2WNJA

Crystal structure of aplysia achbp in complex with dmxba
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
209
structure length
209
Chain Sequence
b'LHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants for Interaction of Partial Agonists with Acetylcholine Binding Protein and Neuronal Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
source organism Aplysia californica
molecule tags Receptor
total genus 52
structure length 209
sequence length 209
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2wnjA00
4Z91A 1I9BA 4HFDA 2XNUA 2X00A 3UQ7A 3WIPA 3IGQA 2VL0A 5HCMA 1UW6A 2Y57A 5SYOA 4UM1A 4ILBA 4ZZCA 4ZR6A 5AFKA 5L4EA 4UY2A 4COFA 4UM3P 3RHWA 3WTIA 5LG3A 2XQ7A 3RI5A 5FJVA 4NZBA 2WN9A 3WTMA 2ZJUA 5JMEA 4BQTA 4QH1A 2W8GA 3RIFA 5L4HA 3P4WA 4QABA 3U8KA 3WTLA 4ZK1A 5HEOA 3WTNA 2Y56A 4UXUA 4ALXA 3RQUA 5LXBA 4ZJSA 4AFGA 4IL9A 4PIRA 3T4MA 2BR7A 2ZJVA 4TWHA 4HFBA 2YOEA 4XK9A 2PH9A 4XHEA 3UU8A 4A98A 4HFIA 2W8FA 4HFCA 4LMJA 5AFLA 3TLSA 4TNVA 5BP0A 5J5IA 4TWFA 4ILAA 4FRRA 5J0ZA 5L47A 3EAMA 3RIAA 1UX2A 2C9TA 3WTOA 5HEHA 2XQ4A 4TNWA 2BYQA 2XQ6A 3EI0A 5HCJA 2BG9E 3UU6A 2PGZA 5J5HA 3WTHA 2Y54A 3TLVA 2BR8A 4HFHA 3U8NA 4ILCA 4A97A 4UM3S 4ZRUA 4WV9A 2XNVA 5KE4A 5TVCA 3SH1A 3UU4A 2BYSA 4QH5A 5J5FA 5KZUA 3RQWA 2BG9C 3EHZA 5AFMA 2XQAA 5AFHA 2XQ3A 2YN6A 4AFHA 4X5TA 5AFNA 4AFTA 5CFBA 5IUXA 3WTJA 5AFMB 3SQ6A 2XYSA 2YMDA 5HEUA 2BYNA 5BRXA 4TWDA 5J5GA 2YKSA 2XZ5A 3PMZA 4EZ1A 5HEGA 3UUBA 2WNJA 4QH4A 3ZKRA 2BYRA 2WZYA 4QAAA 3UU3A 3TLWA 2YMEA 4HQPA 3JAFA 3C79A 3ZDHA 3UU5A 3C84A 2XQ5A 2BYPA 4DBMA 4ZZBA 4B5DA 3GUAA 2WNCA 3PEOA 4LMKA 4LMLA 2BG9A 4HFEA 5BW2A 4ZK4A 1UV6A 2X00D 4Z90A 2Y7YA 4IL4A 2WNLA 5CO5A 3TLTA 3JADA 3UQ4A 4ZJTA 2XZ6A 5HEJA 3U8LA 3TLUA 2BG9B 2XQ9A 3U8JA 3LSVA 3WTKA 2XQ8A 3SQ9A 5AFJA 4D01A 4QACA 4F8HA 3P50A 3SIOA 4UM3A 4BFQA 2BJ0A 2XNTA 2QC1B 4IREA 2XYTA 3ZDGA 2UZ6A 5AINA 2Y58A 4NPPA 3U8MA 3JAEA
chains in the Genus database with same CATH superfamily
