2WNJA

Crystal structure of aplysia achbp in complex with dmxba
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
209
structure length
209
Chain Sequence
LHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structural Determinants for Interaction of Partial Agonists with Acetylcholine Binding Protein and Neuronal Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 52
structure length 209
sequence length 209
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2wnjA00
3EI0A 3UU5A 4NPPA 3UUBA 4TWHA 3U8KA 4HFEA 4ILBA 2XYTA 3U8MA 2ZJVA 1UW6A 4ILCA 4HFHA 3WTMA 2UZ6A 2BYSA 5JMEA 4IL4A 3SIOA 2XNVA 5KE4A 5CO5A 5HCJA 4UM3A 3WTLA 2WNCA 2XQ4A 4ZK1A 3RHWA 5J5IA 5L4HA 3EAMA 5J5GA 4ZZBA 3PEOA 2Y57A 5IUXA 4LMLA 4XK9A 3U8NA 5TVCA 2X00A 2YN6A 5SYOA 3IGQA 5L47A 1I9BA 4HFCA 2PH9A 2BYPA 5LG3A 2Y54A 5KZUA 4QAAA 3TLSA 2YMDA 4UXUA 5AFHA 2QC1B 2XZ6A 4HFIA 3EHZA 4EZ1A 5J5HA 5AFMB 4ZK4A 3WTHA 5AINA 3RIFA 2XQ3A 4D01A 1UX2A 3WTKA 2YMEA 4AFHA 4ALXA 4ZZCA 3LSVA 4IREA 5FJVA 4HQPA 5AFKA 4ZRUA 2YOEA 4UM1A 5BRXA 2BR8A 2X00D 2C9TA 4Z91A 4FRRA 3WTOA 5AFMA 2BYQA 3ZDHA 5AFLA 5J0ZA 4ZR6A 3UU4A 4UY2A 4ILAA 4UM3S 4BFQA 3TLUA 2YKSA 2BJ0A 2XQ5A 3TLVA 3WTJA 3P50A 3RQWA 3SQ6A 4NZBA 4DBMA 2XNTA 3WIPA 5LXBA 3RQUA 3WTNA 2XQ8A 3PMZA 3C79A 3RIAA 3C84A 4LMKA 4QABA 5HEUA 3SH1A 4Z90A 3ZKRA 4QH5A 5HCMA 2XQAA 2XNUA 4ZJSA 3TLTA 4ZJTA 2WNLA 4QH1A 4QACA 4HFDA 2XZ5A 5L4EA 2XQ7A 4AFTA 2WNJA 4TWFA 4F8HA 5AFNA 4HFBA 5HEHA 4COFA 3TLWA 2XQ9A 4B5DA 3SQ9A 4QH4A 2Y56A 4X5TA 2BG9E 5HEJA 2VL0A 3JADA 5HEGA 2W8GA 4TNWA 3U8LA 3UU6A 3P4WA 3UQ4A 2Y58A 3U8JA 4PIRA 4IL9A 2BR7A 3JAEA 4A98A 5J5FA 3RI5A 2W8FA 2BYNA 2ZJUA 2BYRA 2XYSA 4XHEA 3UU8A 4TNVA 5CFBA 2WZYA 2BG9B 5BW2A 3UQ7A 3ZDGA 5AFJA 4UM3P 4LMJA 2WN9A 3GUAA 4AFGA 4TWDA 3JAFA 3T4MA 2XQ6A 3UU3A 4WV9A 5BP0A 2BG9C 5HEOA 3WTIA 4BQTA 1UV6A 4A97A 2Y7YA 2PGZA 2BG9A
chains in the Genus database with same CATH superfamily
