2WNMA

Solution structure of gp2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
TGSLSVDNKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPCVAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE 2
publication title T7 Phage Protein Gp2 Inhibits the Escherichia Coli RNA Polymerase by Antagonizing Stable DNA Strand Separation Near the Transcription Start Site.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Hydrolase
total genus 11
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16857 RNA_pol_inhib RNA polymerase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.510 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wnmA00
4LK0M 2LMCA 2WNMA 4LLGM
chains in the Genus database with same CATH superfamily
3JSVA 1SSNA 2GI9A 2FCNA 2IY0B 4JQWC 3UIPB 1PGXA 1WJ6A 3VTWA 4A6QA 1NDDA 1K53A 2HDEA 1EU3A 3RNEC 2KX3A 3DOWA 3KUZA 3RUIB 2INCC 3MC0B 3B2GA 1CJEA 2KJRA 4K3CA 3Q3OC 4MACA 4XDCA 4E71A 2CHZA 1RWSA 2JYEA 4ANUA 1A70A 3X0WA 2D3GA 1GC6A 1ESFA 2MJEA 1GB4A 3PZDA 2KXJA 2N7DA 4FULA 4HK2A 4ICVA 2JZZA 4ANXA 2BQQA 2KAJA 1GG3A 3A9KA 1NYRA 2DNFA 3KUCB 3EFUA 2MHJA 4P1CC 3P4RB 2K6QA 1H8CA 5TSSA 2KQSA 1ZP0B 4A9AA 2BPSA 4OZBA 2MBBB 2LGYA 1UH6A 2CHWA 2M4NA 4HDOA 4M8MA 1RM6C 3NOBA 2O2VA 4AS1A 3ZXRA 3DVGX 3APCA 1I7HA 2AQ2B 2KD0A 3ML9A 3N1ZC 3RZWC 1ACCA 1FFVA 1NI2A 4ARIA 4NQLB 3DVNV 2LXCA 1WRIA 3RNGC 3DHHC 3AM9A 2WXFA 1MI0A 4FA6A 5AZHA 3BZDB 4GDKB 4OHJA 1V1OA 4IW0A 4XGAB 4DXFA 1E7PB 5E6OA 2WXKA 3HRDD 2KDIA 1LM8B 2L1AA 4W9HA 1YQBA 2N4FA 4HPLB 2WXJA 3JSVB 1V5OA 3IFWB 3AU4A 3MTNB 2AQ3B 4MGKE 4WH4A 4B0EA 5LNK1 1V86A 2J4XA 4XE0A 4BBNC 4AUQC 4XDDA 3WAPA 3NVZA 2WQYB 2BW2A 1KLVA 2QILA 4P7IA 2DZIA 2KN5A 5D3DA 2FIDA 3EHVA 1TTNA 1C78A 5JH5C 4GN1A 4EUTA 2BVCA 2NR2A 1L2NA 2J53A 4W9KA 3BINA 2N7JA 5DCNA 3QARA 4RGOS 1L5PA 2D2QA 4NQKE 2HE7A 3LB8C 5HI1A 4JWSC 3A9KB 1GAQB 1F0ZA 3TEXA 5IP4D 3CIRB 4R3DA 1TKEA 1E6EB 2M19A 4IC7B 3U8ZA 1TKGA 3QA8A 3R7RA 2BYTA 4CQNA 4JLCA 4TKNA 3U7DA 2KVRA 4RGNA 5LXHA 4DXGA 3GZNI 1YX6B 2QJLA 3SFDB 5IAAC 3KLSX 2K39A 1EWYC 1Q1OA 3N20C 3Q3MC 2KZRA 3VR8B 4I6LB 1KM7A 5BYSA 3EECA 2L83A 2O2VB 1V49A 1QT9A 2MSED 2HTME 2QEJC 3RNCC 1ET9A 3O13A 1WM2A 2H88B 2N1WA 4JPSA 3I9V1 4WJQA 5JXVA 5J18A 3AXCA 3VH3B 3RZFA 2WXLA 2WS3B 1ZOYB 2N7EA 3U52E 3SHQA 5JHBA 4MDKE 1OQRA 2RSUA 3LYYA 4GOCA 1WGGA 2OHFA 2V1YA 2LFIA 4ZRJA 2NVUI 4KSKC 1B9RA 2BT6A 1JWUD 4KDLB 4K7UA 1OGWA 3I3TB 3L16A 2KACA 2BGFA 2ZVOA 1WSPA 3Q6BA 2WXRA 4LJOB 2FCSA 1YNTE 5CHVC 2RD0A 4WAAA 3ZXVA 1QF6A 1E8YA 2INNE 1QILA 2IO3B 1WX7A 3O65B 2ZEQA 1SGHA 2MBEA 4I6PA 4K81A 4MT5A 3HVDA 4G11A 4WQOB 3QIJA 1GOZA 3KW5B 4LLGM 4WJPA 4FHJA 4W9EA 3NZSA 2WX0A 2LJ5A 1XXGA 1YN3A 2FUHB 2BYVE 4XWWA 1UNSA 1TY0A 4NAMA 3H1UA 2N9KA 3Q14C 5EE1A 1MFWA 3FILA 3OJ3A 4M02A 2NPTA 2UU7A 1C4PA 2ZW1A 4NJ6A 1WMHA 2N9LA 1Y56A 4WURA 4REZA 3TUOA 1PQSA 1ZXIA 1CQVA 1HA5A 3KWVA 4PS3A 4KDIC 3A33B 2ASQA 2ZCBA 3T3NA 2Y5PA 2PE9A 1I4PA 1WXQA 2IPKD 2K8HA 1N63A 3BVMA 2KT7A 3GOEA 3V05A 1UGMA 4N58A 2BKFA 1WXMA 1DOIA 4JGHB 3DCGA 1P9DU 2C7MB 2D5GA 4ASWC 1JALA 1C79A 2PKOA 1WGHA 2JX5A 2IGGA 1WF9A 4Q2JA 1EF5A 1D5ZC 3QK0A 5J17A 4ZHOA 3LJ3A 3N9YC 2B76B 3RI7C 4HKQA 1C77A 4LK0M 3P4PB 4D2KA 2ICIA 2JPHA 4HVBA 3VUWA 3VUYA 1ROEA 2YLMA 4IM2A 4KGSA 2V3NA 4LNKA 3DBSA 4M01A 3L17A 3QAQA 1V9JA 1NENB 1TIFA 2G4DB 1WE6A 4BAXA 1WZ0A 2A5UA 4DDID 1E5WA 5HKHA 3ZNZB 1WI0A 1I4HA 3ZRFA 1Q10A 5FK9C 1L7YA 2ZPYA 3AEDB 2FUG1 2PEAA 4J3OD 1WYWB 2N9XA 2JYTA 2K9XA 1Z5SB 4ZRKA 4K7SA 3RNAC 2YEPF 2K8CA 4KX6B 1LO5D 4HCPB 3PREA 3NVWA 5GXGB 2UYZB 1NEKB 2BS3B 2REXA 4I6NB 2EMSA 4G0NB 5BYQA 1E8WA 4YTPB 1F52A 1PFDA 3FILB 1I4GA 2NPTB 4DK5A 2L76A 5AUIA 3WA0A 1VJKA 5TR5A 2LUEA 3DVGY 5JHAA 1WMHB 4NPNA 2AL3A 2OJRA 4RF1A 4IKGA 3IAS1 2JXXA 4HDQA 4RF0A 1LQBA 2JWZA 3ZNID 1EU4A 3MFGA 1T6BX 4TV3A 2W9NA 1D5MC 1T0RC 3AV8A 4IWQA 2X38A 3MC8A 1VZ8A 1IUEA 2I2YA 1VLBA 1SIFA 3SU8X 1QZEA 2KWDA 4FN2A 1WZ3A 3C8YA 1E90A 1SE2A 1NYQA 1ZDXA 5E6PA 3N32A 3PLVA 2PE6B 3PHWB 4S0RA 3SDLC 1P7EA 1GC7A 1E8XA 2GMIC 3RMKC 3P63A 2JF5A 3W9CB 5CHWA 1YQ3B 2CR5A 3VTVA 2BS2B 2C7HA 3PPAA 5G55A 1UELA 1WX8A 1FNVA 2IO1B 4RM8A 1YOVB 4ANWA 5DPTA 4NY0A 4MGZE 1N61A 4K7WA 5KHQA 3TSSA 2BYEA 2JZ3B 3ZTCA 2DWQA 4EKUA 1FMAD 3U4EG 4BVUC 1N60A 1I4RA 3L10B 2NBUA 2KLCA 3TMPB 1V80A 2W82A 4UDUC 1WJUA 1ZKHA 2QIEB 4MELA 2DAJA 1RRBA 2LGDA 1RLFA 3ENEA 2HJ8A 3X23A 2FCQA 1L0VB 1FFUA 2N9EB 3UQBA 1NBFC 5E6NA 2M1MA 1MG8A 1YN4A 3AE3B 2EKEC 3ZYYX 3DHIC 4L2YA 2MW5A 3IHPC 1YN5A 4BFRA 1J19A 3OJ4B 4ANVA 3VXWA 2PIAA 1ZXHA 2JUOA 3NUHB 1RYJA 1XQQA 1V5TA 2HJ1A 3ZTDA 2J42A 1WJNA 2K5PA 3KH0A 1FCLA 3IXSA 3ZRCA 2JXTA 3FKYA 1F9JA 2MEKA 2W3RA 2BYFA 2W55A 3TEWA 2EMTA 3EC8A 1XCQL 3MJ5A 3N1YC 4C56C 4N9F4 4C7YA 3FAHA 4G50A 2LGIA 1M94A 2O6VA 1ENFA 2AYOB 3W2DA 2D11A 3MC9A 1U4AA 4RGMA 1J7BA 1Q0WB 1YJJA 2Z0EB 3B2FA 4WWPA 2ZW0A 2MA9B 2WU2B 4AP4C 3SD5A 3NJTA 3N30A 4LDTD 3WAOA 2WDVB 1QOGA 1KLUD 3H7SA 2L00B 1FO4A 2XK5B 1XLPA 4WWMA 2DZJA 2I1KA 3PSEB 2G1EA 3P2BA 3PRZA 1YD8U 3HM6X 3UIOB 1OEYA 3AULA 5C23A 1FD6A 2Z0DB 1DOXA 1K8RB 2GBKA 3WANA 4W9FA 4IM0A 5C2TB 3K9PB 3Q69A 