2WNUA

Complex between c1q globular heads and heparan sulfate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
133
structure length
133
Chain Sequence
b'QPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
molecule tags Immune system
total genus 25
structure length 133
sequence length 133
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnuA00
1XU2A 1U5YA 2Q8OA 1JH5A 4HT1T 1C28A 5CIRA 5L36A 2WNVA 1OQEA 1KXGA 2X29A 4E4DX 4QQ2A 1RJ7A 4TSVA 2WNUC 4TWTA 4KG8A 2JG9A 4QQPA 1KD7A 4GIQA 1S55A 1U5ZA 2WNUB 1GR3A 3QD6A 5KC5A 4QQOA 4KGGA 2R30A 1PK6A 2RE9A 3B93A 4KGQA 4OULA 4G3YC 2OIIA 4MSVA 4F3JA 1DG6A 4RSUA 4QQLA 1OQDA 4NN0A 4D7YA 2Z5WA 4MXWA 1U5XA 3FC0A 4QPYA 2JG9C 2TNFA 4QQHA 3L9JT 3QBQA 3MI8A 2ZPXA 2JG8C 3AB0A 2O0OA 1IQAA 1TNFA 3K51A 2JG9B 2JG8B 2RJLA 1WCKA 1DU3D 2RJKA 4OUMA 2R32A 4J6GA 4N90A 1PK6C 4E4SA 2WNVC 5L19A 2R6QA 4DOUA 2HEYF 1D2QA 1PK6B 1A8MA 1I9RA 3TYJA 1XU1A 5HBAA 2WNVB 3B94A 3LKJA 3K48A 1TNRA 3TWIA 3ALQA 5KWRA 3V56A 4MXVA 3IT8A 2AZ5A 4OUSA 1RJ8A 2E7AA 4MXWB 2KA3A 5BNQA 1C3HA 2ZJCA 4DB5A 1OSGA 2QDNA 2WNUA 4EN0A 5KC6A 1O91A 2HEVF 3URFA 2HEWF 1JTZX 2TUNA 4G4FA 2QE3A 1ALYA 2JG8A 3B9IA 5TSWA 1D0GA 1D4VB 3ME2A 3WD5A 2Q1MA
chains in the Genus database with same CATH superfamily
3N9NA 4QM9A 3ZX7A 4D94A 1K5MB 3N9OA 5IK8A 1KITA 3MO4A 1YHFA 4GXLA 5JIAA 3OF1A 4AHWA 1W3XA 3WCRA 1WMDA 1R1A1 2LW8A 2ZHKA 4L2NA 2OA2A 2JDHA 4BQWA 1EY2A 2JG9A 1NCQC 4JHTA 4CEWA 4D6QA 1J84A 1YNAA 2EAAA 3ILRA 4PBOA 3O0XA 1E5RA 1RXFA 5I0RA 3MUY1 4R9BA 1FNZA 3O12A 3AL5A 5FY5A 2PXJA 1AR91 1OOPC 3AZYA 2ZKLA 3RGBA 5IJRA 1YJLA 1VAMA 4Q4V2 3WNLA 4EN9B 4A6SA 4FP3A 2HWC3 3CQOA 4EN8B 2QQOA 4UFJA 1PK6A 5BNOB 4M00A 1REEA 2JB4A 4RFT0 3ZR6A 1W8TA 2RS51 2OW4A 2G9ZA 5APAA 3UJOA 1GWKA 3MICA 2PHUA 1OT5A 1UYYA 2CAUA 5L9BA 2ZAAA 3WDYA 4D7YA 3KF3A 4FCAA 1NE4A 2C26A 4LOSA 2YDEA 2YV8A 2WFF1 2BBAA 2JD9A 5JSPA 4Q26A 4Q4W2 1V70A 5IFTA 3MI8A 1GZTA 5F3CA 4C1XA 1NY72 2QQPA 1X82A 5I0DA 3WT3A 1G9CA 4HETA 2CU5A 1U5IA 2B42B 3MW4A 3T09A 3POGA 3FHQA 4JCKA 1NZIA 3DF0A 2QKDA 3ZYIB 4Y20B 5KHGA 1SQ4A 2LRPA 3POJA 4OUMA 3AFKA 5DAWA 4N9HA 2XJSA 3KHBA 2RMU2 3J8F1 4IEQA 1AJOA 1RUC1 1JZ7A 4C90A 4RA0A 1XRUA 4NO4A 5FYMA 4AE2A 1WLCA 3WCSA 1I5PA 1XNCA 1Q8QA 3BVCA 2WL1A 4YVSA 4OQ9A 3HBZA 3AP6A 2J1TA 1TMF3 2WZPP 1GWLA 1RVF2 4O65A 3CF6E 4CP9B 2QQNA 3GJAA 5A6XA 4IEVA 2VUJA 1POV1 4KU8A 4XC9A 4CEWB 1QJX2 1XYNA 4Q1PA 3WDUA 3TB0A 1T6GC 1H0BA 2CV6A 3LDRA 4UT5A 1AR82 2PN5A 3K3NA 1B35A 4QX3A 1GQHA 4IUGA 1YQ6A 4TXWA 3MBWA 3VB9A 2PMWB 2BGCA 3AMPA 1MZFA 3URFA 4UW4A 3ILFA 1QF3A 5FUPA 4LORA 4GB32 5C3OA 1JMUB 1ALYA 4UOJA 3ZYPA 1R083 3FHAA 4GULA 5LZ6A 4GA9A 3VDAA 2J1VA 2B9UA 4WM7A 1AXKA 5G04L 3U10A 4K1YA 3ZYGA 4DQAA 1BEV1 4IEYA 4AR2A 4XFFA 3RI9A 2GNTA 1IGOA 2XBO3 5FZ0A 4NIGA 2ZABA 3OBRA 4C0BA 4GMP1 1HV1A 2ZGTA 5LRRA 5BV6A 1Z78A 5C3PA 2RR11 2D5FA 4DXSA 2ZKNA 4P14A 3I54A 2XH6A 4J1WA 3LE0A 4LO7A 2BJSA 3BU0A 3R0RA 5DABA 1BZWA 2A3WA 1Q3EA 3SCHA 5AC92 2W0XA 1UU6A 4JZRA 5A32B 1POQA 3OGJA 1WW5A 3AVSA 3ST7A 1DYOA 1SFNA 1H2LA 4YW5A 5BNPA 2E63A 1JUHA 3MW3A 2VU9A 5F2SA 3GZTB 1V6OA 3PU3A 1W90A 1AYM1 1C1LA 4IQPA 3W58A 3UL2A 2ZXQA 1GZ9A 3EJKA 5C7GA 1W8WA 3MHZA 3UESA 3ZXFA 3RRDA 3TBDA 2PHFA 3T4VA 5FZ1A 2E32A 4ZU4A 3O1OA 2GZWA 1UOJA 3Q9OA 1ZRDA 2J42A 3TN92 3OB8A 3HN1A 2VBBA 3I59B 4HKOA 2HWC2 4LKSA 4B4RA 5A3TA 5JI9A 2VZTA 1F4AA 1MEC3 4XMIA 2IXCA 1FAYA 2MEV2 2QQIA 4NN0A 3U4XA 3BOPA 1Z0HA 3WOGA 1H9WA 1KFUL 2BP6A 2FDHA 1D4M2 1RUD3 2KD7A 3Q8CA 3FC0A 3GBFA 3J7LA 4K1ZA 5D1IA 1FPN1 1STMA 5T3NA 1DQ2A 3QBQA 2CYFA 2JG8C 5IK5A 1GICA 3CZJA 1JBCA 1KFXL 1V6IA 3KV5A 4A44A 5JMCA 1LHOA 3WDVA 1TNFA 3J26N 2VTFA 1SFPA 1QWRA 1MS9A 3HPNA 2WIIB 3U37A 3GBGA 1VE0A 1WCQA 2XWJB 4BXFA 4ZZ5A 5FXXA 1PO11 4JGYC 4WM7B 3VZJA 5A33A 3IDEA 3FBYA 1IQDC 5G05L 3PJQA 1J1TA 1R1A3 4WM8B 2B5HA 1DQ5A 