4Z91A 1I9BA 4HFDA 2XNUA 2X00A 3UQ7A 3WIPA 3IGQA 2VL0A 5HCMA 1UW6A 2Y57A 5SYOA 4UM1A 4ILBA 4ZZCA 4ZR6A 5AFKA 5L4EA 4UY2A 4COFA 4UM3P 3RHWA 3WTIA 5LG3A 2XQ7A 3RI5A 5FJVA 4NZBA 2WN9A 3WTMA 2ZJUA 5JMEA 4BQTA 4QH1A 2W8GA 3RIFA 5L4HA 3P4WA 4QABA 3U8KA 3WTLA 4ZK1A 5HEOA 3WTNA 2Y56A 4UXUA 4ALXA 3RQUA 5LXBA 4ZJSA 4AFGA 4IL9A 4PIRA 3T4MA 2BR7A 2ZJVA 4TWHA 4HFBA 2YOEA 4XK9A 2PH9A 4XHEA 3UU8A 4A98A 4HFIA 2W8FA 4HFCA 4LMJA 5AFLA 3TLSA 4TNVA 5BP0A 5J5IA 4TWFA 4ILAA 4FRRA 5J0ZA 5L47A 3EAMA 3RIAA 1UX2A 2C9TA 3WTOA 5HEHA 2XQ4A 4TNWA 2BYQA 2XQ6A 3EI0A 5HCJA 2BG9E 3UU6A 2PGZA 5J5HA 3WTHA 2Y54A 3TLVA 2BR8A 4HFHA 3U8NA 4ILCA 4A97A 4UM3S 4ZRUA 4WV9A 2XNVA 5KE4A 5TVCA 3SH1A 3UU4A 2BYSA 4QH5A 5J5FA 5KZUA 3RQWA 2BG9C 3EHZA 5AFMA 2XQAA 5AFHA 2XQ3A 2YN6A 4AFHA 4X5TA 5AFNA 4AFTA 5CFBA 5IUXA 3WTJA 5AFMB 3SQ6A 2XYSA 2YMDA 5HEUA 2BYNA 5BRXA 4TWDA 5J5GA 2YKSA 2XZ5A 3PMZA 4EZ1A 5HEGA 3UUBA 2WNJA 4QH4A 3ZKRA 2BYRA 2WZYA 4QAAA 3UU3A 3TLWA 2YMEA 4HQPA 3JAFA 3C79A 3ZDHA 3UU5A 3C84A 2XQ5A 2BYPA 4DBMA 4ZZBA 4B5DA 3GUAA 2WNCA 3PEOA 4LMKA 4LMLA 2BG9A 4HFEA 5BW2A 4ZK4A 1UV6A 2X00D 4Z90A 2Y7YA 4IL4A 2WNLA 5CO5A 3TLTA 3JADA 3UQ4A 4ZJTA 2XZ6A 5HEJA 3U8LA 3TLUA 2BG9B 2XQ9A 3U8JA 3LSVA 3WTKA 2XQ8A 3SQ9A 5AFJA 4D01A 4QACA 4F8HA 3P50A 3SIOA 4UM3A 4BFQA 2BJ0A 2XNTA 2QC1B 4IREA 2XYTA 3ZDGA 2UZ6A 5AINA 2Y58A 4NPPA 3U8MA 3JAEA
chains in the Genus database with same CATH topology
4Z91A 1I9BA 4HFDA 2XNUA 2X00A 3UQ7A 3WIPA 3IGQA 2VL0A 5HCMA 1UW6A 2Y57A 5SYOA 4UM1A 4ILBA 4ZZCA 4ZR6A 5AFKA 5L4EA 4UY2A 4COFA 4UM3P 3RHWA 3WTIA 5LG3A 2XQ7A 3RI5A 5FJVA 4NZBA 2WN9A 3WTMA 2ZJUA 5JMEA 4BQTA 4QH1A 2W8GA 3RIFA 5L4HA 3P4WA 4QABA 3U8KA 3WTLA 4ZK1A 5HEOA 3WTNA 2Y56A 4UXUA 4ALXA 3RQUA 5LXBA 4ZJSA 4AFGA 4IL9A 4PIRA 3T4MA 2BR7A 2ZJVA 4TWHA 4HFBA 2YOEA 4XK9A 2PH9A 4XHEA 3UU8A 4A98A 4HFIA 2W8FA 4HFCA 4LMJA 5AFLA 3TLSA 4TNVA 5BP0A 5J5IA 4TWFA 4ILAA 4FRRA 5J0ZA 5L47A 3EAMA 3RIAA 1UX2A 2C9TA 3WTOA 5HEHA 2XQ4A 4TNWA 2BYQA 2XQ6A 3EI0A 5HCJA 2BG9E 3UU6A 2PGZA 5J5HA 3WTHA 2Y54A 3TLVA 2BR8A 4HFHA 3U8NA 4ILCA 4A97A 4UM3S 4ZRUA 4WV9A 2XNVA 5KE4A 5TVCA 3SH1A 3UU4A 2BYSA 4QH5A 5J5FA 5KZUA 3RQWA 2BG9C 3EHZA 5AFMA 2XQAA 5AFHA 2XQ3A 2YN6A 4AFHA 4X5TA 5AFNA 4AFTA 5CFBA 5IUXA 3WTJA 5AFMB 3SQ6A 2XYSA 2YMDA 5HEUA 2BYNA 5BRXA 4TWDA 5J5GA 2YKSA 2XZ5A 3PMZA 4EZ1A 5HEGA 3UUBA 2WNJA 4QH4A 3ZKRA 2BYRA 2WZYA 4QAAA 3UU3A 3TLWA 2YMEA 4HQPA 3JAFA 3C79A 3ZDHA 3UU5A 3C84A 2XQ5A 2BYPA 4DBMA 4ZZBA 4B5DA 3GUAA 