2WNMA

Solution structure of gp2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
b'TGSLSVDNKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPCVAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE 2
publication title T7 Phage Protein Gp2 Inhibits the Escherichia Coli RNA Polymerase by Antagonizing Stable DNA Strand Separation Near the Transcription Start Site.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Hydrolase
total genus 11
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16857 RNA_pol_inhib RNA polymerase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.510 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wnmA00
4LK0M 2LMCA 4LLGM 2WNMA
chains in the Genus database with same CATH superfamily
2WXQA 4HCNB 2JXXA 3AMZA 1N62A 3TEXA 2JRHA 4HJKA 1Y56A 3APFA 4HVBA 4NAMA 4W9HA 2G3QB 3GOEA 5GMVA 2GI9A 3NZ3A 1FCCC 2J0MA 2N4FA 3ZW3A 1SSNA 1EWCA 2KDFB 4YT0B 3A4SC 2K6DB 2KNBA 2DZKA 4NJ7A 2KJHB 3B0AA 4IWOA 2FCNA 2WXMA 2PW9A 2WXJA 1HXYD 3KYDD 1OTRB 2OHFA 2L00B 4NJ6A 5JHBA 4JQWC 4OZCA 3PLVA 1RLFA 1YJIA 3BK1A 1WXVA 5HHDG 1E7PB 4KGRA 3KYCD 2KAJA 4OZBA 3WANA 1E7VA 1WJNA 2BPSA 2BS2B 2ICIA 1LO5D 2MP2A 2D11A 2D2QA 4KV2A 4N9F4 2N9KA 2EELA 1B1ZA 1H4RA 1TIFA 1RRBA 4KZ0A 5FK9C 1TZ1A 5HG2A 2V3SA 4US8A 2V0GA 4RGOS 2DX5B 5AZGA 2QCZA 2XK5B 3APDA 4JLCA 4IC7B 2PTLA 2IY1B 1FXTB 2ZW0A 1DYQA 2OEDA 1L0VB 3V62A 1YD8U 3AEBB 5AZFA 2BF8B 1K50A 3U8ZA 3NZUA 1ZDVA 1E8YA 1VLBA 3NUHB 1ACCA 2J7QB 2MSED 3RYTA 3BZDB 3AXCA 4FLHA 4PT5A 1A5RA 4L2YA 4AP4C 1DOXA 3NVVA 2K6QA 4DXFA 5D3DA 1WGGA 2UU7A 3ZLZA 4AWJA 3DDCB 3QQ8B 4KX6B 4MGIE 4ANUA 1GAQB 3SHQA 2RR9A 3PRPB 2Y5CA 4M0WB 3RNFC 2R2QA 1V2YA 3ETRA 4ZDVA 2KKCA 2ZCCA 2IO0B 2YEPB 4MJSB 2GBKA 1C78A 2KD0A 3W9CB 4M0WA 3R8BA 3SFDB 4RGMA 5D2MB 3TBLD 4NY0A 1ZXIA 5CHVC 1QKZA 1D6EC 1EU4A 2KMCA 2X38A 2V3PA 3LB8C 4KVGB 4NQKE 2UWQA 3KUDB 1T5XD 2ZPYA 1D5ZC 4XYCA 2KZRA 1TTNA 4JX1C 2KMAA 1L6UA 1ZE3D 2HJ1A 3GZNB 2KANA 2WDVB 4GXBA 1WI0A 4M01A 2MJ3A 3RCZA 2FE8A 4DXGA 3CIRB 2JVCA 1WZ0A 1WE6A 2IY0B 3L08A 4W9JA 2NBUA 1P7FA 4WWNA 3PVLA 3URYA 2W54A 3H7PB 4BOSC 4WQOB 2D07B 4B6WA 3AE2B 1JCKB 4WJPA 4HRSA 4WQMA 4HPPA 4MM3B 4Q2JA 3ZO5B 4AS1A 1WXSA 3ONSA 3LYYA 4K3BA 1F0ZA 2C9WB 1ZP0B 2ZPNA 4K3CA 1UWMA 3QA8A 2JX5A 3HIZA 3R66C 1YNTE 4ZYSA 5C1ZA 1I4XA 1LXDA 4GDKB 4B95A 3UQAA 4RM8A 2MQJA 3VTWA 4B9KA 5AEKB 1AWDA 1KLUD 1ROEA 4YSYB 2FIDA 2LGSA 4GDKA 1UZXB 2WXIA 4JL9A 4LNIA 3P1MA 1WIAA 2D10A 3RPFC 3RNGC 1IYFA 2DBYA 2PVGC 4ZHPA 3PZDA 1SJHD 2Y3AA 3CSFA 2L0TA 3DHGC 5G55A 1LGRA 1VZ6A 3B9JA 4BKSA 4OZAA 1NI3A 2MX2A 2FNJB 4P1BC 4E71A 3N1XC 2NS5A 1FO4A 4WH4A 1JWAD 3NVZA 5D7GA 3AM9A 3DBHI 2AL3A 1VZ7A 3OJ3A 4HROA 4ARIA 2IDYA 2JZ3B 1WZ3A 3C19A 1IP9A 1YN5A 4P7IA 4DHZE 4YXDB 5BYQA 4ACFA 3RNBC 1WJ4A 1WX8A 2IO2B 2N7JA 4DK5A 2NTTA 4ANVA 4J6IA 3FILB 1PGXA 1QOAA 4PS8A 4JWSC 3O65B 4IM3A 5AZHA 2DAFA 2K0PA 1C4AA 3SDLC 3FILA 1X1MA 4LLGM 2HE7A 2FUHB 1ZPSA 4EKUA 3ALBA 4IG7B 4W9GA 2INNE 4FADA 3KUCB 3KQ4A 3BVGA 3T3OA 3NOBA 2G4SA 5DPWA 1F77A 2D5GA 4WAFA 3V60A 5BMGA 2PIAA 3RT3B 1HTQA 1ISNA 5LXIB 3TJPA 4IOIE 5GXGB 3N3KB 2K5PA 2CU1A 2E6XA 2I1JA 2KLCA 3RNEC 3QWZB 2V9HA 4KZCA 2AWTA 3U52E 4GU2A 1U4AA 3IAS1 3QC8B 4WWOA 3OG5A 1N63A 3MC9A 3Q8AA 4IM2A 3UQBA 3DVNU 4A9AA 3CSTA 2BBCA 3KW5B 1R4MB 2JZPA 3IT4B 1C79A 2K25A 3AN1A 1EF5A 2PE9A 1QF6A 3VTUA 4HDOA 4GDLA 5EE3A 3R2IA 1P98A 2R2OA 2L05A 3VRBB 2IYDB 2KVZA 5CX3A 3Q8CA 1NVID 3PT2B 1WR6E 3SD5A 1UUPA 1HEZE 2OOBB 4R3DA 4JPSA 3HM6X 1JW9D 1K52A 2ZNVB 1I4QA 3M3JA 4BAXA 2NPTB 4MDKE 3KUZA 3VH4B 4NAWB 1BUIC 2IBIB 3PZ7A 4NQLB 4NPNA 2IPKD 3ZVVA 2KYWA 2NPTA 4KIKB 3WIMA 3SR6A 1QOGA 4G3XB 4WJQA 3L10B 1SIJA 2WXLA 2JU6X 1P0RA 3DHIC 3D32A 2BWFA 2M56B 4KIKA 2PJHA 1TKEA 3E9SA 2RPQA 5TSSA 3GE3C 3AEGB 1KH0A 3HM3A 2O6VD 1I4GA 2KWUB 1FRRA 3FC4A 4A3PA 3MHSD 3KWVA 1YIWA 3B2FA 3M62B 2KXJA 1IGCA 5JHAA 5HFYA 5IO9A 3RMKC 2ZNVC 3EA6A 5G2NA 4FJYA 4LNNA 4G0NB 1NDDA 4JE3B 2XN9C 1UNSA 1NI2A 2QILA 2N7EA 4LNFA 1UBIA 4DBGA 1WX9A 2NTSA 2QMTA 3ML9A 2AL6A 3AE5B 2ASQA 2MCNB 4BVUC 1FCLA 4W9LA 4B0MA 1R4NB 1FMAD 4NZLB 1WMHB 3APCA 3QIJA 1XLNA 3P4QB 2K22A 3DQVA 3NG0A 1F1HA 1CZPA 1Q10A 3OAWA 1WMHA 3Q2AC 2NVUI 3IBEA 2BVCA 1L6VA 1WGYA 4LDTB 3W5UB 4PS3A 1UF0A 4TUUA 4A20A 1NENB 4I6LB 2WNMA 2OJWA 2JY6A 2J0JA 1ET6A 1C3TA 1JWMD 1M94A 2Z0DB 5JXVA 1KM7A 4URKA 3VUYA 1S1QB 5DCNA 4IWPA 3QARA 3HVDA 3W5VB 4EUTA 3AEDB 1HA5A 3V6CB 4M8NA 2LWPA 2KOXA 4US9A 3IG3A 1WXAA 2HJ8A 5KHQA 2MH7A 3PRMB 4A3OA 2FIFA 3NVYA 1E5WA 4GOCA 3LXFA 4K7SA 2MRPA 3C0RB 3EGRA 1I42A 1M4VA 1E7UA 1CMXB 4HLEA 3ZJTA 4C4VB 2W9NA 1FIQA 1FPYA 5C3JB 4XDCA 3AE7B 2N0SB 4NNJB 2LGYA 3NJTA 5EE9A 4GB9A 1DOIA 2LVQA 1Z5SB 3PREA 2LZ6A 3Q8EA 4P1CC 3EHVA 2MBBB 4AJWA 2LXAA 4KSLC 2GMIC 2M4NA 4HKZE 5H8YE 5DPSA 1BXTA 1L0YB 2PE6B 4BBNF 3NS8A 2VZKD 2MBEA 2KO3A 2WU5B 4XC2A 3UIPB 4MGZE 2NBWB 2AEHA 4ZRPA 4C00A 1J7CA 1CQVA 4ICVA 2BB6A 2N9EB 3T3NA 1PUTA 2GBNA 4GGQA 2IO1B 4PYUA 2RSUA 2LI5A 2VH2A 2W82A 2INDC 3GZNI 3PGEA 4S0RA 4GLSC 5FR6A 1GJZA 2DNFA 3RI7C 2UYZB 1FRDA 3MJ5A 1FNVA 2H88B 1RWSA 2FCMA 1GB1A 4FN2A 1SE2A 5T8IA 1OEYA 