2BKRB 1QOBA 1C76A 4II3B 1J8CA 2KYWA 4YSZB 4KIKA 2JT4B 2CJNA 5C3JB 2PTLA 4JWUC 2KJHB 2BS4B 1VRAB 3A4SC 1F2RC 3APFA 2LVPA 4BKGA 1GNUA 1SE3A 1T5XD 1VCBA 3EA6A 4ZYSA 3U30A 4BOZB 1TGZB 5EE9A 2LRUA 4X57B 1IPGA 5D2MB 3NS8A 4O1NA 2NTTA 2KTFA 1ET6A 2IBIB 4US9A 3DWMA 3ZJVA 1L6UA 3W5UB 5AUKA 4S17A 2L32A 5H92C 1EO6A 2WXGA 1KF6B 3LDZE 4WJNA 4RGTA 2IO2B 1VZ7A 1BUIC 4F8CB 2RPQA 1G6JA 5G5GA 2L05A 4HLEA 4AJYB 1ZUD2 1XLOA 3CMMB 2YVCA 4PYZA 1RAXA 3IVFA 2NBVB 5DPSA 1ZW7A 3AE7B 4J6IA 3I63C 1S3SG 2PW9A 3T8MA 5L83A 2L0FA 3RCZA 1J7AA 4ARCA 4CHKA 1HEZE 2O6VB 5HG2A 4OVZA 1TS2A 3QHTA 1D5XC 4TMAB 3TEYA 1LGRA 4EZJA 4BKTA 1K52A 2HTHA 4MH0E 3PVLA 3V61A 2L8JA 3R8BA 4WWOA 4HRSA 5G5HA 2ZCCA 2GBMA 2KMCA 1BMLC 3TIXA 2LVOA 3VTUA 3JW0X 4KKJA 1AW7A 3RT3B 2KN4A 4II2B 2GLSA 1SJHD 3P1MA 1YIWA 1YQ4B 4XYCA 2JQRB 4MGIE 1D6EC 3TL5A 4WQMA 1XD3B 2XNAC 2GBRA 4PT5A 4TSSA 4HPMB 1FNUA 2VRRB 3ALBA 4KIKB 4BZAA 1E7VA 5D7GA 1V81A 2LI5A 2PMVA 1HXYD 5J2RA 3CWIA 2GOWA 2ZNVC 3AMZA 3URYA 3WAMA 1UD7A 4JE3B 4HPPA 3ZO5B 2AEHA 1EWCA 1OQYA 3Q8BA 1MJDA 4LTUA 3M63B 1P0RA 1WGRA 2KQ7A 4F1SA 1I35A 2BB5A 2BWFA 4YWGG 2FIFA 2ZNVB 3KQ4A 4NAWA 2C9WB 4DXAB 4PYUA 1K51A 4HJKA 2OEDA 4XX5A 4OVVA 1TKYA 2BF8B 2FBWB 3L4PA 4EZLA 2LGXA 3TEZA 3RNFC 2KNBA 3T9LA 4WIPA 1OQQA 4PS8A 3AE2B 3C19A 2WDQB 3VRAB 3AU5A 3L08A 4DHZE 4NZLB 5HFYA 3ABVB 3H7PA 3BVZA 2V4LA 4JL9A 3RN9C 4GDLA 2WXQA 4OZAA 2H89B 2BTEA 3PTFC 1T0QC 4GU2A 1E0ZA 1XEEA 4P1BC 5D6JB 4DHZB 3VRBB 2JVCA 1EM7A 2C7NB 5FR6A 2QHOA 2MJ3A 4MM3A 3DBHI 2L0TA 3M3JA 4TUUA 3ZNHB 3BK1A 2D10A 4IM3A 2LRWA 2ZPNA 1MPEA 3I57A 4ZRIA 3M95A 3PS6A 2FNJB 2N0SB 2JY6A 4P6VF 2MRPA 1JRUA 2V0GA 4C4VB 2BBCA 5MPOA 3HUIA 1E8ZA 4KZCA 2RDGA 1AWDA 1P7FA 4W9DA 3W1SA 4W9JA 4LNFA 1AYFA 1A5RA 3NVVA 2NCNA 2UWQA 1WR6E 3WALA 2CKHB 4MH8A 1JW9D 4W9LA 4USAA 2K3UA 4ZRPA 2WYQA 3PRPB 4LNIA 1KTKA 4FHKA 3AEAB 4RMAA 1SEBD 2KQ4X 4LNNA 4GSWA 3QWZB 3ZVVA 3MHSD 1UZXB 2KWUB 4F7ZA 1PYWD 3V6EB 3P4QB 4NAWB 2KTRA 3ECIA 3AH7A 3ML8A 5DPWA 1IBXB 4HEA1 3DBRI 4WAFA 3ONSA 3TJPA 2MP2A 2L3ZA 4M0WA 1F2RI 1IGDA 4LDTB 3W5VB 1JRPA 3AE9B 3BVGA 1NVID 3H7PB 2SAKA 4IWPA 3V3XA 2MCNB 4GDLB 4C80A 1FRRA 1TS5A 2KOXA 2VH1A 3U7ZA 2KDBA 2LEKA 1JROA 1PGAA 2WHIA 2ACZB 2AX5A 3ZNGC 4YSXB 3CSFA 5H8YE 4MJSA 3C0RB 2NBWB 4B0MA 4MM3B 1CZPA 1HZ5A 1TZ1A 4GIVA 3MJWA 2RDBC 3L54A 4AOFA 1JMLA 3W1YA 1Q5WB 4B95A 2DYMA 4B6WA 1YX5B 2M8SA 4A8XC 2KFKA 3W1SC 4FXCA 1R4MB 3U2SC 4KZ0A 2AQ1B 2JRIB 4JIOU 4KVGB 1C4CA 2GBJA 1XT9B 2NMQA 3L0WB 1ZE3D 3EFCA 4YTNB 2KJ6A 1N5XA 1KFYB 1FRDA 1WRDB 2WXMA 1Y8RC 3AECB 3ETRA 1ISNA 2NTSA 3PV1A 1OEYJ 3R7QA 1MG4A 2I1JA 3AEEB 5BMHA 1S1QB 4FADA 5E6JA 1LXDA 1WGYA 2WWZA 1IYFA 1VZ6A 2IY1B 2XK5A 2C5LC 2BB6A 1P3QU 2C60A 4URKA 1SB3C 2WLBA 4OVUA 3PO0A 3BIID 1WR1A 4DHJD 3ZKJC 2IGHA 4DDGD 4RNAA 3S2AA 2KTRB 1WJ4A 1HTQA 2J52A 2HD5B 1JCKB 4CYEA 1AN8A 2MP2B 2J0MA 2LHDA 4M0WB 3AE6B 3IT6B 4NJCA 3Q8EA 3DPDA 3VH4B 4MSQB 1L4ZB 1P98A 4HXDA 1KOTA 1HE8A 1FIQA 4EE2A 3KYCD 1VDVA 1WWTA 3KYDD 3SR6A 2IZVB 4EEWA 3AEGB 3PZ7A 2VZKD 1FM0D 3TCAA 4HKZE 5AZFA 3UF8A 1F77A 4YT0B 2DAFA 4RM9A 2WX1A 3Q3NC 4MJSB 3ZUNA 4ICUA 3NS1A 1E7UA 3L13A 1BT0A 3H9DA 1SJED 2KLGA 4W9GA 1UBQA 1JQ4A 2J0JA 5EDSA 4AWJA 4LJPB 4EOYA 1DYQA 3QX1A 5BMIA 1SE4A 1STEA 2KFKB 4HWIB 1WIAA 3ZGZA 2KO3A 2KKCA 3DBHB 4ZDVA 3NHEB 2D3CA 1UWMA 2WU5B 3NZ3A 1L6VA 5AEKB 3KWLA 3DVNU 1J7CA 1IGCA 2L7RA 3AEFB 3BYYB 5CTRC 1TYGB 1QOFA 2J0KA 3APDA 4BBNF 4MGYE 2M0AA 5FR3A 3BY4B 2SEBD 2M56B 2Y3AA 3GE8C 1WM3A 1GPXA 2INDC 3B1LX 4NNJB 3DQVA 2LZ6A 3UGBB 4HCNB 3AE1B 4ACFA 1J0GA 4RFBA 3E56A 1FNWA 3QQ8B 1SXTA 1TT5B 2JZPA 1UGJA 1YJIA 2J7QB 2XEWA 1WH3A 1L0YB 3P42A 1XLQA 2B3AA 3AE5B 1C4AA 4HJGE 2KWVB 3DWGC 1IP9A 2ZJDA 4DWFA 1SIJA 1XLNA 3GS2A 2LHEA 2FCMA 2N9PC 2DYOA 1I4XA 1MVKA 2KDMA 1BXTA 2ZVNA 2MLBA 2V9HA 1FXTB 1C1YB 2IGDA 1R4NB 2V3PA 4FJVB 5HHDG 3IT4B 2JWUA 1WGDA 4XWTA 3DBRB 2INPE 1FCCC 2ON8A 4A90A 4DBGA 1V97A 1FXIA 2CU1A 3CSTA 1YMHE 1WE7A 2MJDA 2W54A 2KDFB 3CF6E 4ITKA 2LXAA 5IO9A 3V6CB 2LUMA 1C9FA 2KC2A 3JVZX 3UINB 1V1PA 2IYDB 4JX1C 1DOYA 3IAM1 4A55A 5T8IA 3VAWA 2XN9C 3FC4A 2FAZA 1R7SA 4RH6A 2X8XX 3PRMB 3LXFA 2PJHA 2CJOA 3GE3C 3H8HA 2DLBA 5EE0A 3ZLZA 3IG3A 1HTOA 1X1MA 3WIMA 3A1QA 4GMVA 2M17A 3GP7A 1R4MI 3V60A 2W3SA 1H4RA 1MHHE 3DHGC 3MHZA 1L0XB 5EE3A 2R2QA 2PVOD 2WXHA 2V4IB 2XBBC 3PHXB 1RFAA 3I5JC 1SF0A 4ZRQA 4KV2A 4US8A 3IBEA 3HHMA 2DENB 3AN1A 2G4SA 2KDEB 3J9CA 1JWMD 1AARA 4W9CA 5C1ZA 1I4QA 4M8NA 4C4VA 2G45B 1TY2A 2CS4A 1ZDVA 4YSYB 2D3BA 4IWOA 5I4DA 2LMCA 2I38A 2GB1A 2JU6X 2Q5WD 1DGJA 1UF0A 3EGRA 5GMVA 1F1HA 2PVGC 2MBQA 2RGFA 3ZIMA 1T3QA 1PUTA 2KANA 2K0PA 3HIZA 4RCOA 1FEHA 2WNMA 2LGSA 2E6XA 1TBEA 2DHZA 1GB1A 5IN7A 4K3BA 5FKAC 1QKZA 1KLGD 3Q3JA 2KVZA 4YTMB 2L52A 3WCQA 2MH7A 2VH2A 3UI3A 3QCAA 4A3PA 2IDYA 5D3IB 2QMTA 5CX3A 1QQRA 2Y5BB 1YJ1A 3PZ8A 3N1XC 1IBXA 3PT2B 2QC8A 2KWCA 4IOIE 3RNBC 2D3AA 2RDHA 4YL8A 2FE8A 1E10A 4E3CA 3P4SB 1V1PB 4FJZA 3SFEB 3RFZB 1P1AA 3AI5A 4N59A 2K22A 4YXDB 3RYTA 1NI3A 4BOSC 1WFYA 3ZDMC 4N6EB 1N62A 4L1BA 1I42A 1WX9A 1ZPSA 3DBLB 4DHJB 1RFKA 3ZW3A 2K6DB 1VR9A 4ZOHC 4GXBA 2K25A 2WXOA 3V62A 1B1ZA 