2YBPA 2C9AA 3ETPA 1BVVA 2J22A 4ZY9A 1PMHX 4EN6B 3R4SA 4NE9A 2Y60A 3AKTA 4AI3A 2BUKA 1PNGA 1SPPB 3ZDVA 3P5BA 1ENSA 1S2EA 4FSJA 1AR93 1OFNA 2VZ1A 4LIUA 1I6XA 2GDFA 4GQ7A 3M2MA 1DZTA 4YNIA 2DDUA 3IBMA 4PDWC 5J96B 3E5XA 5CNAA 3VL8A 3E6BA 4OHYA 4R4XA 4A3ZA 2WR9A 2YC0A 3DPRC 5FWJA 3K77A 5KWRA 2XWBB 2OQ7A 1SLAA 4CSWA 5F8PA 4KWKA 1UF2C 3U14A 3GGLA 1WA6X 2RS53 3WW3A 2EALA 4DEQA 5LA0A 3X29B 3VKFC 2OT7A 3MLJA 1E5IA 4GKYA 4LLFA 4AQSA 1RGSA 5LA9A 3J7HA 2IXKA 2G19A 5C6CA 5KC6A 1NCQA 5GLZA 4X6RB 3D5OA 1AL0G 1GFF2 4G4FA 1G8WA 1O3TA 2BV4A 3PVNA 3B9IA 4GAZA 4WVWA 5ERLA 1Q43A 1QJU1 1OOPA 1ZZ8A 3GYDA 2LS6A 4PF5A 5HXVA 1W0NA 4S2GA 2R49A 2RJ2A 2Y26A 4OQ8A 1W6MA 3AJYA 4FQ4A 1JYNA 5IYYA 1XJAA 3PJYA 4D8MA 3J8F3 5CEHA 1RUC3 1H4GA 2VO5A 4BMEA 1HQLA 3KCYA 4NOTA 3AXDA 5FWEA 4OI0A 2LALA 3NQHA 5JVVA 1PIV2 2XL7A 4JDMA 1HW5A 4YM1A 4AVVA 2XL9A 4FTSA 2ZA9A 1IZ3A 3VD4A 4IV3B 5F6LB 4FAHA 3AYAA 3O1MA 1H8VA 3N9PA 1Q8OA 4B4PA 5A33B 3NWKA 3PTYA 5JPNB 3NMBA 1LHVA 4AFDA 1DLLA 1POV3 4AFAA 1E5HA 4B8EA 3QOPA 1YFUA 3ZXDA 1SLLA 2K46A 3JD71 3SKVA 4NIHA 4TLFA 4XF1A 4K40A 4XMAA 3WNMA 2R30A 3VLBB 4AVBA 3B5LB 2DTYA 1LCLA 2R072 2VMDA 4G3YC 4OULA 5C71A 4YARA 3NNMA 2PAEA 2XVKA 2I45A 3FE5A 3ZYBA 1UYXA 1UMIA 4ZZ8A 3WY6A 2LROA 1OD5A 4H2AA 1VBB1 4QQLA 4XURA 4XQWA 2JB8A 3ENRA 1Q8PA 2CL2A 3LIGA 1MEC2 3BTAA 1F2NA 4QXBA 1BEV3 1S0GA 3OBTA 1XPWA 3WDTA 1IHMA 2W52A 4HSLA 3POSA 1Z7S1 2C1FA 4NWWA 5CVRA 3USUA 2X10A 1FX5A 2IC1A 1RL3A 4GMP3 2UWCA 4EROA 1W99A 1HN0A 2RR13 2FCVA 5A7QA 1ZA4A 1UIJA 2WLPA 4W50A 4RYDA 1JW6A 4XF3A 2FDGA 3VBUC 5ABJC 2A6YA 5A3WA 3A0KA 2B39A 5A3OA 2VOVA 4JQTA 4QX2A 2HLEA 1R1A2 4M0HA 2VQ0A 4LTAA 4RQPC 1PGL1 1RUE1 1EAH1 1AYM3 4MV2A 4S2FA 2ZHMA 1W6MB 4A41A 5ACA2 3HAGA 1C5HA 3AKPA 2NMOA 1XU1A 1H2KA 3J7MA 1HDKA 2J7MA 2P2KA 3WINE 4HMZA 1COV1 4YGEA 4MYEA 2AR6A 4LKEA 3JBG1 5E1RA 3VBOB 4MVTA 4FPYA 4XJWA 3RZLA 1UKGA 1QU0A 5A3NA 5I8TA 1MQTB 5K9YA 1KQRA 5FZFA 1X9TA 3FFZA 3S6PA 4CU8A 5FK7A 4COYA 1F9KA 2GNMA 1C3HA 3N36A 5A7OA 1OSGA 2UY8A 1GUIA 1NXMA 2W47A 4XQ4A 3KB5A 4YM2A 3WF3A 4ASLA 3AKRA 4AI8A 3JZVA 3MF6A 2IXIA 1FPN3 1GQPA 4Y1UA 3UV9A 1YXWA 3OBZA 4CDQA 3C7EA 3N7KA 5FP4A 2EXJA 3RDIA 3WX5A 3WZ1A 1CJDA 1S4CA 2WS92 1CGPA 1RUI1 2Q1FA 4JGZA 5J3UA 3H7JA 4XPVA 4Y4RA 1ZRFA 1LESA 1K5MC 3ZYRA 2C0ZA 3MPBA 3BTXA 2WLQA 1PO13 1ULFA 3UETA 4XJ8A 3ZFFA 4IE6A 1SLIA 4LT5A 2PAMA 4Q4V1 1JH5A 3USUB 1YIPA 2BQPA 1GOGA 3VZMA 1DQ1A 1HB4A 1JU3A 4P9LA 4RFRB 4A4AA 2ERFA 4IERA 4LBQD 4XZPA 1LOBA 4RS5B 1WBLA 3E1F1 4HANA 1J3PA 1GNZA 2YBKA 1MVEA 3QLQA 4XFCA 4FFGA 1IPKA 4I2OA 2UY9A 3T3YA 1AXZA 1S55A 1NUKA 4YZ4A 5FYSA 1FMD2 1Y43B 4CCLA 3RG0A 1TQ5A 4FVVA 4MX3A 3VGIA 1DFQA 2H0VA 2WT0A 4XJZA 1NY71 4XETA 4AFCA 1IPJA 1C57A 5BNOC 1IG0A 3V0BA 4N53B 3T2TA 1IS4A 1KJRA 5T55A 4XQDA 5F3GA 3ZMOA 4GH4A 1KS4A 4MHRA 3I3BA 3NNFA 4HK9A 1SLCA 2WZ8A 4V2VA 2WKKA 2NQYA 3OUIA 2RMU1 1QJU3 1GU3A 4P9WA 4PDWA 1ULEA 4MXWA 1QDCA 2KR2A 3S30A 3PUQA 5IVJA 1UY4A 1V6MA 4Z92B 3V65A 2QZ3A 1IS6A 1R092 2A6VA 2VCBA 5FQ0A 2JIGA 3N7JA 1DIWA 3W59A 1I3HA 4AVAA 4S2DA 5FY8A 1O8SA 3C7GA 4MGSA 5KXDA 4BISA 5C3SA 4BQYA 1RVF1 1US3A 4NAMA 1GNYA 4CDQB 3SH5A 1VB4A 2RR12 2BGOA 2XJUA 3NAPA 4Y24A 5B4NA 5CISA 2ETEA 3POWA 1QJX1 1BJQA 1BBT2 4JGZB 4QDRA 1LOCA 2TBVA 2ZMKA 5CG8A 1AR81 3OG2A 4YLZA 3WP5A 5EV7A 3EMRA 2WDBA 3BALA 5DUVA 4AI0A 1W9SA 2MPFA 2NM1A 5FZLA 3S0MA 3KM5A 2R6QA 1OLMA 3BGAA 1CIYA 1HXS2 3ZFFB 4BB3A 4HVQA 5CBLA 2IXJA 1LB2A 4ZS3A 4GB31 2DVFA 1I9RA 4P00B 1VAKA 5LK7B 4LBMA 4CTEA 1SMVA 2O14A 2YFUA 3JD73 4XXPA 4CEWC 3G6JB 1HRI1 3B94A 4XHXA 3FUOA 2W3JA 4COZA 2YXSA 2DTWA 3J4UH 4A6OA 5FRAA 1MZ5A 2P1BA 4HN1A 3KVBA 2BBVA 1Q8VA 2P34A 2KA3A 2Y6JA 1X8MA 5D2AA 1QJEA 2CSGA 3HQRA 1UO9A 1ACCA 5GZCA 1W28A 4DS0A 1VBB3 4L8QA 4XBLA 4EN0A 3KGLA 2VXRA 4IDZA 5GJ6A 4LITA 1NZCA 1Z7S3 1ST8A 3A4UA 4FT8A 3WHTA 5AC91 2QE3A 