2WNUA

Complex between c1q globular heads and heparan sulfate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
133
structure length
133
Chain Sequence
QPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
molecule tags Immune system
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
total genus 25
structure length 133
sequence length 133
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnuA00
4EN0A 2AZ5A 2QE3A 1DU3D 4QPYA 2O0OA 2WNVB 2HEYF 4GIQA 1IQAA 3TYJA 5L19A 1D2QA 1TNRA 3V56A 3ME2A 2Z5WA 1U5ZA 2WNVC 2R6QA 2JG8B 5CIRA 4KG8A 3FC0A 4G3YC 4F3JA 1RJ8A 1XU1A 2JG8C 2JG9B 2ZPXA 2WNUB 2RJKA 5TSWA 4G4FA 2JG8A 1ALYA 2RJLA 1U5XA 5KC6A 3L9JT 1JH5A 5BNQA 2JG9C 3WD5A 4DB5A 1PK6A 1RJ7A 2E7AA 3URFA 4N90A 2WNVA 2R30A 4OULA 4QQ2A 1PK6C 1GR3A 4KGQA 1U5YA 5KWRA 4DOUA 5L36A 2HEWF 1I9RA 4OUMA 3QD6A 2ZJCA 4QQOA 3AB0A 1TNFA 5HBAA 3TWIA 4MSVA 2Q8OA 3IT8A 4HT1T 3MI8A 2TNFA 4E4SA 5KC5A 2R32A 1JTZX 3B94A 2KA3A 2JG9A 1D4VB 4TWTA 4MXWA 2TUNA 4KGGA 1KXGA 4E4DX 1WCKA 1DG6A 3K48A 1C3HA 4J6GA 2WNUC 2OIIA 1O91A 1XU2A 4D7YA 2QDNA 1OQEA 4MXWB 1OSGA 1D0GA 1OQDA 2WNUA 4NN0A 3K51A 4RSUA 4QQLA 3ALQA 1C28A 3QBQA 4OUSA 2HEVF 2X29A 3B9IA 1A8MA 1PK6B 4QQHA 1S55A 1KD7A 3LKJA 4TSVA 4MXVA 2RE9A 3B93A 2Q1MA 4QQPA
chains in the Genus database with same CATH superfamily
1AL23 4L0PA 3U78A 4EN0A 3O1MA 3O0VA 1SLAA 4CEYA 2HLEA 5LA1A 4JKMA 3RGBA 1H9WA 3PIGA 3T0DA 5FZ7A 1UMZA 1S0EA 3LSEA 3AYCA 4GJZA 4FPOB 4QPIA 3LAGA 4XEZA 5BPXA 3VBHB 1IQAA 3WQ1A 1FMD1 4MHUA 1KEXA 3TEZA 3UKTA 2RS12 3FBMA 3G7DA 3KT7A 3OG2A 4X8PA 1GICA 1AR73 2WN2A 3V56A 2PFWA 3W59A 1IS6A 3M1HA 4Q29A 2R6QA 4AVAA 2NMNA 3ZO0B 3VBRC 4EJRA 2WO2A 5T5JA 3W5NA 4QXBA 1QJY3 4CXXA 1M4WA 4PDWB 3PUIA 3MLKA 2QJVA 1CZVA 3EHKA 2RMU2 3MUZ1 4XE9A 3VBRB 4AZZA 3ZVXA 3T1MA 1C57A 2EALA 3H8RA 3I3EA 3ZXJA 2RJKA 1TMF1 2ZAHA 5FV3A 2WDBA 5FXVA 1IKQA 3SCHA 2JE8A 4L8QA 4CDQB 2CAVA 3H8XA 4XPVA 3WQ7A 1JUHA 4FQ4A 2BERA 1QQP1 2ZHLA 4RN5A 2Q8EA 4TZDA 4WV8A 1ZRRA 2W1UA 3ATGA 5EFUA 1RHI3 1U5IA 4LA2A 4BQ3A 4CCMA 1G9DA 4OUEA 1AF9A 2JIGA 2XQRA 4WZCA 4N90A 1HB4A 1NY71 1XXNA 2X8KA 2Y8KA 1J84A 2BU9A 1I3HA 1GOGA 2D44A 3OGRA 4KGQA 5A7QA 2MNGA 5C3QA 5C9AA 2YC2A 1LOBA 1UPSA 2Q1ZB 5IHRA 1OVSA 5FQ0B 4XIKA 2ZZQA 2WLQA 4DRRA 4QKBA 4QPGC 2R071 5HCHA 4CE8A 4CDUC 1VBE1 3WF2A 3KHCA 5FR3A 2IWGB 2GMMA 5ANNA 5M0TA 1HIXA 1S0BA 4EWAA 4Q0QA 4NRMA 4A7ZA 4IEXA 3DN7A 5D8AC 4BMEA 4DXTA 2VZPA 3O0WA 1SPPA 2ZEWA 3ACHA 2VW1A 2DCJA 2VQUA 4MXWA 3EXUA 4YM1A 3CF6E 4YZ5A 1GNYA 1OLQA 2UWCA 2HWC2 5EWSA 2WZPP 1YJLA 4NMIA 4DUWA 4BZ4A 4IXLA 3NO8A 3OEBA 2RDSA 3GCXA 5FY8A 3LEGA 2W87A 3R4UA 3PL0A 2JKBA 2WZ8A 2YDEA 4FQZA 1Z7S3 3ZKYA 1CPMA 3USSA 4W8JA 1FOD3 4BQWA 1RUD3 5FMOS 1X33A 1H30A 4C0BA 4QQLA 1MS0A 2W1QA 4CEWC 1X82A 4GQ7A 2ZGMA 1QJY2 3ZYJB 3IDEA 3M3IA 3ZFEA 3WP3A 3WUDA 2ZABA 5K7PA 1GP4A 4XQWA 4LBLA 1JUIA 3OSDA 1SLIA 4B4PA 2VZSA 2YFUA 3GGLA 2B46X 2WINB 1V9U3 1V6LA 4LOTA 5SV8A 3AZXA 1AYN3 3K3OA 5J98B 4QB6A 3S30A 5JMOA 3V0AB 3PUHA 2DYCA 4QB1A 2Q1FA 2KM2A 3FLRA 4QQPA 3KT4A 1JZ3A 4KQ7A 2WO3A 1SBDA 2P5BA 5FLIA 4UWDA 1B35B 1N3OA 4CDWA 4NWWA 3NSTA 2HEYF 2W5FA 4GB31 5CFDC 3UT0A 1ND3A 3RFRA 2VM9A 1HW5A 5FPZA 1LESA 3B3QE 3MV11 3IAQA 4XDQA 1VPHA 3BALA 4FFHA 4LBNA 1V6JA 4QDQA 5K0UB 3WZ1A 5C5TA 3RYPA 5EPAA 3AM2A 3D6EA 5LB6A 1WW4A 3HQRA 4X6RB 4P9WA 2JE9A 2Z4FA 2YV8A 1QWRA 1PZ9A 1RUC1 2C9AA 3BOWA 3PTYA 4KG8A 1B09A 2HKXA 2W47A 3LQCA 4Q5OA 1OI6A 1T2XA 4TLFA 4CDQC 4ZXKA 1AR72 2XJUA 2Y6HA 1AXYA 3AMPA 4FPJA 4NE9A 1UOBA 2YBPA 1GU3A 3GBWA 2D5HA 3KLSA 4LEJA 5HCFA 5JI9A 1EUUA 1HRV3 3GBFA 3DV8A 4FPLA 2PYTA 1SDDB 1W9YA 4K20A 4C91A 5FYIA 1FPN2 1CZSA 5DG1A 4FI9A 5CFDA 5BNOB 3WNNA 1YC61 2JG9C 2R042 2DUQA 2VQ0A 4AQTA 4DB5A 5FZ9A 5A7SA 1E5RA 1V70A 1RJ7A 2ZGKA 1W6QB 4A6SA 2SBAA 1YI9A 4ISQA 2WNVA 4OHZA 1GMMA 1GFF2 1W6PB 3APBA 4M3CA 2FDHA 2GDFA 1QKQA 4IQPA 2Y38A 4GKXA 2XJQA 2HWD2 3FE5A 3ZFEC 2ENRA 1R083 3DCQA 5GZEA 1UX7A 1S0GA 4KBBA 4PJYA 4YFWA 4ZU7A 5GLUA 1SACA 1COV3 2YBKA 4HANA 1OPMA 1JI6A 4HOOA 3QD6A 3MICA 4QGMA 5FY5A 5A80A 1RUJ2 4CDXC 4RHV3 5F5QA 5HBAA 1CAUB 2IXCA 4YWAA 5F7UA 1SCSA 5A3TA 2W1SA 4YGEA 4YVSB 1QH7A 4L99A 4Q4X1 5FLJA 1PGW2 4B1MA 1SLLA 4LULA 1RUG3 2VGDA 4AK3A 3OJBA 4FXKB 2JG9A 1Q5OA 1POV1 4HSLA 2FHRA 5JOYA 4HVOA 2Y0IA 4N53C 4RL7A 4Q8LA 5AVAA 3U14A 3WCRA 2ZHMA 3AZWA 3AMHA 4LBJA 4Y1UA 2Y6JA 3N3HA 4B7EA 5DN2A 2ETEA 3ZIXA 2ZAAA 5F1RA 2IC1A 2C5DA 2BBAA 4YZ1A 1Q56A 1UZYA 2K46A 1PMIA 3WF0A 3HEIA 1XSQA 2JDNA 4YG6A 1RC6A 5CKNA 2A6XA 5L7OC 5DUUA 3E6CC 5A1LA 2YC4A 2ZEZA 1S0IA 4QPGB 4P9IA 3U75A 3BN6A 2C4XA 1LULA 2LRPA 3NNMA 5A33B 1BVVA 2HWB2 2PHDA 3LA2A 4NAMA 3CKHA 2PAKA 4DUXA 3I3QA 4KI5M 1RGSA 3HOBA 1Q8SA 5A7WA 1ZRFA 1APNA 3ZN6A 1SBFA 4YW2A 5KXCA 3WNKA 3JQWA 3VN4A 1YIFA 1ASJ3 1UZWA 1AYM2 1DU3D 4ZS3A 2Q0AA 3AKSA 2C6SA 5FWEA 5IVEA 2AZ5A 4RGKA 1CVNA 3E5UA 3O14A 2WWUA 1LEMA 2JDYA 4YGDA 3KVBA 2E51A 2XR4A 5FWJA 3MFAA 4NIIA 2QQIA 1T6BX 1DLLA 1H4GA 4CEWA 2J7MA 3H9AA 1ULEA 4RFRB 3GXUA 4BOWA 1YQ8A 5L19A 1YEWA 1EYBA 2EIBA 5C3SA 3WV6A 4IEQA 5FZOA 3ZMOA 1CAWA 1D4M3 5FP8A 1UNBA 1VAMA 3D4KA 2PTMA 3NJVA 1CAXA 5E16A 