3BWUD 4XZ4A 2WXIA 1UWXA 1HQRD 1WXAA 3A1QB 2MWSB 3VDZA 1UBIA 1QLBB 3B0AA 3OG5A 2KX0A 2JSVX 3K9OB 4KGRA 4KGTA 1TZOA 2RMMA 3BYTB 2AWTA 1D3ZA 2JRHA 1CMXB 2G9HD 4OZCA 1PDXA 4BKSD 4AQ7A 2VZKB 3B9JA 4HROA 2KK8A 2EKIA 2K1FA 1HZ6A 3Q8AA 1SE9A 4IUMB 3VUXA 4GB9A 1Z2MA 1L4DB 1TJEA 2TSSA 4A3OA 2LASA 1WYGA 4H2AA 1T0YA 5BMGA 2WXNA 4DQOC 3R2IA 1SBBB 2IO0B 3OAWA 3HM3A 3R66C 5D94A 2A4ZA 2OJWA 4NJ7A 5AZGA 2KHWB 4XC2A 2V3SA 1JWSD 3Q3FA 2GRIA 2MQJA 1V8CA 3VR9B 2R2OA 2RPVA 3VFKA 2M0XA 2MX2A 2QSDA 2DBYA 3NVYA 2WXPA 2N1VA 5IKCM 2E3TA 2KMMA 3ZQ4A 4KKIA 1KH0A 1R4NI 4L23A 3VHTC 2LWPA 1N6ZA 1WXSA 4LNOA 3D32A 2DYBA 3N3KB 4IG7B 4C7ZA 3KVFB 2DZMA 4FLHA 3Q2AC 3RPFC 1M4VA 1EUVB 2O6VD 2NS5A 2KC1A 2DX5B 1LFDA 2AL6A 5BO4B 4P16A 4MEMA 1OFFA 3SEBA 3QC8B 2BWES 3A9JA 2EELA 4IDIA 3Q8FA 1EF1A 2Y5CA 4KSLC 3ZJUA 2RR9A 2DZKA 4TQ1A 3PGEA 3AB5A 2KFJA 2K8BA 1V2YA 2GBNA 3OLMD 3R3MA 1E9MA 1XCTL 2LD9A 5KHOA 1XF5L 5G2NA 4K1RB 2WDRB 4WWNA 4QAYA 1VD2A 1KJTA 3GB1A 3A4RA 2WGSA 3NY5A 1MHXA 4M00A 2Z59B 3H6NA 1TS4A 3NZUA 1ZGUB 1UUPA 2LVQA 3HK0A 3VVWB 4PS7A 3RULA 1V6EA 1GUAB 2KMAA 3QJZA 1PGBA 4MSMB 3Q8CA 1N5WA 4GLSC 2MBHA 5LXIB 5L95C 1WGKA 4TQ0A 3NRZA 1K50A 2D07B 3GZNB 3M62B 1C3TA 1XO3A 4WJOA 3T3OA 5IOIA 1FPYA 4G3XB 1QOAA 3DDCB 5DPRA 1FXAA 3NG0A 2OOBB 3E9SA 2ZZPB 3OWEB 3B08A 2CHXA 2YEPB 4AJWA 2PPHA 4CO7A 1CK1A 2Z8LA 4FJYA 4FBJB 3MP9A 1JWAD 4C00A 5CHFA 4PK1A 3AE4B 2WDTB 3JYUA 2WP9B 2IJ0A 1JWBD 1WY8A 1D4BA 4E74A 4ZYNA 4B9KA 5IA7A 2QCZA 3UQAA 4BKSA 4A20A 5JZEB 3BK2A 3KUDB 4ZHPA 1TS3A 3HVZA 1GJZA 3ZJTA 3AEBB 5LLIA 3EUB2 3RD2A 3A9JB 4GDKA 4LCDE 3TBLD 3ZDTA 2R61A 2MBOA 1WXVA 3AE8B 4W9IA 3R2TA 2G3QB 1T0SC 3PLUA 1OTRB 4EZKA 3VQIA 2QDFA 2ONQA 4OW0A 1KRHA 2PLPA 5BYRA 4GGQA 3DBLI 2CU3A 2LJIA 4EFOA
chains in the Genus database with same CATH topology
1SSNA 1V1PA 2GI9A 4YTPB 4NZLB 5HFYA 1PGXA 3ABVB 1PFDA 3BVZA 3FILB 4JX1C 1DOYA 3IAM1 4A6QA 4A55A 5T8IA 1I4GA 1K53A 2XN9C 3FC4A 5AUIA 1VJKA 2HDEA 2WXQA 1EU3A 4OZAA 1R7SA 4RH6A 3LXFA 2H89B 4RF1A 3MC0B 2BTEA 2CJOA 4IKGA 3IAS1 3B2GA 4RF0A 1CJEA 3H8HA 4XDCA 4MACA 2DLBA 5EE0A 1E0ZA 1XEEA 1EU4A 1RWSA 3VRBB 1EM7A 2JYEA 3MFGA 1A70A 1T6BX 2MJ3A 3GP7A 1ESFA 2W3SA 1D5MC 2MJEA 1MHHE 1GB4A 3MHZA 3AV8A 1L0XB 2X38A 5EE3A 1VZ8A 2PVOD 2WXHA 2V4IB 3BK1A 1IUEA 2I2YA 1VLBA 1SF0A 4ZRQA 2KWDA 1MPEA 3I57A 4US8A 2KAJA 3C8YA 2N0SB 3AN1A 1SE2A 1ZDXA 1NYQA 1NYRA 4P6VF 3J9CA 1JWMD 2V0GA 1P7EA 2BBCA 5MPOA 3HUIA 1I4QA 3P4RB 2RDGA 1TY2A 1ZDVA 4YSYB 3P63A 1AWDA 5I4DA 2LMCA 3W9CB 1P7FA 2I38A 2GB1A 3W1SA 1YQ3B 2JU6X 2Q5WD 5TSSA 1AYFA 1DGJA 2BS2B 1ZP0B 3NVVA 1FNVA 3EGRA 4A9AA 4OZBA 2PVGC 4MH8A 1N61A 1JW9D 3TSSA 1T3QA 1RM6C 1PUTA 2DWQA 4AS1A 4USAA 2K0PA 1I7HA 4RCOA 2AQ2B 2K3UA 1ACCA 1FFVA 1FEHA 4ZRPA 2WNMA 4ARIA 1FMAD 3U4EG 2E6XA 1GB1A 1N60A 1I4RA 1KTKA 5FKAC 1QKZA 1KLGD 3AEAB 4YTMB 1SEBD 1WRIA 2KQ4X 2L52A 3WCQA 2MH7A 2W82A 1PYWD 3AM9A 4UDUC 3UI3A 3P4QB 2WXFA 4NAWB 1MI0A 2IDYA 5D3IB 2QIEB 2QMTA 3BZDB 3AH7A 4GDKB 4OHJA 1QQRA 1IBXB 1V1OA 3PZ8A 4HEA1 4WAFA 1L0VB 1IBXA 1FFUA 4DXFA 1E7PB 2WXKA 4IOIE 4M0WA 1F2RI 3HRDD 1IGDA 2RDHA 1YN4A 2L1AA 3AE3B 2FE8A 1E10A 3P4SB 3W5VB 1JRPA 3ZYYX 2WXJA 3AE9B 1V1PB 3SFEB 4L2YA 3BVGA 3RFZB 4WH4A 2AQ3B 1NVID 4N59A 4B0EA 5LNK1 2K22A 4YXDB 1YN5A 2J4XA 4XE0A 2SAKA 3V3XA 4GDLB 1NI3A 4C80A 1FRRA 1TS5A 3U7ZA 4XDDA 2PIAA 1ZXHA 2LEKA 4N6EB 3NVZA 1N62A 2WQYB 3NUHB 2BW2A 1RYJA 1JROA 1PGAA 4L1BA 2ACZB 1ZPSA 2AX5A 4YSXB 1RFKA 2J42A 2QILA 1VR9A 4ZOHC 5H8YE 2K5PA 2WXOA 1FCLA 1B1ZA 3IXSA 2JXTA 5D3DA 3BWUD 2WXIA 2MEKA 4B0MA 4MM3B 1UWXA 1HQRD 2W3RA 1CZPA 1HZ5A 1C78A 2W55A 3TEWA 1XCQL 1JMLA 1QLBB 3MJ5A 2JSVX 4C56C 4KGRA 2J53A 2N7JA 4KGTA 1TZOA 2DYMA 4RGOS 4C7YA 2RMMA 3FAHA 1L5PA 3BYTB 4A8XC 2LGIA 3LB8C 5HI1A 4FXCA 2G9HD 1ENFA 4JWSC 1GAQB 4OZCA 1F0ZA 1PDXA 3TEXA 3W2DA 3U2SC 4AQ7A 3CIRB 4R3DA 2VZKB 3B9JA 4HROA 2AQ1B 1TKEA 1E6EB 2EKIA 2M19A 4RGMA 1TKGA 1HZ6A 1J7BA 3Q8AA 2BYTA 1C4CA 2NMQA 4CQNA 1YJJA 1ZE3D 4YTNB 3B2FA 1N5XA 1KFYB 4RGNA 1FRDA 2ZW0A 4DXGA 2WXMA 2QJLA 3SFDB 3KLSX 1EWYC 1L4DB 1TJEA 2TSSA 2WU2B 3AECB 3ETRA 1WYGA 4H2AA 5BMGA 2WXNA 2NTSA 3VR8B 2WDVB 4DQOC 1QOGA 3R2IA 1SBBB 1KLUD 2L83A 5BYSA 3AEEB 1FO4A 1QT9A 5BMHA 2HTME 2QEJC 5E6JA 1XLPA 4WWMA 1ET9A 2G1EA 1VZ6A 3O13A 2H88B 1JWSD 2BB6A 1FD6A 2GRIA 4JPSA 3I9V1 1DOXA 5JXVA 1SB3C 2WLBA 3PO0A 1V8CA 2WXLA 2WS3B 1ZOYB 3VR9B 3BIID 3U52E 2RPVA 2IGHA 1OQRA 5C2TB 3LYYA 3Q69A 4RNAA 1QOBA 2DBYA 2QSDA 2WXPA 3NVYA 1C76A 2OHFA 2LFIA 4YSZB 2E3TA 2KMMA 3ZQ4A 2CJNA 2J52A 4KKIA 5C3JB 1KH0A 1B9RA 2BT6A 4L23A 1JWUD 2PTLA 1JCKB 1AN8A 4JWUC 2KACA 2LHDA 2BS4B 3AE6B 4C7ZA 3IT6B 1VRAB 4NJCA 3Q8EA 1F2RC 1WSPA 1SE3A 1T5XD 3EA6A 2WXRA 4ZYSA 1L4ZB 3RPFC 1YNTE 5EE9A 1M4VA 4O1NA 1FIQA 2NTTA 4EE2A 1QF6A 1ET6A 1VDVA 1WWTA 3DWMA 4US9A 3SR6A 2INNE 1L6UA 3ZJVA 1QILA 3W5UB 4P16A 3AEGB 3PZ7A 5AUKA 2L32A 1OFFA 1FM0D 2VZKD 5H92C 4MT5A 3SEBA 4HKZE 3HVDA 1F77A 2WXGA 1KF6B 4YT0B 4RGTA 2EELA 1GOZA 4IDIA 1VZ7A 4LLGM 1BUIC 3Q8FA 2Y5CA 1XXGA 3NS1A 3ZJUA 1YN3A 5G5GA 1ZUD2 1SJED 4XWWA 4TQ1A 1XLOA 1UNSA 1TY0A 4NAMA 1JQ4A 2N9KA 5EE1A 3AB5A 3FILA 3AE7B 1DYQA 