4EZKA 2LHDA 2A4ZA 4EFOA 2DYBA 3L54A 2PLPA 4WURA 5C23A 5IA7A 1YQBA 2GLSA 2G1EA 4MSMB 3PRZA 1C77A 3MHZA 1UELA 1MVKA 3A1QB 2XK5A 2N9XA 3QAQA 1NEKB 2CS4A 4OVUA 4FHKA 2LRWA 3A4RA 4M00A 2PKOA 1T3QA 1JQ4A 1V5TA 2JWZA 4E3CA 2CJNA 2KQ4X 2IGHA 2RGFA 3L17A 2RPVA 1YJJA 1MJDA 1XCQL 3I57A 5EDSA 4ZRQA 2LVOA 3EFUA 1WF9A 3T8MA 1RYJA 4HJGE 3ZDTA 2V4IB 1GOZA 1I4HA 4N59A 4M8MA 1IUEA 1PFDA 3N32A 2Y5BB 3PS6A 2IZVB 4TMAB 3U7ZA 2Z59B 2DLBA 1K8RB 1V1PB 2N7DA 1L4DB 3V3XA 2G4DB 1PGAA 2SAKA 2G9HD 1SGHA 5I4DA 1MHXA 1FNWA 1V1PA 2KTFA 3T9LA 1BMLC 3JSVB 2LGIA 2D3CA 1UH6A 1EWYC 1V8CA 1WY8A 4MJSA 5HKHA 3AE1B 3RNAC 1L0XB 2GBMA 2WXKA 5BYRA 1ET9A 1N5XA 3V61A 2JUOA 3RFZB 1E10A 2L3ZA 4C56C 3ZIMA 1MG8A 4XWTA 2KWVB 4WWPA 3PZ8A 2WXNA 2KFKB 4RM9A 4USAA 5LNK1 4FJVB 2G45B 3H6NA 2IO3B 1SE3A 4LK0M 2DZIA 1NYQA 3H7PA 3BWUD 4W9FA 3DWMA 3MC0B 2KTRB 3NS1A 3Q3MC 1OQYA 4AOFA 4MM3A 2V3NA 3KWLA 1HTOA 1NBFC 3L4PA 4N6EB 3A9JB 2DHZA 3N9YC 1KTKA 5BO4B 1STEA 1WXQA 2L7RA 2HDEA 2ZW1A 3N1YC 2NMQA 2E3TA 4TV3A 3CWIA 4MELA 3VAWA 4BKSD 1SE4A 2Y5PA 2JZZA 3ZDMC 1JMLA 2MEKA 3AH7A 2RDBC 3ZRFA 3AE3B 2QJLA 3UI3A 1E90A 4I6NB 2QEJC 3RUIB 3IXSA 2W3SA 2HD5B 2A5UA 2M19A 4AJYB 1RFAA 1CK1A 2KACA 4FULA 3TMPB 2FBWB 1WYWB 3R7QA 1AARA 3SEBA 4KKIA 4J3OD 1VDVA 4IUMB 2J0KA 4D2KA 3M95A 2KN4A 4ZOHC 5DPTA 2WXOA 4HPMB 2JXTA 3Q3OC 4F8CB 3RNCC 3DBRB 1TZOA 3IT6B 2LUMA 4OVZA 4NJCA 3GP7A 1ZW7A 3VUXA 1MFWA 3PPAA 5IN7A 2K9XA 2IGGA 3NZSA 2C7MB 3FKYA 1LFDA 2C7NB 2KLGA 2M0AA 1V81A 1YOVB 4EZJA 4HDQA 3FAHA 3E56A 1XT9B 2KQ7A 2KK8A 1F9JA 4ARCA 3BYYB 1TT5B 5J18A 1G6JA 2XEWA 5IOIA 3U30A 2MW5A 1FFVA 2DAJA 3AE8B 3RULA 1CJEA 2GRIA 1YN4A 2BQQA 2YLMA 4P16A 2R61A 1DGJA 4RMAA 2KJRA 1ZKHA 4XDDA 2EKEC 4UDUC 3W2DA 3QJZA 5D6JB 2WWZA 5JH5C 1KOTA 1XLPA 4XWWA 3BVZA 2MBHA 1R4NI 2GOWA 1IBXB 2AYOB 1XXGA 4MGKE 5C2TB 1TBEA 3LDZE 2WS3B 2PEAA 1ZOYB 2H89B 3L13A 1GC6A 2WX1A 5EE0A 1J7BA 3Q3FA 2WYQA 1ESFA 3HK0A 1MHHE 1V80A 1FNUA 1Y8RC 3DHHC 3TUOA 4FXCA 1HQRD 2B76B 4W9KA 4YTNB 2WXPA 1P1AA 1WGKA 1V97A 2DWQA 4EEWA 4F7ZA 1VCBA 1H8CA 3TIXA 4L1BA 2LJIA 4DHJD 3MJWA 1EUVB 2ZZPB 4W9DA 4II2B 2C5LC 4NAWA 3GE8C 4S17A 4WJNA 1EU3A 3V05A 2ZVOA 1WSPA 2PPHA 2J53A 2LEKA 3GS2A 2L0FA 3HRDD 4CHKA 2K39A 4BOZB 1T0SC 3ZTCA 2MBQA 2FAZA 1IGDA 1XLQA 4CYEA 1C4PA 2BYEA 3P63A 1RM6C 1YX6B 3VRAB 3OLMD 3N1ZC 3JVZX 4HCPB 5FR3A 2BW2A 1TJEA 3DVGX 2O6VB 4RH6A 1I4RA 2ZEQA 4EOYA 2JF5A 2ON8A 2JYEA 3IHPC 4I6PA 3U7DA 2VH1A 2L1AA 2RD0A 2BTEA 3ZRCA 2Q5WD 3QHTA 5G5GA 3HUIA 4FA6A 1F52A 3EECA 3QK0A 2WU2B 1K53A 2IJ0A 1E8XA 1D4BA 4TKNA 1QT9A 1YQ4B 1LM8B 2DENB 3ZXVA 1OQRA 4L23A 3J9CA 2KDMA 3TEZA 2AX5A 5IAAC 4XZ4A 2QHOA 4ANWA 1VR9A 4M02A 1SIFA 3X23A 2LRUA 5IKCM 4GN1A 1Q0WB 4WWMA 2PVOD 3QCAA 5L83A 3IFWB 4IKGA 1E0ZA 3P2BA 3H1UA 2V1YA 4K1RB 4W9IA 1V1OA 5E6OA 4TQ0A 3DBLB 2N1VA 1QQRA 3VH3B 3AE9B 2BKFA 3ZUNA 2MJEA 1TS2A 1D5MC 3BK2A 4RNAA 3VR8B 4DWFA 1Q5WB 4N58A 3PSEB 3WAMA 3Q3JA 4W9EA 3MTNB 1XLOA 5TR5A 3NRZA 4OW0A 4MSQB 1GB4A 1C76A 1I7HA 2AQ1B 3DOWA 3NVWA 5KHOA 4ASWC 2MLBA 4HXDA 1D3ZA 2KFJA 2O2VB 5D3IB 1SE9A 4C4VA 3VFKA 3VVWB 3Q69A 1P9DU 3ZNID 4IDIA 4OVVA 4FBJB 3AEFB 2O2VA 1WX7A 1ZUD2 3JW0X 4JGHB 3AU4A 2HTME 2BYTA 1TS4A 5H92C 1RAXA 3ABVB 1VJKA 3ENEA 2L76A 4H2AA 2J42A 2KX3A 2HTHA 2XBBC 4ITKA 2WDQB 3IVFA 2VZKB 2MA9B 3B2GA 2RDGA 1QOBA 2W55A 5BMHA 2WDRB 4RF1A 2PMVA 2JPHA 4A90A 1LQBA 2W3RA 1UGMA 1JRUA 4AQ7A 4CO7A 2LHEA 1Q1OA 2KC2A 1WJ6A 4YTMB 3DCGA 3VR9B 1NYRA 3Q6BA 1F2RC 2MP2B 3ZJUA 4MH0E 4ZYNA 2D3BA 2DYOA 4REZA 3ZYYX 1J19A 1E9MA 3P4RB 1EO6A 1I4PA 2BYFA 3JYUA 1KRHA 1JWSD 1V9JA 3TL5A 1JROA 1KLVA 3K9PB 4C7YA 4LJPB 2BWES 2TSSA 2LGDA 2KWCA 3QX1A 4X57B 4JWUC 2I38A 3A33B 1J7AA 3IAM1 2LD9A 4KKJA 3A1QA 1E8WA 2BB5A 2CKHB 1XD3B 4LJOB 2CR5A 3AULA 1VRAB 1FXIA 4KSKC 4PYZA 2WLBA 3AV8A 1S3SG 5E6PA 2CJOA 1YX5B 4TQ1A 1E6EB 3AE6B 4BFRA 1SEBD 1RFKA 1OQQA 1T6BX 2LJ5A 3WAOA 3RD2A 3K9OB 2WXGA 1QZEA 1SB3C 3TSSA 1KFYB 4FJZA 4YTPB 4A8XC 3DPDA 2M8SA 2ZVNA 3CMMB 1WGRA 1ENFA 2OJRA 4HPLB 4LCDE 4OHJA 1EF1A 1XF5L 2QC8A 4XE0A 3VQIA 1KF6B 1YQ3B 4QAYA 1WRDB 3Q8BA 3U4EG 1WR1A 1FD6A 1YMHE 5CTRC 1P7EA 3JSVA 3PTFC 2I1KA 5IP4D 2MWSB 2KT7A 4A55A 3TEWA 3RZFA 1FXAA 4HEA1 4O1NA 1JRPA 1UBQA 1UWXA 1N6ZA 3VDZA 2L8JA 1V49A 2WP9B 2M1MA 1YN3A 1GPXA 4HKQA 3Q8FA 1JWBD 5J2RA 1WM2A 5CHWA 1WJUA 2K1FA 4GMVA 3UF8A 4G50A 4HWIB 1UD7A 1V86A 1QOFA 3DBRI 1K51A 4WJOA 1TKGA 2KFKA 4MGYE 4ZRJA 4DHZB 4WIPA 3W1SA 1GG3A 1L5PA 2KX0A 2IGDA 4EZLA 1XQQA 1GC7A 4YSXB 1WM3A 3I5JC 4AUQC 1L2NA 5HI1A 1YJ1A 4BZAA 3AECB 1HZ6A 1IPGA 4RCOA 1Z2MA 2QDFA 3W1YA 2LGXA 2K8BA 4MT5A 2KTRA 4MACA 3S2AA 2MHJA 2ONQA 2AQ2B 3AEAB 4ZRIA 1MPEA 3A9JA 1GUAB 3W1SC 4A6QA 1TS3A 3C8YA 3VHTC 3DWGC 2FCSA 1VD2A 4KGSA 3ZXRA 2L52A 2J4XA 4LNOA 1J8CA 2DZMA 3HHMA 4DQOC 2C60A 1PGBA 1R4MI 2ZCBA 4FHJA 1EM7A 2RMMA 2YEPF 3TCAA 1HZ5A 1KLGD 5AUIA 4YSZB 2DZJA 1WRIA 4C7ZA 4DDID 1WE7A 2MJDA 3KVFB 4II3B 5LLIA 2M0XA 4IW0A 4DDGD 4K7UA 1TY2A 2WX0A 2YVCA 5LXHA 2CU3A 5JZEB 2BS4B 3A9KB 3BIID 3AEEB 3B08A 4RFBA 3N20C 3Q3NC 4PS7A 3VXWA 3ML8A 1QLBB 2GBJA 1JALA 3KH0A 3A9KA 2MBOA 2WQYB 4B0EA 1WYGA 1SF0A 4LTUA 3ZTDA 2LMCA 1N5WA 2GB1A 1FM0D 