2P3IA 2OKXA 2PHTA 2JDAA 1W0OA 5JMOA 5FYIA 4OI1A 3FWEA 2WFPA 1QDOA 1OH3A 4CA9A 4C1WA 3I2KA 5TSWA 3CLPA 4XF4A 3WEZA 3T0BA 4AYUA 3N9LA 3OUJA 2YUEA 3AM2A 4GWIA 3T1MA 4N8MA 4Y5SA 2Q1MA 1L3JA 5J37A 1W6NB 2Z2SB 2ZHNA 4I01A 1PO12 5FBJA 1U5YA 4FXKB 3KWVA 2WUHA 4HT1T 4Y33A 1XNKA 3MEPA 3TN91 4LOTA 4AAXA 3ZKYA 1K45A 1RUE3 1W9YA 1EAH3 1QOOA 3ITQA 5FZIA 4E4DX 1HB2A 3T0AA 3VHNA 4B1MA 5HPOA 2CTVA 2BNOA 2D44A 4B29A 1JYVA 1VBC1 2ZX0A 4KBZA 4CU6A 4HOOA 1P8JA 2MEV1 2VZPA 1APNA 5T54A 1COV3 2DFCA 3NAPB 4ATEA 5KHKA 3O1TA 1QJY2 3N3HA 4XUOA 5KXCA 1D4M1 3JBG3 3V64A 4NHLA 2OPKA 1J58A 3HMYA 2QTWB 4YZ3A 5FR3A 4FOWA 3A23A 4ET7A 1JYIA 2R062 1DLCA 5FXVA 2Z42A 3KCCA 5ABJA 1DBNA 4RL7A 5J1XA 4DFSA 1WZXA 4FPFA 4FPOB 3GJBA 4B7EA 3ES4A 4RSUA 2EXIA 1WD3A 1QH7A 1V9U3 4YWAA 4D7TA 1XE8A 1MS0A 3TNQA 2Q0AA 1RUI3 1T6BX 2NLRA 2X8KA 3IDAA 5BNNB 2VGDA 2G9GA 4I30A 4EYUA 2TNFA 4LHNA 4OHXA 1EP0A 2RHPA 1ZZCA 3HOBA 2CAVA 4XDOA 3ZFGB 2DVBA 3AP7A 3ZSEA 5JXIA 2AGSA 2ID4A 4WM7C 1FXZA 4LQRA 4HLTA 3RZHA 3OBAA 1YC61 2XGXA 2WQZC 4Q4V3 4BJ0A 2WNOA 4WM8C 2HYKA 3LA7A 3RS6A 4OI4A 4FPJA 3U11A 4AQTA 4EZ4A 4K3UA 3FLTA 2VZ3A 5K7PA 2VMCA 3PL0A 4C91A 2RS33 2VCAA 4XE9A 3ROUA 2OYZA 1ND3B 4AAPA 4FPHA 1LHNA 5IK4A 4L11A 4AHZA 1O3RA 4XF9A 3WP3A 3LA3A 5LA2A 3Q8BA 1GMMA 4D7SA 4UYBA 5HV4A 1OLRA 3IZOA 2D40A 1OUXA 3W5MA 3T1LA 1OF3A 1K5MA 2V73A 2JENA 4MGYE 1H8TB 2VG9A 1ODNA 2OUHA 2VUCA 4RN5A 4L9BA 3AFGA 3HIFA 1YRZA 4GWNA 5DZFA 1MS5A 1TNRA 3JD72 4QB2A 4DXRA 4NHXA 4LMFA 5LEKA 3IT8A 1OURA 1XNTA 2WO2A 3BI3A 4CDWB 4JQRA 5FO8B 4CDXB 1W6QB 4H14A 5KHJA 5BUVA 3VBRB 2PAKA 1Y4WA 2HWF1 5C33A 2PFWA 2RMU3 3EHKA 4M3CB 5F5QA 2QJVA 4LE3A 4IEZA 4UW3A 3VHPA 3BKZA 4QHOA 3GHNA 4CCOA 1PIV1 2W46A 4RGKA 3HD8B 4AEDB 1Z7S2 2WO1A 3T08A 4ZS2A 1CONA 3N35A 4PLNA 4CCKA 2DCJA 3VBSB 2YYOA 4AHXA 4FAGA 1RVF3 4F83A 3AMMA 3NV4A 5EIYB 5HCFA 1XSRA 5L73A 4BIOA 4JDNA 1QJX3 4ISRA 1V6NA 5I8SA 3HQXA 1GOFA 1VB2A 1U12A 3W21A 1AR83 1RUG2 2Q8OA 2BRTA 1UU4A 1C28A 2CGNA 2XDVA 5CIRA 3A7QA 4Q5OA 2BWAA 2WO3A 1DGWX 4NVPA 5FREA 1ENQA 1O6UA 2R071 2BYVE 2RDQA 4YG3A 3UNPA 2PQQA 1JOBA 3WNKA 4GB33 1L7QA 3D0JA 2CY6A 2D6LX 3BN6A 4YZ2A 4KG8A 1UYPA 2CGOA 3RYPA 1HRI3 2VMEA 1ODMA 4SLIA 4Y20A 1COV2 4FOYA 1LTEA 1VPHA 2WNUB 3U07A 3FUQA 1O4ZA 3LPFA 1GR3A 3JBG2 3HT1A 5B4XA 3OGGA 4IEUA 2DVDA 2W1QA 3K4AA 5KC5A 2JEMA 1ZBE2 2XB6C 2Z69A 3JUUA 1H1MA 1H2NA 1AX1A 2VZOA 3CMGA 3MIBA 3QACA 3CO2A 1PX4A 4ZXKA 4IESA 4FPLA 2F6BA 2JKXA 3WNOA 5FZOA 4COUA 1REDA 1SFYA 4Q4X2 4UFMA 5AC93 5EZWA 1CAXB 2UWAA 1RIRA 3SQOA 4SBVA 5D8AB 5F1RA 3KV6A 4CP9A 3GDBA 1V9U2 4WVZA 1J59A 1RUI2 1BLZA 4A3XA 3DXUA 3SMHA 5FP7A 1RTVA 3KV9A 4JRLA 4LHKA 4MGZE 3RZZA 3VZKA 3WXPA 2ZPXA 4XUTA 1F5JA 3OOXA 3VUOA 4AZZA 4I09A 4LBQB 1MS8A 4LUKA 2GAUA 3KLSA 2ZEYA 4OMCA 4YFZA 5FZ7A 4CCNA 3TN93 3O1PA 1WMEA 1N3QA 2FCTA 1DU3D 2KM2A 3O1RA 2RJKA 3GXUA 4KMQA 4YW7A 5T5OA 4CE8A 1XC6A 5L7OB 1VBC3 1OA4A 3NJYA 2MEV3 2ORZA 2RS32 5FYVA 5I8YA 1YEWA 4NIIA 1Y3TA 1MS4A 1G7YA 1XE0A 1D4M3 2XUEA 2ZTNA 4YG6A 4DOUA 4CUCA 2R1BA 2HEYF 5BY5A 3VBOC 3ZN4A 3NW4A 3TYJA 4Z2AA 5HBAA 4B4QA 2JDPA 1MQTC 5FTTC 2WS91 3N9QA 5FMOS 4NRPA 3TEXA 4PI0A 3TEYA 5J36A 4OHVA 2BU9A 1JOPA 2NZ9A 4AI2A 2W2IA 3FL7A 3V56A 3WP4A 3PUHA 4FFFA 2VQAA 5FMBA 3WHUA 1ZBA3 5A32A 5FOJB 5JOYA 5FYBA 3OYWA 3KGZA 4LNVA 5ACA1 2A71A 1W03A 4BQ4A 1UKRA 2ZACA 3LEIA 3RPQA 4FOVA 4OZXA 4W6YA 4QKDA 5LBEA 2E51A 2JDUA 4ZU7A 2Z4FA 3APBA 5FZCA 5FY9A 4B3NA 1B09A 4NJ4A 2IVIB 3B3QE 1G9AA 3BUCA 2W5FA 3LEMA 2WSUA 2TUNA 1GZWB 4W4ZA 4AG4A 3NRUA 2HWB2 3I2IA 1W9WA 2ZOEB 1CX4A 4AL9A 1WW6A 3I3MA 3I59A 2RDRA 1PVC1 2WN2A 5FZOB 5CFCB 3GHMA 4PQQA 1FMD1 1LOFC 2IVJA 4AI9A 1YO8A 2O1QA 2A75A 4OVEA 1X9PA 3IMNA 1VR3A 3NV1A 4NIAA 4RS5C 2EIGA 3LSEA 5DG2A 3FZ3A 3PU8A 2N7GA 3I2JA 3ES1A 4TYSA 2ZZQA 2A70A 5T5JA 1YFYA 3DKQA 3THTA 2YBSA 1VBA1 3LQCA 2ENRA 4H7MA 4BQ3A 