2PW9A 1C4PA 2ZW1A 5BMIA 1E9MA 1SE4A 1J7AA 1STEA 4ARCA 1XCTL 1HEZE 2N9LA 1Y56A 3ZGZA 4WURA 5HG2A 1XF5L 4REZA 3TUOA 1ZXIA 2WDRB 1CQVA 4OVZA 1TS2A 1D5XC 1HA5A 3KWVA 1UWMA 2WU5B 3NZ3A 4TMAB 3TEYA 1L6VA 3KWLA 3GB1A 3T3NA 1K52A 1J7CA 2Y5PA 1IGCA 3AEFB 1I4PA 1MHXA 2IPKD 1WXQA 1N63A 3BVMA 3BYYB 1TS4A 3V05A 3R8BA 1TYGB 1QOFA 4HRSA 5G5HA 1UUPA 4N58A 1BMLC 2M0AA 1DOIA 4KKJA 5FR3A 1PGBA 2SEBD 3Q8CA 2M56B 1N5WA 1AW7A 4GLSC 2Y3AA 1GPXA 1WGKA 2KN4A 4TQ0A 3NRZA 1K50A 1SJHD 3P1MA 2D5GA 1YQ4B 3AE1B 1XO3A 1JALA 4RFBA 3T3OA 2JQRB 3E56A 1C79A 2PKOA 1QOAA 1FNWA 2JX5A 1D6EC 1FXAA 2IGGA 4WQMA 2XNAC 4Q2JA 3E9SA 4TSSA 4PT5A 1D5ZC 1SXTA 3OWEB 2JZPA 1UGJA 2YEPB 4ZHOA 1YJIA 1FNUA 3N9YC 1L0YB 2B76B 1CK1A 2Z8LA 3P42A 3MP9A 4HKQA 1XLQA 3AE5B 1C77A 1C4AA 4HJGE 3P4PB 4LK0M 4D2KA 2ICIA 1JWAD 1ROEA 5D7GA 2PMVA 1HXYD 3DWGC 3CWIA 4KGSA 2V3NA 3AE4B 1SIJA 1XLNA 3GS2A 3AMZA 3URYA 2LHEA 4JE3B 1NENB 2WP9B 2IJ0A 2DYOA 1I4XA 1JWBD 1MVKA 1EWCA 3Q8BA 2KDMA 1BXTA 4LTUA 1D4BA 2IGDA 1I4HA 1Q10A 2V3PA 3BK2A 5FK9C 4ZHPA 5HHDG 1TS3A 3AEDB 2BB5A 3HVZA 2FUG1 3IT4B 2JWUA 4YWGG 3ZJTA 3KQ4A 4J3OD 4XWTA 2INPE 1FCCC 3AEBB 2JYTA 2ON8A 2K9XA 3EUB2 4A90A 1K51A 1V97A 2OEDA 1FXIA 2R61A 1TKYA 2FBWB 2YEPF 3AE8B 1YMHE 3L4PA 3R2TA 4KX6B 2MJDA 3TEZA 1LO5D 2W54A 3NVWA 4ITKA 5GXGB 3VQIA 1NEKB 2BS3B 4WIPA 2ONQA 4OW0A 1OQQA 1KRHA 2PLPA 5BYRA 2CU3A 2LJIA 3AE2B 2LUMA 2WDQB 3VRAB 5BYQA 1C9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK0 M;  2LMC A;  2WNM A;  4LLG M; 
#chains in the Genus database with same CATH topology
 3JSV A;  1SSN A;  2GI9 A;  2FCN A;  2IY0 B;  4JQW C;  3UIP B;  1PGX A;  1WJ6 A;  3VTW A;  4A6Q A;  1NDD A;  1K53 A;  2HDE A;  1EU3 A;  3RNE C;  2KX3 A;  3DOW A;  3KUZ A;  3RUI B;  2INC C;  3MC0 B;  3B2G A;  1CJE A;  2KJR A;  4K3C A;  3Q3O C;  4MAC A;  4XDC A;  4E71 A;  2CHZ A;  1RWS A;  2JYE A;  4ANU A;  1A70 A;  3X0W A;  2D3G A;  1GC6 A;  1ESF A;  2MJE A;  1GB4 A;  3PZD A;  2KXJ A;  2N7D A;  4FUL A;  4HK2 A;  4ICV A;  2JZZ A;  4ANX A;  2BQQ A;  2KAJ A;  1GG3 A;  3A9K A;  1NYR A;  2DNF A;  3KUC B;  3EFU A;  2MHJ A;  4P1C C;  3P4R B;  2K6Q A;  1H8C A;  5TSS A;  2KQS A;  1ZP0 B;  4A9A A;  2BPS A;  4OZB A;  2MBB B;  2LGY A;  1UH6 A;  2CHW A;  2M4N A;  4HDO A;  4M8M A;  1RM6 C;  3NOB A;  2O2V A;  4AS1 A;  3ZXR A;  3DVG X;  3APC A;  1I7H A;  2AQ2 B;  2KD0 A;  3ML9 A;  3N1Z C;  3RZW C;  1ACC A;  1FFV A;  1NI2 A;  4ARI A;  4NQL B;  3DVN V;  2LXC A;  1WRI A;  3RNG C;  3DHH C;  3AM9 A;  2WXF A;  1MI0 A;  4FA6 A;  5AZH A;  3BZD B;  4GDK B;  4OHJ A;  1V1O A;  4IW0 A;  4XGA B;  4DXF A;  1E7P B;  5E6O A;  2WXK A;  3HRD D;  2KDI A;  1LM8 B;  2L1A A;  4W9H A;  1YQB A;  2N4F A;  4HPL B;  2WXJ A;  3JSV B;  1V5O A;  3IFW B;  3AU4 A;  3MTN B;  2AQ3 B;  4MGK E;  4WH4 A;  4B0E A;  5LNK 1;  1V86 A;  2J4X A;  4XE0 A;  4BBN C;  4AUQ C;  4XDD A;  3WAP A;  3NVZ A;  2WQY B;  2BW2 A;  1KLV A;  2QIL A;  4P7I A;  2DZI A;  2KN5 A;  5D3D A;  2FID A;  3EHV A;  1TTN A;  1C78 A;  5JH5 C;  4GN1 A;  4EUT A;  2BVC A;  2NR2 A;  1L2N A;  2J53 A;  4W9K A;  3BIN A;  2N7J A;  5DCN A;  3QAR A;  4RGO S;  1L5P A;  2D2Q A;  4NQK E;  2HE7 A;  3LB8 C;  5HI1 A;  4JWS C;  3A9K B;  1GAQ B;  1F0Z A;  3TEX A;  5IP4 D;  3CIR B;  4R3D A;  1TKE A;  1E6E B;  2M19 A;  4IC7 B;  3U8Z A;  1TKG A;  3QA8 A;  3R7R A;  2BYT A;  4CQN A;  4JLC A;  4TKN A;  3U7D A;  2KVR A;  4RGN A;  5LXH A;  4DXG A;  3GZN I;  1YX6 B;  2QJL A;  3SFD B;  5IAA C;  3KLS X;  2K39 A;  1EWY C;  1Q1O A;  3N20 C;  3Q3M C;  2KZR A;  3VR8 B;  4I6L B;  1KM7 A;  5BYS A;  3EEC A;  2L83 A;  2O2V B;  1V49 A;  1QT9 A;  2MSE D;  2HTM E;  2QEJ C;  3RNC C;  1ET9 A;  3O13 A;  1WM2 A;  2H88 B;  2N1W A;  4JPS A;  3I9V 1;  4WJQ A;  5JXV A;  5J18 A;  3AXC A;  3VH3 B;  3RZF A;  2WXL A;  2WS3 B;  1ZOY B;  2N7E A;  3U52 E;  3SHQ A;  5JHB A;  4MDK E;  1OQR A;  2RSU A;  3LYY A;  4GOC A;  1WGG A;  2OHF A;  2V1Y A;  2LFI A;  4ZRJ A;  2NVU I;  4KSK C;  1B9R A;  2BT6 A;  1JWU D;  4KDL B;  4K7U A;  1OGW A;  3I3T B;  3L16 A;  2KAC A;  2BGF A;  2ZVO A;  1WSP A;  3Q6B A;  2WXR A;  4LJO B;  2FCS A;  1YNT E;  5CHV C;  2RD0 A;  4WAA A;  3ZXV A;  1QF6 A;  1E8Y A;  2INN E;  1QIL A;  2IO3 B;  1WX7 A;  3O65 B;  2ZEQ A;  1SGH A;  2MBE A;  4I6P A;  4K81 A;  4MT5 A;  3HVD A;  4G11 A;  4WQO B;  3QIJ A;  1GOZ A;  3KW5 B;  4LLG M;  4WJP A;  4FHJ A;  4W9E A;  3NZS A;  2WX0 A;  2LJ5 A;  1XXG A;  1YN3 A;  2FUH B;  2BYV E;  4XWW A;  1UNS A;  1TY0 A;  4NAM A;  3H1U A;  2N9K A;  3Q14 C;  5EE1 A;  1MFW A;  3FIL A;  3OJ3 A;  4M02 A;  2NPT A;  2UU7 A;  1C4P A;  2ZW1 A;  4NJ6 A;  1WMH A;  2N9L A;  1Y56 A;  4WUR A;  4REZ A;  3TUO A;  1PQS A;  1ZXI A;  1CQV A;  1HA5 A;  3KWV A;  4PS3 A;  4KDI C;  3A33 B;  2ASQ A;  2ZCB A;  3T3N A;  2Y5P A;  2PE9 A;  1I4P A;  1WXQ A;  2IPK D;  2K8H A;  1N63 A;  3BVM A;  2KT7 A;  3GOE A;  3V05 A;  1UGM A;  4N58 A;  2BKF A;  1WXM A;  1DOI A;  4JGH B;  3DCG A;  1P9D U;  2C7M B;  2D5G A;  4ASW C;  1JAL A;  1C79 A;  2PKO A;  1WGH A;  2JX5 A;  2IGG A;  1WF9 A;  4Q2J A;  1EF5 A;  1D5Z