3OWEB 2KDEB 2KJ6A 3DVNV 3ZNGC 4PK1A 3B1LX 3EUB2 1FFUA 3L0WB 4JIOU 1V5OA 2KC1A 1XEEA 3P42A 2X8XX 1WFYA 4GIVA 2KN5A 4HK2A 2LUEA 2JQRB 1AN8A 2WXRA 5FKAC 2BGFA 4ANXA 3AI5A 1J0GA 2K8HA 3UIOB 2NCNA 4XGAB 2KDBA 3BINA 2M17A 4BKTA 4K7WA 3H8HA 2N9LA 4RF0A 3R3MA 3ZGZA 3MP9A 2DYMA 4ZRKA 4ICUA 2C7HA 2B3AA 1R7SA 3M63B 3PO0A 4MEMA 4E74A 3VUWA 1ZXHA 3WAPA 1TGZB 2CHXA 1VZ8A 2BYVE 1ZDXA 2RDHA 3AU5A 3ECIA 1T0QC 3AE4B 1V6EA 5BMIA 3OJ4B 3BVMA 3SU8X 3V6EB 1P3QU 4IM0A 2WXFA 4GDLB 1IBXA 4KDIC 2LVPA 1JWUD 1OGWA 1MI0A 1XCTL 1TYGB 1DOYA 5J17A 2FCQA 3DVGY 2D3GA 2KWDA 3DBHB 2KDIA 3UGBB 4MH8A 3DBSA 4C80A 4RGNA 3DBLI 3NHEB 1QILA 2JRIB 3CF6E 3WALA 3EC8A 2JSVX 5AUKA 1B9RA 3H7SA 2WDTB 1PYWD 1C4CA 3WCQA 2Z8LA 2NBVB 4LNKA 4KGTA 2WHIA 4CQNA 3I3TB 1SJED 2EMTA 4DHJB 2WGSA 2NR2A 1OEYJ 2FUG1 5E6NA 1C1YB 2JWUA 4TSSA 1L7YA 3ZKJC 2CHWA 4YWGG 1FEHA 2D3AA 3RZWC 2L83A 1SXTA 1L4ZB 3BY4B 2GBRA 2EKIA 2BKRB 4YL8A 1N60A 1BT0A 1TS5A 4KDLB 3TEYA 4K81A 2KVRA 1AYFA 1GNUA 3EFCA 2JT4B 2O6VA 3BYTB 2INCC 4G11A 2KQSA 3PV1A 4BKGA 2LASA 2N1WA 2KHWB 3MFGA 4RGTA 3U2SC 3ZNZB 4F1SA 1F2RI 5D94A 4IWQA 3LJ3A 5MPOA 4XX5A 2REXA 3PLUA 2I2YA 2VRRB 1PDXA 1HE8A 3KLSX 1PQSA 3I9V1 4WAAA 2KMMA 3L16A 1WWTA 2EMSA 4ZHOA 2K3UA 3ZJVA 3AB5A 1TKYA 4LDTD 3ZNHB 3GB1A 3VTVA 2ZJDA 2ACZB 1SBBB 3Q14C 3SFEB 2BT6A 1TY0A 3H9DA 2QIEB 1D5XC 2L32A 1XO3A 4W9CA 2N9PC 5G5HA 2JYTA 1OFFA 3UINB 3PHWB 2AQ3B 4DXAB 2INPE 1AW7A 4GSWA 1UGJA 2CHZA 3ZQ4A 1T0YA 5CHFA 3PHXB 3P4PB 5DPRA 3HVZA 1WGDA 3R7RA 5BYSA 2BS3B 2Z0EB 1MG4A 3MC8A 1E8ZA 5E6JA 4EE2A 4BBNC 1I35A 1KJTA 2LFIA 3I63C 2V4LA 1WH3A 1ZGUB 5L95C 1WXMA 1WGHA 2K8CA 5EE1A 3N30A 2J52A 4P6VF 3P4SB 1T0RC 1C9FA 3WA0A 1A70A 2LXCA 3RN9C 2SEBD 3R2TA 2QSDA 2WXHA 1N61A 3X0WA 3O13A 2XNAC 3NY5A
chains in the Genus database with same CATH topology
2JXTA 5TSSA 3AEGB 2WXQA 1KH0A 1P7EA 3AMZA 1N62A 3TEXA 1I4GA 1FRRA 3FC4A 3KWVA 1Y56A 1TZOA 4A55A 3B2FA 3IT6B 3TEWA 1IGCA 2LUMA 1FXAA 4HEA1 4NAMA 5HFYA 4OVZA 4O1NA 1JRPA 4NJCA 3GP7A 1UWXA 3EA6A 2WP9B 1YN3A 2K9XA 2IGGA 2GI9A 1GPXA 3NZ3A 4HKQA 3Q8FA 1FCCC 1JWBD 4JE3B 2XN9C 1UNSA 2QILA 2M0AA 1SSNA 2NTSA 1EWCA 1QOFA 2QMTA 4YT0B 1K51A 1TKGA 4WIPA 3AE5B 1FCLA 3FAHA 3E56A 3W1SA 1L5PA 2IGDA 4B0MA 1FMAD 4YSXB 4NZLB 4ARCA 3BYYB 2WXMA 2PW9A 2WXJA 1HXYD 5HI1A 1XLNA 2OHFA 3P4QB 2K22A 1FFVA 3AE8B 4OZCA 1CJEA 3AECB 1CZPA 1YN4A 1HZ6A 2GRIA 4RCOA 1YJIA 3BK1A 5HHDG 1Q10A 1E7PB 4KGRA 4P16A 2KAJA 1DGJA 2R61A 4OZBA 2BS2B 1L6VA 2ICIA 4MT5A 4XDDA 1LO5D 4MACA 4UDUC 3W5UB 3W2DA 2N9KA 2EELA 1XLPA 4XWWA 1B1ZA 3BVZA 2ONQA 2AQ2B 1NENB 1IBXB 3AEAB 5FK9C 1MPEA 5HG2A 4US8A 2WNMA 1XXGA 5C2TB 2V0GA 4RGOS 1ET6A 2WS3B 4A6QA 1JWMD 1TS3A 3C8YA 3DWGC 1ZOYB 5JXVA 2H89B 4KGSA 2PTLA 3HVDA 3W5VB 2L52A 2J4XA 3AEDB 2ZW0A 1DYQA 1HA5A 2OEDA 5EE0A 1L0VB 4DQOC 1J7BA 3AEBB 4US9A 1PGBA 1ESFA 1K50A 1EM7A 2MH7A 2RMMA 1MHHE 2YEPF 1ZDVA 1VLBA 3NUHB 1FNUA 1ACCA 3TUOA 1HZ5A 3NVYA 1KLGD 4FXCA 5AUIA 3LXFA 4YSZB 1HQRD 2B76B 3BZDB 4YTNB 2WXPA 1WGKA 4PT5A 3EGRA 1WRIA 1V97A 2DWQA 4C7ZA 1M4VA 3ZJTA 4L2YA 4L1BA 2LJIA 1DOXA 3NVVA 4DXFA 5D3DA 2MJDA 1FIQA 4KX6B 1GAQB 5C3JB 1EU3A 1TY2A 2Y5CA 3V05A 1WSPA 4XDCA 2J53A 2LEKA 3AE7B 2N0SB 3GS2A 3HRDD 2CU3A 3ETRA 5EE9A 2BS4B 1DOIA 2YEPB 3BIID 3AEEB 1C78A 1IGDA 1XLQA 4RFBA 3Q8EA 3W9CB 4M0WA 3R8BA 3SFDB 4RGMA 1C4PA 1QLBB 1ZXIA 3P63A 1QKZA 1RM6C 3VRAB 1D6EC 1EU4A 1JALA 2X38A 2V3PA 3LB8C 2WQYB 4HKZE 5H8YE 5FR3A 1T5XD 1D5ZC 2BW2A 1TJEA 4JX1C 1WYGA 4B0EA 1BXTA 1L0YB 1SF0A 4LTUA 4RH6A 1I4RA 1L6UA 1ZE3D 2VZKD 2LMCA 1N5WA 2GB1A 1FM0D 3OWEB 2WU5B 2ON8A 2JYEA 2WDVB 3EUB2 1FFUA 4ZRPA 2MJ3A 2L1AA 1J7CA 1XEEA 2FE8A 4DXGA 2BTEA 3CIRB 3P42A 2Q5WD 5G5GA 1CQVA 3HUIA 2BB6A 2JQRB 2WU2B 3T3NA 1AN8A 1PUTA 1K53A 2WXRA 2IJ0A 5FKAC 1D4BA 1P7FA 1QT9A 1YQ4B 3URYA 2W54A 2W82A 1OQRA 4L23A 3J9CA 3H8HA 2KDMA 2N9LA 4RF0A 2AX5A 3TEZA 3AE2B 3ZGZA 1JCKB 3MP9A 2DYMA 4GLSC 1VR9A 4HRSA 4WQMA 4MM3B 1R7SA 1FRDA 3MJ5A 1FNVA 4Q2JA 2H88B 3PO0A 4AS1A 1ZXHA 1RWSA 4WWMA 3LYYA 1GB1A 1F0ZA 2PVOD 1ZP0B 1SE2A 1VZ8A 5T8IA 4IKGA 1ZDXA 2RDHA 1UWMA 2JX5A 2LHDA 1E0ZA 3AE4B 2PLPA 4WURA 1YNTE 1V1OA 4ZYSA 5BMIA 3BVMA 4TQ0A 1I4XA 4GDKB 2G1EA 2WXFA 1QQRA 3AE9B 4GDLB 1IBXA 1JWUD 1AWDA 1TS2A 2MJEA 1D5MC 1KLUD 3BK2A 1ROEA 4YSYB 4RNAA 1MI0A 1C77A 3VR8B 1XCTL 2WXIA 1TYGB 3MHZA 1MVKA 1DOYA 4N58A 3P1MA 3RPFC 2KWDA 2DBYA 1NEKB 2PVGC 4ZHPA 2PKOA 4MH8A 1T3QA 1JQ4A 1SJHD 1XLOA 2CJNA 2Y3AA 2KQ4X 2IGHA 3NRZA 4OW0A 4C80A 4RGNA 2RPVA 1YJJA 1GB4A 1XCQL 1VZ6A 1QILA 3B9JA 3I57A 4OZAA 1C76A 2AQ1B 1I7HA 1NI3A 3NVWA 4ZRQA 2JSVX 1RYJA 4HJGE 5AUKA 2V4IB 1B9RA 1GOZA 1I4HA 4N59A 1IUEA 1PYWD 1C4CA 1PFDA 2Z8LA 3WCQA 1FO4A 4WH4A 1JWAD 4TMAB 4KGTA 5D3IB 3NVZA 3U7ZA 5D7GA 4CQNA 3AM9A 2DLBA 1SJED 1VZ7A 3Q69A 4HROA 1V1PB 4ARIA 1L4DB 2IDYA 3V3XA 2FUG1 4IDIA 1PGAA 2SAKA 2G9HD 5I4DA 1YN5A 2JWUA 4TSSA 3AEFB 4YXDB 1MHXA 1FNWA 1ZUD2 5BYQA 4YWGG 1FEHA 2L83A 1V1PA 2HTME 1SXTA 2N7JA 1BMLC 1L4ZB 2NTTA 2LGIA 1EWYC 1V8CA 3FILB 2BYTA 1PGXA 2EKIA 3AE1B 1L0XB 1N60A 1QOAA 1TS4A 2WXKA 5BYRA 1TS5A 4JWSC 3TEYA 5H92C 1ET9A 1N5XA 2K0PA 3ABVB 1VJKA 1AYFA 1C4AA 4H2AA 2J42A 