PA 5BVPL 1A3RH 4PJCE 4WJG3 4TWTA 3K3QA 4DGUA 3FH8A 1MDAA 1CZ8L 1T3FB 3EYFA 2YC1B 4ZUTB 4DN3L 1E3FA 1YPZF 1JMUB 1W9SA 3MIBA 3B7TA 1GGIH 3EGDA 1IQDA 4P5TD 5FZOA 2OULB 4YZ2A 1LWHA 5FWEA 4RFNB 3IF1A 3T6VA 3WEXA 2P34A 2HWZL 1R5IB 5ACA1 4M0NA 1K85A 3TOJA 1F56A 2NY1B 2RH0A 3O4LA 5GISL 2R59A 4Y89A 3LVTA 4XH2A 1A64A 3LTVA 1INQB 3OAYH 1V6LA 3BUDA 3PDOA 3A0NA 4R9CA 4BB3A 1MFDL 3UG5A 1MFCH 3ZKSD 1HQ4B 5CSGA 4WTWA 4N6QA 4AYID 3WENA 4PJHA 3F58H 4YDKL 4EQ2A 2OW4A 4JM2B 3AT8A 2ICWJ 4ACTA 3U0WH 5GZND 4CVZB 3VMPA 1NPJA 3RWNA 3TBDA 2N7SA 1YJDH 3V5KA 1OM9A 1G9HA 5FQ0B 2EIKB 3QCTL 4OCXH 4OLEA 5FP9A 1I9IH 1V3LA 3H3BC 4NC2B 1A1OA 3PUCA 5LBSL 2XPGA 5C9KA 7CGTA 5I6KA 4KWJA 2EYRB 2AUYA 3DIVA 4LCCC 4HPKA 4XBNA 2YKLL 4HKOA 3LDRA 2J1WA 1AR71 3N42B 5I1EH 3T65B 1WD4A 4KKRA 5HHNB 4BE5A 5GGRA 3TIEA 1KYDA 2BOBA 2K3HA 3HG2A 1X5AA 3IWUA 4W68A 1YIFA 2UXFA 3HFMH 4OZHE 4EDXA 5SWQB 4I3PA 4F8OA 4I48B 4WZ9A 4LBQB 5EYXA 1HCVA 1WMDA 4FKEA 3E6DA 4BZ4A 5I5RA 4MJID 4AV5A 1WHOA 1BG9A 2B5IC 2LW3A 4R52A 5F9OL 3EO0B 3QORC 5DO2D 5IAXA 4M3CF 2AK1L 4GRLD 2VNRA 5CIRA 5JZGB 1R1A1 4PLJD 1LO5B 2VVDA 4ITCA 4QRFA 1Y3TA 1S4IA 2GYSA 1HI6B 2KH2B 5DJCB 5DRNB 2Y6SC 4MSWA 4PJFF 5A16B 3I6GA 4KY2A 1QEWB 2R15A 3C5JA 4QOKE 1FNZA 3ZYIB 5BNNA 3VZOA 3Q01A 5DT1L 3DJRA 4LPUA 1ANUA 1OD9A 4M7ZB 1T0OA 4BFKA 2R1BA 3AYEA 4DINB 2WWJA 3KL5A 3P4LA 5D1QB 5B2GB 3L1FA 1AR72 3L13A 2QQNA 5A7OA 1QHQA 1PVC1 3B93A 4PLJC 2VVEA 1NL0L 2YWZA 1AXTH 3K2UL 1EO8H 1J1XH 3IFLH 5DO2C 5DHVH 2UY8A 5ITBL 4AEDC 4PCYA 2NX5E 1EFXD 1K5MC 3K46A 5C8CC 3C6LC 4XPFL 3WIIL 1J1PL 5IB4B 1SF3A 3VD5A 3ME0A 2DCKA 2AQPA 4WW2B 1XEUA 1EZSA 1L7RA 5IK8A 4QQPA 1T66C 5C0AD 1OL0A 2HLFD 5CD5C 2EDEA 1W0PA 3APMA 2KZWA 3TBSB 5IM7A 1EAH2 5D8AA 4BU2A 2ADFH 1T22B 3MXWH 4Y5YA 1LULA 1OH4A 4JFFA 4EQ3A 5H9RA 3SDAB 4HK3J 5D93C 3TO4B 4ONGH 2CHNA 2DEXX 4PQXA 1QKZH 1RMFH 4JFDD 1AR93 3FU7A 1FH5L 1KCRL 4EXKA 1SEBA 5JHDA 4O51A 3HUJB 3CSYA 1NIBA 1IL1B 2D0HA 3X17A 3K1KC 2Y5TB 3Q2LA 5FF6A 3MOBH 2GC3A 5JZGA 4R5VA 4KJPC 3ACLA 4X80H 3TXAA 5IFJB 1IC7L