C;  3QK0 A;  5J17 A;  4ZHO A;  3LJ3 A;  3N9Y C;  2B76 B;  3RI7 C;  4HKQ A;  1C77 A;  4LK0 M;  3P4P B;  4D2K A;  2ICI A;  2JPH A;  4HVB A;  3VUW A;  3VUY A;  1ROE A;  2YLM A;  4IM2 A;  4KGS A;  2V3N A;  4LNK A;  3DBS A;  4M01 A;  3L17 A;  3QAQ A;  1V9J A;  1NEN B;  1TIF A;  2G4D B;  1WE6 A;  4BAX A;  1WZ0 A;  2A5U A;  4DDI D;  1E5W A;  5HKH A;  3ZNZ B;  1WI0 A;  1I4H A;  3ZRF A;  1Q10 A;  5FK9 C;  1L7Y A;  2ZPY A;  3AED B;  2FUG 1;  2PEA A;  4J3O D;  1WYW B;  2N9X A;  2JYT A;  2K9X A;  1Z5S B;  4ZRK A;  4K7S A;  3RNA C;  2YEP F;  2K8C A;  4KX6 B;  1LO5 D;  4HCP B;  3PRE A;  3NVW A;  5GXG B;  2UYZ B;  1NEK B;  2BS3 B;  2REX A;  4I6N B;  2EMS A;  4G0N B;  5BYQ A;  1E8W A;  4YTP B;  1F52 A;  1PFD A;  3FIL B;  1I4G A;  2NPT B;  4DK5 A;  2L76 A;  5AUI A;  3WA0 A;  1VJK A;  5TR5 A;  2LUE A;  3DVG Y;  5JHA A;  1WMH B;  4NPN A;  2AL3 A;  2OJR A;  4RF1 A;  4IKG A;  3IAS 1;  2JXX A;  4HDQ A;  4RF0 A;  1LQB A;  2JWZ A;  3ZNI D;  1EU4 A;  3MFG A;  1T6B X;  4TV3 A;  2W9N A;  1D5M C;  1T0R C;  3AV8 A;  4IWQ A;  2X38 A;  3MC8 A;  1VZ8 A;  1IUE A;  2I2Y A;  1VLB A;  1SIF A;  3SU8 X;  1QZE A;  2KWD A;  4FN2 A;  1WZ3 A;  3C8Y A;  1E90 A;  1SE2 A;  1NYQ A;  1ZDX A;  5E6P A;  3N32 A;  3PLV A;  2PE6 B;  3PHW B;  4S0R A;  3SDL C;  1P7E A;  1GC7 A;  1E8X A;  2GMI C;  3RMK C;  3P63 A;  2JF5 A;  3W9C B;  5CHW A;  1YQ3 B;  2CR5 A;  3VTV A;  2BS2 B;  2C7H A;  3PPA A;  5G55 A;  1UEL A;  1WX8 A;  1FNV A;  2IO1 B;  4RM8 A;  1YOV B;  4ANW A;  5DPT A;  4NY0 A;  4MGZ E;  1N61 A;  4K7W A;  5KHQ A;  3TSS A;  2BYE A;  2JZ3 B;  3ZTC A;  2DWQ A;  4EKU A;  1FMA D;  3U4E G;  4BVU C;  1N60 A;  1I4R A;  3L10 B;  2NBU A;  2KLC A;  3TMP B;  1V80 A;  2W82 A;  4UDU C;  1WJU A;  1ZKH A;  2QIE B;  4MEL A;  2DAJ A;  1RRB A;  2LGD A;  1RLF A;  3ENE A;  2HJ8 A;  3X23 A;  2FCQ A;  1L0V B;  1FFU A;  2N9E B;  3UQB A;  1NBF C;  5E6N A;  2M1M A;  1MG8 A;  1YN4 A;  3AE3 B;  2EKE C;  3ZYY X;  3DHI C;  4L2Y A;  2MW5 A;  3IHP C;  1YN5 A;  4BFR A;  1J19 A;  3OJ4 B;  4ANV A;  3VXW A;  2PIA A;  1ZXH A;  2JUO A;  3NUH B;  1RYJ A;  1XQQ A;  1V5T A;  2HJ1 A;  3ZTD A;  2J42 A;  1WJN A;  2K5P A;  3KH0 A;  1FCL A;  3IXS A;  3ZRC A;  2JXT A;  3FKY A;  1F9J A;  2MEK A;  2W3R A;  2BYF A;  2W55 A;  3TEW A;  2EMT A;  3EC8 A;  1XCQ L;  3MJ5 A;  3N1Y C;  4C56 C;  4N9F 4;  4C7Y A;  3FAH A;  4G50 A;  2LGI A;  1M94 A;  2O6V A;  1ENF A;  2AYO B;  3W2D A;  2D11 A;  3MC9 A;  1U4A A;  4RGM A;  1J7B A;  1Q0W B;  1YJJ A;  2Z0E B;  3B2F A;  4WWP A;  2ZW0 A;  2MA9 B;  2WU2 B;  4AP4 C;  3SD5 A;  3NJT A;  3N30 A;  4LDT D;  3WAO A;  2WDV B;  1QOG A;  1KLU D;  3H7S A;  2L00 B;  1FO4 A;  2XK5 B;  1XLP A;  4WWM A;  2DZJ A;  2I1K A;  3PSE B;  2G1E A;  3P2B A;  3PRZ A;  1YD8 U;  3HM6 X;  3UIO B;  1OEY A;  3AUL A;  5C23 A;  1FD6 A;  2Z0D B;  1DOX A;  1K8R B;  2GBK A;  3WAN A;  4W9F A;  4IM0 A;  5C2T B;  3K9P B;  3Q69 A;  2BKR B;  1QOB A;  1C76 A;  4II3 B;  1J8C A;  2KYW A;  4YSZ B;  4KIK A;  2JT4 B;  2CJN A;  5C3J B;  2PTL A;  4JWU C;  2KJH B;  2BS4 B;  1VRA B;  3A4S C;  1F2R C;  3APF A;  2LVP A;  4BKG A;  1GNU A;  1SE3 A;  1T5X D;  1VCB A;  3EA6 A;  4ZYS A;  3U30 A;  4BOZ B;  1TGZ B;  5EE9 A;  2LRU A;  4X57 B;  1IPG A;  5D2M B;  3NS8 A;  4O1N A;  2NTT A;  2KTF A;  1ET6 A;  2IBI B;  4US9 A;  3DWM A;  3ZJV A;  1L6U A;  3W5U B;  5AUK A;  4S17 A;  2L32 A;  5H92 C;  1EO6 A;  2WXG A;  1KF6 B;  3LDZ E;  4WJN A;  4RGT A;  2IO2 B;  1VZ7 A;  1BUI C;  4F8C B;  2RPQ A;  1G6J A;  5G5G A;  2L05 A;  4HLE A;  4AJY B;  1ZUD 2;  1XLO A;  3CMM B;  2YVC A;  4PYZ A;  1RAX A;  3IVF A;  2NBV B;  5DPS A;  1ZW7 A;  3AE7 B;  4J6I A;  3I63 C;  1S3S G;  2PW9 A;  3T8M A;  5L83 A;  2L0F A;  3RCZ A;  1J7A A;  4ARC A;  4CHK A;  1HEZ E;  2O6V B;  5HG2 A;  4OVZ A;  1TS2 A;  3QHT A;  1D5X C;  4TMA B;  3TEY A;  1LGR A;  4EZJ A;  4BKT A;  1K52 A;  2HTH A;  4MH0 E;  3PVL A;  3V61 A;  2L8J A;  3R8B A;  4WWO A;  4HRS A;  5G5H A;  2ZCC A;  2GBM A;  2KMC A;  1BML C;  3TIX A;  2LVO A;  3VTU A;  3JW0 X;  4KKJ A;  1AW7 A;  3RT3 B;  2KN4 A;  4II2 B;  2GLS A;  1SJH D;  3P1M A;  1YIW A;  1YQ4 B;  4XYC A;  2JQR B;  4MGI E;  1D6E C;  3TL5 A;  4WQM A;  1XD3 B;  2XNA C;  2GBR A;  4PT5 A;  4TSS A;  4HPM B;  1FNU A;  2VRR B;  3ALB A;  4KIK B;  4BZA A;  1E7V A;  5D7G A;  1V81 A;  2LI5 A;  2PMV A;  1HXY D;  5J2R A;  3CWI A;  2GOW A;  2ZNV C;  3AMZ A;  3URY A;  3WAM A;  1UD7 A;  4JE3 B;  4HPP A;  3ZO5 B;  2AEH A;  1EWC A;  1OQY A;  3Q8B A;  1MJD A;  4LTU A;  3M63 B;  1P0R A;  1WGR A;  2KQ7 A;  4F1S A;  1I35 A;  2BB5 A;  2BWF A;  4YWG G;  2FIF A;  2ZNV B;  3KQ4 A;  4NAW A;  2C9W B;  4DXA B;  4PYU A;  1K51 A;  4HJK A;  2OED A;  4XX5 A;  4OVV A;  1TKY A;  2BF8 B;  2FBW B;  3L4P A;  4EZL A;  2LGX A;  3TEZ A;  3RNF C;  2KNB A;  3T9L A;  4WIP A;  1OQQ A;  4PS8 A;  3AE2 B;  3C19 A;  2WDQ B;  3VRA B;  3AU5 A;  3L08 A;  4DHZ E;  4NZL B;  5HFY A;  3ABV B;  3H7P A;  3BVZ A;  2V4L A;  4JL9 A;  3RN9 C;  4GDL A;  2WXQ A;  4OZA A;  2H89 B;  2BTE A;  3PTF C;  1T0Q C;  4GU2 A;  