1SACA 2V4AA 3AZWA 4Q0PA 4FFHA 3VDCA 3WF2A 4OLLA 3ACFA 1NE6A 4IL7A 2YHJA 2DVGA 3OY8A 1LU2A 4BWOA 1U0AA 3PMEA 5JOWA 1HRI2 4ZONA 5CFDB 2E53A 4WM8A 4IV1B 5FCCA 5JI7A 2YMZA 1SBDA 1HLCA 1R091 2R042 2BTVC 3I3QA 3RZGA 3VZNA 5GZEA 2FQPA 2ZAHA 4F7ZA 3CIHA 2W1UA 3EXUA 1OD3A 3GZAA 3JXSA 2IUWA 4BK4A 2HWF3 4MGQA 1VRBA 1FV3A 2IZWA 3ZPOA 2EA7A 4K6BA 4CP2A 1JZ5A 1SPPA 2DURA 3LGRA 1GLHA 1DG6A 4MUVA 1CR7A 1PIV3 1BBT1 3I3DA 1UZZA 3POYA 2C9KA 3D4KA 1ZREA 1EV12 2XHNA 3IPVB 1FOD2 5JUVA 2UYAA 3OYWB 5F3IA 3H1YA 5DAQA 2XXZA 5IVVA 1U5XA 1HXS1 5CADA 2WYFA 4XW3A 4CDQC 3DL3A 5IVCA 5D21A 1VBE2 3AB0A 4IETA 4JGZC 4YM0A 5JOXA 2VECA 4NHMA 1G9DA 5A1AA 2HYXA 3Q8AA 2MNGA 1XQNA 3THCA 1WCKA 1CWPA 2R073 1AZDA 3QCWA 3W9AA 4YZ1A 4LR4A 2A7AA 3ZFFC 5EJ1B 2A1XA 2GMMA 2VH9A 1PVXA 3KV4A 3C7HA 2BFUS 4QGNA 4WVMB 5DN2A 1W0PA 3MV11 1VBC2 4AVCA 4E8CA 2DUPA 5FO7B 3M3EA 3U75A 1GOHA 3MDPA 1D2QA 4IXLA 4E9KA 3JQWA 5JOZA 2D3RA 1S0JA 1TE1B 1TEIA 2BZDA 2JE9A 3AC0A 4CXYA 1M06G 1WGPA 2PHRA 3ALQA 1IS5A 4CZSA 1POV0 1S2KA 4Y22A 3WG3A 4XTMA 2HJIA 2ZMNA 1A3KA 1NCRB 1W2UA 4IV3A 5EWSA 1SDWA 1WUVA 1ZBA2 3GBWA 3OY8B 3PURA 3CL1A 5LASA 5LBFA 2HBTA 5GZFA 1ZZBA 4QDSA 4BLJA 1GV9A 5FUIA 2ZEXA 4GH4C 3A0NA 4R9DA 3USSA 4BLIA 5ACA3 3MGUA 4XABA 3OPWA 2Y33A 5H9SA 2QQVA 3LD8A 3RJ2X 4S2HA 4PBPA 4G9SB 1QJY1 3H1MA 4YGBA 5FY1A 5A6YA 2WNEA 4N43A 4BYYA 3ACLA 4GMP0 5E89A 4D3WA 3VKMA 1CAWB 1XU2A 5JR7B 5C70A 2R0HA 4P02B 5FYYA 1R1ZA 3Q8FA 2R061 2QQLA 3M3CA 1GKBA 2HWD2 2QQUA 3HR9A 2Q8DA 3S7EA 3A22A 5L36A 2I2SA 3IDBB 3NAPC 1FI2A 2D43A 3B69A 1CAUB 2RVAA 3M3QA 3MIFA 5FMDA 2ZX4A 5DUXA 1V6KA 2D6PA 2R16A 4QPIB 4Q29A 2WS93 5A80A 3POEA 3IAPA 2GMPA 5FMOL 1Q56A 2VTXA 1AYN3 2F4LA 3ZXAC 3DXTA 3INAA 2YC4A 4LBNA 4P5HA 5A7WB 2QFEA 4Z1VA 4FFIA 3SH3A 2Q5TA 4QQOA 4L0PA 3U0ZA 4RD7A 1AL21 4NIDA 1CZTA 2Y6LA 3OGRA 3AKQA 1GNHA 5L9VA 1Y9QA 3KD4A 1IS3A 3RNSA 3RMYA 1TME2 1LR5A 1US2A 2HWF2 2OS2A 3B93A 4A7YA 4BIFA 2FDFA 3N7MA 1GBGA 2ADEA 4LK7A 3IWZA 3MIDA 5F39A 5FZKA 2GU9A 1BHGA 4FP2A 2YU2A 1DCSA 4Y22B 1PZ7A 3VBOA 2Z5WA 3ZFGC 3GALA 4Z2WA 2V72A 1QY4A 3S5QA 1KS5A 2BOJA 1MQTA 1PVC3 4UAPA 1AR73 1K5JA 1CVNA 2NMNA 3LEKA 1FMD3 4QQHA 3KHCA 2VULA 4HG6B 1RHI1 4UFIA 5J98B 4YPJA 3OEAA 4KL1A 4HKLA 3I2DA 1UMZA 3SC7X 3E5UA 4MHUA 5FPLA 1ND3C 4OYUA 5FV3A 3OGSA 4Y26A 4AXOA 2ZZJA 1ONAA 2G1MA 4MH0E 4XUPA 4O9EA 2CHHA 4YZ5A 1LEDA 1GP4A 1O59A 1ULCA 3AZXA 2IWGB 1ZYBA 5C5UA 1VBA3 4EJRA 4CPBD 1CIWA 2PLV2 5JXJA 4N43B 2VBPA 1W8ZA 3UT0A 1H8TC 2AH2A 4QKNA 4R9CA 1WMFA 3I3EA 4BH9A 4QXKA 2VQUA 1SG3A 3ZSMA 3B00A 1AF9A 3GM8A 5FDBA 1O3SA 3DUIA 2EIEA 4CXWA 4F8AA 1R093 3UK9A 2F4PA 4CDWC 1BK0A 1LOFA 1LNSA 1NQDA 4URAA 3T30A 3NVCA 3U4SA 2VAUA 4CDXC 2PELA 4LHSA 1XNDA 3SITA 4FOQA 3ZN5A 3WW2A 1O4TA 4YYOA 1N1TA 1JZ2A 2YY1A 5FOBB 4MXVA 4RS5A 1DQ4A 2WQ8A 3VDDB 2WABA 3M8LA 2XJQA 4LBOA 2D93A 1BBT3 1YJKA 1UY1A 3M70A 5GLVA 1BK1A 4AEKA 1RUG1 2Y0IA 2QQJA 1FATA 4HFSA 2VMGA 3LIHA 1QJFA 1NKGA 2ZGMA 3EBRA 1S0IA 5FY4A 3NV3A 2ZGLA 1O91A 1JZ4A 1IKQA 1HXS3 3VBSC 1S0EA 2B9VA 3KT1A 2ZX1A 1NQJA 4OHWA 4CCEA 2BDRA 5JLVA 1S1AA 3ZO0B 4MG2A 3VKLA 3DGTA 4N53A 3H50A 4E8DA 4JRAA 1C8M1 1VP6A 3D3AA 3LWCA 2IXHA 2W9XA 1W2OA 4DXZA 1QH6A 3CJXA 4BK5A 1D0GA 4BDVB 4META 3D8CA 3ME2A 4WBBA 4XAEA 2P3YA 3O5SA 4AVTA 4DNYA 1ZBE1 2LM3A 2VOKA 4FPEA 5GALA 1OPMA 1PGSA 2XKOA 5F32A 3UGGA 2WO7A 1ENXA 5EYXA 2E6VA 4JDOA 1OQEA 2BFUL 3B9CA 1UZVA 3DYMA 5HV0A 4XUNA 1IKPA 2H6CA 4XJUA 4EWDA 1JODA 2C5DA 2WNUC 4Q4X1 1UIKA 4D6SA 1LOAA 2IFWA 5FZHA 4LJHA 3R05A 5B2GB 5C3QA 1MACA 1PZ8A 1KD7A 1W9TA 1V9U1 1QOTA 1LAJA 3AL6A 1YUDA 3FMGA 1T2XA 1HB3A 1MPXA 5GKAC 4Q27A 1ZRCA 2D7FA 1AYN2 3WDWA 1UWWA 3QH6A 1UZ0A 4EV0A 3ACIA 2OZ6A 2WYSA 5T52A 5M0TA 4Z82A 1ASJ2 2Q1ZB 4AQ2A 5CKNA 3O1SA 5GLTA 5D8AC 5A70A 2B7YA 1RUH2 4XDQA 3AMQA 2XJPA 4MSVA 1WCSA 1KJLA 5GLWA 3AYCA 1BYHA 5IVYA 1F15A 2RS31 1YQ8A 