3FILA 3RFZB 4LLGM 1E10A 4C56C 4ITKA 4XWTA 1ZPSA 2WDQB 2INNE 3BYTB 2VZKB 3KQ4A 3BVGA 3T3OA 3PZ8A 3B2GA 2WXNA 2RDGA 4USAA 3MFGA 4RGTA 3U2SC 1F77A 1QOBA 2D5GA 2W55A 4WAFA 5LNK1 1F2RI 5BMHA 2WDRB 4RF1A 5BMGA 2PIAA 2PMVA 4A90A 5MPOA 2W3RA 2I2YA 1PDXA 4IOIE 3KLSX 5GXGB 1SE3A 3I9V1 2K5PA 2E6XA 4AQ7A 4LK0M 2KMMA 1WWTA 4ZHOA 2K3UA 2LHEA 3ZJVA 1NYQA 3AB5A 1TKYA 3BWUD 4YTMB 3VR9B 3DWMA 3U52E 1NYRA 3MC0B 1F2RC 3GB1A 3IAS1 3NS1A 3ZJUA 2ACZB 1N63A 2V3NA 3KWLA 1SBBB 3SFEB 2DYOA 4REZA 3L4PA 3ZYYX 2BT6A 1TY0A 1E9MA 3Q8AA 2QIEB 4N6EB 1D5XC 3P4RB 4A9AA 2L32A 1I4PA 2BBCA 1KRHA 1JWSD 1XO3A 2JZPA 3N9YC 1KTKA 1JROA 3IT4B 5G5HA 1STEA 1C79A 2JYTA 1OFFA 1WXQA 3AN1A 4C7YA 2AQ3B 2INPE 1AW7A 1QF6A 1UGJA 2HDEA 2ZW1A 3ZQ4A 2TSSA 2NMQA 2E3TA 4JWUC 3P4PB 5EE3A 3CWIA 3HVZA 2I38A 3R2IA 1J7AA 3IAM1 5BYSA 2BS3B 4KKJA 3VRBB 5E6JA 3Q8CA 1NVID 2BB5A 4EE2A 1UUPA 1VRAB 2LFIA 1FXIA 1HEZE 1SE4A 2Y5PA 4R3DA 2WLBA 4JPSA 1JMLA 2MEKA 3AV8A 3AH7A 1JW9D 5EE1A 1K52A 1I4QA 2CJOA 4TQ1A 1E6EB 3AE6B 3AE3B 2QJLA 3UI3A 2J52A 1SEBD 4P6VF 1RFKA 2QEJC 3IXSA 2W3SA 1BUIC 3P4SB 4NAWB 1OQQA 1T6BX 3PZ7A 2IPKD 2M19A 2WXGA 1CK1A 1SB3C 2KACA 2FBWB 3TSSA 1KFYB 3SR6A 3SEBA 1QOGA 1C9FA 4YTPB 1A70A 4A8XC 4KKIA 4J3OD 1SIJA 2WXLA 2SEBD 1VDVA 3R2TA 2JU6X 2QSDA 1ENFA 4OHJA 2WXHA 4D2KA 2M56B 1XF5L 3VQIA 1N61A 2KN4A 4XE0A 1KF6B 1YQ3B 4ZOHC 1TKEA 3E9SA 3O13A 3Q8BA 2WXOA 3U4EG 2XNAC 1YMHE 1FD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK0 M;  2LMC A;  4LLG M;  2WNM A; 
#chains in the Genus database with same CATH topology
 2WXQ A;  4HCN B;  2JXX A;  3AMZ A;  1N62 A;  3TEX A;  2JRH A;  4HJK A;  1Y56 A;  3APF A;  4HVB A;  4NAM A;  4W9H A;  2G3Q B;  3GOE A;  5GMV A;  2GI9 A;  3NZ3 A;  1FCC C;  2J0M A;  2N4F A;  3ZW3 A;  1SSN A;  1EWC A;  2KDF B;  4YT0 B;  3A4S C;  2K6D B;  2KNB A;  2DZK A;  4NJ7 A;  2KJH B;  3B0A A;  4IWO A;  2FCN A;  2WXM A;  2PW9 A;  2WXJ A;  1HXY D;  3KYD D;  1OTR B;  2OHF A;  2L00 B;  4NJ6 A;  5JHB A;  4JQW C;  4OZC A;  3PLV A;  1RLF A;  1YJI A;  3BK1 A;  1WXV A;  5HHD G;  1E7P B;  4KGR A;  3KYC D;  2KAJ A;  4OZB A;  3WAN A;  1E7V A;  1WJN A;  2BPS A;  2BS2 B;  2ICI A;  1LO5 D;  2MP2 A;  2D11 A;  2D2Q A;  4KV2 A;  4N9F 4;  2N9K A;  2EEL A;  1B1Z A;  1H4R A;  1TIF A;  1RRB A;  4KZ0 A;  5FK9 C;  1TZ1 A;  5HG2 A;  2V3S A;  4US8 A;  2V0G A;  4RGO S;  2DX5 B;  5AZG A;  2QCZ A;  2XK5 B;  3APD A;  4JLC A;  4IC7 B;  2PTL A;  2IY1 B;  1FXT B;  2ZW0 A;  1DYQ A;  2OED A;  1L0V B;  3V62 A;  1YD8 U;  3AEB B;  5AZF A;  2BF8 B;  1K50 A;  3U8Z A;  3NZU A;  1ZDV A;  1E8Y A;  1VLB A;  3NUH B;  1ACC A;  2J7Q B;  2MSE D;  3RYT A;  3BZD B;  3AXC A;  4FLH A;  4PT5 A;  1A5R A;  4L2Y A;  4AP4 C;  1DOX A;  3NVV A;  2K6Q A;  4DXF A;  5D3D A;  1WGG A;  2UU7 A;  3ZLZ A;  4AWJ A;  3DDC B;  3QQ8 B;  4KX6 B;  4MGI E;  4ANU A;  1GAQ B;  3SHQ A;  2RR9 A;  3PRP B;  2Y5C A;  4M0W B;  3RNF C;  2R2Q A;  1V2Y A;  3ETR A;  4ZDV A;  2KKC A;  2ZCC A;  2IO0 B;  2YEP B;  4MJS B;  2GBK A;  1C78 A;  2KD0 A;  3W9C B;  4M0W A;  3R8B A;  3SFD B;  4RGM A;  5D2M B;  3TBL D;  4NY0 A;  1ZXI A;  5CHV C;  1QKZ A;  1D6E C;  1EU4 A;  2KMC A;  2X38 A;  2V3P A;  3LB8 C;  4KVG B;  4NQK E;  2UWQ A;  3KUD B;  1T5X D;  2ZPY A;  1D5Z C;  4XYC A;  2KZR A;  1TTN A;  4JX1 C;  2KMA A;  1L6U A;  1ZE3 D;  2HJ1 A;  3GZN B;  2KAN A;  2WDV B;  4GXB A;  1WI0 A;  4M01 A;  2MJ3 A;  3RCZ A;  2FE8 A;  4DXG A;  3CIR B;  2JVC A;  1WZ0 A;  1WE6 A;  2IY0 B;  3L08 A;  4W9J A;  2NBU A;  1P7F A;  4WWN A;  3PVL A;  3URY A;  2W54 A;  3H7P B;  4BOS C;  4WQO B;  2D07 B;  4B6W A;  3AE2 B;  1JCK B;  4WJP A;  4HRS A;  4WQM A;  4HPP A;  4MM3 B;  4Q2J A;  3ZO5 B;  4AS1 A;  1WXS A;  3ONS A;  3LYY A;  4K3B A;  1F0Z A;  2C9W B;  1ZP0 B;  2ZPN A;  4K3C A;  1UWM A;  3QA8 A;  2JX5 A;  3HIZ A;  3R66 C;  1YNT E;  4ZYS A;  5C1Z A;  1I4X A;  1LXD A;  4GDK B;  4B95 A;  3UQA A;  4RM8 A;  2MQJ A;  3VTW A;  4B9K A;  5AEK B;  1AWD A;  1KLU D;  1ROE A;  4YSY B;  2FID A;  2LGS A;  4GDK A;  1UZX B;  2WXI A;  4JL9 A;  4LNI A;  3P1M A;  1WIA A;  2D10 A;  3RPF C;  3RNG C;  1IYF A;  2DBY A;  2PVG C;  4ZHP A;  3PZD A;  1SJH D;  2Y3A A;  3CSF A;  2L0T A;  3DHG C;  5G55 A;  1LGR A;  1VZ6 A;  3B9J A;  4BKS A;  4OZA A;  1NI3 A;  2MX2 A;  2FNJ B;  4P1B C;  4E71 A;  3N1X C;  2NS5 A;  1FO4 A;  4WH4 A;  1JWA D;  3NVZ A;  5D7G A;  3AM9 A;  3DBH I;  2AL3 A;  1VZ7 A;  3OJ3 A;  4HRO A;  4ARI A;  2IDY A;  2JZ3 B;  1WZ3 A;  3C19 A;  1IP9 A;  1YN5 A;  4P7I A;  4DHZ E;  4YXD B;  5BYQ A;  4ACF A;  3RNB C;  1WJ4 A;  1WX8 A;  2IO2 B;  2N7J A;  4DK5 A;  2NTT A;  4ANV A;  4J6I A;  3FIL B;  1PGX A;  1QOA A;  4PS8 A;  4JWS C;  3O65 B;  4IM3 A;  5AZH A;  2DAF A;  2K0P A;  1C4A A;  3SDL C;  3FIL A;  1X1M A;  4LLG M;  2HE7 A;  2FUH B;  1ZPS A;  4EKU A;  3ALB A;  4IG7 B;  4W9G A;  2INN E;  4FAD A;  3KUC B;  3KQ4 A;  3BVG A;  3T3O A;  3NOB A;  2G4S A;  5DPW A;  1F77 A;  2D5G A;  4WAF A;  3V60 A;  5BMG A;  2PIA A;  3RT3 B;  1HTQ A;  1ISN A;  5LXI B;  3TJP A;  4IOI E;  5GXG B;  3N3K B;  2K5P A;  2CU1 A;  2E6X