1E0Z A;  1XEE A;  4P1B C;  5D6J B;  4DHZ B;  3VRB B;  2JVC A;  1EM7 A;  2C7N B;  5FR6 A;  2QHO A;  2MJ3 A;  4MM3 A;  3DBH I;  2L0T A;  3M3J A;  4TUU A;  3ZNH B;  3BK1 A;  2D10 A;  4IM3 A;  2LRW A;  2ZPN A;  1MPE A;  3I57 A;  4ZRI A;  3M95 A;  3PS6 A;  2FNJ B;  2N0S B;  2JY6 A;  4P6V F;  2MRP A;  1JRU A;  2V0G A;  4C4V B;  2BBC A;  5MPO A;  3HUI A;  1E8Z A;  4KZC A;  2RDG A;  1AWD A;  1P7F A;  4W9D A;  3W1S A;  4W9J A;  4LNF A;  1AYF A;  1A5R A;  3NVV A;  2NCN A;  2UWQ A;  1WR6 E;  3WAL A;  2CKH B;  4MH8 A;  1JW9 D;  4W9L A;  4USA A;  2K3U A;  4ZRP A;  2WYQ A;  3PRP B;  4LNI A;  1KTK A;  4FHK A;  3AEA B;  4RMA A;  1SEB D;  2KQ4 X;  4LNN A;  4GSW A;  3QWZ B;  3ZVV A;  3MHS D;  1UZX B;  2KWU B;  4F7Z A;  1PYW D;  3V6E B;  3P4Q B;  4NAW B;  2KTR A;  3ECI A;  3AH7 A;  3ML8 A;  5DPW A;  1IBX B;  4HEA 1;  3DBR I;  4WAF A;  3ONS A;  3TJP A;  2MP2 A;  2L3Z A;  4M0W A;  1F2R I;  1IGD A;  4LDT B;  3W5V B;  1JRP A;  3AE9 B;  3BVG A;  1NVI D;  3H7P B;  2SAK A;  4IWP A;  3V3X A;  2MCN B;  4GDL B;  4C80 A;  1FRR A;  1TS5 A;  2KOX A;  2VH1 A;  3U7Z A;  2KDB A;  2LEK A;  1JRO A;  1PGA A;  2WHI A;  2ACZ B;  2AX5 A;  3ZNG C;  4YSX B;  3CSF A;  5H8Y E;  4MJS A;  3C0R B;  2NBW B;  4B0M A;  4MM3 B;  1CZP A;  1HZ5 A;  1TZ1 A;  4GIV A;  3MJW A;  2RDB C;  3L54 A;  4AOF A;  1JML A;  3W1Y A;  1Q5W B;  4B95 A;  2DYM A;  4B6W A;  1YX5 B;  2M8S A;  4A8X C;  2KFK A;  3W1S C;  4FXC A;  1R4M B;  3U2S C;  4KZ0 A;  2AQ1 B;  2JRI B;  4JIO U;  4KVG B;  1C4C A;  2GBJ A;  1XT9 B;  2NMQ A;  3L0W B;  1ZE3 D;  3EFC A;  4YTN B;  2KJ6 A;  1N5X A;  1KFY B;  1FRD A;  1WRD B;  2WXM A;  1Y8R C;  3AEC B;  3ETR A;  1ISN A;  2NTS A;  3PV1 A;  1OEY J;  3R7Q A;  1MG4 A;  2I1J A;  3AEE B;  5BMH A;  1S1Q B;  4FAD A;  5E6J A;  1LXD A;  1WGY A;  2WWZ A;  1IYF A;  1VZ6 A;  2IY1 B;  2XK5 A;  2C5L C;  2BB6 A;  1P3Q U;  2C60 A;  4URK A;  1SB3 C;  2WLB A;  4OVU A;  3PO0 A;  3BII D;  1WR1 A;  4DHJ D;  3ZKJ C;  2IGH A;  4DDG D;  4RNA A;  3S2A A;  2KTR B;  1WJ4 A;  1HTQ A;  2J52 A;  2HD5 B;  1JCK B;  4CYE A;  1AN8 A;  2MP2 B;  2J0M A;  2LHD A;  4M0W B;  3AE6 B;  3IT6 B;  4NJC A;  3Q8E A;  3DPD A;  3VH4 B;  4MSQ B;  1L4Z B;  1P98 A;  4HXD A;  1KOT A;  1HE8 A;  1FIQ A;  4EE2 A;  3KYC D;  1VDV A;  1WWT A;  3KYD D;  3SR6 A;  2IZV B;  4EEW A;  3AEG B;  3PZ7 A;  2VZK D;  1FM0 D;  3TCA A;  4HKZ E;  5AZF A;  3UF8 A;  1F77 A;  4YT0 B;  2DAF A;  4RM9 A;  2WX1 A;  3Q3N C;  4MJS B;  3ZUN A;  4ICU A;  3NS1 A;  1E7U A;  3L13 A;  1BT0 A;  3H9D A;  1SJE D;  2KLG A;  4W9G A;  1UBQ A;  1JQ4 A;  2J0J A;  5EDS A;  4AWJ A;  4LJP B;  4EOY A;  1DYQ A;  3QX1 A;  5BMI A;  1SE4 A;  1STE A;  2KFK B;  4HWI B;  1WIA A;  3ZGZ A;  2KO3 A;  2KKC A;  3DBH B;  4ZDV A;  3NHE B;  2D3C A;  1UWM A;  2WU5 B;  3NZ3 A;  1L6V A;  5AEK B;  3KWL A;  3DVN U;  1J7C A;  1IGC A;  2L7R A;  3AEF B;  3BYY B;  5CTR C;  1TYG B;  1QOF A;  2J0K A;  3APD A;  4BBN F;  4MGY E;  2M0A A;  5FR3 A;  3BY4 B;  2SEB D;  2M56 B;  2Y3A A;  3GE8 C;  1WM3 A;  1GPX A;  2IND C;  3B1L X;  4NNJ B;  3DQV A;  2LZ6 A;  3UGB B;  4HCN B;  3AE1 B;  4ACF A;  1J0G A;  4RFB A;  3E56 A;  1FNW A;  3QQ8 B;  1SXT A;  1TT5 B;  2JZP A;  1UGJ A;  1YJI A;  2J7Q B;  2XEW A;  1WH3 A;  1L0Y B;  3P42 A;  1XLQ A;  2B3A A;  3AE5 B;  1C4A A;  4HJG E;  2KWV B;  3DWG C;  1IP9 A;  2ZJD A;  4DWF A;  1SIJ A;  1XLN A;  3GS2 A;  2LHE A;  2FCM A;  2N9P C;  2DYO A;  1I4X A;  1MVK A;  2KDM A;  1BXT A;  2ZVN A;  2MLB A;  2V9H A;  1FXT B;  1C1Y B;  2IGD A;  1R4N B;  2V3P A;  4FJV B;  5HHD G;  3IT4 B;  2JWU A;  1WGD A;  4XWT A;  3DBR B;  2INP E;  1FCC C;  2ON8 A;  4A90 A;  4DBG A;  1V97 A;  1FXI A;  2CU1 A;  3CST A;  1YMH E;  1WE7 A;  2MJD A;  2W54 A;  2KDF B;  3CF6 E;  4ITK A;  2LXA A;  5IO9 A;  3V6C B;  2LUM A;  1C9F A;  2KC2 A;  3JVZ X;  3UIN B;  1V1P A;  2IYD B;  4JX1 C;  1DOY A;  3IAM 1;  4A55 A;  5T8I A;  3VAW A;  2XN9 C;  3FC4 A;  2FAZ A;  1R7S A;  4RH6 A;  2X8X X;  3PRM B;  3LXF A;  2PJH A;  2CJO A;  3GE3 C;  3H8H A;  2DLB A;  5EE0 A;  3ZLZ A;  3IG3 A;  1HTO A;  1X1M A;  3WIM A;  3A1Q A;  4GMV A;  2M17 A;  3GP7 A;  1R4M I;  3V60 A;  2W3S A;  1H4R A;  1MHH E;  3DHG C;  3MHZ A;  1L0X B;  5EE3 A;  2R2Q A;  2PVO D;  2WXH A;  2V4I B;  2XBB C;  3PHX B;  1RFA A;  3I5J C;  1SF0 A;  4ZRQ A;  4KV2 A;  4US8 A;  3IBE A;  3HHM A;  2DEN B;  3AN1 A;  2G4S A;  2KDE B;  3J9C A;  1JWM D;  1AAR A;  4W9C A;  5C1Z A;  1I4Q A;  4M8N A;  4C4V A;  2G45 B;  1TY2 A;  2CS4 A;  1ZDV A;  4YSY B;  2D3B A;  4IWO A;  5I4D A;  2LMC A;  2I38 A;  2GB1 A;  2JU6 X;  2Q5W D;  1DGJ A;  1UF0 A;  3EGR A;  5GMV A;  1F1H A;  2PVG C;  2MBQ A;  2RGF A;  3ZIM A;  1T3Q A;  1PUT A;  2KAN A;  2K0P A;  3HIZ A;  4RCO A;  1FEH A;  2WNM A;  2LGS A;  2E6X A;  1TBE A;  2DHZ A;  1GB1 A;  5IN7 A;  4K3B A;  5FKA C;  1QKZ A;  1KLG D;  3Q3J A;  2KVZ A;  4YTM B;  2L52 A;  3WCQ A;  2MH7 A;  2VH2 A;  3UI3 A;  3QCA A;  4A3P A;  2IDY A;  5D3I B;  2QMT A;  5CX3 A;  1QQR A;  2Y5B B;  1YJ1 A;  3PZ8 A;  3N1X C;  1IBX A;  3PT2 B;  2QC8 A;  2KWC