4GJZA 3C2UA 2GP3A 4PT6A 1XB9A 1QJY3 4KWUA 3TNPB 1X7NA 4BE3A 4XHBA 4AFBA 2NYYA 1PVC2 4IGPA 1AR72 4XIKA 3T2OA 5IVFA 2Q4SA 2OUJA 5C9AA 1PGW1 2ARBA 4AQ6A 3FJSA 5L7OC 3CEWA 4DUXA 1N47A 4HK8A 1S0CA 2R063 3HBKA 4E2SA 4Q2FA 5DAPA 3AZZA 5FJKA 4QGMA 3VZOA 5DXDA 2Q8CA 2DWRA 1NLQA 2DF7A 5IFPA 2R32A 1REFA 4CXXA 1XBFA 2BOIA 2MHFA 3UKNA 2EXKA 5E88A 1VBA2 1F5FA 1Y7BA 2UU8A 4DUVA 2VVDA 4X6QB 1W6NA 2Q8EA 1N1SA 3POIA 2ZGOA 3O1VA 2HWB1 4QHZA 4Y1YA 3PHMA 4RR3A 1AL23 3VN4A 3ZXLA 1WMXA 2FD8A 1VLNA 4I3PA 1LGBA 1GZCA 2ZX2A 5IT6A 2Y64A 3SXWA 3PUAA 5K0UA 5J09A 3KVAA 2XJRA 1OI6A 2RS11 1UYZA 2JDKA 4YW3A 1ZRRA 1XSQA 3AMNA 4K8FA 2VCMA 1OLQA 1LU1A 1WLTA 3K4ZA 4UFLA 4IEXA 3SH4A 3ZXEA 4RGAA 4MZUA 1DQ6A 2P4EA 2YC2A 3B01A 4GD4A 4MOAA 4E4HA 5KXEA 1ZRIA 2D3SA 1DGRA 1KDKA 2HEWF 4PIYA 5CFCC 1NT0A 1YYNA 3RWKX 1JZ8A 3NKGA 1RHI3 4OMDA 2KXLA 5FXWA 2FMDA 2YU1A 4CUGA 2X5IB 4NRQA 4XFHA 4WV8A 3SEEA 4DRVA 4EWEA 1EYBA 1OLME 1BVP1 5JIUA 2JE8A 1NG0A 2R041 2EXHA 2DUQA 2W1SA 4CCMA 1JYWA 5BNNA 2OQ6A 2ZHLA 2ADDA 1JUIA 2GALA 3JB8A 4PJYA 2VNVA 3I7DA 1KXGA 3R4UA 5T5LA 5FZEA 5C9AB 4QX1A 4CCCA 1JS9A 3ZFGA 1SCSA 1RJ7A 1OUSA 3SISA 2Y0OA 4UW6A 1OHFA 3E5QA 3NNGA 4H55A 5AVAA 5LBCA 3ZXKA 3BTYA 4QQPA 4IV1C 1EV11 3ACHA 1FOD1 3LFIA 4I3GA 1SBEA 2GP5A 4DMIA 4AHYA 5FP8A 4L97A 2D6KA 1GP5A 1PMJX 2PHXA 3TOJA 1DF0A 2J1UA 5HCAA 1ND3A 3QD6A 3DEMA 3MW2A 3VHOA 1VBE1 1OA2A 1RUG3 2JDYA 3IN9A 2FCUA 2A6WA 4OUEA 3CKHA 4COVA 2YB7A 2XJTA 2OIIA 5FPVA 4F3JA 4RR3B 1H8TA 1V6LA 4CPBA 2W08A 3JB4C 1JZ6A 2FZ2A 3WUDA 1AX0A 5FUNA 4A7ZA 4LA3A 2ARCA 4PQ9A 2VMHA 4EQVA 3ZFEA 1WCUA 4CRQA 5K0UB 5EYYA 3LFMA 3IMMA 1C8M3 3SLIA 2XVLA 4XEZA 4PCRA 1C8NA 3VBHB 1UY0A 1NA1B 3QH7A 4HL0A 4CDWA 1RUJ1 1F8VA 4CDXA 2XG3A 1W6QA 3AZVA 3S5AA 2GC0A 1HIXA 2WINB 4PLOA 5E16A 1WA4A 2BEOA 3VBRA 4CCJA 1RUOA 2ZGQA 2XVGA 3WNPA 1O8PA 2O0OA 1SCRA 1ZBE3 3G7DA 4M3CA 4BPZA 5KHIA 2AENA 1QHDA 2B46X 1FV2A 1CJPA 5FO9B 1UXZA 2QBXA 4M3CE 4GJYA 4AEDA 1LULA 1AHSA 3VL9A 2PHLA 1ZBA1 2XUMA 4Q4X3 4QMAA 1WW7A 5F6KA 3SHRA 4BHPA 3K4DA 3VBSA 5KBFA 2J1RA 4E4SA 4BZ4A 5F5AA 5A3MA 2W92A 1OA3A 2V5DA 3NSTA 3D6EA 3ZYHA 4HXCA 3BTZA 1LENA 3K3OA 4LEJA 2E9QA 2OPWA 3H8RA 1KDMA 5C4WB 1ENRA 5IUQA 4UF0B 2ET7A 1F31A 4K21A 3MLLA 2EAKA 1LGCA 4WVVA 4LIVA 1AL22 4Y1VA 3GCWA 5DMYA 2D6MA 4TTGA 3WG2A 2WA3A 5CG9A 2X53S 1UCXA 1RMU2 1YI9A 2FDJA 5CKQA 2L9LA 3BODA 4DB5A 1RB8G 5A7SA 2HWD1 5EJ3A 2WNUA 5JXGA 1XNBA 1H9PA 3TEZA 4M0NA 1DGLA 2VPVA 2VZSA 4W6WA 4OCTA 1DGRN 2VR4A 4ES8A 2HKXA 3NKTA 5IVEA 2EIBA 1ULPA 2SBAA 1LEMA 4U2AA 4A2UA 2FDKA 1BKZA 3H3UA 5IAXA 4IEPA 1RHI2 4XIOA 3IKWA 2HWE2 2VNRA 5FLHA 5C5TA 1JYTA 4ZHNA 1IPSA 3NJZA 1QGLA 3BPSA 3ZFEB 1CAXA 2YFZA 4N7UA 5D8AA 3UJQA 2YPJA 1VMJA 4ASMB 4BCUA 2H0BA 1SEFA 3IM0A 4MLOA 1UAIA 4QXHA 3WDXA 2WNVA 5DUWA 3H8OA 4QPIC 3E6CC 1D0HA 1TME1 5FYZA 3DYPA 4QQ2A 1UXXX 4CP0A 3ZIXA 2QQKA 1MZEA 1LECA 4E2QA 5I91A 1MS1A 1ND2A 3OSDA 4LBQA 5A1FA 1QIQA 4TWTA 5DZEA 2HWB3 2EF6A 3GNEA 4Q0QA 4OI2A 5A6QA 3RI8A 5FZ6A 2EIDA 5FPZA 4QWNA 3UGFA 3CNAA 1YIFA 4ARYA 5L7OA 4W6XA 4B1LA 2R0FA 3IIIA 2QQWA 5DDJ2 2DCZA 2RS13 2R7EB 1RUF1 5LBBA 1NAEA 1RXGA 3F2ZA 3LF7A 1GSLA 1UOBA 4HBNA 1N3PA 4PF1A 4QB1A 1JZ3A 4QHBA 4QKFA 5CB7A 4L92A 3AXEA 4GWMA 4KGQA 2B4KA 3T2PA 4IV3C 1E5SA 2D5HA 3NNJA 3CJIA 2A5ZA 2X09A 1FNYA 1YQCA 2PLV1 4IGOA 1E57A 3AKSA 1PM7A 1VALA 2FZ1A 1Y9GA 3OEBA 1IOAA 3UKVA 3VBUB 4C0HA 4N9IA 3N7LA 3NL1A 5FYHA 1HRV2 3HT2A 4C8DA 1C8M2 4IW3A 2W87A 1J1LA 3L9JT 3C8XA 1OQ1A 1G6NA 2R043 3O1UA 3RYRA 4XFBA 2XKPA 1BMV2 4B7KA 4N43C 4BQ1A 2XLGA 2XLFA 3BPZA 1GZWA 1LHUA 4FO9A 3UKTA 1JYCA 4LLOA 2UYBA 3CDZB 2P3JA 4NRMA 2JIJA 3CHXA 4Q4Y2 2JECA 3AX4A 2QNKA 3WQBA 3ZXGA 4LO5B 1OPOA 3V0AB 3FLRA 5HCBA 1EV13 5CFCA 1FOD3 3H8UA 4LBJA 2GC3A 3KT7A 4YGDA 2HBUA 2Z79A 1A8MA 2AACA 5E6HA 2WNVB 2W1WA 4IEWA 3I49A 1NYWA 3VDDC 1VBE3 2XONA 4A7KA 3MYXA 2TEPA 