3EI0A 3UU5A 4NPPA 3UUBA 4TWHA 3U8KA 4HFEA 4ILBA 2XYTA 3U8MA 2ZJVA 1UW6A 4ILCA 4HFHA 3WTMA 2UZ6A 2BYSA 5JMEA 4IL4A 3SIOA 2XNVA 5KE4A 5CO5A 5HCJA 4UM3A 3WTLA 2WNCA 2XQ4A 4ZK1A 3RHWA 5J5IA 5L4HA 3EAMA 5J5GA 4ZZBA 3PEOA 2Y57A 5IUXA 4LMLA 4XK9A 3U8NA 5TVCA 2X00A 2YN6A 5SYOA 3IGQA 5L47A 1I9BA 4HFCA 2PH9A 2BYPA 5LG3A 2Y54A 5KZUA 4QAAA 3TLSA 2YMDA 4UXUA 5AFHA 2QC1B 2XZ6A 4HFIA 3EHZA 4EZ1A 5J5HA 5AFMB 4ZK4A 3WTHA 5AINA 3RIFA 2XQ3A 4D01A 1UX2A 3WTKA 2YMEA 4AFHA 4ALXA 4ZZCA 3LSVA 4IREA 5FJVA 4HQPA 5AFKA 4ZRUA 2YOEA 4UM1A 5BRXA 2BR8A 2X00D 2C9TA 4Z91A 4FRRA 3WTOA 5AFMA 2BYQA 3ZDHA 5AFLA 5J0ZA 4ZR6A 3UU4A 4UY2A 4ILAA 4UM3S 4BFQA 3TLUA 2YKSA 2BJ0A 2XQ5A 3TLVA 3WTJA 3P50A 3RQWA 3SQ6A 4NZBA 4DBMA 2XNTA 3WIPA 5LXBA 3RQUA 3WTNA 2XQ8A 3PMZA 3C79A 3RIAA 3C84A 4LMKA 4QABA 5HEUA 3SH1A 4Z90A 3ZKRA 4QH5A 5HCMA 2XQAA 2XNUA 4ZJSA 3TLTA 4ZJTA 2WNLA 4QH1A 4QACA 4HFDA 2XZ5A 5L4EA 2XQ7A 4AFTA 2WNJA 4TWFA 4F8HA 5AFNA 4HFBA 5HEHA 4COFA 3TLWA 2XQ9A 4B5DA 3SQ9A 4QH4A 2Y56A 4X5TA 2BG9E 5HEJA 2VL0A 3JADA 5HEGA 2W8GA 4TNWA 3U8LA 3UU6A 3P4WA 3UQ4A 2Y58A 3U8JA 4PIRA 4IL9A 2BR7A 3JAEA 4A98A 5J5FA 3RI5A 2W8FA 2BYNA 2ZJUA 2BYRA 2XYSA 4XHEA 3UU8A 4TNVA 5CFBA 2WZYA 2BG9B 5BW2A 3UQ7A 3ZDGA 5AFJA 4UM3P 4LMJA 2WN9A 3GUAA 4AFGA 4TWDA 3JAFA 3T4MA 2XQ6A 3UU3A 4WV9A 5BP0A 2BG9C 5HEOA 3WTIA 4BQTA 1UV6A 4A97A 2Y7YA 2PGZA 2BG9A
chains in the Genus database with same CATH topology
3EI0A 3UU5A 4NPPA 3UUBA 4TWHA 3U8KA 4HFEA 4ILBA 2XYTA 3U8MA 2ZJVA 1UW6A 4ILCA 4HFHA 3WTMA 2UZ6A 2BYSA 5JMEA 4IL4A 3SIOA 2XNVA 5KE4A 5CO5A 5HCJA 4UM3A 3WTLA 2WNCA 2XQ4A 4ZK1A 3RHWA 5J5IA 5L4HA 3EAMA 5J5GA 4ZZBA 3PEOA 2Y57A 5IUXA 4LMLA 4XK9A 3U8NA 5TVCA 2X00A 2YN6A 5SYOA 3IGQA 5L47A 1I9BA 4HFCA 2PH9A 2BYPA 5LG3A 2Y54A 5KZUA 4QAAA 3TLSA 2YMDA 4UXUA 5AFHA 2QC1B 2XZ6A 4HFIA 3EHZA 4EZ1A 5J5HA 5AFMB 4ZK4A 3WTHA 5AINA 3RIFA 2XQ3A 4D01A 1UX2A 3WTKA 2YMEA 4AFHA 4ALXA 4ZZCA 3LSVA 4IREA 5FJVA 4HQPA 5AFKA 4ZRUA 2YOEA 4UM1A 5BRXA 2BR8A 2X00D 2C9TA 4Z91A 4FRRA 3WTOA 5AFMA 2BYQA 3ZDHA 5AFLA 5J0ZA 4ZR6A 3UU4A 4UY2A 4ILAA 4UM3S 4BFQA 3TLUA 2YKSA 2BJ0A 2XQ5A 3TLVA 3WTJA 3P50A 3RQWA 3SQ6A 4NZBA 4DBMA 2XNTA 3WIPA 5LXBA 3RQUA 3WTNA 2XQ8A 3PMZA 3C79A 3RIAA 3C84A 4LMKA 4QABA 5HEUA 3SH1A 4Z90A 3ZKRA 4QH5A 5HCMA 2XQAA 2XNUA 4ZJSA 3TLTA 4ZJTA 2WNLA 4QH1A 4QACA 4HFDA 2XZ5A 5L4EA 2XQ7A 4AFTA 2WNJA 4TWFA 4F8HA 5AFNA 4HFBA 5HEHA 4COFA 3TLWA 2XQ9A 4B5DA 3SQ9A 4QH4A 2Y56A 4X5TA 2BG9E 5HEJA 2VL0A 3JADA 5HEGA 2W8GA 4TNWA 3U8LA 3UU6A 3P4WA 3UQ4A 