2WNCA 3PEOA 4LMKA 4LMLA 2BG9A 4HFEA 5BW2A 4ZK4A 1UV6A 2X00D 4Z90A 2Y7YA 4IL4A 2WNLA 5CO5A 3TLTA 3JADA 3UQ4A 4ZJTA 2XZ6A 5HEJA 3U8LA 3TLUA 2BG9B 2XQ9A 3U8JA 3LSVA 3WTKA 2XQ8A 3SQ9A 5AFJA 4D01A 4QACA 4F8HA 3P50A 3SIOA 4UM3A 4BFQA 2BJ0A 2XNTA 2QC1B 4IREA 2XYTA 3ZDGA 2UZ6A 5AINA 2Y58A 4NPPA 3U8MA 3JAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z91 A;  1I9B A;  4HFD A;  2XNU A;  2X00 A;  3UQ7 A;  3WIP A;  3IGQ A;  2VL0 A;  5HCM A;  1UW6 A;  2Y57 A;  5SYO A;  4UM1 A;  4ILB A;  4ZZC A;  4ZR6 A;  5AFK A;  5L4E A;  4UY2 A;  4COF A;  4UM3 P;  3RHW A;  3WTI A;  5LG3 A;  2XQ7 A;  3RI5 A;  5FJV A;  4NZB A;  2WN9 A;  3WTM A;  2ZJU A;  5JME A;  4BQT A;  4QH1 A;  2W8G A;  3RIF A;  5L4H A;  3P4W A;  4QAB A;  3U8K A;  3WTL A;  4ZK1 A;  5HEO A;  3WTN A;  2Y56 A;  4UXU A;  4ALX A;  3RQU A;  5LXB A;  4ZJS A;  4AFG A;  4IL9 A;  4PIR A;  3T4M A;  2BR7 A;  2ZJV A;  4TWH A;  4HFB A;  2YOE A;  4XK9 A;  2PH9 A;  4XHE A;  3UU8 A;  4A98 A;  4HFI A;  2W8F A;  4HFC A;  4LMJ A;  5AFL A;  3TLS A;  4TNV A;  5BP0 A;  5J5I A;  4TWF A;  4ILA A;  4FRR A;  5J0Z A;  5L47 A;  3EAM A;  3RIA A;  1UX2 A;  2C9T A;  3WTO A;  5HEH A;  2XQ4 A;  4TNW A;  2BYQ A;  2XQ6 A;  3EI0 A;  5HCJ A;  2BG9 E;  3UU6 A;  2PGZ A;  5J5H A;  3WTH A;  2Y54 A;  3TLV A;  2BR8 A;  4HFH A;  3U8N A;  4ILC A;  4A97 A;  4UM3 S;  4ZRU A;  4WV9 A;  2XNV A;  5KE4 A;  5TVC A;  3SH1 A;  3UU4 A;  2BYS A;  4QH5 A;  5J5F A;  5KZU A;  3RQW A;  2BG9 C;  3EHZ A;  5AFM A;  2XQA A;  5AFH A;  2XQ3 A;  2YN6 A;  4AFH A;  4X5T A;  5AFN A;  4AFT A;  5CFB A;  5IUX A;  3WTJ A;  5AFM B;  3SQ6 A;  2XYS A;  2YMD A;  5HEU A;  2BYN A;  5BRX A;  4TWD A;  5J5G A;  2YKS A;  2XZ5 A;  3PMZ A;  4EZ1 A;  5HEG A;  3UUB A;  2WNJ A;  4QH4 A;  3ZKR A;  2BYR A;  2WZY A;  4QAA A;  3UU3 A;  3TLW A;  2YME A;  4HQP A;  3JAF A;  3C79 A;  3ZDH A;  3UU5 A;  3C84 A;  2XQ5 A;  2BYP A;  4DBM A;  4ZZB A;  4B5D A;  3GUA A;  2WNC A;  3PEO A;  4LMK A;  4LML A;  2BG9 A;  4HFE A;  5BW2 A;  4ZK4 A;  1UV6 A;  2X00 D;  4Z90 A;  2Y7Y A;  4IL4 A;  2WNL A;  5CO5 A;  3TLT A;  3JAD A;  3UQ4 A;  4ZJT A;  2XZ6 A;  5HEJ A;  3U8L A;  3TLU A;  2BG9 B;  2XQ9 A;  3U8J A;  3LSV A;  3WTK A;  2XQ8 A;  3SQ9 A;  5AFJ A;  4D01 A;  4QAC A;  4F8H A;  3P50 A;  3SIO A;  4UM3 A;  4BFQ A;  2BJ0 A;  2XNT A;  2QC1 B;  4IRE A;  2XYT A;  3ZDG A;  2UZ6 A;  5AIN A;  2Y58 A;  4NPP A;  3U8M A;  3JAE A; 