A;  2I1J A;  2KLC A;  3RNE C;  3QWZ B;  2V9H A;  4KZC A;  2AWT A;  3U52 E;  4GU2 A;  1U4A A;  3IAS 1;  3QC8 B;  4WWO A;  3OG5 A;  1N63 A;  3MC9 A;  3Q8A A;  4IM2 A;  3UQB A;  3DVN U;  4A9A A;  3CST A;  2BBC A;  3KW5 B;  1R4M B;  2JZP A;  3IT4 B;  1C79 A;  2K25 A;  3AN1 A;  1EF5 A;  2PE9 A;  1QF6 A;  3VTU A;  4HDO A;  4GDL A;  5EE3 A;  3R2I A;  1P98 A;  2R2O A;  2L05 A;  3VRB B;  2IYD B;  2KVZ A;  5CX3 A;  3Q8C A;  1NVI D;  3PT2 B;  1WR6 E;  3SD5 A;  1UUP A;  1HEZ E;  2OOB B;  4R3D A;  4JPS A;  3HM6 X;  1JW9 D;  1K52 A;  2ZNV B;  1I4Q A;  3M3J A;  4BAX A;  2NPT B;  4MDK E;  3KUZ A;  3VH4 B;  4NAW B;  1BUI C;  2IBI B;  3PZ7 A;  4NQL B;  4NPN A;  2IPK D;  3ZVV A;  2KYW A;  2NPT A;  4KIK B;  3WIM A;  3SR6 A;  1QOG A;  4G3X B;  4WJQ A;  3L10 B;  1SIJ A;  2WXL A;  2JU6 X;  1P0R A;  3DHI C;  3D32 A;  2BWF A;  2M56 B;  4KIK A;  2PJH A;  1TKE A;  3E9S A;  2RPQ A;  5TSS A;  3GE3 C;  3AEG B;  1KH0 A;  3HM3 A;  2O6V D;  1I4G A;  2KWU B;  1FRR A;  3FC4 A;  4A3P A;  3MHS D;  3KWV A;  1YIW A;  3B2F A;  3M62 B;  2KXJ A;  1IGC A;  5JHA A;  5HFY A;  5IO9 A;  3RMK C;  2ZNV C;  3EA6 A;  5G2N A;  4FJY A;  4LNN A;  4G0N B;  1NDD A;  4JE3 B;  2XN9 C;  1UNS A;  1NI2 A;  2QIL A;  2N7E A;  4LNF A;  1UBI A;  4DBG A;  1WX9 A;  2NTS A;  2QMT A;  3ML9 A;  2AL6 A;  3AE5 B;  2ASQ A;  2MCN B;  4BVU C;  1FCL A;  4W9L A;  4B0M A;  1R4N B;  1FMA D;  4NZL B;  1WMH B;  3APC A;  3QIJ A;  1XLN A;  3P4Q B;  2K22 A;  3DQV A;  3NG0 A;  1F1H A;  1CZP A;  1Q10 A;  3OAW A;  1WMH A;  3Q2A C;  2NVU I;  3IBE A;  2BVC A;  1L6V A;  1WGY A;  4LDT B;  3W5U B;  4PS3 A;  1UF0 A;  4TUU A;  4A20 A;  1NEN B;  4I6L B;  2WNM A;  2OJW A;  2JY6 A;  2J0J A;  1ET6 A;  1C3T A;  1JWM D;  1M94 A;  2Z0D B;  5JXV A;  1KM7 A;  4URK A;  3VUY A;  1S1Q B;  5DCN A;  4IWP A;  3QAR A;  3HVD A;  3W5V B;  4EUT A;  3AED B;  1HA5 A;  3V6C B;  4M8N A;  2LWP A;  2KOX A;  4US9 A;  3IG3 A;  1WXA A;  2HJ8 A;  5KHQ A;  2MH7 A;  3PRM B;  4A3O A;  2FIF A;  3NVY A;  1E5W A;  4GOC A;  3LXF A;  4K7S A;  2MRP A;  3C0R B;  3EGR A;  1I42 A;  1M4V A;  1E7U A;  1CMX B;  4HLE A;  3ZJT A;  4C4V B;  2W9N A;  1FIQ A;  1FPY A;  5C3J B;  4XDC A;  3AE7 B;  2N0S B;  4NNJ B;  2LGY A;  3NJT A;  5EE9 A;  4GB9 A;  1DOI A;  2LVQ A;  1Z5S B;  3PRE A;  2LZ6 A;  3Q8E A;  4P1C C;  3EHV A;  2MBB B;  4AJW A;  2LXA A;  4KSL C;  2GMI C;  2M4N A;  4HKZ E;  5H8Y E;  5DPS A;  1BXT A;  1L0Y B;  2PE6 B;  4BBN F;  3NS8 A;  2VZK D;  2MBE A;  2KO3 A;  2WU5 B;  4XC2 A;  3UIP B;  4MGZ E;  2NBW B;  2AEH A;  4ZRP A;  4C00 A;  1J7C A;  1CQV A;  4ICV A;  2BB6 A;  2N9E B;  3T3N A;  1PUT A;  2GBN A;  4GGQ A;  2IO1 B;  4PYU A;  2RSU A;  2LI5 A;  2VH2 A;  2W82 A;  2IND C;  3GZN I;  3PGE A;  4S0R A;  4GLS C;  5FR6 A;  1GJZ A;  2DNF A;  3RI7 C;  2UYZ B;  1FRD A;  3MJ5 A;  1FNV A;  2H88 B;  1RWS A;  2FCM A;  1GB1 A;  4FN2 A;  1SE2 A;  5T8I A;  1OEY A;  4EZK A;  2LHD A;  2A4Z A;  4EFO A;  2DYB A;  3L54 A;  2PLP A;  4WUR A;  5C23 A;  5IA7 A;  1YQB A;  2GLS A;  2G1E A;  4MSM B;  3PRZ A;  1C77 A;  3MHZ A;  1UEL A;  1MVK A;  3A1Q B;  2XK5 A;  2N9X A;  3QAQ A;  1NEK B;  2CS4 A;  4OVU A;  4FHK A;  2LRW A;  3A4R A;  4M00 A;  2PKO A;  1T3Q A;  1JQ4 A;  1V5T A;  2JWZ A;  4E3C A;  2CJN A;  2KQ4 X;  2IGH A;  2RGF A;  3L17 A;  2RPV A;  1YJJ A;  1MJD A;  1XCQ L;  3I57 A;  5EDS A;  4ZRQ A;  2LVO A;  3EFU A;  1WF9 A;  3T8M A;  1RYJ A;  4HJG E;  3ZDT A;  2V4I B;  1GOZ A;  1I4H A;  4N59 A;  4M8M A;  1IUE A;  1PFD A;  3N32 A;  2Y5B B;  3PS6 A;  2IZV B;  4TMA B;  3U7Z A;  2Z59 B;  2DLB A;  1K8R B;  1V1P B;  2N7D A;  1L4D B;  3V3X A;  2G4D B;  1PGA A;  2SAK A;  2G9H D;  1SGH A;  5I4D A;  1MHX A;  1FNW A;  1V1P A;  2KTF A;  3T9L A;  1BML C;  3JSV B;  2LGI A;  2D3C A;  1UH6 A;  1EWY C;  1V8C A;  1WY8 A;  4MJS A;  5HKH A;  3AE1 B;  3RNA C;  1L0X B;  2GBM A;  2WXK A;  5BYR A;  1ET9 A;  1N5X A;  3V61 A;  2JUO A;  3RFZ B;  1E10 A;  2L3Z A;  4C56 C;  3ZIM A;  1MG8 A;  4XWT A;  2KWV B;  4WWP A;  3PZ8 A;  2WXN A;  2KFK B;  4RM9 A;  4USA A;  5LNK 1;  4FJV B;  2G45 B;  3H6N A;  2IO3 B;  1SE3 A;  4LK0 M;  2DZI A;  1NYQ A;  3H7P A;  3BWU D;  4W9F A;  3DWM A;  3MC0 B;  2KTR B;  3NS1 A;  3Q3M C;  1OQY A;  4AOF A;  4MM3 A;  2V3N A;  3KWL A;  1HTO A;  1NBF C;  3L4P A;  4N6E B;  3A9J B;  2DHZ A;  3N9Y C;  1KTK A;  5BO4 B;  1STE A;  1WXQ A;  2L7R A;  2HDE A;  2ZW1 A;  3N1Y C;  2NMQ A;  2E3T A;  4TV3 A;  3CWI A;  4MEL A;  3VAW A;  4BKS D;  1SE4 A;  2Y5P A;  2JZZ A;  3ZDM C;  1JML A;  2MEK A;  3AH7 A;  2RDB C;  3ZRF A;  3AE3 B;  2QJL A;  3UI3 A;  1E90 A;  4I6N B;  2QEJ C;  3RUI B;  3IXS A;  2W3S A;  2HD5 B;  2A5U A;  2M19 A;  4AJY B;  1RFA A;  1CK1 A;  2KAC A;  4FUL A;  3TMP B;  2FBW B;  1WYW B;  3R7Q A;  1AAR A;  3SEB A;  4KKI A;  4J3O D;  1VDV A;  4IUM B;  2J0K A;  4D2K A;  3M95 A;  2KN4 A;  4ZOH C;  5DPT A;  2WXO A;  4HPM B;  2JXT A;  3Q3O C;  4F8C B;  3RNC C;  3DBR B;  1TZO A;  3IT6 B;  2LUM A;  4OVZ A;  4NJC A;  3GP7 A;  1ZW7 A;  3VUX A;  1MFW A;  3PPA A;  5IN7 A;  2K9X A;  2IGG A;  