2Y58A 3U8JA 4PIRA 4IL9A 2BR7A 3JAEA 4A98A 5J5FA 3RI5A 2W8FA 2BYNA 2ZJUA 2BYRA 2XYSA 4XHEA 3UU8A 4TNVA 5CFBA 2WZYA 2BG9B 5BW2A 3UQ7A 3ZDGA 5AFJA 4UM3P 4LMJA 2WN9A 3GUAA 4AFGA 4TWDA 3JAFA 3T4MA 2XQ6A 3UU3A 4WV9A 5BP0A 2BG9C 5HEOA 3WTIA 4BQTA 1UV6A 4A97A 2Y7YA 2PGZA 2BG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EI0 A;  3UU5 A;  4NPP A;  3UUB A;  4TWH A;  3U8K A;  4HFE A;  4ILB A;  2XYT A;  3U8M A;  2ZJV A;  1UW6 A;  4ILC A;  4HFH A;  3WTM A;  2UZ6 A;  2BYS A;  5JME A;  4IL4 A;  3SIO A;  2XNV A;  5KE4 A;  5CO5 A;  5HCJ A;  4UM3 A;  3WTL A;  2WNC A;  2XQ4 A;  4ZK1 A;  3RHW A;  5J5I A;  5L4H A;  3EAM A;  5J5G A;  4ZZB A;  3PEO A;  2Y57 A;  5IUX A;  4LML A;  4XK9 A;  3U8N A;  5TVC A;  2X00 A;  2YN6 A;  5SYO A;  3IGQ A;  5L47 A;  1I9B A;  4HFC A;  2PH9 A;  2BYP A;  5LG3 A;  2Y54 A;  5KZU A;  4QAA A;  3TLS A;  2YMD A;  4UXU A;  5AFH A;  2QC1 B;  2XZ6 A;  4HFI A;  3EHZ A;  4EZ1 A;  5J5H A;  5AFM B;  4ZK4 A;  3WTH A;  5AIN A;  3RIF A;  2XQ3 A;  4D01 A;  1UX2 A;  3WTK A;  2YME A;  4AFH A;  4ALX A;  4ZZC A;  3LSV A;  4IRE A;  5FJV A;  4HQP A;  5AFK A;  4ZRU A;  2YOE A;  4UM1 A;  5BRX A;  2BR8 A;  2X00 D;  2C9T A;  4Z91 A;  4FRR A;  3WTO A;  5AFM A;  2BYQ A;  3ZDH A;  5AFL A;  5J0Z A;  4ZR6 A;  3UU4 A;  4UY2 A;  4ILA A;  4UM3 S;  4BFQ A;  3TLU A;  2YKS A;  2BJ0 A;  2XQ5 A;  3TLV A;  3WTJ A;  3P50 A;  3RQW A;  3SQ6 A;  4NZB A;  4DBM A;  2XNT A;  3WIP A;  5LXB A;  3RQU A;  3WTN A;  2XQ8 A;  3PMZ A;  3C79 A;  3RIA A;  3C84 A;  4LMK A;  4QAB A;  5HEU A;  3SH1 A;  4Z90 A;  3ZKR A;  4QH5 A;  5HCM A;  2XQA A;  2XNU A;  4ZJS A;  3TLT A;  4ZJT A;  2WNL A;  4QH1 A;  4QAC A;  4HFD A;  2XZ5 A;  5L4E A;  2XQ7 A;  4AFT A;  2WNJ A;  4TWF A;  4F8H A;  5AFN A;  4HFB A;  5HEH A;  4COF A;  3TLW A;  2XQ9 A;  4B5D A;  3SQ9 A;  4QH4 A;  2Y56 A;  4X5T A;  2BG9 E;  5HEJ A;  2VL0 A;  3JAD A;  5HEG A;  2W8G A;  4TNW A;  3U8L A;  3UU6 A;  3P4W A;  3UQ4 A;  2Y58 A;  3U8J A;  4PIR A;  4IL9 A;  2BR7 A;  3JAE A;  4A98 A;  5J5F A;  3RI5 A;  2W8F A;  2BYN A;  2ZJU A;  2BYR A;  2XYS A;  4XHE A;  3UU8 A;  4TNV A;  5CFB A;  2WZY A;  2BG9 B;  5BW2 A;  3UQ7 A;  3ZDG A;  5AFJ A;  4UM3 P;  4LMJ A;  2WN9 A;  3GUA A;  4AFG A;  4TWD A;  3JAF A;  3T4M A;  2XQ6 A;  3UU3 A;  4WV9 A;  5BP0 A;  2BG9 C;  5HEO A;  3WTI A;  4BQT A;  1UV6 A;  4A97 A;  2Y7Y A;  2PGZ A;  2BG9 A; 