2W08A 5DAWA 1X9PA 3MPPG 5FPLA 2R072 3N7LA 1LKNA 3DXUA 4G3YC 4JVAA 2QQKA 1LRHA 1ONAA 4P9YA 4PIYA 2V5YA 4XBQA 4CEWB 3FN9A 1MR5A 4LBQA 1RJ8A 1DZQA 1XU1A 1ZNPA 2ZXQA 5ACA2 4UBGA 5ABJB 4M0NA 1VB2A 4A3ZA 3BODA 3NV4A 4BQ4A 4LT5A 2VC9A 4YW4A 3T2TA 3EYPA 1JBCA 2CWMA 2RJLA 1ENSA 5EZWA 4AHYA 4KU7A 2WT1A 4NHLA 4Q4W1 5F5IA 4CEYC 2P1BA 3ZFGC 3J8F2 4AI1A 2P3JA 4D7TA 3N9NA 2FBEA 1DQ0A 2XHKA 3AZZA 2BPA2 2XL9A 3UYJA 5C33A 1BK1A 4AL9A 2OPWA 5T3NA 4QPGA 3VD9A 4UF0A 4B8EA 2Q30A 3OF1A 1VLNA 5BNPB 3U4XA 1EPZA 4YZ2A 3LSDA 1LB2A 4XILA 4COUA 3NV3A 5F6LB 3HBKA 5F39A 1Y3TA 2FDGA 1YQ6A 1ZRIA 1E5SA 4JQTA 1RIRA 2GNMA 1IHMA 1VBB2 1BK0A 3OYWA 4HT1T 3IAPA 1CJPA 1UPIA 5FJKA 3IIIA 4AI9A 3UJOA 5BNOC 2TNFA 2ZS6B 2QCSB 3MIEA 5GLTA 2DCTA 5BUVA 3KQ4B 2XVGA 3UKNA 2A3WA 3O5SA 4YM3A 3SKJE 3FJSA 4QX8A 3A22A 3N9LA 3RDIA 2IUWA 3OPZA 2AYHA 4A42A 3K77A 1JYIA 3POSA 2CTVA 1DGRN 5CU1A 1Q8VA 1R1A3 4RYDA 1CAUA 3MPBA 3H7JA 4KWKA 3VHNA 2DVBA 2VXJA 1RUI1 5FMOL 3R4SA 2D6LX 3RI8A 2ARCA 4CCNA 4QAWA 4XMIA 4ES8A 3TEWA 1TZOA 3J7MA 1ZREA 3HAGA 5IATA 3JXSA 1OFNA 5LEJA 4XTPA 3ZMNA 3ES1A 3ORJA 2PHLA 4MZUA 4YARA 2QZ2A 2VZ1A 2J1UA 3ILNA 3POBA 3ST7A 1JZ5A 4LE4A 2ZOEB 3PUSA 3A0NA 4KL1A 2W39A 3LEKA 3I59B 5A6ZA 4I3PA 2DV9A 2VNRA 2DF7A 2VTXA 3ZXGA 5I93A 2B45X 2GH8A 5FZ4A 1Y9MA 4TN7A 1DFQA 1H1MA 3VBFC 1JYNA 4MXVA 5DDJ1 5DUVA 2Q1MA 1I6XA 5JXIA 4IE6A 1HJFA 1RMU2 1H6YA 5L7OA 4QXKA 4YSFA 1WMFA 4IUGA 4MV2A 5FO9B 1BMV1 2P6CA 4AQ6A 1X7NA 1BQPA 3K4DA 3LFMA 2VY0A 5KR7A 4D94A 2KXLA 4LE3A 5F37A 1FV2A 1YHFA 1WD3A 4PIZA 3WW4A 2ZMKA 4WBBA 4URAA 2WFF1 2WS91 2YROA 4RS5A 4CP2A 5CG9A 3N9OA 2C26A 2VNGA 2B4KA 5DQ0A 3NNLA 3VBOA 1UN1A 4PT6A 1UU4A 1KJRA 1GV9A 5K0UC 3M3EA 1F35A 1UWWA 1GQGA 3OYWB 4FPEA 3BOPA 4EZHA 2P3KA 3U4SA 2RMU1 4NRQA 3OD4A 4DMIA 4JGZB 1UO9A 1UY2A 1A6CA 2JDMA 4C8DA 1XE7A 1JOJA 4ZZ8A 1A34A 1HX6A 4N9HA 3INAA 2O8OA 4FOVA 5GZGA 3U37A 3VDDA 1PNGA 5C7GA 1R64A 2IZWA 2CGPA 1W28A 2V72A 1RUH1 2MEV1 3H7YA 4OMCA 3AP4A 2GP3A 3LB9A 1CIYA 2VVEA 1GQPA 1SLCA 3P3NA 1P8JA 1UMHA 3D82A 4XETA 3B5LB 1GR3A 3WG4A 3WNPA 3AKTA 3R4DB 2VZVA 3JB4C 3SISA 1H2KA 2Q8CA 3V0BA 3RZJA 3DYMA 4FP3A 4XJZA 5L9RA 5CBLA 3I59A 3ZXLA 3WHUA 2VMFA 2BNNA 3DYPA 4Z82A 5A3OA 5G04L 1OKQA 1UF2C 1J3RA 1I5PA 2ZJCA 4KU8A 3FHIB 3ZXDA 5JXGA 1QNYA 2Y64A 3KF5A 1DBNA 3WINE 3WEZA 1VBE2 2W9XA 2CGNA 5APAA 1MZFA 3I2OA 2R32A 3PVEA 1JTZX 2A6WA 3ABZA 5F6KA 4AVTA 4GZ9A 5C5UA 1RXGA 2XVKA 1S1AA 3ZFFB 3UL2A 1DQ1A 3LGRA 4FFGA 5J96B 1KXGA 4DIQA 1CJDA 4PBOA 1W9WA 2R043 3AFKA 4A2UA 2C1FA 1K5JA 1W8HA 5EV7A 2JECA 4LKFA 5FMCA 1BLZA 3HN3A 2FZ1A 5CA6A 2YPDA 3DGTA 4Q0SA 1DDLA 1SCRA 4C1XA 1BBT3 2VOKA 2HYXA 5IAVA 2MEV3 3O1OA 1PMHX 3VBSC 1R1A2 3CNAA 3ACGA 4Q4W3 1REDA 3HVDA 3AYAA 4C1WA 2A3YA 4MGIE 4R4ZA 1R082 3K51A 5C4WA 2LUWA 1UOFA 3AXDA 3B00A 3BPZA 2YU1A 3MHZA 5J37A 3SEEA 2Q4SA 4HL0A 1AR93 4NHYA 2XBO2 1NA1B 1IG3A 4L2NA 1SZBA 4PLMA 2A6YA 5GLZA 1RUF3 4XIOA 3RZMA 2H0BA 2HWC1 1IZ3A 4XAEA 1V6KA 4CCEA 1TME1 3J7NA 3UGHA 5JZGA 3UNPA 3AB0A 1NA1C 2NLRA 1R093 3AKPA 4AEJA 1S4CA 1WBLA 3N36A 1NKGA 5A7NA 5IAXA 1PO21 5CISA 4BQ2A 1DHKB 1MQTC 2DUOA 1W9SA 5A32A 4LHKA 3TNPB 1XB9A 4I0WB 5FPVA 5LA9A 5HV4A 5T5PA 1GANA 1XRUA 1ZBE2 4H7LA 5J36A 4MO3M 2AR6A 3ZPOA 4Z92B 4QM9A 5LBFA 2D6MA 1PMJX 4FFFA 4N43C 3RZZA 4RQPC 3I49A 4IV1C 1XNKA 2VTFA 5DZGA 3M4FA 2ZX3A 1AR82 1PGL2 2I07B 2QQLA 3USUB 3ZXFA 4DFSA 4QX3A 3O1RA 3WR0A 4IE5A 3VHPA 1DQ2A 1JMUB 3T4HB 1M06G 5EJ3A 3B01A 1F4AA 1ZZ6A 5ANQA 5FYMA 1FOD1 4AEDA 3DXTA 4CPBA 2XKPA 3KV4A 4XJ9A 1BXHA 2CAUA 2VOTA 4JGYA 2P6HA 4YGBA 3H42B 4Q4V3 2A6ZA 2E32A 2A70A 4XW3A 1OUXA 5FZGA 5JPNB 1MQTB 1COV2 1PNFA 3L2YA 2IVJA 3RZKA 5FY7A 2K0GA 2D7FA 2E7AA 2JDHA 4B1LA 1C1LA 2PHFA 1O3QA 2W94A 1ULOA 3J26N 4AVCA 4N43A 1R1ZA 3GALA 1F15A 3VGIA 5EJ1B 2WZEA 4XC9A 2ARAA 4XURA 4AFCA 3MZHA 1FNZA 2XLFA 4WZFA 2GMEA 4D8MA 4Q4W2 4CU9A 2QQVA 4QGNA 4DXRA 1K45A 1NQDA 4JKKA 1ASJ2 2B7YA 3VKOA 1BZWA 1FPN1 3IN9A 5HI0A 2LW8A 1NA1A 2J1TA 3Q8CA 1CN1A 1SFPA 4R9AA 4AEDB 4CCOA 1YXWA 2Q8OA 4NIDA 3F2ZA 3SITA 1UU6A 3LOIA 5E89A 5KC5A 2RS11 3OUHA 4L97A 1XOYA 2ZGOA 3B94A 5FYUA 5F9TA 1N1TA 3F95A 5CB7A 1PGW1 2BQPA 2WO7A 1F8VA 1WMDA 1RHI2 2D40A 3GZTB 5J48A 2WT0A 3AKQA 4M4PA 1RVF3 2RV9A 3IM0A 4YNIA 5GLWA 4XJAA 3BU0A 4Y5TA 2CNAA 2WQZC 5H9RA 1AR91 4NAOA 4NOTA 4OQ9A 4M00A 1N1VA 1C8M3 1HB3A 2QQNA 4QMAA 5FDBA 4XF9A 2NP0A 3VKNA 3JBG2 1XNTA 4LBOA 1Q43A 4FVVA 2NMOA 4MGQA 1POV0 4ZPIA 1RUH3 2VMEA 4ASLA 1DGWA 5JZGB 1W8FA 1FAYA 1SFNA 2DUPA 2ZX1A 4MGYE 1V00A 5L7OB 3V65A 1N1YA 4AGVA 3WXPA 3CLPA 1VBB3 2VR4A 1OA3A 3HPNA 1CAVA 2OZJA 2QQJA 4YM0A 2OA2A 5JWPA 1JYCA 3WNMA 1OFSA 2UURA 4IEVA 1ZRDA 4H3WA 4TSVA 1LTEA 3VZMA 3WF1A 3VB9A 5LCWL 3ZDVA 3ZYHA 2QQUA 3UETA 4UW5A 3VBUB 5DAVA 4QX2A 2O0OA 1RUH2 5FKCA 3MIGA 3I54A 1WLDA 2NQYA 5IVCA 5LY2A 4OMDA 4XXPA 1XNCA 1C8M2 1RUG1 2WYFA 4XFHA 3M70A 2CU5A 1D2QA 4UAPA 1H8TC 3VKLA 1LU2A 2JEMA 1KQRA 5I0TA 2WQ8A 3WW1A 1J1TA 4CRQA 4DEVA 2LALA 1YYNA 2J1AA 2F4LA 1OOPA 2WO1A 4JGYB 1ZZCA 2Q5TA 5EQUA 3WCSA 2EIGA 1IKPA 4GAZA 4AI2A 1Z78A 5JXJA 5AC93 1VBA1 3KGZA 1WBFA 4ZZ5A 3VHRA 3WDXA 3ZSEA 1MPXA 4QKFA 5IVYA 3LDKA 3H3LA 1OHFA 