3NZS A;  2C7M B;  3FKY A;  1LFD A;  2C7N B;  2KLG A;  2M0A A;  1V81 A;  1YOV B;  4EZJ A;  4HDQ A;  3FAH A;  3E56 A;  1XT9 B;  2KQ7 A;  2KK8 A;  1F9J A;  4ARC A;  3BYY B;  1TT5 B;  5J18 A;  1G6J A;  2XEW A;  5IOI A;  3U30 A;  2MW5 A;  1FFV A;  2DAJ A;  3AE8 B;  3RUL A;  1CJE A;  2GRI A;  1YN4 A;  2BQQ A;  2YLM A;  4P16 A;  2R61 A;  1DGJ A;  4RMA A;  2KJR A;  1ZKH A;  4XDD A;  2EKE C;  4UDU C;  3W2D A;  3QJZ A;  5D6J B;  2WWZ A;  5JH5 C;  1KOT A;  1XLP A;  4XWW A;  3BVZ A;  2MBH A;  1R4N I;  2GOW A;  1IBX B;  2AYO B;  1XXG A;  4MGK E;  5C2T B;  1TBE A;  3LDZ E;  2WS3 B;  2PEA A;  1ZOY B;  2H89 B;  3L13 A;  1GC6 A;  2WX1 A;  5EE0 A;  1J7B A;  3Q3F A;  2WYQ A;  1ESF A;  3HK0 A;  1MHH E;  1V80 A;  1FNU A;  1Y8R C;  3DHH C;  3TUO A;  4FXC A;  1HQR D;  2B76 B;  4W9K A;  4YTN B;  2WXP A;  1P1A A;  1WGK A;  1V97 A;  2DWQ A;  4EEW A;  4F7Z A;  1VCB A;  1H8C A;  3TIX A;  4L1B A;  2LJI A;  4DHJ D;  3MJW A;  1EUV B;  2ZZP B;  4W9D A;  4II2 B;  2C5L C;  4NAW A;  3GE8 C;  4S17 A;  4WJN A;  1EU3 A;  3V05 A;  2ZVO A;  1WSP A;  2PPH A;  2J53 A;  2LEK A;  3GS2 A;  2L0F A;  3HRD D;  4CHK A;  2K39 A;  4BOZ B;  1T0S C;  3ZTC A;  2MBQ A;  2FAZ A;  1IGD A;  1XLQ A;  4CYE A;  1C4P A;  2BYE A;  3P63 A;  1RM6 C;  1YX6 B;  3VRA B;  3OLM D;  3N1Z C;  3JVZ X;  4HCP B;  5FR3 A;  2BW2 A;  1TJE A;  3DVG X;  2O6V B;  4RH6 A;  1I4R A;  2ZEQ A;  4EOY A;  2JF5 A;  2ON8 A;  2JYE A;  3IHP C;  4I6P A;  3U7D A;  2VH1 A;  2L1A A;  2RD0 A;  2BTE A;  3ZRC A;  2Q5W D;  3QHT A;  5G5G A;  3HUI A;  4FA6 A;  1F52 A;  3EEC A;  3QK0 A;  2WU2 B;  1K53 A;  2IJ0 A;  1E8X A;  1D4B A;  4TKN A;  1QT9 A;  1YQ4 B;  1LM8 B;  2DEN B;  3ZXV A;  1OQR A;  4L23 A;  3J9C A;  2KDM A;  3TEZ A;  2AX5 A;  5IAA C;  4XZ4 A;  2QHO A;  4ANW A;  1VR9 A;  4M02 A;  1SIF A;  3X23 A;  2LRU A;  5IKC M;  4GN1 A;  1Q0W B;  4WWM A;  2PVO D;  3QCA A;  5L83 A;  3IFW B;  4IKG A;  1E0Z A;  3P2B A;  3H1U A;  2V1Y A;  4K1R B;  4W9I A;  1V1O A;  5E6O A;  4TQ0 A;  3DBL B;  2N1V A;  1QQR A;  3VH3 B;  3AE9 B;  2BKF A;  3ZUN A;  2MJE A;  1TS2 A;  1D5M C;  3BK2 A;  4RNA A;  3VR8 B;  4DWF A;  1Q5W B;  4N58 A;  3PSE B;  3WAM A;  3Q3J A;  4W9E A;  3MTN B;  1XLO A;  5TR5 A;  3NRZ A;  4OW0 A;  4MSQ B;  1GB4 A;  1C76 A;  1I7H A;  2AQ1 B;  3DOW A;  3NVW A;  5KHO A;  4ASW C;  2MLB A;  4HXD A;  1D3Z A;  2KFJ A;  2O2V B;  5D3I B;  1SE9 A;  4C4V A;  3VFK A;  3VVW B;  3Q69 A;  1P9D U;  3ZNI D;  4IDI A;  4OVV A;  4FBJ B;  3AEF B;  2O2V A;  1WX7 A;  1ZUD 2;  3JW0 X;  4JGH B;  3AU4 A;  2HTM E;  2BYT A;  1TS4 A;  5H92 C;  1RAX A;  3ABV B;  1VJK A;  3ENE A;  2L76 A;  4H2A A;  2J42 A;  2KX3 A;  2HTH A;  2XBB C;  4ITK A;  2WDQ B;  3IVF A;  2VZK B;  2MA9 B;  3B2G A;  2RDG A;  1QOB A;  2W55 A;  5BMH A;  2WDR B;  4RF1 A;  2PMV A;  2JPH A;  4A90 A;  1LQB A;  2W3R A;  1UGM A;  1JRU A;  4AQ7 A;  4CO7 A;  2LHE A;  1Q1O A;  2KC2 A;  1WJ6 A;  4YTM B;  3DCG A;  3VR9 B;  1NYR A;  3Q6B A;  1F2R C;  2MP2 B;  3ZJU A;  4MH0 E;  4ZYN A;  2D3B A;  2DYO A;  4REZ A;  3ZYY X;  1J19 A;  1E9M A;  3P4R B;  1EO6 A;  1I4P A;  2BYF A;  3JYU A;  1KRH A;  1JWS D;  1V9J A;  3TL5 A;  1JRO A;  1KLV A;  3K9P B;  4C7Y A;  4LJP B;  2BWE S;  2TSS A;  2LGD A;  2KWC A;  3QX1 A;  4X57 B;  4JWU C;  2I38 A;  3A33 B;  1J7A A;  3IAM 1;  2LD9 A;  4KKJ A;  3A1Q A;  1E8W A;  2BB5 A;  2CKH B;  1XD3 B;  4LJO B;  2CR5 A;  3AUL A;  1VRA B;  1FXI A;  4KSK C;  4PYZ A;  2WLB A;  3AV8 A;  1S3S G;  5E6P A;  2CJO A;  1YX5 B;  4TQ1 A;  1E6E B;  3AE6 B;  4BFR A;  1SEB D;  1RFK A;  1OQQ A;  1T6B X;  2LJ5 A;  3WAO A;  3RD2 A;  3K9O B;  2WXG A;  1QZE A;  1SB3 C;  3TSS A;  1KFY B;  4FJZ A;  4YTP B;  4A8X C;  3DPD A;  2M8S A;  2ZVN A;  3CMM B;  1WGR A;  1ENF A;  2OJR A;  4HPL B;  4LCD E;  4OHJ A;  1EF1 A;  1XF5 L;  2QC8 A;  4XE0 A;  3VQI A;  1KF6 B;  1YQ3 B;  4QAY A;  1WRD B;  3Q8B A;  3U4E G;  1WR1 A;  1FD6 A;  1YMH E;  5CTR C;  1P7E A;  3JSV A;  3PTF C;  2I1K A;  5IP4 D;  2MWS B;  2KT7 A;  4A55 A;  3TEW A;  3RZF A;  1FXA A;  4HEA 1;  4O1N A;  1JRP A;  1UBQ A;  1UWX A;  1N6Z A;  3VDZ A;  2L8J A;  1V49 A;  2WP9 B;  2M1M A;  1YN3 A;  1GPX A;  4HKQ A;  3Q8F A;  1JWB D;  5J2R A;  1WM2 A;  5CHW A;  1WJU A;  2K1F A;  4GMV A;  3UF8 A;  4G50 A;  4HWI B;  1UD7 A;  1V86 A;  1QOF A;  3DBR I;  1K51 A;  4WJO A;  1TKG A;  2KFK A;  4MGY E;  4ZRJ A;  4DHZ B;  4WIP A;  3W1S A;  1GG3 A;  1L5P A;  2KX0 A;  2IGD A;  4EZL A;  1XQQ A;  1GC7 A;  4YSX B;  1WM3 A;  3I5J C;  4AUQ C;  1L2N A;  5HI1 A;  1YJ1 A;  4BZA A;  3AEC B;  1HZ6 A;  1IPG A;  4RCO A;  1Z2M A;  2QDF A;  3W1Y A;  2LGX A;  2K8B A;  4MT5 A;  2KTR A;  4MAC A;  3S2A A;  2MHJ A;  2ONQ A;  2AQ2 B;  3AEA B;  4ZRI A;  1MPE A;  3A9J A;  1GUA B;  3W1S C;  4A6Q A;  1TS3 A;  3C8Y A;  3VHT C;  3DWG C;  2FCS A;  1VD2 A;  4KGS A;  3ZXR A;  2L52 A;  2J4X A;  4LNO A;  1J8C A;  2DZM A;  3HHM A;  4DQO C;  2C60 A;  1PGB A;  1R4M I;  2ZCB A;  4FHJ A;  1EM7 A;  2RMM A;  2YEP F;  3TCA A;  1HZ5 A;  1KLG D;  5AUI A;  4YSZ B;  2DZJ A;  1WRI A;  4C7Z A;  4DDI D;  1WE7 