A;  4IOI E;  3RNB C;  2D3A A;  2RDH A;  4YL8 A;  2FE8 A;  1E10 A;  4E3C A;  3P4S B;  1V1P B;  4FJZ A;  3SFE B;  3RFZ B;  1P1A A;  3AI5 A;  4N59 A;  2K22 A;  4YXD B;  3RYT A;  1NI3 A;  4BOS C;  1WFY A;  3ZDM C;  4N6E B;  1N62 A;  4L1B A;  1I42 A;  1WX9 A;  1ZPS A;  3DBL B;  4DHJ B;  1RFK A;  3ZW3 A;  2K6D B;  1VR9 A;  4ZOH C;  4GXB A;  2K25 A;  2WXO A;  3V62 A;  1B1Z A;  3BWU D;  4XZ4 A;  2WXI A;  1UWX A;  1HQR D;  1WXA A;  3A1Q B;  2MWS B;  3VDZ A;  1UBI A;  1QLB B;  3B0A A;  3OG5 A;  2KX0 A;  2JSV X;  3K9O B;  4KGR A;  4KGT A;  1TZO A;  2RMM A;  3BYT B;  2AWT A;  1D3Z A;  2JRH A;  1CMX B;  2G9H D;  4OZC A;  1PDX A;  4BKS D;  4AQ7 A;  2VZK B;  3B9J A;  4HRO A;  2KK8 A;  2EKI A;  2K1F A;  1HZ6 A;  3Q8A A;  1SE9 A;  4IUM B;  3VUX A;  4GB9 A;  1Z2M A;  1L4D B;  1TJE A;  2TSS A;  4A3O A;  2LAS A;  1WYG A;  4H2A A;  1T0Y A;  5BMG A;  2WXN A;  4DQO C;  3R2I A;  1SBB B;  2IO0 B;  3OAW A;  3HM3 A;  3R66 C;  5D94 A;  2A4Z A;  2OJW A;  4NJ7 A;  5AZG A;  2KHW B;  4XC2 A;  2V3S A;  1JWS D;  3Q3F A;  2GRI A;  2MQJ A;  1V8C A;  3VR9 B;  2R2O A;  2RPV A;  3VFK A;  2M0X A;  2MX2 A;  2QSD A;  2DBY A;  3NVY A;  2WXP A;  2N1V A;  5IKC M;  2E3T A;  2KMM A;  3ZQ4 A;  4KKI A;  1KH0 A;  1R4N I;  4L23 A;  3VHT C;  2LWP A;  1N6Z A;  1WXS A;  4LNO A;  3D32 A;  2DYB A;  3N3K B;  4IG7 B;  4C7Z A;  3KVF B;  2DZM A;  4FLH A;  3Q2A C;  3RPF C;  1M4V A;  1EUV B;  2O6V D;  2NS5 A;  2KC1 A;  2DX5 B;  1LFD A;  2AL6 A;  5BO4 B;  4P16 A;  4MEM A;  1OFF A;  3SEB A;  3QC8 B;  2BWE S;  3A9J A;  2EEL A;  4IDI A;  3Q8F A;  1EF1 A;  2Y5C A;  4KSL C;  3ZJU A;  2RR9 A;  2DZK A;  4TQ1 A;  3PGE A;  3AB5 A;  2KFJ A;  2K8B A;  1V2Y A;  2GBN A;  3OLM D;  3R3M A;  1E9M A;  1XCT L;  2LD9 A;  5KHO A;  1XF5 L;  5G2N A;  4K1R B;  2WDR B;  4WWN A;  4QAY A;  1VD2 A;  1KJT A;  3GB1 A;  3A4R A;  2WGS A;  3NY5 A;  1MHX A;  4M00 A;  2Z59 B;  3H6N A;  1TS4 A;  3NZU A;  1ZGU B;  1UUP A;  2LVQ A;  3HK0 A;  3VVW B;  4PS7 A;  3RUL A;  1V6E A;  1GUA B;  2KMA A;  3QJZ A;  1PGB A;  4MSM B;  3Q8C A;  1N5W A;  4GLS C;  2MBH A;  5LXI B;  5L95 C;  1WGK A;  4TQ0 A;  3NRZ A;  1K50 A;  2D07 B;  3GZN B;  3M62 B;  1C3T A;  1XO3 A;  4WJO A;  3T3O A;  5IOI A;  1FPY A;  4G3X B;  1QOA A;  3DDC B;  5DPR A;  1FXA A;  3NG0 A;  2OOB B;  3E9S A;  2ZZP B;  3OWE B;  3B08 A;  2CHX A;  2YEP B;  4AJW A;  2PPH A;  4CO7 A;  1CK1 A;  2Z8L A;  4FJY A;  4FBJ B;  3MP9 A;  1JWA D;  4C00 A;  5CHF A;  4PK1 A;  3AE4 B;  2WDT B;  3JYU A;  2WP9 B;  2IJ0 A;  1JWB D;  1WY8 A;  1D4B A;  4E74 A;  4ZYN A;  4B9K A;  5IA7 A;  2QCZ A;  3UQA A;  4BKS A;  4A20 A;  5JZE B;  3BK2 A;  3KUD B;  4ZHP A;  1TS3 A;  3HVZ A;  1GJZ A;  3ZJT A;  3AEB B;  5LLI A;  3EUB 2;  3RD2 A;  3A9J B;  4GDK A;  4LCD E;  3TBL D;  3ZDT A;  2R61 A;  2MBO A;  1WXV A;  3AE8 B;  4W9I A;  3R2T A;  2G3Q B;  1T0S C;  3PLU A;  1OTR B;  4EZK A;  3VQI A;  2QDF A;  2ONQ A;  4OW0 A;  1KRH A;  2PLP A;  5BYR A;  4GGQ A;  3DBL I;  2CU3 A;  2LJI A;  4EFO A; 
#chains in the Genus database with same CATH homology
 1SSN A;  1V1P A;  2GI9 A;  4YTP B;  4NZL B;  5HFY A;  1PGX A;  3ABV B;  1PFD A;  3BVZ A;  3FIL B;  4JX1 C;  1DOY A;  3IAM 1;  4A6Q A;  4A55 A;  5T8I A;  1I4G A;  1K53 A;  2XN9 C;  3FC4 A;  5AUI A;  1VJK A;  2HDE A;  2WXQ A;  1EU3 A;  4OZA A;  1R7S A;  4RH6 A;  3LXF A;  2H89 B;  4RF1 A;  3MC0 B;  2BTE A;  2CJO A;  4IKG A;  3IAS 1;  3B2G A;  4RF0 A;  1CJE A;  3H8H A;  4XDC A;  4MAC A;  2DLB A;  5EE0 A;  1E0Z A;  1XEE A;  1EU4 A;  1RWS A;  3VRB B;  1EM7 A;  2JYE A;  3MFG A;  1A70 A;  1T6B X;  2MJ3 A;  3GP7 A;  1ESF A;  2W3S A;  1D5M C;  2MJE A;  1MHH E;  1GB4 A;  3MHZ A;  3AV8 A;  1L0X B;  2X38 A;  5EE3 A;  1VZ8 A;  2PVO D;  2WXH A;  2V4I B;  3BK1 A;  1IUE A;  2I2Y A;  1VLB A;  1SF0 A;  4ZRQ A;  2KWD A;  1MPE A;  3I57 A;  4US8 A;  2KAJ A;  3C8Y A;  2N0S B;  3AN1 A;  1SE2 A;  1ZDX A;  1NYQ A;  1NYR A;  4P6V F;  3J9C A;  1JWM D;  2V0G A;  1P7E A;  2BBC A;  5MPO A;  3HUI A;  1I4Q A;  3P4R B;  2RDG A;  1TY2 A;  1ZDV A;  4YSY B;  3P63 A;  1AWD A;  5I4D A;  2LMC A;  3W9C B;  1P7F A;  2I38 A;  2GB1 A;  3W1S A;  1YQ3 B;  2JU6 X;  2Q5W D;  5TSS A;  1AYF A;  1DGJ A;  2BS2 B;  1ZP0 B;  3NVV A;  1FNV A;  3EGR A;  4A9A A;  4OZB A;  2PVG C;  4MH8 A;  1N61 A;  1JW9 D;  3TSS A;  1T3Q A;  1RM6 C;  1PUT A;  2DWQ A;  4AS1 A;  4USA A;  2K0P A;  1I7H A;  4RCO A;  2AQ2 B;  2K3U A;  1ACC A;  1FFV A;  1FEH A;  4ZRP A;  2WNM A;  4ARI A;  1FMA D;  3U4E G;  2E6X A;  1GB1 A;  1N60 A;  1I4R A;  1KTK A;  5FKA C;  1QKZ A;  1KLG D;  3AEA B;  4YTM B;  1SEB D;  1WRI A;  2KQ4 X;  2L52 A;  3WCQ A;  2MH7 A;  2W82 A;  1PYW D;  3AM9 A;  4UDU C;  3UI3 A;  3P4Q B;  2WXF A;  4NAW B;  1MI0 A;  2IDY A;  5D3I B;  2QIE B;  2QMT A;  3BZD B;  3AH7 A;  4GDK B;  4OHJ A;  1QQR A;  1IBX B;  1V1O A;  3PZ8 A;  4HEA 1;  4WAF A;  1L0V B;  1IBX A;  1FFU A;  4DXF A;  1E7P B;  2WXK A;  4IOI E;  4M0W A;  1F2R I;  3HRD D;  1IGD A;  2RDH A;  1YN4 A;  2L1A A;  3AE3 B;  2FE8 A;  1E10 A;  3P4S B;  3W5V B;  1JRP A;  3ZYY X;  