2EICA 4XFGA 3GJBA 3LDBA 4D6SA 2JDUA 4Q27A 4LUMA 2VU9A 2YMZA 1OF4A 3L2HA 1AXKA 2VZTA 3BVCA 5FKBA 5FYBA 3PUQA 2DU0A 4JAAA 2OKXA 4ET7A 5A3PA 5KC6A 4PHZA 4LKDA 2J22A 2WSUA 2HWD3 3ILRA 1N3PA 3URFA 3BKZA 4CXYA 4XABA 2EVXA 4E9KA 3KF3A 2ZEYA 2VULA 2E7TA 3HNYM 4XDPA 1VAKA 1ZBA2 2CGOA 1YLLA 4I2OA 1NUKA 3LE0A 3V64A 1W90A 3NV2A 3WQ0A 3NAPB 2B5HA 2UU8A 2VBPA 2UYBA 2WR9A 4LIVA 4ASKA 5IK8A 3H3ZA 5K9YA 2O1QA 1JN2P 5JR2A 3VBFA 1EPWA 1D4M1 2ILMA 4GB32 4MSVA 4A3XA 4RGGA 3PHMA 2JJ6A 3J8F1 2Z2SB 1RVF1 3PTRB 2GAUA 3Q8FA 4XYXA 3BTZA 4ITCA 3W9AA 1WUVA 4ARXA 3THTA 2RS33 4FCAA 5LA2A 2Z69A 1Q8QA 4YGCA 4N43B 3SKVA 4QM8A 1F2NA 2XJVA 5KXEA 1LAJA 1UZVA 3SXWA 2WZR2 4BA6A 1DG6A 4FPHA 3I2JA 1KDMA 1VBC1 3KCYA 4PQ9A 1DQ4A 1UW8A 3CZJA 4RR3C 4P08A 1TQ5A 1DF0A 2JENA 3KB5A 5JDBA 4P9JA 4BE3A 2DVGA 3N9QA 1CD3G 1C4RA 1NLRA 1QJU2 4QKNA 1HRI3 4XACA 3ELNA 3CO2A 3K3NA 1OOPC 3PMSA 3WG3A 3T0BA 2JDKA 3PIJA 4QT6A 4D0QA 3AYDA 1GQHA 2X29A 4LR4A 5J1XA 1KDKA 4I0BA 3KS7A 2E7QA 1PK6B 1X9TA 5EXOA 4E8CA 3C7FA 3OGSA 2X5IC 4FTEA 5IWFA 2V5DA 4NROA 2MHFA 2RHPA 2RE9A 3LOBA 4AFBA 1A3KA 3T2PA 2QVSB 3GZAA 1SHWB 3CMGA 3MO4A 4AVVA 4HK8A 1RUD2 4AYUA 5A6XA 2ZX2A 4FTBA 3MUY1 2EXJA 3K46A 4YG3A 4AQ2A 5L9VA 3GNEA 1IPSA 5FK8A 1K5MC 4K8FA 3BTYA 4OI4A 4XJ8A 4ZONA 3VDCA 4AEDC 4MGTA 3JU9A 3FHAA 2ID4A 3PUAA 2DCZA 3P1IA 4ZY9A 1MZ5A 5JOXA 3FHQA 4XF3A 3RNSA 2ZGPA 5JXHA 1VBD3 4YZ4A 2VCBA 5FO8B 1WMXA 1HXS1 3ZFGA 3DEMA 2AEZA 3PLQA 1NE4A 4QDRA 3TNQA 4FPCA 3VZJA 4Z1VA 5KXDA 1LHUA 1UY4A 1HRI2 4IETA 5JUVA 3T2OA 1AYN1 5BV6A 2ZPXA 3K75B 4CP1A 2Q8DA 3BB6A 1V6MA 4HXCA 1RUJ1 1DQ6A 2AREA 2BJSA 4G4FA 4DY5A 3IWZA 3E6DA 2DCKA 1Q3EA 3B69A 4HG6B 2BRTA 4MOAA 4PQQA 4W6WA 1RUE1 1LHNA 5SV5A 2GNTA 1NZCA 3A23A 2UY9A 5C8CA 4AI8A 4M01A 3PDQA 5I91A 4Z2AA 2VOXA 3MBWA 4LO6B 2EXIA 3ON7A 3VKMA 3POWA 2G4IA 5FRAA 3BCWA 4OLLA 4YFZA 5C8CC 5FOBB 1O59A 1NZIA 2B8MA 2QUOA 1RUC3 2JWPA 4AFAA 4M3CB 5L36A 2FD8A 4X8NA 1W9TA 2E9QA 1XYOA 3CJXA 3HNBM 1S0DA 4YRDA 5C4WC 3D8CA 1ZYBA 4TLGA 4CVUA 2ZGTA 5FZ3A 4OUMA 5A7WB 5H9PA 5CAZA 1QJFA 2G9ZA 4HKWA 4AI0A 4NRPA 4N53B 3W5MA 5C3RA 4HSJA 2ARBA 4XBLA 4DXSA 4I09A 4E4SA 3IKWA 4MLOA 4GALA 2YU2A 2VUAA 4MH0E 1PO11 3NNGA 2I74A 1OLME 4HPKB 1KGYA 4TWTA 4LBQB 4GWMA 4Z2WA 1GP5A 3KV5A 1AR83 4LBQD 2D3RA 4BXSV 1IS5A 4UBHA 3IPVA 3OY8B 3M3QA 1W05A 2BGCA 1OH3A 4EN7B 1G86A 2R16A 4AF9A 4XCBA 1K5MA 2RG4A 3QCWA 4UW3A 2YFZA 3LDRA 3C3VA 4DRVA 1YCIA 2QDNA 3I7DA 3U0ZA 3HIFA 1OQEA 2OW4A 4I0AA 1R081 1TG7A 1QEXA 3POJA 2WNUA 4MGZE 5DXDA 4QHZA 1IPJA 5FBZA 3T1LA 5F2WA 4HVQA 4R9BA 3WDUA 1WMEA 4LHNA 2ZHKA 3ACIA 3AZYA 4U2AA 5EHDA 3T30A 3WP4A 3ZX7A 2PLV1 3WSOA 4A45A 4Q4X2 3SCGA 4E2SA 3OOXA 4E4HA 4META 2J1RA 3ILFA 1DP0A 5EP9A 5IFTA 1CR7A 1HN1A 4BQYA 1JOPA 5LA0A 4UFKA 3ZYFA 1MQTA 1XE8A 3MYXA 3N9PA 5FK7A 1OA2A 4OHXA 5CKQA 4YVWC 2VVDA 1GP6A 3I8TA 1PVC2 1N1SA 4IEPA 2P3YA 4OFGA 1J59A 4FAGA 3SH3A 4BCUA 1VMHA 1VBD1 4ARYA 3EO6A 2PHRA 2B42B 4RR3A 1QDCA 3E6BA 4J25A 4Q4Y2 1CZTA 4QX1A 2PHTA 3M3OA 4OZOA 1QXRA 1U5ZA 4GD4A 2XQXA 3DKQA 1Q8OA 4B4RA 1HV1A 1L7LA 2BVBA 3JB8A 3ZYPA 4LIUA 3I2FA 3FC0A 1SLBA 2H6BA 1JHJA 4JZRA 1GUIA 3UGFA 3N4MA 1SEFA 1L7RA 3ETQA 4RS5C 1FOD2 3CJIA 4OI1A 1WLWA 2TEPA 1PZ8A 4LO7A 1IS3A 2R0HA 4EROA 4PCRA 2VTXJ 2VZUA 5AVPA 2UWBA 2WNUB 3E1F1 1BCXA 5TSWA 1J1LA 1IG0A 1COV1 1E57A 1OD3A 2VCCA 1HB1A 2XMLA 3RZGA 1CAWB 2VMHA 4YW1A 4O9EA 1UKGA 3IPVB 3OY8A 3SLIA 3H0OA 4UYBA 1LEDA 2E63A 4B3NA 4D6QA 5GALA 1UYPA 1ZBE3 2RS32 4OULA 3BI3A 1UZ0A 2VCAA 3HT2A 1W6QA 2RVAA 3G6JB 1QHDA 3V0BB 4XUNA 3OEAA 2R0FA 1U5YA 3KGLA 4CUCA 2E53A 5KWRA 1AHSA 3MW4A 1ZA7A 4DOUA 5CNAA 3FLTA 1QJU3 4M3CE 2WYSA 1DQ5A 4GWJA 3Q8AA 3UGGA 1MS1A 4BPZA 2RS52 4EE2A 5DDJ2 3TAYA 3NJZA 4YYOA 1YQCA 5LRSA 4V1PA 3OUIA 4RA0A 3O0XA 4C0HA 5JSOA 3TWIA 2BFUS 4EWEA 4OHWA 1YI7A 1F31A 2G19A 4IV1B 2FMDA 1MZEA 1LGCA 2WNEA 1QJZA 4URTA 1VRH3 3R0RA 1U0AA 1UMIA 2D6OX 3M7AA 4IW3A 1WLTA 4J1WA 4OI0A 2W0XA 1WCKA 3SH5A 1H8TA 1VBD2 2VCMA 3AYEA 2YBSA 2ES3A 4CP9A 2LTNA 1QXJA 4FPYA 2X05A 3USUA 4XZPA 1NYWA 2JD9A 2H0VA 1RUJ3 2CYFA 4Q4Y1 2VNVA 4UW6A 3FBYA 5K0UA 1PHMA 1X50A 3POGA 4MXWB 5FPBA 2CY6A 2XOMA 3MGUA 1ZA4A 3WDTA 1QOTA 2HWE2 2A5ZA 2PXJA 4K40A 1Y4WA 5FUPA 3VD7A 1S0JA 2XUMA 3P5BA 3NMBA 3EQEA 1XYPA 4QHOA 4YZ3A 5A7PA 2XVLA 3E5QA 3NL1A 3NV1A 1SG3A 1GNZA 4HN1A 2FMYA 2EAAA 2EXKA 4LNVA 4Y3OA 1KD7A 2VZOA 3O7OA 1O5UA 3AFGA 4W4ZA 3Q8BA 4GULA 4QKDA 3WX5A 1J3QA 3THPA 4Q4X3 4IEYA 3WG2A 5I8TA 1FPN3 2P4EA 1EV12 4KWJA 4INDA 4COVA 2ZA9A 1RUC2 2VL4A 1QOOA 3CZUA 2YPJA 4W65A 1POV3 2WNVB 3UKVA 2EIEA 1VRH1 2C24A 2WAAA 2IXHA 1ACCA 4Y4YA 2VZ3A 2ZMNA 1G8WA 1G9FA 1HKDA 4HK9A 3POIA 3MV01 4AEMA 3AVRA 4FBFA 1US3A 3A21A 2MPFA 1V9U2 1B35C 1O4YA 3QH7A 5CFDB 3ME2A 1RUF2 1PVXA 2ERFA 4CUBA 3TN91 2ZKNA 4XBNA 5KHHA 3PURA 4AVSA 1PGSA 4JV4A 4ES9A 1XC6A 5JOWA 4CP9B 1LU1A 4NPLA 1QIQA 1BEV3 2DBIA 1LGNA 3MW2A 4QXCA 1MS5A 4RGAA 2HWE3 4OHYA 4UI9L 4Q0VA 3OUJA 1NCQC 1HV0A 2JG8C 2JB4A 3NJXA 4IEOA 5DAPA 4XF0A 5KXBA 3AXEA 2JG8A 2LROA 1JU3A 1VB4A 4WVZA 1QY4A 4XXAA 5FZCA 5BY5A 5IYYA 1OMIA 1DIWA 3RZLA 3O1TA 1JH5A 2O8QA 2PLV3 2WSVA 4K1ZA 4JCKA 4OVEA 1QH6A 4PLOA 