A;  2MJD A;  3KVF B;  4II3 B;  5LLI A;  2M0X A;  4IW0 A;  4DDG D;  4K7U A;  1TY2 A;  2WX0 A;  2YVC A;  5LXH A;  2CU3 A;  5JZE B;  2BS4 B;  3A9K B;  3BII D;  3AEE B;  3B08 A;  4RFB A;  3N20 C;  3Q3N C;  4PS7 A;  3VXW A;  3ML8 A;  1QLB B;  2GBJ A;  1JAL A;  3KH0 A;  3A9K A;  2MBO A;  2WQY B;  4B0E A;  1WYG A;  1SF0 A;  4LTU A;  3ZTD A;  2LMC A;  1N5W A;  2GB1 A;  1FM0 D;  3OWE B;  2KDE B;  2KJ6 A;  3DVN V;  3ZNG C;  4PK1 A;  3B1L X;  3EUB 2;  1FFU A;  3L0W B;  4JIO U;  1V5O A;  2KC1 A;  1XEE A;  3P42 A;  2X8X X;  1WFY A;  4GIV A;  2KN5 A;  4HK2 A;  2LUE A;  2JQR B;  1AN8 A;  2WXR A;  5FKA C;  2BGF A;  4ANX A;  3AI5 A;  1J0G A;  2K8H A;  3UIO B;  2NCN A;  4XGA B;  2KDB A;  3BIN A;  2M17 A;  4BKT A;  4K7W A;  3H8H A;  2N9L A;  4RF0 A;  3R3M A;  3ZGZ A;  3MP9 A;  2DYM A;  4ZRK A;  4ICU A;  2C7H A;  2B3A A;  1R7S A;  3M63 B;  3PO0 A;  4MEM A;  4E74 A;  3VUW A;  1ZXH A;  3WAP A;  1TGZ B;  2CHX A;  1VZ8 A;  2BYV E;  1ZDX A;  2RDH A;  3AU5 A;  3ECI A;  1T0Q C;  3AE4 B;  1V6E A;  5BMI A;  3OJ4 B;  3BVM A;  3SU8 X;  3V6E B;  1P3Q U;  4IM0 A;  2WXF A;  4GDL B;  1IBX A;  4KDI C;  2LVP A;  1JWU D;  1OGW A;  1MI0 A;  1XCT L;  1TYG B;  1DOY A;  5J17 A;  2FCQ A;  3DVG Y;  2D3G A;  2KWD A;  3DBH B;  2KDI A;  3UGB B;  4MH8 A;  3DBS A;  4C80 A;  4RGN A;  3DBL I;  3NHE B;  1QIL A;  2JRI B;  3CF6 E;  3WAL A;  3EC8 A;  2JSV X;  5AUK A;  1B9R A;  3H7S A;  2WDT B;  1PYW D;  1C4C A;  3WCQ A;  2Z8L A;  2NBV B;  4LNK A;  4KGT A;  2WHI A;  4CQN A;  3I3T B;  1SJE D;  2EMT A;  4DHJ B;  2WGS A;  2NR2 A;  1OEY J;  2FUG 1;  5E6N A;  1C1Y B;  2JWU A;  4TSS A;  1L7Y A;  3ZKJ C;  2CHW A;  4YWG G;  1FEH A;  2D3A A;  3RZW C;  2L83 A;  1SXT A;  1L4Z B;  3BY4 B;  2GBR A;  2EKI A;  2BKR B;  4YL8 A;  1N60 A;  1BT0 A;  1TS5 A;  4KDL B;  3TEY A;  4K81 A;  2KVR A;  1AYF A;  1GNU A;  3EFC A;  2JT4 B;  2O6V A;  3BYT B;  2INC C;  4G11 A;  2KQS A;  3PV1 A;  4BKG A;  2LAS A;  2N1W A;  2KHW B;  3MFG A;  4RGT A;  3U2S C;  3ZNZ B;  4F1S A;  1F2R I;  5D94 A;  4IWQ A;  3LJ3 A;  5MPO A;  4XX5 A;  2REX A;  3PLU A;  2I2Y A;  2VRR B;  1PDX A;  1HE8 A;  3KLS X;  1PQS A;  3I9V 1;  4WAA A;  2KMM A;  3L16 A;  1WWT A;  2EMS A;  4ZHO A;  2K3U A;  3ZJV A;  3AB5 A;  1TKY A;  4LDT D;  3ZNH B;  3GB1 A;  3VTV A;  2ZJD A;  2ACZ B;  1SBB B;  3Q14 C;  3SFE B;  2BT6 A;  1TY0 A;  3H9D A;  2QIE B;  1D5X C;  2L32 A;  1XO3 A;  4W9C A;  2N9P C;  5G5H A;  2JYT A;  1OFF A;  3UIN B;  3PHW B;  2AQ3 B;  4DXA B;  2INP E;  1AW7 A;  4GSW A;  1UGJ A;  2CHZ A;  3ZQ4 A;  1T0Y A;  5CHF A;  3PHX B;  3P4P B;  5DPR A;  3HVZ A;  1WGD A;  3R7R A;  5BYS A;  2BS3 B;  2Z0E B;  1MG4 A;  3MC8 A;  1E8Z A;  5E6J A;  4EE2 A;  4BBN C;  1I35 A;  1KJT A;  2LFI A;  3I63 C;  2V4L A;  1WH3 A;  1ZGU B;  5L95 C;  1WXM A;  1WGH A;  2K8C A;  5EE1 A;  3N30 A;  2J52 A;  4P6V F;  3P4S B;  1T0R C;  1C9F A;  3WA0 A;  1A70 A;  2LXC A;  3RN9 C;  2SEB D;  3R2T A;  2QSD A;  2WXH A;  1N61 A;  3X0W A;  3O13 A;  2XNA C;  3NY5 A; 
#chains in the Genus database with same CATH homology
 2JXT A;  5TSS A;  3AEG B;  2WXQ A;  1KH0 A;  1P7E A;  3AMZ A;  1N62 A;  3TEX A;  1I4G A;  1FRR A;  3FC4 A;  3KWV A;  1Y56 A;  1TZO A;  4A55 A;  3B2F A;  3IT6 B;  3TEW A;  1IGC A;  2LUM A;  1FXA A;  4HEA 1;  4NAM A;  5HFY A;  4OVZ A;  4O1N A;  1JRP A;  4NJC A;  3GP7 A;  1UWX A;  3EA6 A;  2WP9 B;  1YN3 A;  2K9X A;  2IGG A;  2GI9 A;  1GPX A;  3NZ3 A;  4HKQ A;  3Q8F A;  1FCC C;  1JWB D;  4JE3 B;  2XN9 C;  1UNS A;  2QIL A;  2M0A A;  1SSN A;  2NTS A;  1EWC A;  1QOF A;  2QMT A;  4YT0 B;  1K51 A;  1TKG A;  4WIP A;  3AE5 B;  1FCL A;  3FAH A;  3E56 A;  3W1S A;  1L5P A;  2IGD A;  4B0M A;  1FMA D;  4YSX B;  4NZL B;  4ARC A;  3BYY B;  2WXM A;  2PW9 A;  2WXJ A;  1HXY D;  5HI1 A;  1XLN A;  2OHF A;  3P4Q B;  2K22 A;  1FFV A;  3AE8 B;  4OZC A;  1CJE A;  3AEC B;  1CZP A;  1YN4 A;  1HZ6 A;  2GRI A;  4RCO A;  1YJI A;  3BK1 A;  5HHD G;  1Q10 A;  1E7P B;  4KGR A;  4P16 A;  2KAJ A;  1DGJ A;  2R61 A;  4OZB A;  2BS2 B;  1L6V A;  2ICI A;  4MT5 A;  4XDD A;  1LO5 D;  4MAC A;  4UDU C;  3W5U B;  3W2D A;  2N9K A;  2EEL A;  1XLP A;  4XWW A;  1B1Z A;  3BVZ A;  2ONQ A;  2AQ2 B;  1NEN B;  1IBX B;  3AEA B;  5FK9 C;  1MPE A;  5HG2 A;  4US8 A;  2WNM A;  1XXG A;  5C2T B;  2V0G A;  4RGO S;  1ET6 A;  2WS3 B;  4A6Q A;  1JWM D;  1TS3 A;  3C8Y A;  3DWG C;  1ZOY B;  5JXV A;  2H89 B;  4KGS A;  2PTL A;  3HVD A;  3W5V B;  2L52 A;  2J4X A;  3AED B;  2ZW0 A;  1DYQ A;  1HA5 A;  2OED A;  5EE0 A;  1L0V B;  4DQO C;  1J7B A;  3AEB B;  4US9 A;  1PGB A;  1ESF A;  1K50 A;  1EM7 A;  2MH7 A;  2RMM A;  1MHH E;  2YEP F;  1ZDV A;  1VLB A;  3NUH B;  1FNU A;  1ACC A;  3TUO A;  1HZ5 A;  3NVY A;  1KLG D;  4FXC A;  5AUI A;  3LXF A;  4YSZ B;  1HQR D;  2B76 B;  3BZD B;  4YTN B;  2WXP A;  1WGK A;  4PT5 A;  3EGR A;  1WRI A;  1V97 A;  2DWQ A;  4C7Z A;  1M4V A;  3ZJT A;  4L2Y A;  4L1B A;  2LJI A;  1DOX A;  3NVV A;  4DXF A;  5D3D A;  2MJD A;  1FIQ A;  4KX6 B;  1GAQ B;  5C3J B;  1EU3 A;  1TY2 A;  2Y5C A;  3V05 A;  1WSP A;  4XDC A;  