5EP9A 3K48A 3PIJA 4LBKA 4PI2A 2QZ2A 2Y6FA 2BWCA 4A42A 3NJVA 5C8CB 1ND2B 4HVOA 3ZIWA 2WQ4A 2AZ5A 3ZDSA 1CAVB 2VVFA 2XPJA 3SCFA 1W8UA 5JCTA 3RSJA 2RG4A 2VNOA 3H42B 2CDOA 4AW7A 4DY5A 3AP4A 1VJ2A 2C24A 2WZR2 2WN3A 2QDNA 4P9YA 2GSYA 5CFDA 1QNWA 2VJXA 1W39A 2RV9A 3OPTA 4IV1A 5LB6A 1RUJ3 2VW0A 5FJHA 4RHV2 4NHKA 1GANA 1QQP2 2BGPA 1HX6A 1MS3A 4JTOA 3ZM8A 1OC1A 4O61A 1JN2P 4XAAA 5FYCA 1A6CA 4CEYB 1PGW2 5LCWL 3CJIB 1HV0A 2SLIA 1UY2A 1DGWA 1AYN1 2HH9A 3WD5A 4YG0A 5HI0A 3IPVA 4YFWA 2OZJA 3J7NA 2FHRA 5F5IA 5IAVA 4FTEA 4FTBA 4L99A 5EQUA 1ASJ1 4CDUB 2YGLA 1HQWA 3HEIA 2JDZA 4QKBA 1DDLA 2J1AA 1RUH1 2JXAA 5SV8A 3ZSLA 5AFEA 3K75B 4YGCA 2RM22 5GZDA 3PVBB 1AJKA 2ZGNA 4QPWA 3AMHA 1QKQA 5AFBA 4KG0A 1MR5A 4QX7A 4DY3A 4Y4YA 3WQ7A 4EN7B 5JZGA 2PQSA 4HONA 3OTFA 3WG1A 3WV6A 4CUBA 2VE1A 1AR71 1UW8A 2IFRA 3WW1A 4CU9A 4QU1A 4WVMA 1W6PB 4P9GA 4YW2A 1BXHA 2XHKA 4YVWA 2RS12 1CQ9A 2XJVA 3IIAA 3VKNA 2HWD3 3M1HA 4OFGA 3VV1A 4QPGB 3ZKUA 4D0QA 4Q8LA 4HVRA 1N1YA 2P37A 1PO22 5CKMA 2ILMA 5A3PA 4K7JA 1J83A 2CWSA 3AK0A 2JD4A 4XOGA 5C3RA 1UD1A 4KWLA 4Q0SA 3WVJA 2Y34A 3S7IA 3SKJE 1O3QA 3ZYFA 2DBNA 3H8XA 4N7IA 4KWJA 1LRHA 1NCRA 2ARAA 4AFMA 1YQ2A 1BCXA 3WG4A 2DCKA 4ARXA 1YFXA 4NR1A 3FLPA 4X8NA 4XFGA 2ZCWA 4N53C 3VBFA 4YSFA 1O5LA 4QX8A 2JG9B 1GP6A 3HWJA 5EJZB 3LDBA 1SZBA 4I0AA 5FMCA 5LY1A 1TME3 1UY3A 3FFQA 2VD7A 4XXAA 3HJRA 5JWPA 4LUMA 1YI7A 4N90A 4ZXEA 1LOEA 4BQ2A 2VC9A 3ZMNA 1NLSA 2DCTA 5DG1A 2AEZA 4BA6A 5L19A 1QXRA 3WP6A 3MZHA 2G9FA 3P3PA 3THDA 1CAWA 1PK6B 1PX3A 1ZZ7A 4KH9A 3IB3A 3ECQA 5F2WA 4DPNA 1KGYA 3FHIB 3KMHA 1S0FA 1S0BA 1RUF3 2GNBA 2J1EA 3DKWA 3LOIA 1V6JA 4QGLA 5LRSA 4IE0A 5FPBA 3TWIA 1CAUA 2VMFA 2ARXA 3WSOA 5J7MA 4LULA 2ET1A 1N1VA 2E7AA 2DFBA 2P6HA 2DVAA 4QPIA 2UURA 2H6BA 1NXD1 4UW5A 4FBFA 5JZGB 1UOGA 2ZJCA 3EQEA 2PLV3 1SBFA 1W05A 4XBQA 1CZVA 3LB9A 3PUIA 3RFRA 3T2QA 1YWKA 3PIGA 1H2MA 2HEVF 2X5IC 3KQRA 5A7WA 1DYKA 2DU0A 2W94A 3I2OA 4YVWB 5I0TA 3M4FA 1TG7A 3K2OA 5F5CA 5F37A 1RUJ2 2WAAA 3DCQA 4FPGA 5I0SA 1SLTA 4XACA 5ANQA 4Y1ZA 5HXMA 4LO6B 1VAVA 1VRH1 2VQTA 4EZHA 2PA7A 3AP5A 3WNXA 4QU2A 5CU1A 3VD3A 4R8HA 3PVOA 5C9AC 4NPLA 4IEOA 3PVEA 4DO0A 5KHHA 4DINB 4AI1A 4YVSB 2PHWA 4MADA 4M3CF 4R9AA 5FXZA 3AYDA 1OH4A 5FBZA 3W5NA 3VD5A 2JDNA 4TLGA 3VBFB 3RQ0A 3LAGA 3H7YA 3EO6A 1VBD1 2DBIA 4ZKTB 1VMFA 2ZX3A 4NPMA 3O0VA 1B35B 5GZGA 2B45X 3GZEA 4P08A 4JVAA 2I74A 1Q8SA 3HVDA 2ZGKA 4JHZA 5JSRA 4H7LA 3ZPYA 1AVBA 1JXNA 5LWBA 5F7UA 4RR3C 2K2SA 2DUOA 2LUWA 3PUSA 4P9XA 1EPWA 1X36A 5FKBA 2CNAA 2VZRA 5FYUA 3BOWA 2RE9A 4LO8A 5FFOC 4AK3A 5K0UC 3RZKA 5FIXA 3VBHC 1NA1C 1UX6A 3HNYM 2BNNA 4XBNA 4ES9A 2PYTA 4JX0A 1MZ6A 4YRDA 1DZQA 1LGNA 5LW9A 4AEJA 1RUNA 4YM3A 3ASIA 2XOMA 3VDDA 2WRAA 1OFSA 3WLUA 3C3VA 4AGRA 5JPMB 2C4XA 2OX0A 2EICA 3U1XA 2AC1A 1TMF2 5GLUA 5KR7A 3K46A 1ASJ3 5BNPB 3OCPA 1X33A 2RDSA 3P1IA 1H30A 1OVSA 1XE7A 2VOXA 1W8HA 1RUH3 1RMU1 2RJLA 3I2FA 4OHZA 3PTRB 3FX3A 3MUZ1 2DCYA 2GN3A 4J6GA 4MO3M 3KT4A 5FZDA 5LK5A 5BNNC 4NWVA 3S57A 2WFF3 1BQPA 4Q0VA 5EHDA 5L9RA 1QOSA 1SLBA 1FYUA 2Y8KA 5C4WC 1KEXA 4ONUA 4OZOA 4HPKA 4Y3OA 4AGVA 4XVHA 1C5IA 1DQ0A 4U36A 1R082 3O0WA 2FDIA 1W3VA 4ZU5A 3C7FA 2VM9A 3GZUC 2O8QA 5A6ZA 4X8PA 3NV2A 2XLAA 4PHZA 1O5UA 2HWE1 4V1PA 4XFAA 2NPIA 1RUF2 5IHRA 2XBO2 1S2BA 1YLLA 4OUSA 4TN7A 3PNAA 5CAZA 3ZR5A 5BNQA 4XZUG 2QDRA 3ILNA 4CYDA 1OBNA 4UFHA 4COWA 2W68A 3MF9A 1URXA 1UL9A 3POFA 1MVQA 4JTNA 2K9ZA 4Q1RA 4UI9L 2CDPA 2W91A 5EPAA 1XXNA 1QXJA 1WBFA 1W9FA 3ZFEC 5IK7A 1QMJA 1EPZA 2WJSA 1NLRA 3ATGA 3OJBA 4ISQA 1W06A 2VXJA 4QX5A 4NUBA 2VMIA 1D4VB 2G4IA 4BOWA 3VBRC 4JV4A 4K20A 5DDJ1 2VNGA 4NMIA 2E33A 4D6RA 5DQ0A 1ZVFA 4LHLA 1L7LA 1YCIA 5KXBA 3W20A 1DP0A 1OMIA 4GZ9A 4LKFA 3RZJA 4AEDC 5CZKA 4UBGA 3VD9A 3AP9A 1UX7A 1HB1A 4LO4B 1AX2A 2ATFA 5DAXA 1WW4A 2LTNA 1RUD2 4QX0A 1ZM1A 2VL4A 1HRV1 1W04A 2WAOA 1JYXA 3FBMA 2VY0A 