3ZR5A 4HKOA 1JHNA 2CV6A 3WLUA 4AQSA 5C9AB 3IB3A 5FP3A 4AR2A 3AP9A 4JDNA 1YQ2A 1H1AA 1MZ6A 1UKRA 3RYRA 5FQ0A 1G9BA 3S0MA 3SEPA 3BTXA 1B35A 3PVBB 5FCCA 3OCPA 4BJ0A 4RR3B 2PMWB 5D2AA 2VJXA 1J83A 5ISLA 3VL9A 4QPIC 1CAVB 3A0KA 3VBFB 3BGAA 3VD4A 3FFZA 1QJY1 1H9PA 3ZN6B 2YGMA 3RJ2X 3U10A 4CCLA 3N35A 5IK7A 3QOPA 2V09A 3SQOA 1UD1A 3T2QA 1NQJA 3WNLA 5I0RA 4CXWA 4I02A 3ZIWA 1AXZA 4M4RA 3RPQA 3VD5A 4BK5A 5FZMA 2XUEA 1F4HA 1JS9A 2OUHA 3LFIA 4Y33A 1CGPA 1ZBA1 5E6HA 1NLQA 3UV9A 3ZSJA 5IVBA 4P9XA 1A8DA 1O5LA 4PBPA 2TUNA 4CCKA 4E27A 4FFIA 2VUCA 4RQPA 1O3TA 5FP7A 1GWLA 4JC1A 1CX1A 1RYYA 1CIWA 1SQ4A 4J6GA 3S7EA 1ENRA 5C8WA 3B9CA 4LLOA 3SHRA 4M0HA 2BEOA 5HPOA 4D7YA 4YW5A 4NPRA 2DBNA 5FZOB 2W1WA 3C7GA 3WOGA 3KZ4C 2BNOA 2JE7A 5A70A 2QDRA 5FY4A 3ZYRA 3A4UA 2X10A 1H8TB 4LKEA 4HONA 3IMNA 1UZZA 2WWJA 4D6RA 4ISRA 1KS4A 4LJHA 4F7ZA 1N3QA 3VZNA 3ZFFA 1XJAA 2BW8A 4AHWA 1QNWA 2R063 2HEVF 2OVUA 1C5IA 4AWDA 5FZFA 3WF4A 2V4AA 2ZCWA 3ZN4A 1KFXL 1HRV1 3WG1A 1JW6A 1QJX3 2WLPA 1DGWX 3W58A 4IERA 4JRAA 1X8MA 3KWVA 4AHZA 4B7KA 3LPFA 1VE0A 2HWF3 2XKOA 3FLPA 1HQLA 1ZRCA 1ODNA 1UXXX 2B9VA 2YZ4A 3H1YA 4XJUA 4Q4V2 4XVHA 3ZPYA 1XQNA 2N7GA 1ZBA3 5KHIA 2ORXA 1G9CA 4EQVA 1AL22 4K6BA 1GLHA 5LW9A 5HXVA 3OBZA 2RS31 3R6SA 1R1A1 1BEV1 1VMFA 2E26A 1H2LA 2XDVA 4NO4A 3WHTA 1AX1A 1MEC1 2ZGSA 3LCPA 3OPWA 3RMXA 3T08A 2AUYA 1SFYA 1HQNA 2J1SA 4CU7A 2OXBA 1NXMA 1PVC1 4CDQA 3D0SA 2A71A 4S2FA 2QQMA 1AUYA 2BDRA 4BLIA 2GP5A 1GOHA 1C5HA 2DVDA 3MLLA 4B4QA 2WWSA 3H8OA 2W3JA 4ORFA 4D69A 1V6NA 3RI9A 2H6CA 3VV1A 5A3UA 4QHBA 4UW4A 1HRI1 4XQ4A 2NM1A 4XTMA 2R061 1LODA 1V6OA 5JCTA 3LIGA 4YVSA 3S57A 1URXA 5CFCB 2AEYA 5ABJC 4BISA 2BP6A 1FX5A 3AP7A 2GSYA 1AX2A 4FPGA 4QPIB 3POEA 4OQ8A 1W2TA 4BIFA 2W2IA 2VUDA 3NNJA 5CYYA 5JOZA 3AP6A 2DU1A 1OH4A 4E8DA 3HD8B 5IVJA 3ZSKA 5IK4A 1GZTA 1LCLA 4QGLA 1MS4A 5DZFA 4TYSA 1JU4A 3T0AA 5FFOC 5GLVA 2G9FA 1UU5A 3TBDA 4IV3C 4PLNA 4IDZA 4YVWA 3WY6A 1PIV1 2GN7A 1MVQA 1MVEA 2KD7A 1HRV2 1OT5A 1LHWA 5CKMA 2WFPA 1YJKA 1BJQA 1PM4A 3MW3A 4FTSA 4YW7A 5ABJA 2OQ6A 1D4VB 2D93A 1YUDA 3VLBB 3MIDA 1OVPA 5HV0A 2UWAA 1VR3A 2BGPA 1AJOA 5BXXA 5D8AA 1C3HA 1RXFA 1VBA2 5DMYA 2WNUC 2EA7A 4IGPA 1WZXA 4DEQA 3I97A 5C3PA 3TB0A 3E5XA 1RUE3 1RUOA 3MF6A 5FZ6A 4DZGA 2D3PA 1TE1B 4RSUA 3N9MA 2HWF1 1W2OA 2XB6C 3ALQA 4LK7A 5FPUA 1CESA 1LOAA 4HZFA 4LTAA 5C9AC 3AJYA 4EV0A 3BUCA 1J3PA 3HJRA 1S55A 3PU8A 4CCJA 4LO4B 2XWBB 4P02B 5F2SA 1PIV3 4NIAA 4CDWC 4OYUA 1VP6A 2YB7A 2IXKA 3FUQA 3GCWA 1H4HA 2FDKA 4KWLA 2YGLA 2WKKA 2P3IA 2R49A 4XUQA 5FUIA 1PVC3 4Q2FA 2BOJA 2J1VA 4W6YA 4PI2A 1UL9A 2GC1A 4NR1A 1A78A 1W99A 4CDUB 4O9GA 2G9GA 5LRRA 2ZX0A 5T55A 5K4LA 3TEYA 3RVHA 3VDDB 4S2GA 3HQXA 3NNFA 2Z5WA 2QQOA 3JCIA 5FLHA 1RVF2 3WUCA 4XDOA 4BYYA 5G05L 3AVSA 5F3CA 2ZX4A 3FL7A 1W2UA 4BMBA 2QBXA 3N7MA 4AHXA 3GHMA 1UYZA 4A7KA 4LLFA 2Y6FA 3B7MA 5C71A 3KHBA 2QQPA 4GKYA 3VBRA 3OBAA 1VRH2 4YM2A 4DY3A 4XFBA 3J7HA 1YFYA 2AH2A 1JYXA 4Q1RA 3KV6A 2XJSA 3ETPA 2JG9B 1OURA 4A44A 2VBDA 4XFAA 1JZ6A 1MACA 1RUF1 1ALYA 1W8TA 1JXNA 2I2SA 3GZUC 1U5XA 3ACLA 3AMMA 1AYM3 3AK0A 2RS53 2JKXA 3P6BA 5A1FA 3THCA 5T5LA 3LF7A 3R05A 5L9BA 2I45A 2WABA 2GMPA 2VNOA 2BNMA 3N7KA 2RDRA 3ZOIA 1QJX1 3E97A 2VXRA 1ND2A 2X09A 5ACA1 3NAPC 2RS13 3ZR6A 2BTVC 3KMHA 4AVBA 2RJ2A 4ZHNA 2OUJA 4O65A 2ZTNA 5FY1A 1AJKA 1ULDA 1XBFA 2LM3A 2EIDA 4K9SA 4Y5SA 2UY8A 3ACFA 3JD72 3OBTA 3WDWA 3MIFA 4BHPA 3OTFA 3KQRA 4H14A 3I2KA 5AC91 3MLJA 2ADDA 4LOSA 4Y5Z0 5HXMA 3HT1A 3MFCA 2A3XA 2IFRA 2QQWA 5FTTC 5CEHA 5A3NA 4A41A 5F5AA 3WW3A 5LY1A 1L7QA 1REEA 2CDPA 3SNMA 4UF0B 2XBO3 4UFJA 5FUNA 1AL0G 3SCFA 4CU6A 5J3UA 5DUXA 2NYYA 1W6MA 2OYZA 4XMAA 1TME2 3U1XA 5E8AA 3GZEA 3ZM8A 2BWAA 2WL1A 2J42A 3I3MA 2K2SA 2PA7A 5F3EA 3ZDSA 1DGRA 1AL21 2HWD1 4PIXA 3AMQA 2F4PA 3EJKA 1QMJA 3JZVA 4QU2A 4QX0A 1NG0A 2K9ZA 2RS51 2DTWA 3WQBA 1Q8PA 5CG8A 4Y1XA 2F17A 4LXLA 2ET7A 1NCRB 1VMJA 3RS6A 3WNOA 1MS9A 2IXJA 2XHNA 3CQOA 4Y4RA 5ACA3 5I8SA 3BIWE 3DPRB 5FYCA 5BNNB 3IBMA 4GJYA 4RQPB 1H2MA 1NE6A 2UYAA 3N7JA 4XFFA 1ZBE1 4GMP0 2VMIA 2ZGLA 2A1XA 3J7LA 4GWIA 3WF3A 3VBSB 2QTWB 4OUSA 5GZCA 3VBOB 4LQRA 3B9IA 1H6XA 1A8MA 1JZ7A 5I0SA 1HB2A 3VL8A 3ZKUA 4COWA 1PGL1 4WVMB 4B29A 1LGBA 5J7MA 2ZHNA 4FT8A 1QOSA 1ZZ7A 3KD4A 4IGQA 3PU3A 4AFDA 3RRDA 3B93A 1O8PA 1O6UA 4LBKA 2ORZA 4N7IA 4UFHA 4ASMB 1DYKA 2AENA 5DABA 1W03A 4XUTA 1ND2B 1NCRA 2VD7A 2WBKA 2FCTA 1UQXA 3ZXAC 1RTVA 1BKZA 3P3PA 3ZSMA 4TTGA 4NIHA 5DAQA 4IEWA 2BOIA 2DURA 3KM5A 3WW2A 2DVAA 4AAPA 1LHVA 4LBMA 5D8AB 4XFIA 5A7OA 3MIHA 2W46A 4EN6B 1V9U1 2VZRA 5J09A 1OKOA 3ES4A 1YFUA 1QF3A 2ZBJA 2FDIA 1DGLA 2D3SA 1GKBA 2WJSA 1CQ9A 2DCYA 4W50A 1AYM1 1RINA 1X36A 1CWPA 3FUOA 3KSCA 5FOJB 3ZSLA 2PHWA 5FZIA 2GH2A 5FZBA 1D2SA 1S2BA 1VBE3 2FCVA 4IV3A 2P2KA 5C3OA 4I01A 4Y1ZA 4YVWB 4BIOA 2DDUA 1FXZA 2CSGA 1CAXB 2XLAA 4PDWC 5B2GB 3HNMA 4AE2A 5DDJ3 5BNQA 1XNAA 4XHXA 3UJQA 3DUIA 4R9CA 2VMDA 1ZZ9A 3CDZB 2WIIB 2WNOA 4QU1A 2DFCA 1AX0A 4FP2A 5FPAA 1BYHA 1W6OB 3SMHA 2WRAA 1YIPA 3BU7A 3DKWA 2BV4A 4S2DA 3ROUA 3VDAA 4MYEA 2NN8A 4AI3A 2GC2A 2XJTA 4DUVA 5T54A 5C6CA 1VBC3 4BXFA 4YVSC 4DPNA 4LHSA 3RQ0A 4P00B 5FAXA 4MVTA 3OB8A 