2J53 A;  2LEK A;  3AE7 B;  2N0S B;  3GS2 A;  3HRD D;  2CU3 A;  3ETR A;  5EE9 A;  2BS4 B;  1DOI A;  2YEP B;  3BII D;  3AEE B;  1C78 A;  1IGD A;  1XLQ A;  4RFB A;  3Q8E A;  3W9C B;  4M0W A;  3R8B A;  3SFD B;  4RGM A;  1C4P A;  1QLB B;  1ZXI A;  3P63 A;  1QKZ A;  1RM6 C;  3VRA B;  1D6E C;  1EU4 A;  1JAL A;  2X38 A;  2V3P A;  3LB8 C;  2WQY B;  4HKZ E;  5H8Y E;  5FR3 A;  1T5X D;  1D5Z C;  2BW2 A;  1TJE A;  4JX1 C;  1WYG A;  4B0E A;  1BXT A;  1L0Y B;  1SF0 A;  4LTU A;  4RH6 A;  1I4R A;  1L6U A;  1ZE3 D;  2VZK D;  2LMC A;  1N5W A;  2GB1 A;  1FM0 D;  3OWE B;  2WU5 B;  2ON8 A;  2JYE A;  2WDV B;  3EUB 2;  1FFU A;  4ZRP A;  2MJ3 A;  2L1A A;  1J7C A;  1XEE A;  2FE8 A;  4DXG A;  2BTE A;  3CIR B;  3P42 A;  2Q5W D;  5G5G A;  1CQV A;  3HUI A;  2BB6 A;  2JQR B;  2WU2 B;  3T3N A;  1AN8 A;  1PUT A;  1K53 A;  2WXR A;  2IJ0 A;  5FKA C;  1D4B A;  1P7F A;  1QT9 A;  1YQ4 B;  3URY A;  2W54 A;  2W82 A;  1OQR A;  4L23 A;  3J9C A;  3H8H A;  2KDM A;  2N9L A;  4RF0 A;  2AX5 A;  3TEZ A;  3AE2 B;  3ZGZ A;  1JCK B;  3MP9 A;  2DYM A;  4GLS C;  1VR9 A;  4HRS A;  4WQM A;  4MM3 B;  1R7S A;  1FRD A;  3MJ5 A;  1FNV A;  4Q2J A;  2H88 B;  3PO0 A;  4AS1 A;  1ZXH A;  1RWS A;  4WWM A;  3LYY A;  1GB1 A;  1F0Z A;  2PVO D;  1ZP0 B;  1SE2 A;  1VZ8 A;  5T8I A;  4IKG A;  1ZDX A;  2RDH A;  1UWM A;  2JX5 A;  2LHD A;  1E0Z A;  3AE4 B;  2PLP A;  4WUR A;  1YNT E;  1V1O A;  4ZYS A;  5BMI A;  3BVM A;  4TQ0 A;  1I4X A;  4GDK B;  2G1E A;  2WXF A;  1QQR A;  3AE9 B;  4GDL B;  1IBX A;  1JWU D;  1AWD A;  1TS2 A;  2MJE A;  1D5M C;  1KLU D;  3BK2 A;  1ROE A;  4YSY B;  4RNA A;  1MI0 A;  1C77 A;  3VR8 B;  1XCT L;  2WXI A;  1TYG B;  3MHZ A;  1MVK A;  1DOY A;  4N58 A;  3P1M A;  3RPF C;  2KWD A;  2DBY A;  1NEK B;  2PVG C;  4ZHP A;  2PKO A;  4MH8 A;  1T3Q A;  1JQ4 A;  1SJH D;  1XLO A;  2CJN A;  2Y3A A;  2KQ4 X;  2IGH A;  3NRZ A;  4OW0 A;  4C80 A;  4RGN A;  2RPV A;  1YJJ A;  1GB4 A;  1XCQ L;  1VZ6 A;  1QIL A;  3B9J A;  3I57 A;  4OZA A;  1C76 A;  2AQ1 B;  1I7H A;  1NI3 A;  3NVW A;  4ZRQ A;  2JSV X;  1RYJ A;  4HJG E;  5AUK A;  2V4I B;  1B9R A;  1GOZ A;  1I4H A;  4N59 A;  1IUE A;  1PYW D;  1C4C A;  1PFD A;  2Z8L A;  3WCQ A;  1FO4 A;  4WH4 A;  1JWA D;  4TMA B;  4KGT A;  5D3I B;  3NVZ A;  3U7Z A;  5D7G A;  4CQN A;  3AM9 A;  2DLB A;  1SJE D;  1VZ7 A;  3Q69 A;  4HRO A;  1V1P B;  4ARI A;  1L4D B;  2IDY A;  3V3X A;  2FUG 1;  4IDI A;  1PGA A;  2SAK A;  2G9H D;  5I4D A;  1YN5 A;  2JWU A;  4TSS A;  3AEF B;  4YXD B;  1MHX A;  1FNW A;  1ZUD 2;  5BYQ A;  4YWG G;  1FEH A;  2L83 A;  1V1P A;  2HTM E;  1SXT A;  2N7J A;  1BML C;  1L4Z B;  2NTT A;  2LGI A;  1EWY C;  1V8C A;  3FIL B;  2BYT A;  1PGX A;  2EKI A;  3AE1 B;  1L0X B;  1N60 A;  1QOA A;  1TS4 A;  2WXK A;  5BYR A;  1TS5 A;  4JWS C;  3TEY A;  5H92 C;  1ET9 A;  1N5X A;  2K0P A;  3ABV B;  1VJK A;  1AYF A;  1C4A A;  4H2A A;  2J42 A;  3FIL A;  3RFZ B;  4LLG M;  1E10 A;  4C56 C;  4ITK A;  4XWT A;  1ZPS A;  2WDQ B;  2INN E;  3BYT B;  2VZK B;  3KQ4 A;  3BVG A;  3T3O A;  3PZ8 A;  3B2G A;  2WXN A;  2RDG A;  4USA A;  3MFG A;  4RGT A;  3U2S C;  1F77 A;  1QOB A;  2D5G A;  2W55 A;  4WAF A;  5LNK 1;  1F2R I;  5BMH A;  2WDR B;  4RF1 A;  5BMG A;  2PIA A;  2PMV A;  4A90 A;  5MPO A;  2W3R A;  2I2Y A;  1PDX A;  4IOI E;  3KLS X;  5GXG B;  1SE3 A;  3I9V 1;  2K5P A;  2E6X A;  4AQ7 A;  4LK0 M;  2KMM A;  1WWT A;  4ZHO A;  2K3U A;  2LHE A;  3ZJV A;  1NYQ A;  3AB5 A;  1TKY A;  3BWU D;  4YTM B;  3VR9 B;  3DWM A;  3U52 E;  1NYR A;  3MC0 B;  1F2R C;  3GB1 A;  3IAS 1;  3NS1 A;  3ZJU A;  2ACZ B;  1N63 A;  2V3N A;  3KWL A;  1SBB B;  3SFE B;  2DYO A;  4REZ A;  3L4P A;  3ZYY X;  2BT6 A;  1TY0 A;  1E9M A;  3Q8A A;  2QIE B;  4N6E B;  1D5X C;  3P4R B;  4A9A A;  2L32 A;  1I4P A;  2BBC A;  1KRH A;  1JWS D;  1XO3 A;  2JZP A;  3N9Y C;  1KTK A;  1JRO A;  3IT4 B;  5G5H A;  1STE A;  1C79 A;  2JYT A;  1OFF A;  1WXQ A;  3AN1 A;  4C7Y A;  2AQ3 B;  2INP E;  1AW7 A;  1QF6 A;  1UGJ A;  2HDE A;  2ZW1 A;  3ZQ4 A;  2TSS A;  2NMQ A;  2E3T A;  4JWU C;  3P4P B;  5EE3 A;  3CWI A;  3HVZ A;  2I38 A;  3R2I A;  1J7A A;  3IAM 1;  5BYS A;  2BS3 B;  4KKJ A;  3VRB B;  5E6J A;  3Q8C A;  1NVI D;  2BB5 A;  4EE2 A;  1UUP A;  1VRA B;  2LFI A;  1FXI A;  1HEZ E;  1SE4 A;  2Y5P A;  4R3D A;  2WLB A;  4JPS A;  1JML A;  2MEK A;  3AV8 A;  3AH7 A;  1JW9 D;  5EE1 A;  1K52 A;  1I4Q A;  2CJO A;  4TQ1 A;  1E6E B;  3AE6 B;  3AE3 B;  2QJL A;  3UI3 A;  2J52 A;  1SEB D;  4P6V F;  1RFK A;  2QEJ C;  3IXS A;  2W3S A;  1BUI C;  3P4S B;  4NAW B;  1OQQ A;  1T6B X;  3PZ7 A;  2IPK D;  2M19 A;  2WXG A;  1CK1 A;  1SB3 C;  2KAC A;  2FBW B;  3TSS A;  1KFY B;  3SR6 A;  3SEB A;  1QOG A;  1C9F A;  4YTP B;  1A70 A;  4A8X C;  4KKI A;  4J3O D;  1SIJ A;  2WXL A;  2SEB D;  1VDV A;  3R2T A;  2JU6 X;  2QSD A;  1ENF A;  4OHJ A;  2WXH A;  4D2K A;  2M56 B;  1XF5 L;  3VQI A;  1N61 A;  2KN4 A;  4XE0 A;  1KF6 B;  1YQ3 B;  4ZOH C;  1TKE A;  3E9S A;  3O13 A;  3Q8B A;  2WXO A;  3U4E G;  2XNA C;  1YMH E;  1FD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...