2WXJ A;  3AE9 B;  1V1P B;  3SFE B;  4L2Y A;  3BVG A;  3RFZ B;  4WH4 A;  2AQ3 B;  1NVI D;  4N59 A;  4B0E A;  5LNK 1;  2K22 A;  4YXD B;  1YN5 A;  2J4X A;  4XE0 A;  2SAK A;  3V3X A;  4GDL B;  1NI3 A;  4C80 A;  1FRR A;  1TS5 A;  3U7Z A;  4XDD A;  2PIA A;  1ZXH A;  2LEK A;  4N6E B;  3NVZ A;  1N62 A;  2WQY B;  3NUH B;  2BW2 A;  1RYJ A;  1JRO A;  1PGA A;  4L1B A;  2ACZ B;  1ZPS A;  2AX5 A;  4YSX B;  1RFK A;  2J42 A;  2QIL A;  1VR9 A;  4ZOH C;  5H8Y E;  2K5P A;  2WXO A;  1FCL A;  1B1Z A;  3IXS A;  2JXT A;  5D3D A;  3BWU D;  2WXI A;  2MEK A;  4B0M A;  4MM3 B;  1UWX A;  1HQR D;  2W3R A;  1CZP A;  1HZ5 A;  1C78 A;  2W55 A;  3TEW A;  1XCQ L;  1JML A;  1QLB B;  3MJ5 A;  2JSV X;  4C56 C;  4KGR A;  2J53 A;  2N7J A;  4KGT A;  1TZO A;  2DYM A;  4RGO S;  4C7Y A;  2RMM A;  3FAH A;  1L5P A;  3BYT B;  4A8X C;  2LGI A;  3LB8 C;  5HI1 A;  4FXC A;  2G9H D;  1ENF A;  4JWS C;  1GAQ B;  4OZC A;  1F0Z A;  1PDX A;  3TEX A;  3W2D A;  3U2S C;  4AQ7 A;  3CIR B;  4R3D A;  2VZK B;  3B9J A;  4HRO A;  2AQ1 B;  1TKE A;  1E6E B;  2EKI A;  2M19 A;  4RGM A;  1TKG A;  1HZ6 A;  1J7B A;  3Q8A A;  2BYT A;  1C4C A;  2NMQ A;  4CQN A;  1YJJ A;  1ZE3 D;  4YTN B;  3B2F A;  1N5X A;  1KFY B;  4RGN A;  1FRD A;  2ZW0 A;  4DXG A;  2WXM A;  2QJL A;  3SFD B;  3KLS X;  1EWY C;  1L4D B;  1TJE A;  2TSS A;  2WU2 B;  3AEC B;  3ETR A;  1WYG A;  4H2A A;  5BMG A;  2WXN A;  2NTS A;  3VR8 B;  2WDV B;  4DQO C;  1QOG A;  3R2I A;  1SBB B;  1KLU D;  2L83 A;  5BYS A;  3AEE B;  1FO4 A;  1QT9 A;  5BMH A;  2HTM E;  2QEJ C;  5E6J A;  1XLP A;  4WWM A;  1ET9 A;  2G1E A;  1VZ6 A;  3O13 A;  2H88 B;  1JWS D;  2BB6 A;  1FD6 A;  2GRI A;  4JPS A;  3I9V 1;  1DOX A;  5JXV A;  1SB3 C;  2WLB A;  3PO0 A;  1V8C A;  2WXL A;  2WS3 B;  1ZOY B;  3VR9 B;  3BII D;  3U52 E;  2RPV A;  2IGH A;  1OQR A;  5C2T B;  3LYY A;  3Q69 A;  4RNA A;  1QOB A;  2DBY A;  2QSD A;  2WXP A;  3NVY A;  1C76 A;  2OHF A;  2LFI A;  4YSZ B;  2E3T A;  2KMM A;  3ZQ4 A;  2CJN A;  2J52 A;  4KKI A;  5C3J B;  1KH0 A;  1B9R A;  2BT6 A;  4L23 A;  1JWU D;  2PTL A;  1JCK B;  1AN8 A;  4JWU C;  2KAC A;  2LHD A;  2BS4 B;  3AE6 B;  4C7Z A;  3IT6 B;  1VRA B;  4NJC A;  3Q8E A;  1F2R C;  1WSP A;  1SE3 A;  1T5X D;  3EA6 A;  2WXR A;  4ZYS A;  1L4Z B;  3RPF C;  1YNT E;  5EE9 A;  1M4V A;  4O1N A;  1FIQ A;  2NTT A;  4EE2 A;  1QF6 A;  1ET6 A;  1VDV A;  1WWT A;  3DWM A;  4US9 A;  3SR6 A;  2INN E;  1L6U A;  3ZJV A;  1QIL A;  3W5U B;  4P16 A;  3AEG B;  3PZ7 A;  5AUK A;  2L32 A;  1OFF A;  1FM0 D;  2VZK D;  5H92 C;  4MT5 A;  3SEB A;  4HKZ E;  3HVD A;  1F77 A;  2WXG A;  1KF6 B;  4YT0 B;  4RGT A;  2EEL A;  1GOZ A;  4IDI A;  1VZ7 A;  4LLG M;  1BUI C;  3Q8F A;  2Y5C A;  1XXG A;  3NS1 A;  3ZJU A;  1YN3 A;  5G5G A;  1ZUD 2;  1SJE D;  4XWW A;  4TQ1 A;  1XLO A;  1UNS A;  1TY0 A;  4NAM A;  1JQ4 A;  2N9K A;  5EE1 A;  3AB5 A;  3FIL A;  3AE7 B;  1DYQ A;  2PW9 A;  1C4P A;  2ZW1 A;  5BMI A;  1E9M A;  1SE4 A;  1J7A A;  1STE A;  4ARC A;  1XCT L;  1HEZ E;  2N9L A;  1Y56 A;  3ZGZ A;  4WUR A;  5HG2 A;  1XF5 L;  4REZ A;  3TUO A;  1ZXI A;  2WDR B;  1CQV A;  4OVZ A;  1TS2 A;  1D5X C;  1HA5 A;  3KWV A;  1UWM A;  2WU5 B;  3NZ3 A;  4TMA B;  3TEY A;  1L6V A;  3KWL A;  3GB1 A;  3T3N A;  1K52 A;  1J7C A;  2Y5P A;  1IGC A;  3AEF B;  1I4P A;  1MHX A;  2IPK D;  1WXQ A;  1N63 A;  3BVM A;  3BYY B;  1TS4 A;  3V05 A;  3R8B A;  1TYG B;  1QOF A;  4HRS A;  5G5H A;  1UUP A;  4N58 A;  1BML C;  2M0A A;  1DOI A;  4KKJ A;  5FR3 A;  1PGB A;  2SEB D;  3Q8C A;  2M56 B;  1N5W A;  1AW7 A;  4GLS C;  2Y3A A;  1GPX A;  1WGK A;  2KN4 A;  4TQ0 A;  3NRZ A;  1K50 A;  1SJH D;  3P1M A;  2D5G A;  1YQ4 B;  3AE1 B;  1XO3 A;  1JAL A;  4RFB A;  3T3O A;  2JQR B;  3E56 A;  1C79 A;  2PKO A;  1QOA A;  1FNW A;  2JX5 A;  1D6E C;  1FXA A;  2IGG A;  4WQM A;  2XNA C;  4Q2J A;  3E9S A;  4TSS A;  4PT5 A;  1D5Z C;  1SXT A;  3OWE B;  2JZP A;  1UGJ A;  2YEP B;  4ZHO A;  1YJI A;  1FNU A;  3N9Y C;  1L0Y B;  2B76 B;  1CK1 A;  2Z8L A;  3P42 A;  3MP9 A;  4HKQ A;  1XLQ A;  3AE5 B;  1C77 A;  1C4A A;  4HJG E;  3P4P B;  4LK0 M;  4D2K A;  2ICI A;  1JWA D;  1ROE A;  5D7G A;  2PMV A;  1HXY D;  3DWG C;  3CWI A;  4KGS A;  2V3N A;  3AE4 B;  1SIJ A;  1XLN A;  3GS2 A;  3AMZ A;  3URY A;  2LHE A;  4JE3 B;  1NEN B;  2WP9 B;  2IJ0 A;  2DYO A;  1I4X A;  1JWB D;  1MVK A;  1EWC A;  3Q8B A;  2KDM A;  1BXT A;  4LTU A;  1D4B A;  2IGD A;  1I4H A;  1Q10 A;  2V3P A;  3BK2 A;  5FK9 C;  4ZHP A;  5HHD G;  1TS3 A;  3AED B;  2BB5 A;  3HVZ A;  2FUG 1;  3IT4 B;  2JWU A;  4YWG G;  3ZJT A;  3KQ4 A;  4J3O D;  4XWT A;  2INP E;  1FCC C;  3AEB B;  2JYT A;  2ON8 A;  2K9X A;  3EUB 2;  4A90 A;  1K51 A;  1V97 A;  2OED A;  1FXI A;  2R61 A;  1TKY A;  2FBW B;  2YEP F;  3AE8 B;  1YMH E;  3L4P A;  3R2T A;  4KX6 B;  2MJD A;  3TEZ A;  1LO5 D;  2W54 A;  3NVW A;  4ITK A;  5GXG B;  3VQI A;  1NEK B;  2BS3 B;  4WIP A;  2ONQ A;  4OW0 A;  1OQQ A;  1KRH A;  2PLP A;  5BYR A;  2CU3 A;  2LJI A;  3AE2 B;  2LUM A;  2WDQ B;  3VRA B;  5BYQ A;  1C9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...