1EY2A 2YHJA 3VBHC 1STMA 3GHNA 3PJYA 5FPXA 1VBA3 2JB8A 3HN1A 5A33A 4LO5B 2IXIA 1O7FA 2F6BA 4CZSA 3BTAA 2BZDA 3DECA 1IOAA 2BVVA 1R091 1WWYA 5JSPA 4Q1PA 3ZYBA 5EYXA 2ET1A 4EZ4A 4RD7A 1PO23 1AR62 5IK5A 1YNAA 3PJQA 4KMQA 2YY1A 2MEV2 3WP5A 4P14A 4GB33 2KR2A 3Q8EA 5F3IA 4E2QA 1VRBA 1HQWA 2OIIA 4QB2A 4ONUA 1W04A 1OA4A 3M3CA 1C1FA 2P37A 5FZDA 2TBVA 1UOGA 1JZ8A 2JXAA 3A7QA 5FXWA 4EN9B 1LOGA 2HBUA 3IDBB 4YLZA 3BPSA 2P17A 1Y9QA 2RM22 1W6OA 3QBQA 1GOFA 1DYPA 1RUI2 4NHXA 5DZEA 1BVP1 4FPFA 1LOCA 2ZACA 1W2NA 3CHXA 4HFSA 4Z07A 3V0AA 2D6PA 3RWKX 1T6GC 1UYXA 4EYUA 3LKJA 2Z42A 3ZFFC 4Q4V1 1HXS3 2AACA 4LPLA 4BWOA 3O12A 5IT6A 1GZWA 4WM8C 2YYOA 1QXPA 1DCSA 3GM8A 1AR81 4CCDA 3WVJA 1UX6A 2ZMLA 1FYUA 2VH9A 2GU9A 2W95A 4K21A 4SLIA 5H9SA 3OGGA 2XBO1 3VBUA 3ZYGA 1HDKA 5GZFA 4UT5A 2VMGA 2WAOA 1BEV2 4YW6A 2RR13 5KHGA 2VBBA 5LZ6A 2XXZA 1W39A 1K12A 4N7UA 1RMU1 4P9LA 5LEKA 3KCCA 4AW7A 1ASJ1 1UY0A 2D98A 2YUEA 5JVVA 5K8SA 2VUJA 5C70A 4KBZA 2FZ2A 2FDJA 2VVFA 2WN3A 4XQDA 3LEIA 3J9SA 4JGYC 2QNKA 4RHV1 2GNBA 2D43A 4E2GA 3C8XA 1TEIA 4WM8B 4XUOA 1NLSA 4IL7A 3D5OA 1BBT2 5EYYA 3CJIB 2NPIA 3LWCA 2DVFA 1R092 3VUOA 1EV13 3J4UH 5LASA 1W8ZA 4N9IA 4WVMA 1VAVA 3DPRC 1C8NA 4HMZA 2WFF2 2WS92 4NJ4A 4ZU5A 3WD5A 1RB8G 3CU7A 3GYDA 3UK9A 1JZ2A 1X8EA 4Y20A 1WA6X 3K2OA 2X5IA 3BYWA 1SMVA 4MUVA 1JYVA 1AR92 2R062 2CL2A 2RM23 4W6XA 2OPKA 1CX4A 4L92A 2VOWA 4UOJA 1UCXA 3AP5A 1FATA 1WGPA 5FYYA 4K1YA 3VBUC 3AC0A 1WA4A 3I2HA 1WD4A 4UFIA 4Y20B 3RWNA 4JKLA 1PIV2 2GZWA 2HBTA 5CZKA 4ZKTB 2SLIA 4CUGA 5AFBA 1VBC2 4WM8A 5JZGC 1NCQA 1OQ1A 4Q26A 3KV9A 1NT0A 2Y6GA 3POFA 4M3CF 5I0UA 3HR9A 5IVFA 1LOFA 4FPKA 2QFEA 3JD71 1NXD1 1W6PA 4FAHA 4ATEA 1K3IA 4GH4A 4IV3B 4CSWA 1AR71 3WDYA 4IESA 4BLJA 2XJPA 2ZGRA 1S2EA 5ERLA 1JYTA 2Y60A 1W0OA 4PI0A 3OGJA 1EV11 4XJWA 3S5AA 4RFT0 3H1MA 4LK6A 1W8NA 1XU2A 1WCSA 1UYYA 5FMBA 4BQ5A 5F8PA 1K5MB 4LHLA 2C0ZA 4FOQA 5JMCA 2GALA 1OQDA 3I3BA 3U11A 2YC0A 5JLVA 1BHGA 1GZCA 4HBNA 2HH9A 3LIHA 1K42A 5FZKA 4ZXEA 3ZN5A 4Q8KA 4H2AA 2HWF2 1L3JA 4NVPA 4NHMA 2D97A 1QGLA 4XUPA 4PF1A 2RR12 1XNDA 2NZ9A 3AX4A 2XLGA 3C2UA 5BNPC 1YQ5A 1J58A 4JRLA 3RJRA 1H2NA 1WLCA 4FOWA 3K4AA 3T3YA 5A3LA 4XHBA 5JI7A 1ND3B 4JX0A 1XSRA 2PQSA 1YWKA 2W92A 2VW0A 1RMU3 2X5IB 3I3DA 3JD73 4HKLA 1FNYA 4LITA 1G9AA 4HLTA 1GSLA 4C90A 1ULGA 2O14A 1W3VA 4K8RB 2BBVA 2OZ6A 4IEZA 2Y34A 2IFWA 1XYNA 4Y26A 1TNRA 5FXZA 1GZ9A 5D21A 1FMD2 1I5ZA 1KS5A 3LEMA 4XF4A 5FZ8A 4JTNA 4OI2A 5FZAA 2WZR3 3WP6A 4R8HA 3Q9OA 5A3WA 2ZKLA 3C7HA 3POYA 4QXHA 4NPMA 4FO9A 3ZFEB 1S0FA 5T50A 1LOEA 5JR7B 2PAEA 4QX5A 5LK7B 1TMF2 4UFLA 5C4WB 4JGZA 4PDWA 4LORA 4E4ZA 2PAMA 1DLCA 4BU2A 2WQ4A 2ADEA 4FXGB 4JDMA 4KWUA 1EP0A 1U12A 2PHUA 4R52A 1PO12 5DAXA 3W20A 1UOJA 2RM21 2IXLA 4CU8A 1RL3A 4UFMA 1AR63 1PO22 1PM7A 5EJZB 4YW3A 3VBOC 3RG0A 1GYKA 2XG3A 2PQQA 3NVCA 4A4AA 3NW4A 5JPMB 3B02A 2WT2A 2Y26A 5LK5A 4F83A 1FI2A 1FT9A 1RUI3 1SPPB 2J1EA 3NKGA 4QWNA 1YFXA 5B4XA 1NY72 5BNNA 4IGOA 4BK4A 2Y6KA 4L9BA 5FBJA 2OT7A 2VQAA 1NCRC 2W91A 5F5CA 3FMGA 1W6NA 3CEWA 2XPJA 1I9RA 1Y9GA 2PLV2 1DYOA 5BNNC 4MADA 2C9KA 5BNOA 4LMFA 4BB3A 5A1AA 1S2KA 1TNFA 2VO5A 3FWEA 3ITQA 3MEPA 1ENXA 4H55A 3CJIC 5FP4A 3ZYIB 2RR11 1EAH1 5CADA 1H0BA 3NJYA 3RMYA 2YXSA 3ZXEA 4GMP3 1H8VA 1W8OA 2VAUA 5AC92 4JHTA 5FYZA 4H7MA 3T4VA 4E4DX 3M8LA 1FV3A 2EXHA 1JYWA 4A7YA 4GH4C 5KBFA 3FFQA 2BYVE 1KJLA 5B4NA 3K48A 1O8SA 3OPTA 5BYNA 1LOFC 3JQXA 4TXWA 2GC3A 2QKDA 4L11A 5A32B 4YG0A 2DWRA 3M2MA 5FO7B 4GH4B 1ZX5A 2AC1A 4JHZA 4MGKE 1WCDJ 5JAXA 4DS0A 4MG2A 5FJHA 3ECQA 1REFA 1W6MB 3LPGA 4BM8A 5I0DA 2FQPA 5FZEA 5GZDA 1S0CA 4DO0A 5JIAA 1C28A 1F9KA 4JQRA 4P5YA 5I8YA 2FDFA 2JDPA 4XAAA 4V2VA 1AYN2 1GWMA 4WVWA 5C8CB 1O4ZA 5GKAC 1ODMA 3J8F3 5LBCA 5CFCA 2ZEXA 4FOYA 2HYKA 2XGXA 4WM7B 2R7EB 5T52A 1W0PA 1KFUL 4YPJA 3H1WA 1GBGA 3DPRA 3NKTA 3O1SA 3VD3A 1UAIA 2Y0OA 4GMP1 3JBG1 5BNPA 2WZR1 1OBNA 4CEYB 4SBVA 2WA3A 3TYJA 2CDOA 4AGRA 1GZWB 5HCAA 2HJIA 4R9DA 4GXLA 4HETA 5D1IA 3RZHA 2ARXA 2X53S 2D6NA 3I4IA 4IEUA 5FYHA 2JG8B 2HWC3 1GWKA 3NQHA 5KHJA 4AOCA 2E6VA 3VZLA 4AGGA 1QQP2 3CIHA 3FZ3A 1WKYA 3D0JA 4F3JA 5LBEA 5IW0A 2VW2A 2WUHA 2A6VA 2Y33A 4IV1A 4MX3A 2EAKA 3TOJA 1JOBA 4UXAA 2WC2A 1EAH2 3GJAA 4WM7C 4XOGA 2OS2A 5EIYB 2QZ3A 4G9SB 1F5FA 1WW5A 2XL7A 4NWVA 3DYOA 4AFMA 3UESA 3LA3A 4MHRA 5CVRA 4AXOA 4XZUG 1ENQA 1EUTA 3HWJA 3H3UA 1TVGA 2A75A 2D6KA 2GNDA 3VZKA 3GDBA 4OZXA 4S2HA 1PK6A 4Z8BA 1MEC2 1W6NB 2R041 2ZGUA 3HMYA 4Y1VA 3EBRA 4QPWA 2FCUA 1O4TA 2BWCA 1C8M1 1RUG2 2R30A 5FYTA 1AZDA 2JDAA 3OGVA 4CTEA 4QQ2A 3IDAA 3PMEA 1PK6C 2HWB3 2JDZA 3IDCB 5E88A 2RDNA 1BBT1 3KVAA 3AKRA 3IZOA 4AG4A 4Y22A 4DXZA 4U36A 2WA4A 1DZTA 5GJ6A 5H9QA 1POQA 3TN93 3PVOA 5LBBA 4WVVA 3VDBA 4LO8A 2JX9A 4DNYA 1OF3A 1HXS2 4QQOA 1ZZBA 4WM7A 3MIBA 5F3GA 3VBSA 1F5JA 3I2DA 4IE4A 1ULPA 3IT8A 2HWE1 4PF5A 4BDVB 5JSRA 1MS3A 3D3AA 3MI8A 2W52A 4Q0UA 4Q0PA 1JZ4A 4BH9A 5AFEA 1W9FA 3QLQA 2KA3A 1IGOA 2V4VA 1NAEA 3ZFGB 2R1DA 3AZVA 1QDOA 1TME3 3OBRA 4KGGA 5FZ0A 5LATA 1RITA 2PELA 4RS5B 3I2GA 3IMMA 5GM0A 2XH6A 1D0HA 5IJRA 3KT1A 1NOVA 3ENRA 3O1PA 1OLRA 2AGSA 1PX3A 1SBEA 1OC1A 5DUWA 1OD5A 2XONA 4Y24A 