#chains in the Genus database with same CATH topology
 3EI0 A;  3UU5 A;  4NPP A;  3UUB A;  4TWH A;  3U8K A;  4HFE A;  4ILB A;  2XYT A;  3U8M A;  2ZJV A;  1UW6 A;  4ILC A;  4HFH A;  3WTM A;  2UZ6 A;  2BYS A;  5JME A;  4IL4 A;  3SIO A;  2XNV A;  5KE4 A;  5CO5 A;  5HCJ A;  4UM3 A;  3WTL A;  2WNC A;  2XQ4 A;  4ZK1 A;  3RHW A;  5J5I A;  5L4H A;  3EAM A;  5J5G A;  4ZZB A;  3PEO A;  2Y57 A;  5IUX A;  4LML A;  4XK9 A;  3U8N A;  5TVC A;  2X00 A;  2YN6 A;  5SYO A;  3IGQ A;  5L47 A;  1I9B A;  4HFC A;  2PH9 A;  2BYP A;  5LG3 A;  2Y54 A;  5KZU A;  4QAA A;  3TLS A;  2YMD A;  4UXU A;  5AFH A;  2QC1 B;  2XZ6 A;  4HFI A;  3EHZ A;  4EZ1 A;  5J5H A;  5AFM B;  4ZK4 A;  3WTH A;  5AIN A;  3RIF A;  2XQ3 A;  4D01 A;  1UX2 A;  3WTK A;  2YME A;  4AFH A;  4ALX A;  4ZZC A;  3LSV A;  4IRE A;  5FJV A;  4HQP A;  5AFK A;  4ZRU A;  2YOE A;  4UM1 A;  5BRX A;  2BR8 A;  2X00 D;  2C9T A;  4Z91 A;  4FRR A;  3WTO A;  5AFM A;  2BYQ A;  3ZDH A;  5AFL A;  5J0Z A;  4ZR6 A;  3UU4 A;  4UY2 A;  4ILA A;  4UM3 S;  4BFQ A;  3TLU A;  2YKS A;  2BJ0 A;  2XQ5 A;  3TLV A;  3WTJ A;  3P50 A;  3RQW A;  3SQ6 A;  4NZB A;  4DBM A;  2XNT A;  3WIP A;  5LXB A;  3RQU A;  3WTN A;  2XQ8 A;  3PMZ A;  3C79 A;  3RIA A;  3C84 A;  4LMK A;  4QAB A;  5HEU A;  3SH1 A;  4Z90 A;  3ZKR A;  4QH5 A;  5HCM A;  2XQA A;  2XNU A;  4ZJS A;  3TLT A;  4ZJT A;  2WNL A;  4QH1 A;  4QAC A;  4HFD A;  2XZ5 A;  5L4E A;  2XQ7 A;  4AFT A;  2WNJ A;  4TWF A;  4F8H A;  5AFN A;  4HFB A;  5HEH A;  4COF A;  3TLW A;  2XQ9 A;  4B5D A;  3SQ9 A;  4QH4 A;  2Y56 A;  4X5T A;  2BG9 E;  5HEJ A;  2VL0 A;  3JAD A;  5HEG A;  2W8G A;  4TNW A;  3U8L A;  3UU6 A;  3P4W A;  3UQ4 A;  2Y58 A;  3U8J A;  4PIR A;  4IL9 A;  2BR7 A;  3JAE A;  4A98 A;  5J5F A;  3RI5 A;  2W8F A;  2BYN A;  2ZJU A;  2BYR A;  2XYS A;  4XHE A;  3UU8 A;  4TNV A;  5CFB A;  2WZY A;  2BG9 B;  5BW2 A;  3UQ7 A;  3ZDG A;  5AFJ A;  4UM3 P;  4LMJ A;  2WN9 A;  3GUA A;  4AFG A;  4TWD A;  3JAF A;  3T4M A;  2XQ6 A;  3UU3 A;  4WV9 A;  5BP0 A;  2BG9 C;  5HEO A;  3WTI A;  4BQT A;  1UV6 A;  4A97 A;  2Y7Y A;  2PGZ A;  2BG9 A; 