3H1WA 4NAOA 1OXCA 1NCQB 4BM8A 5FPUA 5FZMA 1EUUA 4V2WA 4KI5M 3IDCB 2BVVA 4UXAA 5FLIA 5FZGA 3LPGA 3FN9A 1AR61 1C4RA 1YQ5A 4HPKB 5LA1A 1BMV1 4LE4A 3JCIA 1OOPB 3KSCA 3C7OA 1UZYA 1PZ9A 3ABZA 5T50A 5IATA 2YZ4A 3BB6A 4Q4Y1 3LA2A 2WWJA 3EYPA 1CPMA 1W8NA 1R64A 2FMYA 4WZFA 5GM0A 3ELNA 2P3KA 1VRH3 2E31A 2XQRA 4H3WA 3U78A 4QPYA 2JWPA 4TZDA 2JKBA 2ES3A 1AR92 2V4VA 4K8RB 1NX9A 4MGIE 1N3OA 1RC6A 3BU7A 4E4ZA 5JR2A 4A45A 1X50A 1QEXA 2YGMA 3RWNA 1IQAA 1V0AA 2D6OX 1CD3G 2DYCA 4O7XA 3WUCA 5JDBA 1JU4A 5BYNA 1WKYA 4QXCA 3OUHA 1RINA 1S0DA 2E26A 2RS52 3LEGA 5FAXA 5CA6A 2ZGPA 3WF1A 1W6OA 1GYKA 1UZWA 2VCCA 2X5IA 2A3YA 3VZLA 1VBD3 1XYOA 1H4HA 2WZR1 1DZRA 3SCGA 2WNVC 5LATA 3KZ4C 2C6SA 1KRIA 2WFF2 4P5YA 5FZ4A 3TEWA 4QDQA 3WR0A 2P6CA 4RHV1 5C8CC 1QQP1 4NROA 1ND2C 5DUUA 1RITA 4XFIA 3P6BA 1AUYA 4Y5Z0 2I07B 3PDQA 4JKLA 4K9SA 2XR4A 4P9IA 1RYYA 3O14A 4AWDA 5A3UA 5EXOA 3ETQA 2BNMA 2CGPA 4NHYA 3NJXA 1HKDA 4Q8KA 1UPIA 4AOCA 5JSOA 4PIXA 2FBEA 2VZQA 3B02A 4W8JA 1HN1A 1D2SA 1PHMA 4JC1A 2GC1A 3UYJA 1OVPA 2W39A 3H3LA 2VZUA 1RUC2 1GQGA 2YPDA 3I2GA 3I8TA 1X8EA 3J8F2 4AGGA 3GF6A 2R1DA 2Y6HA 1QNYA 2WBKA 3WQ1A 4CEYC 3GCXA 3CJIC 2RM21 4BXSV 2JG8A 4M01A 3MLKA 1DHKB 2ZGSA 4J25A 2WA4A 2YG0A 1ZA7A 3NO8A 4LA2A 4HKWA 3JQXA 1EUTA 4Q4W1 4URTA 5AVPA 5FK8A 3H3ZA 1HJFA 2B8MA 2J1SA 1CZSA 1M4WA 2ZEZA 1Q5OA 2BERA 3E6DA 4I02A 4XILA 4CDUC 1RMU3 3THPA 4JGYA 5H9QA 4QD2A 3KCXA 3SEPA 5ANNA 2WWUA 1ULGA 3DECA 3OD0A 3T4HB 3VBHA 1NA1A 4Y5TA 1UMHA 1GWMA 1ULDA 2X29A 4IE5A 4FPKA 4PIZA 5DZGA 5F3EA 5LEJA 3DN7A 2VW2A 3ZXJA 4IE7A 5IWFA 4TSVA 4XTPA 2WT1A 1PO21 1UQXA 1WLWA 3I97A 2ORXA 1IG3A 2VOWA 5FY0A 2GMEA 4GIQA 5DAVA 1BEV2 5DPNA 4AF9A 5ISLA 2F17A 2P5BA 4YW4A 2HWE3 2E7QA 2VZVA 1W2TA 3DPRA 3TRSB 1W6OB 5CYYA 3POBA 1H6XA 3ACGA 4QPGC 5IW0A 4CP1A 4JAAA 3B7MA 2AUYA 4I0BA 5JAXA 1CPNA 2JE7A 2OVUA 1PMIA 2Y38A 5EFUA 3L2HA 3MIGA 3OGVA 3R4DB 4XCAA 5FZ3A 2JDMA 2A6XA 3MIHA 3UGHA 4JKMA 4GALA 1OKQA 4UBHA 4PLMA 4FI9A 5FP3A 3RJRA 4ORFA 5A7NA 4DEVA 5C4WA 2WC2A 4UF0A 1OKOA 1ZZ6A 5I0UA 4WZCA 4MGTA 1W8FA 4DZGA 1OQDA 2XQXA 2EVXA 2W95A 4KU7A 1K3IA 5CFDC 2ZMLA 1QXPA 2OXBA 1AYM2 1C1FA 3O7OA 2CWMA 1LODA 2YROA 4MGKE 5K8SA 2JG9C 3HNMA 1G9FA 1VRH2 3IAQA 4LXLA 4LKDA 3SNMA 5DDJ3 4UFKA 3I2HA 1UU5A 1H6YA 3NNLA 5FYTA 1JHJA 4EE2A 5I93A 1JOJA 3BYWA 4BQXA 2JG8B 3Q8EA 4ZPIA 2VBDA 4QT6A 1J3RA 4GWJA 2QCSB 3ORJA 4GKXA 1SHWB 1PK6C 4JKKA 3HN3A 4NPRA 2PTMA 3ZOIA 1W2AX 3AYEA 2GC2A 1VBD2 4JGYB 1QJZA 5FZ8A 3RMXA 3V0BB 1HRV3 3ON7A 4Z8BA 1FPN2 4AVSA 2AEYA 4GH4B 5K4LA 2DV9A 4P9JA 2AYHA 1H1AA 2JX9A 3ZSJA 1AR63 3LOBA 1NOVA 4R52A 4XCBA 3ZN6A 5JZGC 4R4ZA 4PDWB 4MXWB 3OD4A 3M3OA 1W2NA 2D3PA 5F9TA 1ZNPA 4Q4Y3 1LJ7A 2VOTA 4E27A 3DPRB 4YVWC 2GNDA 5E8AA 5FQ0B 2HWC1 1XOYA 4IGQA 3PMSA 5BPXA 1F35A 1XYPA 3ZLIA 3PLQA 4RGGA 3J9SA 2RDNA 2VVEA 1JTZX 5FP9A 3CU7A 1G86A 3BIWE 1WWYA 4M4PA 1YFWA 1DYPA 1K12A 1FT9A 2VTXJ 4HZFA 4INDA 1NCRC 3M3IA 4LK6A 1ZZ9A 3HNBM 4YVSC 2D97A 4IE4A 3VD7A 5IVBA 1W8OA 3D0SA 2VUAA 4XDPA 2JJ6A 3KF5A 3MPPG 4YW1A 3CZUA 3VBUA 4CU7A 3VBFC 3P3NA 5BXXA 3LCPA 1TZOA 2O8OA 3I4IA 4DRRA 2WZR3 4FQZA 4KBBA 2QVSB 3ZYJB 2A73B 4RQPA 3EB7A 2UWBA 1JHNA 1CESA 5FZAA 1B35C 1UPSA 1Y9MA 1XNAA 2V5YA 3H9AA 2PHDA 2V09A 1QQP3 2DU1A 1A8DA 4RHV3 4ASKA 2NN8A 2Q30A 4CCDA 1QJU2 1PM4A 3LDKA 1UNBA 4AEMA 3RVHA 1U5ZA 2GH8A 2ZEWA 2JICA 4DXTA 1D7PM 4XJ9A 1K42A 3F95A 1ZX5A 3VHRA 3V0AA 3LZZA 2D6NA 4KGGA 4XJAA 1TMF1 2ZBJA 3DV8A 5H9PA 1OF4A 3WW4A 5SV5A 2VW1A 5H9RA 1L7RA 2QUOA 4KNCA 3AJZA 1O4YA 3TAYA 2VUDA 3ZN6B 1LHWA 2RM23 2Y6GA 5C8WA 5C8CA 3RZMA 5JXHA 1JI6A 5LY2A 2BVBA 3ZVXA 4Q4W3 1CAVA 3KQ4B 5A1LA 1SDDB 5BNPC 5FZBA 4D69A 2ZS6B 2E7TA 4FXGB 1R081 3ZSKA 5HCHA 3H0OA 3HQUA 2Y6KA 2QQMA 3WF0A 4QAWA 4CVUA 2A6ZA 3M7AA 3N4MA 3K51A 1H1IA 2XBO1 4DUWA 3WQ0A 3D82A 3MV01 2NP0A 3WF4A 1UN1A 1WLDA 1PO23 1WD4A 3OPZA 5FKCA 1LKNA 