1UIKA 1W0NA 2VOVA 2JIJA 1AVBA 3CBNA 4NN0A 4HPKA 3TN92 1TMF3 1IPKA 2ZGNA 5FREA 1AR61 1HLCA 2HWB1 1OXCA 2BFUL 3LZZA 5T5OA 5CFCC 1ULCA 5A3MA 1QQP3 4N53A 4CDWB 1LJ7A 5FZLA 1JODA 2GC0A 1IS4A 3PVNA 3H50A 4QQHA 1D4M2 4AEKA 2VECA 2R1BA 3RYKA 5FYSA 2RDQA 1G6NA 1XE0A 4I30A 4CYDA 2E33A 4IE7A 4LA3A 4CDXA 4QX7A 1PO13 2QE3A 4QPYA 3X29B 3AL6A 3VDDC 5KHKA 1YO8A 1XPWA 4I3GA 1O3SA 2ZZJA 3JUUA 1EAH3 2PN5A 2PHXA 4GIQA 4XFCA 3BIEA 1SLTA 3C7EA 4CDXB 2E31A 3SC7X 2P34A 3VKFC 1QJX2 1OOPB 3ZLIA 2WNVC 3IIAA 1UY3A 3PNAA 3DL3A 1YFWA 5CIRA 1QJU1 1V6IA 2Y6LA 1XNBA 4D3WA 1RUNA 3S7IA 1ULFA 1DZRA 3AL5A 4F8AA 3OD0A 1WW7A 1KITA 2GN3A 1FMD3 4BQ1A 1E5HA 4CA9A 3HQUA 1LECA 1OLMA 3CL1A 2JD4A 5FYVA 5LWBA 2B9UA 1Z7S2 4O61A 3SH4A 1D7PM 1HJGA 1W06A 1I1EA 4P5HA 4J1XA 5E1RA 4R4XA 1UXZA 2XWJB 3C7OA 4KH9A 4MGSA 4X6QB 2IVIB 3L9JT 5DG2A 1QJEA 2D5FA 3GF6A 4COZA 2BGOA 2Z79A 4DQAA 1RUD1 1CONA 2W68A 4K7JA 4ATFA 3KCXA 3WT3A 4CCCA 3NWKA 4Q4Y3 2V73A 3TRSB 2BUKA 1W8UA 4V2WA 2JICA 1G7YA 1LR5A 3NRUA 1CPNA 3TEXA 1IQDC 4GWNA 2VG9A 2VZQA 4QD2A 1N47A 2CHHA 3AJZA 3VBHA 1OUSA 4JDOA 4OCTA 1MEC3 3VHOA 4RHV2 1HN0A 1ND3C 3JBG3 5IUQA 3T09A 1GNHA 1RUE2 2HEWF 5FY9A 4DINB 1PX4A 4GA9A 1SDWA 1W3XA 3H8UA 1Y7BA 3GBGA 4K3UA 4P9GA 5FIXA 5FMDA 3RSJA 4EN8B 5DPNA 2OQ7A 3MDPA 4JGZC 5A6YA 1LENA 2YG0A 3HBZA 4HVRA 3S5QA 1VIWB 3LA7A 5F32A 4D7SA 4Y22B 3AMNA 3QACA 3ZXKA 1VBB1 1WCQA 4NUBA 4COYA 3S6PA 4O7XA 1LHOA 3ASIA 5FY0A 4XF1A 1ST8A 3LD8A 5HCBA 4QDSA 1Z0HA 2A7AA 4KG0A 5FXXA 1UIJA 1OPOA 1WW6A 2R073 4BQXA 2A73B 1UY1A 3THDA 5JIUA 2WFF3 2WS93 5FZ1A 2ZGQA 3O1UA 4N8MA 4ZS2A 1WCUA 3EMRA 3W21A 5FP9A 2VPVA 1LNSA 5IFPA 3DF0A 2CWSA 4CP0A 2XJRA 4OHVA 1VJ2A 1O91A 1ZVFA 3U07A 4JTOA 5FZHA 2EF6A 1OSGA 1D0GA 2VQTA 4CPBD 2LS6A 4IE0A 1NX9A 1KRIA 2RMU3 1W8WA 2VMCA 2DFBA 4HN0A 4XCAA 1US2A 2OX0A 1YRZA 2ATFA 1MS8A 4AAXA 4KNCA 5A6QA 2G1MA 1O3RA 5L73A 3WNXA 3VZOA 3K4ZA 4EWDA 4CUAA 1BMV2 2L9LA 3FX3A 4FSJA 2B39A 4NHKA 3WDVA 2DTYA 1Z7S1 3MF9A 4LKSA 4NIGA 4LUKA 4Y1YA 2VE1A 4A6OA 5IVVA 1E5IA 1QU0A 1W2AX 1VALA 3NAPA 1NCQB 1ND2C 1RHI1 3QH6A 4ZU4A 1V0AA 1ZZ8A 3O1VA 1PZ7A 3I2IA 4CDUA 1ZM1A 3EB7A 1Y43B 1H1IA
chains in the Genus database with same CATH topology
1AL23 4EN0A 3O0VA 1SLAA 4CEYA 1H9WA 1UMZA 1S0EA 3LSEA 3AYCA 4QPIA 4FPOB 4XEZA 3LAGA 3VBHB 5BPXA 3WQ1A 1IQAA 1FMD1 3UKTA 2RS12 3FBMA 3G7DA 3KT7A 4X8PA 1GICA 1AR73 3V56A 2PFWA 3W59A 1IS6A 3M1HA 4Q29A 2R6QA 4AVAA 2NMNA 3ZO0B 3VBRC 4EJRA 5T5JA 1QJY3 1M4WA 4PDWB 3MLKA 2QJVA 3EHKA 2RMU2 4XE9A 3VBRB 3ZVXA 3T1MA 1C57A 2EALA 3ZXJA 2RJKA 1TMF1 2ZAHA 1IKQA 3SCHA 4CDQB 4L8QA 2CAVA 4XPVA 3WQ7A 1JUHA 4FQ4A 1QQP1 2ZHLA 4TZDA 4WV8A 1ZRRA 3ATGA 5EFUA 1RHI3 1U5IA 4LA2A 1G9DA 1AF9A 4WZCA 4N90A 1NY71 1XXNA 2X8KA 1I3HA 2D44A 4KGQA 2MNGA 5C9AA 1LOBA 1UPSA 2Q1ZB 5FQ0B 4XIKA 2ZZQA 2WLQA 4DRRA 4QPGC 2R071 4CDUC 1VBE1 2IWGB 2GMMA 1HIXA 1S0BA 4EWAA 4Q0QA 4A7ZA 4IEXA 3DN7A 5D8AC 4BMEA 3O0WA 2VW1A 2DCJA 4MXWA 3EXUA 4YM1A 3CF6E 4YZ5A 1OLQA 2UWCA 2HWC2 5EWSA 2WZPP 1YJLA 4BZ4A 4IXLA 3NO8A 3R4UA 2JKBA 2YDEA 4FQZA 1Z7S3 1CPMA 3USSA 1FOD3 1RUD3 5FMOS 1X33A 1H30A 4C0BA 4QQLA 1MS0A 1X82A 4GQ7A 2ZGMA 1QJY2 3ZYJB 3IDEA 3M3IA 3ZFEA 3WP3A 3WUDA 2ZABA 5K7PA 4XQWA 4LBLA 1JUIA 4B4PA 1SLIA 5SV8A 2B46X 2WINB 1V9U3 1V6LA 3AZXA 1AYN3 5J98B 3S30A 3V0AB 2DYCA 2KM2A 3FLRA 4QQPA 3KT4A 4KQ7A 1SBDA 5FLIA 4CDWA 1B35B 1N3OA 5CFDC 4NWWA 3NSTA 2HEYF 4GB31 1ND3A 1HW5A 5FPZA 1LESA 3B3QE 4XDQA 3BALA 4LBNA 1V6JA 5K0UB 3WZ1A 3RYPA 3AM2A 3D6EA 1WW4A 4X6RB 4P9WA 2JE9A 3BOWA 2YV8A 1QWRA 1PZ9A 1RUC1 2C9AA 4KG8A 3PTYA 4Y1YA 1B09A 2HKXA 4TLFA 1OI6A 4CDQC 4ZXKA 1AR72 2XJUA 3AMPA 1AXYA 4FPJA 3GBWA 2D5HA 3KLSA 4LEJA 5HCFA 5JI9A 1HRV3 3GBFA 3DV8A 4FPLA 2PYTA 4K20A 4C91A 1FPN2 5DG1A 5BNOB 5CFDA 2JG9C 2R042 2DUQA 2VQ0A 4AQTA 4DB5A 1V70A 1RJ7A 2ZGKA 1W6QB 2SBAA 1YI9A 4ISQA 2WNVA 4OHZA 1GFF2 1W6PB 3APBA 4M3CA 2GDFA 1QKQA 4IQPA 2Y38A 4GKXA 2XJQA 2HWD2 3FE5A 3ZFEC 2ENRA 1R083 5GZEA 1S0GA 4PJYA 4KBBA 4YFWA 4ZU7A 5GLUA 1SACA 1COV3 4HANA 1OPMA 3QD6A 3MICA 4QGMA 4CDXC 1RUJ2 4RHV3 5F5QA 5HBAA 1CAUB 2IXCA 1SCSA 4YGEA 4YVSB 1QH7A 4L99A 4Q4X1 5FLJA 1PGW2 1SLLA 4LULA 1RUG3 2VGDA 4AK3A 3OJBA 4FXKB 2JG9A 1Q5OA 1POV1 4HSLA 2FHRA 5JOYA 4HVOA 2Y0IA 4N53C 4RL7A 4Q8LA 5AVAA 3WCRA 2ZHMA 3AZWA 3AMHA 4LBJA 4Y1UA 3N3HA 4B7EA 2ETEA 3ZIXA 2ZAAA 5F1RA 2IC1A 2C5DA 4YZ1A 1Q56A 1UZYA 1PMIA 4YG6A 1RC6A 2A6XA 5L7OC 5DUUA 3E6CC 1S0IA 4QPGB 4P9IA 5A33B 1LULA 1BVVA 2HWB2 2PHDA 3LA2A 2PAKA 1RGSA 1Q8SA 1ZRFA 1APNA 3ZN6A 1SBFA 4YW2A 5KXCA 3JQWA 3VN4A 1YIFA 1ASJ3 1AYM2 1DU3D 2Q0AA 3AKSA 2AZ5A 1CVNA 3E5UA 3O14A 1LEMA 4YGDA 2E51A 3MFAA 1DLLA 1H4GA 4CEWA 3H9AA 1ULEA 5L19A 4BOWA 1EYBA 3WV6A 4IEQA 3ZMOA 1CAWA 1D4M3 1VAMA 3D4KA 2PTMA 1CAXA 5E16A 2W08A 3MPPG 2R072 3N7LA 1LKNA 4G3YC 4JVAA 4PIYA 4CEWB 1LRHA 1ONAA 4P9YA 4XBQA 2V5YA 1MR5A 4LBQA 1RJ8A 1DZQA 1XU1A 1ZNPA 5ACA2 4UBGA 5ABJB 4M0NA 1VB2A 3BODA 3NV4A 4LT5A 4YW4A 3T2TA 1JBCA 2CWMA 2RJLA 1ENSA 5EZWA 4AHYA 4KU7A 2WT1A 4NHLA 4Q4W1 4CEYC 3ZFGC 3J8F2 4AI1A 2P3JA 4D7TA 2FBEA 1DQ0A 2XHKA 3AZZA 2BPA2 2XL9A 5C33A 1BK1A 5T3NA 4QPGA 4B8EA 2Q30A 3OF1A 1VLNA 5BNPB 