#chains in the Genus database with same CATH topology
 4Z91 A;  1I9B A;  4HFD A;  2XNU A;  2X00 A;  3UQ7 A;  3WIP A;  3IGQ A;  2VL0 A;  5HCM A;  1UW6 A;  2Y57 A;  5SYO A;  4UM1 A;  4ILB A;  4ZZC A;  4ZR6 A;  5AFK A;  5L4E A;  4UY2 A;  4COF A;  4UM3 P;  3RHW A;  3WTI A;  5LG3 A;  2XQ7 A;  3RI5 A;  5FJV A;  4NZB A;  2WN9 A;  3WTM A;  2ZJU A;  5JME A;  4BQT A;  4QH1 A;  2W8G A;  3RIF A;  5L4H A;  3P4W A;  4QAB A;  3U8K A;  3WTL A;  4ZK1 A;  5HEO A;  3WTN A;  2Y56 A;  4UXU A;  4ALX A;  3RQU A;  5LXB A;  4ZJS A;  4AFG A;  4IL9 A;  4PIR A;  3T4M A;  2BR7 A;  2ZJV A;  4TWH A;  4HFB A;  2YOE A;  4XK9 A;  2PH9 A;  4XHE A;  3UU8 A;  4A98 A;  4HFI A;  2W8F A;  4HFC A;  4LMJ A;  5AFL A;  3TLS A;  4TNV A;  5BP0 A;  5J5I A;  4TWF A;  4ILA A;  4FRR A;  5J0Z A;  5L47 A;  3EAM A;  3RIA A;  1UX2 A;  2C9T A;  3WTO A;  5HEH A;  2XQ4 A;  4TNW A;  2BYQ A;  2XQ6 A;  3EI0 A;  5HCJ A;  2BG9 E;  3UU6 A;  2PGZ A;  5J5H A;  3WTH A;  2Y54 A;  3TLV A;  2BR8 A;  4HFH A;  3U8N A;  4ILC A;  4A97 A;  4UM3 S;  4ZRU A;  4WV9 A;  2XNV A;  5KE4 A;  5TVC A;  3SH1 A;  3UU4 A;  2BYS A;  4QH5 A;  5J5F A;  5KZU A;  3RQW A;  2BG9 C;  3EHZ A;  5AFM A;  2XQA A;  5AFH A;  2XQ3 A;  2YN6 A;  4AFH A;  4X5T A;  5AFN A;  4AFT A;  5CFB A;  5IUX A;  3WTJ A;  5AFM B;  3SQ6 A;  2XYS A;  2YMD A;  5HEU A;  2BYN A;  5BRX A;  4TWD A;  5J5G A;  2YKS A;  2XZ5 A;  3PMZ A;  4EZ1 A;  5HEG A;  3UUB A;  2WNJ A;  4QH4 A;  3ZKR A;  2BYR A;  2WZY A;  4QAA A;  3UU3 A;  3TLW A;  2YME A;  4HQP A;  3JAF A;  3C79 A;  3ZDH A;  3UU5 A;  3C84 A;  2XQ5 A;  2BYP A;  4DBM A;  4ZZB A;  4B5D A;  3GUA A;  2WNC A;  3PEO A;  4LMK A;  4LML A;  2BG9 A;  4HFE A;  5BW2 A;  4ZK4 A;  1UV6 A;  2X00 D;  4Z90 A;  2Y7Y A;  4IL4 A;  2WNL A;  5CO5 A;  3TLT A;  3JAD A;  3UQ4 A;  4ZJT A;  2XZ6 A;  5HEJ A;  3U8L A;  3TLU A;  2BG9 B;  2XQ9 A;  3U8J A;  3LSV A;  3WTK A;  2XQ8 A;  3SQ9 A;  5AFJ A;  4D01 A;  4QAC A;  4F8H A;  3P50 A;  3SIO A;  4UM3 A;  4BFQ A;  2BJ0 A;  2XNT A;  2QC1 B;  4IRE A;  2XYT A;  3ZDG A;  2UZ6 A;  5AIN A;  2Y58 A;  4NPP A;  3U8M A;  3JAE A; 