#chains in the Genus database with same CATH homology
 3EI0 A;  3UU5 A;  4NPP A;  3UUB A;  4TWH A;  3U8K A;  4HFE A;  4ILB A;  2XYT A;  3U8M A;  2ZJV A;  1UW6 A;  4ILC A;  4HFH A;  3WTM A;  2UZ6 A;  2BYS A;  5JME A;  4IL4 A;  3SIO A;  2XNV A;  5KE4 A;  5CO5 A;  5HCJ A;  4UM3 A;  3WTL A;  2WNC A;  2XQ4 A;  4ZK1 A;  3RHW A;  5J5I A;  5L4H A;  3EAM A;  5J5G A;  4ZZB A;  3PEO A;  2Y57 A;  5IUX A;  4LML A;  4XK9 A;  3U8N A;  5TVC A;  2X00 A;  2YN6 A;  5SYO A;  3IGQ A;  5L47 A;  1I9B A;  4HFC A;  2PH9 A;  2BYP A;  5LG3 A;  2Y54 A;  5KZU A;  4QAA A;  3TLS A;  2YMD A;  4UXU A;  5AFH A;  2QC1 B;  2XZ6 A;  4HFI A;  3EHZ A;  4EZ1 A;  5J5H A;  5AFM B;  4ZK4 A;  3WTH A;  5AIN A;  3RIF A;  2XQ3 A;  4D01 A;  1UX2 A;  3WTK A;  2YME A;  4AFH A;  4ALX A;  4ZZC A;  3LSV A;  4IRE A;  5FJV A;  4HQP A;  5AFK A;  4ZRU A;  2YOE A;  4UM1 A;  5BRX A;  2BR8 A;  2X00 D;  2C9T A;  4Z91 A;  4FRR A;  3WTO A;  5AFM A;  2BYQ A;  3ZDH A;  5AFL A;  5J0Z A;  4ZR6 A;  3UU4 A;  4UY2 A;  4ILA A;  4UM3 S;  4BFQ A;  3TLU A;  2YKS A;  2BJ0 A;  2XQ5 A;  3TLV A;  3WTJ A;  3P50 A;  3RQW A;  3SQ6 A;  4NZB A;  4DBM A;  2XNT A;  3WIP A;  5LXB A;  3RQU A;  3WTN A;  2XQ8 A;  3PMZ A;  3C79 A;  3RIA A;  3C84 A;  4LMK A;  4QAB A;  5HEU A;  3SH1 A;  4Z90 A;  3ZKR A;  4QH5 A;  5HCM A;  2XQA A;  2XNU A;  4ZJS A;  3TLT A;  4ZJT A;  2WNL A;  4QH1 A;  4QAC A;  4HFD A;  2XZ5 A;  5L4E A;  2XQ7 A;  4AFT A;  2WNJ A;  4TWF A;  4F8H A;  5AFN A;  4HFB A;  5HEH A;  4COF A;  3TLW A;  2XQ9 A;  4B5D A;  3SQ9 A;  4QH4 A;  2Y56 A;  4X5T A;  2BG9 E;  5HEJ A;  2VL0 A;  3JAD A;  5HEG A;  2W8G A;  4TNW A;  3U8L A;  3UU6 A;  3P4W A;  3UQ4 A;  2Y58 A;  3U8J A;  4PIR A;  4IL9 A;  2BR7 A;  3JAE A;  4A98 A;  5J5F A;  3RI5 A;  2W8F A;  2BYN A;  2ZJU A;  2BYR A;  2XYS A;  4XHE A;  3UU8 A;  4TNV A;  5CFB A;  2WZY A;  2BG9 B;  5BW2 A;  3UQ7 A;  3ZDG A;  5AFJ A;  4UM3 P;  4LMJ A;  2WN9 A;  3GUA A;  4AFG A;  4TWD A;  3JAF A;  3T4M A;  2XQ6 A;  3UU3 A;  4WV9 A;  5BP0 A;  2BG9 C;  5HEO A;  3WTI A;  4BQT A;  1UV6 A;  4A97 A;  2Y7Y A;  2PGZ A;  2BG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...