3U4XA 1EPZA 4YZ2A 3LSDA 1LB2A 4XILA 4COUA 3NV3A 5F6LB 1Y3TA 1RIRA 2GNMA 1IHMA 1VBB2 3OYWA 4HT1T 1CJPA 1UPIA 3UJOA 5BNOC 2TNFA 2ZS6B 2QCSB 3MIEA 5GLTA 2DCTA 5BUVA 4YM3A 2XVGA 3UKNA 2A3WA 3O5SA 3FJSA 3RDIA 3OPZA 2AYHA 1JYIA 3POSA 2CTVA 1DGRN 5CU1A 1Q8VA 1R1A3 1CAUA 3MPBA 3H7JA 4KWKA 3VHNA 2DVBA 1RUI1 5FMOL 3R4SA 2D6LX 3RI8A 4ES8A 4XMIA 1ZREA 3HAGA 1OFNA 5LEJA 4XTPA 3ZMNA 3ES1A 2PHLA 4MZUA 4YARA 2QZ2A 3ILNA 3ST7A 4LE4A 2ZOEB 3A0NA 4KL1A 2W39A 3I59B 4I3PA 2DV9A 2VNRA 2DF7A 3ZXGA 5I93A 2B45X 2GH8A 1DFQA 1H1MA 3VBFC 4MXVA 5DDJ1 5DUVA 2Q1MA 1I6XA 1RMU2 5L7OA 4QXKA 4YSFA 1WMFA 4MV2A 5FO9B 1BMV1 4AQ6A 1X7NA 1BQPA 2VY0A 4D94A 2KXLA 4LE3A 1FV2A 1YHFA 1WD3A 4PIZA 3WW4A 2ZMKA 4WBBA 2WFF1 2WS91 2YROA 4RS5A 4CP2A 5CG9A 2VNGA 3VBOA 1UN1A 1UU4A 1KJRA 1GV9A 5K0UC 3M3EA 1GQGA 3OYWB 4FPEA 3BOPA 2P3KA 2RMU1 3OD4A 4DMIA 4JGZB 1A6CA 1XE7A 1JOJA 1HX6A 4N9HA 3INAA 2O8OA 4FOVA 5GZGA 3VDDA 1PNGA 2IZWA 2CGPA 1RUH1 2MEV1 3H7YA 3AP4A 3LB9A 2VVEA 3P3NA 1SLCA 3D82A 4XETA 3B5LB 1GR3A 3WG4A 3AKTA 3R4DB 3JB4C 3SISA 1H2KA 3V0BA 4FP3A 4XJZA 5CBLA 3I59A 3ZXLA 3WHUA 2BNNA 4Z82A 1OKQA 1UF2C 1J3RA 2ZJCA 4KU8A 3FHIB 3ZXDA 1QNYA 3WINE 1DBNA 1VBE2 2CGNA 1MZFA 2R32A 3PVEA 1JTZX 2A6WA 5F6KA 4AVTA 2XVKA 1S1AA 3ZFFB 3UL2A 1DQ1A 3LGRA 5J96B 1KXGA 1CJDA 4PBOA 2R043 3AFKA 4A2UA 2C1FA 5EV7A 2JECA 2FZ1A 5CA6A 3DGTA 4Q0SA 1DDLA 1SCRA 4C1XA 1BBT3 2VOKA 2MEV3 3VBSC 1R1A2 3CNAA 4Q4W3 1REDA 3AYAA 4C1WA 2A3YA 4MGIE 4R4ZA 1R082 3K51A 5C4WA 2LUWA 3AXDA 3B00A 3BPZA 5J37A 2Q4SA 4HL0A 1AR93 2XBO2 1NA1B 5GLZA 4L2NA 4PLMA 2A6YA 1RUF3 4XIOA 2H0BA 2HWC1 1IZ3A 1V6KA 1TME1 5JZGA 3AB0A 1NA1C 2NLRA 1R093 3AKPA 4AEJA 1WBLA 3N36A 1PO21 1DHKB 1MQTC 2DUOA 5A32A 4LHKA 3TNPB 4I0WB 5T5PA 1GANA 1XRUA 1ZBE2 4H7LA 5J36A 2AR6A 4Z92B 4QM9A 2D6MA 4N43C 3RZZA 4RQPC 4IV1C 1XNKA 5DZGA 3M4FA 2ZX3A 1AR82 1PGL2 2I07B 3USUB 3ZXFA 4DFSA 3WR0A 3VHPA 1DQ2A 1M06G 5EJ3A 3B01A 1ZZ6A 1FOD1 4AEDA 2XKPA 4XJ9A 1BXHA 2CAUA 4JGYA 4YGBA 4XW3A 4Q4V3 2A6ZA 5JPNB 2A70A 1MQTB 1COV2 1PNFA 3L2YA 2K0GA 2D7FA 2E7AA 1C1LA 2PHFA 1O3QA 3J26N 4AVCA 4N43A 1R1ZA 3GALA 3VGIA 4AFCA 3MZHA 1FNZA 2XLFA 4WZFA 2GMEA 4Q4W2 4QGNA 1NQDA 3VKOA 1ASJ2 2B7YA 1BZWA 1FPN1 3IN9A 5HI0A 1NA1A 4AEDB 1CN1A 4R9AA 1YXWA 2Q8OA 3SITA 1UU6A 3LOIA 5E89A 5KC5A 2RS11 4L97A 5F9TA 2ZGOA 3B94A 1N1TA 5CB7A 1PGW1 2BQPA 1F8VA 1WMDA 1RHI2 2D40A 3GZTB 5J48A 2WT0A 3AKQA 1RVF3 3IM0A 4YNIA 5GLWA 4XJAA 2CNAA 2WQZC 5H9RA 1AR91 4NOTA 4M00A 1N1VA 1C8M3 4QMAA 5FDBA 4XF9A 2NP0A 3VKNA 3JBG2 4LBOA 1Q43A 4FVVA 2NMOA 1POV0 1RUH3 4ASLA 1DGWA 5JZGB 1FAYA 1SFNA 2DUPA 2ZX1A 4MGYE 1V00A 5L7OB 3V65A 1N1YA 4AGVA 3WXPA 3CLPA 1VBB3 1OA3A 1CAVA 2OZJA 4YM0A 2OA2A 5JWPA 1JYCA 1OFSA 2UURA 4IEVA 1ZRDA 4H3WA 4TSVA 1LTEA 3VZMA 4UW5A 3VBUB 2O0OA 1RUH2 3MIGA 3I54A 1WLDA 2NQYA 4XXPA 1XNCA 1C8M2 1RUG1 4XFHA 3M70A 1D2QA 3VKLA 1H8TC 1LU2A 2JEMA 1KQRA 5I0TA 3WW1A 4CRQA 1J1TA 2LALA 1YYNA 3WCSA 1OOPA 4JGYB 2Q5TA 1ZZCA 2EIGA 1IKPA 4AI2A 1Z78A 5AC93 1VBA1 3KGZA 1WBFA 3VHRA 3WDXA 3ZSEA 1OHFA 4XFGA 4Q27A 4LUMA 2VU9A 2YMZA 3L2HA 1AXKA 2DU0A 4JAAA 5KC6A 2WSUA 2HWD3 3ILRA 1N3PA 3URFA 2EVXA 4E9KA 2VULA 2E7TA 1VAKA 1ZBA2 2CGOA 1YLLA 4I2OA 3WQ0A 3V64A 3NV2A 3NAPB 2B5HA 2UU8A 2UYBA 5IK8A 3H3ZA 5K9YA 2O1QA 1JN2P 3VBFA 1EPWA 1D4M1 2ILMA 4GB32 4MSVA 4A3XA 4RGGA 3PHMA 2JJ6A 3J8F1 2Z2SB 1RVF1 4XYXA 2GAUA 4ITCA 3W9AA 1WUVA 3THTA 2RS33 4FCAA 2Z69A 1Q8QA 4YGCA 4N43B 4QM8A 1F2NA 2XJVA 5KXEA 3SXWA 2WZR2 4BA6A 1DG6A 4FPHA 1KDMA 1VBC1 3KCYA 4PQ9A 1DQ4A 1UW8A 4RR3C 1TQ5A 1DF0A 2JENA 3KB5A 5JDBA 4P9JA 4BE3A 2DVGA 1CD3G 1C4RA 1NLRA 1QJU2 1HRI3 3ELNA 3CO2A 1OOPC 3PMSA 3WG3A 4QT6A 3AYDA 1GQHA 2X29A 4LR4A 1KDKA 4I0BA 3KS7A 2E7QA 1PK6B 5EXOA 2X5IC 4FTEA 2MHFA 2RHPA 2RE9A 3LOBA 4AFBA 1A3KA 2QVSB 3GZAA 4AVVA 4AYUA 4HK8A 1RUD2 2ZX2A 4FTBA 2EXJA 4YG3A 4AQ2A 3GNEA 1K5MC 4K8FA 4OI4A 4XJ8A 4AEDC 3JU9A 2DCZA 1MZ5A 5JOXA 3RNSA 4XF3A 2ZGPA 1VBD3 4YZ4A 5FO8B 1HXS1 3ZFGA 3PLQA 1NE4A 3TNQA 4FPCA 3VZJA 4Z1VA 5KXDA 1LHUA 1HRI2 4IETA 1AYN1 5BV6A 2ZPXA 4CP1A 3BB6A 1V6MA 1RUJ1 1DQ6A 2AREA 4G4FA 4DY5A 3IWZA 3E6DA 2DCKA 1Q3EA 3B69A 4W6WA 1RUE1 1LHNA 5SV5A 2GNTA 1NZCA 2UY9A 5C8CA 4AI8A 4M01A 5I91A 2VOXA 4LO6B 2EXIA 3VKMA 3POWA 2G4IA 5FRAA 3BCWA 4OLLA 4YFZA 5C8CC 5FOBB 2B8MA 2QUOA 1RUC3 4AFAA 4M3CB 5L36A 4X8NA 2E9QA 1XYOA 3CJXA 4YRDA 1S0DA 5C4WC 3D8CA 1ZYBA 2ZGTA 4OUMA 5H9PA 5CAZA 4HKWA 4AI0A 4N53B 4HSJA 2ARBA 4XBLA 4I09A 4E4SA 3IKWA 4MLOA 4GALA 2VUAA 4MH0E 1PO11 4HPKB 2I74A 4TWTA 4LBQB 4GWMA 4Z2WA 1AR83 4LBQD 2D3RA 1IS5A 4UBHA 3IPVA 3OY8B 3M3QA 2BGCA 4EN7B 1G86A 2R16A 4AF9A 1K5MA 3QCWA 4UW3A 3C3VA 4DRVA 1YCIA 2QDNA 3I7DA 3U0ZA 3HIFA 1OQEA 2OW4A 4I0AA 1R081 2WNUA 4MGZE 5DXDA 5FBZA 1IPJA 3T1LA 4HVQA 4R9BA 3WDUA 1WMEA 4LHNA 2ZHKA 3AZYA 4U2AA 3WP4A 3ZX7A 2PLV1 4Q4X2 3SCGA 4E2SA 4META 3ILFA 1CR7A 1MQTA 1XE8A 3MYXA 1OA2A 4OHXA 4YVWC 2VVDA 3I8TA 1PVC2 1N1SA 4IEPA 4OFGA 1J59A 4FAGA 3SH3A 4BCUA 1VBD1 3EO6A 2PHRA 2B42B 4RR3A 1QDCA 3E6BA 4Q4Y2 2PHTA 3M3OA 1QXRA 1U5ZA 1Q8OA 4B4RA 1HV1A 2BVBA 3JB8A 3ZYPA 3FC0A 1SLBA 2H6BA 3N4MA 1SEFA 3ETQA 4RS5C 1FOD2 3CJIA 4OI1A 2TEPA 