#chains in the Genus database with same CATH homology
 4Z91 A;  1I9B A;  4HFD A;  2XNU A;  2X00 A;  3UQ7 A;  3WIP A;  3IGQ A;  2VL0 A;  5HCM A;  1UW6 A;  2Y57 A;  5SYO A;  4UM1 A;  4ILB A;  4ZZC A;  4ZR6 A;  5AFK A;  5L4E A;  4UY2 A;  4COF A;  4UM3 P;  3RHW A;  3WTI A;  5LG3 A;  2XQ7 A;  3RI5 A;  5FJV A;  4NZB A;  2WN9 A;  3WTM A;  2ZJU A;  5JME A;  4BQT A;  4QH1 A;  2W8G A;  3RIF A;  5L4H A;  3P4W A;  4QAB A;  3U8K A;  3WTL A;  4ZK1 A;  5HEO A;  3WTN A;  2Y56 A;  4UXU A;  4ALX A;  3RQU A;  5LXB A;  4ZJS A;  4AFG A;  4IL9 A;  4PIR A;  3T4M A;  2BR7 A;  2ZJV A;  4TWH A;  4HFB A;  2YOE A;  4XK9 A;  2PH9 A;  4XHE A;  3UU8 A;  4A98 A;  4HFI A;  2W8F A;  4HFC A;  4LMJ A;  5AFL A;  3TLS A;  4TNV A;  5BP0 A;  5J5I A;  4TWF A;  4ILA A;  4FRR A;  5J0Z A;  5L47 A;  3EAM A;  3RIA A;  1UX2 A;  2C9T A;  3WTO A;  5HEH A;  2XQ4 A;  4TNW A;  2BYQ A;  2XQ6 A;  3EI0 A;  5HCJ A;  2BG9 E;  3UU6 A;  2PGZ A;  5J5H A;  3WTH A;  2Y54 A;  3TLV A;  2BR8 A;  4HFH A;  3U8N A;  4ILC A;  4A97 A;  4UM3 S;  4ZRU A;  4WV9 A;  2XNV A;  5KE4 A;  5TVC A;  3SH1 A;  3UU4 A;  2BYS A;  4QH5 A;  5J5F A;  5KZU A;  3RQW A;  2BG9 C;  3EHZ A;  5AFM A;  2XQA A;  5AFH A;  2XQ3 A;  2YN6 A;  4AFH A;  4X5T A;  5AFN A;  4AFT A;  5CFB A;  5IUX A;  3WTJ A;  5AFM B;  3SQ6 A;  2XYS A;  2YMD A;  5HEU A;  2BYN A;  5BRX A;  4TWD A;  5J5G A;  2YKS A;  2XZ5 A;  3PMZ A;  4EZ1 A;  5HEG A;  3UUB A;  2WNJ A;  4QH4 A;  3ZKR A;  2BYR A;  2WZY A;  4QAA A;  3UU3 A;  3TLW A;  2YME A;  4HQP A;  3JAF A;  3C79 A;  3ZDH A;  3UU5 A;  3C84 A;  2XQ5 A;  2BYP A;  4DBM A;  4ZZB A;  4B5D A;  3GUA A;  2WNC A;  3PEO A;  4LMK A;  4LML A;  2BG9 A;  4HFE A;  5BW2 A;  4ZK4 A;  1UV6 A;  2X00 D;  4Z90 A;  2Y7Y A;  4IL4 A;  2WNL A;  5CO5 A;  3TLT A;  3JAD A;  3UQ4 A;  4ZJT A;  2XZ6 A;  5HEJ A;  3U8L A;  3TLU A;  2BG9 B;  2XQ9 A;  3U8J A;  3LSV A;  3WTK A;  2XQ8 A;  3SQ9 A;  5AFJ A;  4D01 A;  4QAC A;  4F8H A;  3P50 A;  3SIO A;  4UM3 A;  4BFQ A;  2BJ0 A;  2XNT A;  2QC1 B;  4IRE A;  2XYT A;  3ZDG A;  2UZ6 A;  5AIN A;  2Y58 A;  4NPP A;  3U8M A;  3JAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...