1WLWA 1PZ8A 4LO7A 1IS3A 2R0HA 4EROA 4PCRA 5AVPA 2UWBA 2WNUB 1BCXA 5TSWA 1J1LA 1COV1 1E57A 1CAWB 2VMHA 4YW1A 4O9EA 1UKGA 3IPVB 3OY8A 3SLIA 3H0OA 1LEDA 2E63A 4B3NA 5GALA 1ZBE3 2RS32 4OULA 3HT2A 1W6QA 3G6JB 3V0BB 1QHDA 2R0FA 1U5YA 3KGLA 5KWRA 2E53A 1AHSA 3MW4A 4DOUA 5CNAA 3FLTA 1QJU3 4M3CE 4BPZA 1DQ5A 1MS1A 2RS52 5DDJ2 3TAYA 3NJZA 4YYOA 5LRSA 4V1PA 4RA0A 3O0XA 4C0HA 5JSOA 3TWIA 2BFUS 4EWEA 4OHWA 1YI7A 1F31A 4IV1B 2FMDA 1MZEA 1LGCA 2WNEA 1QJZA 4URTA 1VRH3 3R0RA 1U0AA 2D6OX 3M7AA 1WLTA 4J1WA 4OI0A 2W0XA 1WCKA 3SH5A 1H8TA 1VBD2 3AYEA 2ES3A 2LTNA 1QXJA 4FPYA 3USUA 4XZPA 1NYWA 2H0VA 1RUJ3 2CYFA 4Q4Y1 4UW6A 3FBYA 5K0UA 1PHMA 1X50A 4MXWB 2CY6A 3MGUA 3WDTA 1ZA4A 1QOTA 2HWE2 2A5ZA 4K40A 1S0JA 2XUMA 3EQEA 1XYPA 4YZ3A 2XVLA 3E5QA 3NL1A 3NV1A 1GNZA 4HN1A 2FMYA 2EAAA 2EXKA 4LNVA 1KD7A 3O7OA 1O5UA 3AFGA 4GULA 3WX5A 1J3QA 3THPA 4Q4X3 4IEYA 3WG2A 5I8TA 1FPN3 1EV12 4KWJA 4INDA 4COVA 2ZA9A 1RUC2 4W65A 1QOOA 2YPJA 1POV3 2WNVB 3UKVA 1VRH1 2IXHA 4Y4YA 2ZMNA 4HK9A 1G8WA 1G9FA 1HKDA 4AEMA 4FBFA 2MPFA 1V9U2 1B35C 1O4YA 3QH7A 5CFDB 3ME2A 1RUF2 1PVXA 2ERFA 3TN91 2ZKNA 4XBNA 5KHHA 4AVSA 1PGSA 4JV4A 4ES9A 5JOWA 1LU1A 1BEV3 1LGNA 3MW2A 1MS5A 4RGAA 2HWE3 4OHYA 4Q0VA 1NCQC 1HV0A 2JG8C 4IEOA 4XF0A 5KXBA 3AXEA 2JG8A 4WVZA 1VB4A 5BY5A 1QY4A 4XXAA 1OMIA 1DIWA 1JH5A 2O8QA 2PLV3 2WSVA 4K1ZA 4JCKA 4OVEA 1QH6A 4PLOA 4HKOA 1JHNA 2CV6A 3WLUA 4AQSA 5C9AB 3AP9A 4JDNA 1H1AA 1MZ6A 1UKRA 3RYRA 5FQ0A 1G9BA 3S0MA 1B35A 3PVBB 5FCCA 3OCPA 4RR3B 3VL9A 4QPIC 1CAVB 3A0KA 3VBFB 3FFZA 1QJY1 1H9PA 3ZN6B 2YGMA 3RJ2X 3U10A 5IK7A 3N35A 3QOPA 2V09A 1UD1A 1NQJA 5I0RA 4I02A 3ZIWA 1AXZA 3RPQA 1CGPA 2OUHA 1ZBA1 3UV9A 3ZSJA 4P9XA 1A8DA 1O5LA 4PBPA 2TUNA 4E27A 4RQPA 1O3TA 4JC1A 1CIWA 1SQ4A 4J6GA 3S7EA 1ENRA 5C8WA 3B9CA 4LLOA 3SHRA 4M0HA 2BEOA 4D7YA 4YW5A 4NPRA 3WOGA 3KZ4C 2BNOA 2JE7A 2QDRA 3ZYRA 3A4UA 1H8TB 3IMNA 1UZZA 4ISRA 1KS4A 4F7ZA 1N3QA 3VZNA 3ZFFA 2BW8A 4AHWA 1QNWA 2R063 2HEVF 2OVUA 1C5IA 4AWDA 2ZCWA 4CEWC 3ZN4A 1KFXL 1HRV1 3WG1A 1JW6A 1QJX3 2WLPA 1DGWX 3W58A 4IERA 4JRAA 1X8MA 4AHZA 4B7KA 2HWF3 2XKOA 3FLPA 1HQLA 1ZRCA 2YZ4A 3H1YA 4XJUA 4Q4V2 3ZPYA 1XQNA 2N7GA 1ZBA3 5KHIA 1G9CA 1AL22 4K6BA 1GLHA 5HXVA 2RS31 3R6SA 1R1A1 1BEV1 4NO4A 1H2LA 3WHTA 1AX1A 1MEC1 2ZGSA 3LCPA 3RMXA 2AUYA 1SFYA 1HQNA 1NXMA 1PVC1 4CDQA 3D0SA 2A71A 4S2FA 1AUYA 4BLIA 2DVDA 3MLLA 1C5HA 4B4QA 2WWSA 4ORFA 4D69A 1V6NA 3RI9A 2H6CA 3VV1A 4QHBA 4UW4A 1HRI1 4XQ4A 2NM1A 4XTMA 2R061 1LODA 1V6OA 5JCTA 4YVSA 1URXA 5CFCB 5ABJC 1FX5A 3AP7A 2GSYA 1AX2A 4FPGA 4QPIB 4BIFA 5JOZA 3AP6A 2DU1A 3HD8B 3ZSKA 5IK4A 1LCLA 4QGLA 1MS4A 5DZFA 4TYSA 5FFOC 5GLVA 2G9FA 1UU5A 3TBDA 4IV3C 4PLNA 4YVWA 3WY6A 1PIV1 2GN7A 1MVQA 1MVEA 1HRV2 1LHWA 2WFPA 1YJKA 1BJQA 3MW3A 4FTSA 5ABJA 1D4VB 2D93A 1YUDA 3VLBB 3MIDA 2UWAA 1VR3A 1AJOA 5BXXA 5D8AA 1C3HA 1VBA2 2WNUC 2EA7A 3TB0A 3E5XA 1RUE3 1RUOA 3MF6A 4DZGA 2D3PA 1TE1B 4RSUA 2HWF1 2XB6C 3ALQA 1CESA 1LOAA 4HZFA 4LTAA 5C9AC 3AJYA 4EV0A 1J3PA 1S55A 4LO4B 2XWBB 1PIV3 4CDWC 1VP6A 2IXKA 3FUQA 1H4HA 4KWLA 2YGLA 2WKKA 2P3IA 2R49A 1PVC3 4Q2FA 4W6YA 1UL9A 2GC1A 4NR1A 1A78A 4CDUB 4O9GA 2G9GA 5LRRA 2ZX0A 5T55A 3VDDB 4S2GA 3HQXA 5FLHA 2Z5WA 3JCIA 3WUCA 1RVF2 4BYYA 2ZX4A 1W2UA 4BMBA 3N7MA 4AHXA 4A7KA 3GHMA 4LLFA 3B7MA 2QQPA 4GKYA 3VBRA 4DY3A 1VRH2 4YM2A 4XFBA 1YFYA 2AH2A 4Q1RA 2XJSA 2JG9B 4XFAA 1MACA 1RUF1 1ALYA 1JXNA 2I2SA 3GZUC 1U5XA 3ACLA 3AMMA 1AYM3 3AK0A 2RS53 5T5LA 3R05A 2I45A 2GMPA 2VNOA 2BNMA 3N7KA 1QJX1 3E97A 2VXRA 1ND2A 5ACA1 3NAPC 2RS13 4AVBA 2BTVC 3KMHA 2OUJA 2ZTNA 1AJKA 1ULDA 2LM3A 4K9SA 2UY8A 3JD72 3OBTA 3WDWA 3MIFA 4BHPA 3OTFA 3KQRA 4H14A 5AC91 3MLJA 4Y5Z0 3HT1A 3MFCA 2A3XA 2IFRA 5FTTC 3WW3A 1REEA 3SNMA 2XBO3 1AL0G 3SCFA 5J3UA 5DUXA 2NYYA 1W6MA 2OYZA 4XMAA 1TME2 5E8AA 2BWAA 2WL1A 2K2SA 2PA7A 3ZDSA 1DGRA 1AL21 2HWD1 4PIXA 3AMQA 2F4PA 3EJKA 1QMJA 3JZVA 4QU2A 1NG0A 2K9ZA 2RS51 2DTWA 1Q8PA 5CG8A 4Y1XA 2ET7A 1NCRB 3RS6A 1MS9A 2IXJA 5ACA3 5I8SA 3BIWE 3DPRB 5BNNB 3IBMA 4RQPB 4XFFA 1H2MA 1NE6A 2UYAA 3N7JA 1ZBE1 4GMP0 2VMIA 2ZGLA 3VBSB 4OUSA 5GZCA 3VBOB 3B9IA 1A8MA 5I0SA 3VL8A 4COWA 1PGL1 4WVMB 4B29A 1LGBA 5J7MA 2ZHNA 4FT8A 1QOSA 1ZZ7A 3KD4A 4AFDA 3RRDA 3B93A 4LBKA 4N7IA 4ASMB 1DYKA 2AENA 1ND2B 1NCRA 3ZXAC 1RTVA 1BKZA 3P3PA 3ZSMA 4IEWA 2DURA 3KM5A 3WW2A 2DVAA 1LHVA 4LBMA 5D8AB 4XFIA 3MIHA 4EN6B 1V9U1 5J09A 3ES4A 1YFUA 1QF3A 2ZBJA 1DGLA 2WJSA 1GKBA 2D3SA 1CQ9A 2DCYA 1AYM1 1RINA 1X36A 3FUOA 3KSCA 5FOJB 3ZSLA 2PHWA 2GH2A 1D2SA 1S2BA 1VBE3 4IV3A 2P2KA 4I01A 4Y1ZA 4YVWB 4BIOA 1FXZA 2XLAA 1CAXB 4PDWC 5B2GB 4AE2A 5DDJ3 5BNQA 4XHXA 3UJQA 3DUIA 4R9CA 1ZZ9A 2WIIB 2DFCA 1AX0A 4FP2A 3SMHA 1BYHA 1W6OB 1YIPA 3BU7A 3DKWA 4S2DA 3ROUA 4MYEA 2NN8A 4AI3A 2GC2A 2XJTA 5T54A 5C6CA 1VBC3 4YVSC 4DPNA 3RQ0A 5FAXA 4MVTA 1EY2A 2YHJA 3VBHC 3GHNA 3PJYA 5FPXA 1VBA3 3HN1A 5A33A 4LO5B 2IXIA 1O7FA 2F6BA 4CZSA 3BTAA 1IOAA 1R091 2BVVA 5JSPA 4Q1PA 5EYXA 2ET1A 4RD7A 1PO23 1AR62 5IK5A 1YNAA 3PJQA 2YY1A 2MEV2 3WP5A 4P14A 4GB33 4E2QA 1HQWA 2OIIA 4ONUA 1OA4A 3M3CA 1C1FA 2P37A 2TBVA 2JXAA 4EN9B 1LOGA 3IDBB 4YLZA 2P17A 1Y9QA 2RM22 1W6OA 3QBQA 1RUI2 1DYPA 5DZEA