1VBB2 5FPAA 5FPXA 4CEYA 3MIEA 4XUQA 1HQNA 4FPCA 4W65A 4YW6A 4J1XA 4LBLA 2WWSA 2WT2A 4ITCA 5ABJB 3BCWA 1A34A 2BPA2 4XF0A 4O9GA 2WSVA 4QM8A 3DYOA 3MFCA 3T0DA 4HSJA 5BNOA 4CDUA 4RQPB 1LOGA 2D98A 2ZGRA 4XYXA 5A7PA 2GH2A 3LKJA 4UWDA 2BW8A 2GN7A 5FLJA 3LSDA 3AVRA 1AR62 4BMBA 3L2YA 5J48A 5FZ9A 1RJ8A 1I5ZA 2WZEA 1WCDJ 1AXYA 1J3QA 2XMLA 1A78A 4HN0A 3VKOA 3WNNA 1ULOA 3KS7A 2K0GA 4ATFA 4BQ5A 3MFAA 4LPLA 5T5PA 1G9BA 1PGL2 4CUAA 1RUE2 1EAH2 4KQ7A 3E97A 2IXLA 4Z07A 1VIWB 4E2GA 3RYKA 4DIQA 3N9MA 3BIEA 1W6PA 4M4RA 2ZGUA 3VDBA 1VMHA 1MEC1 5A3LA 4Y1XA 5FY7A 4BU2A 2P17A 3A21A 4QPGA 4Q0UA 3CBNA 1F4HA 1RUD1 4I0WB 1CN1A 1TVGA 2AREA 1HJGA 2X05A 1PNFA 2A3XA 3R6SA 1V00A 3JU9A 1CX1A 1UOFA 4QB6A 1O7FA 1I1EA 4EWAA
chains in the Genus database with same CATH topology
4QM9A 3ZX7A 4D94A 1K5MB 5IK8A 1KITA 1YHFA 4GXLA 5JIAA 3OF1A 4AHWA 3WCRA 1WMDA 1R1A1 2ZHKA 4L2NA 2OA2A 1EY2A 2JG9A 1NCQC 4CEWA 1YNAA 2EAAA 3ILRA 4PBOA 3O0XA 5I0RA 4R9BA 1FNZA 3O12A 1AR91 1OOPC 3AZYA 2ZKLA 1YJLA 1VAMA 4Q4V2 4EN9B 4FP3A 2HWC3 4EN8B 1PK6A 5BNOB 4M00A 1REEA 4RFT0 2RS51 2OW4A 3UJOA 3MICA 2PHUA 3WDYA 2CAUA 2ZAAA 4D7YA 4FCAA 1NE4A 2YDEA 2YV8A 2WFF1 5JSPA 4Q26A 4Q4W2 1V70A 3MI8A 4C1XA 1NY72 2QQPA 1X82A 3WT3A 1G9CA 4HETA 1U5IA 2B42B 3MW4A 4JCKA 3DF0A 2QKDA 3ZYIB 4Y20B 5KHGA 1SQ4A 4OUMA 3AFKA 4N9HA 2XJSA 2RMU2 3J8F1 4IEQA 1AJOA 1RUC1 4C90A 4RA0A 1XRUA 4NO4A 4AE2A 1WLCA 3WCSA 1XNCA 1Q8QA 2WL1A 4YVSA 3HBZA 3AP6A 1TMF3 2WZPP 1RVF2 3CF6E 4IEVA 2VUJA 1POV1 4KU8A 4CEWB 1QJX2 1XYNA 4Q1PA 3WDUA 3TB0A 1T6GC 1H0BA 2CV6A 1AR82 2PN5A 1B35A 1GQHA 2BGCA 3AMPA 1MZFA 3URFA 4UW4A 3ILFA 1QF3A 4GB32 1ALYA 3ZYPA 1R083 4GULA 4GA9A 2B9UA 4WM7A 1AXKA 3U10A 4K1YA 3ZYGA 4DQAA 1BEV1 4IEYA 4XFFA 3RI9A 2GNTA 1IGOA 2XBO3 2ZABA 3OBRA 4C0BA 4GMP1 1HV1A 2ZGTA 5LRRA 5BV6A 1Z78A 2RR11 2D5FA 2ZKNA 4P14A 3I54A 2XH6A 4J1WA 4LO7A 3R0RA 1BZWA 2A3WA 1Q3EA 3SCHA 5AC92 2W0XA 1UU6A 5A32B 3OGJA 1WW5A 3ST7A 1SFNA 4YW5A 1H2LA 5BNPA 2E63A 1JUHA 3MW3A 2VU9A 3GZTB 1V6OA 1AYM1 1C1LA 4IQPA 3W58A 3UL2A 1GZ9A 3EJKA 3ZXFA 3RRDA 3TBDA 2PHFA 4ZU4A 2GZWA 3Q9OA 1ZRDA 3TN92 3HN1A 3I59B 4HKOA 2HWC2 4B4RA 5JI9A 1MEC3 4XMIA 2IXCA 1FAYA 2MEV2 4NN0A 3U4XA 3BOPA 1Z0HA 3WOGA 1H9WA 1KFUL 1D4M2 1RUD3 3FC0A 3GBFA 4K1ZA 5D1IA 1FPN1 5T3NA 1DQ2A 3QBQA 2CYFA 2JG8C 5IK5A 1GICA 1JBCA 1KFXL 1V6IA 5JMCA 1LHOA 3WDVA 1TNFA 3J26N 1QWRA 1MS9A 2WIIB 3GBGA 2XWJB 3VZJA 1PO11 4JGYC 4WM7B 5A33A 3IDEA 3FBYA 3PJQA 1J1TA 1R1A3 4WM8B 2B5HA 1DQ5A 2C9AA 1BVVA 4EN6B 3R4SA 3AKTA 4AI3A 2BUKA 1PNGA 4FSJA 1ENSA 1AR93 1OFNA 1I6XA 2GDFA 4GQ7A 3M2MA 1DZTA 4YNIA 5J96B 3IBMA 4PDWC 3E5XA 5CNAA 3VL8A 3E6BA 4OHYA 4R4XA 2YC0A 3DPRC 5KWRA 2XWBB 1SLAA 4KWKA 1UF2C 3WW3A 2RS53 2EALA 3X29B 3VKFC 3MLJA 4LLFA 4GKYA 4AQSA 1RGSA 2IXKA 5C6CA 5KC6A 1NCQA 5GLZA 4X6RB 3D5OA 1AL0G 1GFF2 4G4FA 1G8WA 1O3TA 3PVNA 3B9IA 4WVWA 1Q43A 1QJU1 1OOPA 1ZZ8A 3GYDA 4PF5A 5HXVA 4S2GA 2R49A 2Y26A 1W6MA 3AJYA 4FQ4A 3PJYA 3J8F3 1RUC3 1H4GA 4BMEA 1HQLA 3KCYA 4NOTA 3AXDA 4OI0A 2LALA 5JVVA 1PIV2 2XL7A 4JDMA 1HW5A 4YM1A 4AVVA 2XL9A 4FTSA 2ZA9A 1IZ3A 4IV3B 5F6LB 4FAHA 3AYAA 1H8VA 1Q8OA 4B4PA 5A33B 3NWKA 3PTYA 5JPNB 1LHVA 4AFDA 1DLLA 1POV3 4AFAA 4B8EA 3QOPA 1YFUA 3ZXDA 1SLLA 3JD71 4TLFA 4XF1A 4K40A 4XMAA 2R30A 3VLBB 4AVBA 3B5LB 2DTYA 1LCLA 2R072 4OULA 4G3YC 4YARA 2PAEA 2XVKA 2I45A 3FE5A 3WY6A 1OD5A 4QQLA 1VBB1 4XQWA 3ENRA 1Q8PA 2CL2A 1MEC2 3BTAA 1F2NA 1BEV3 1S0GA 3OBTA 3WDTA 1IHMA 2W52A 4HSLA 3POSA 1Z7S1 2C1FA 4NWWA 5CVRA 3USUA 1FX5A 2IC1A 1RL3A 4GMP3 2UWCA 4EROA 2RR13 1ZA4A 1UIJA 2WLPA 1JW6A 4XF3A 3VBUC 5ABJC 2A6YA 3A0KA 2B39A 2VOVA 1R1A2 4M0HA 2VQ0A 4LTAA 4RQPC 1PGL1 1RUE1 1EAH1 1AYM3 4MV2A 4S2FA 2ZHMA 1W6MB 5ACA2 3HAGA 1C5HA 3AKPA 2NMOA 1XU1A 1H2KA 1HDKA 2P2KA 3WINE 4HMZA 1COV1 4YGEA 4MYEA 2AR6A 5E1RA 3JBG1 3VBOB 4MVTA 4FPYA 4XJWA 1UKGA 1QU0A 5I8TA 5K9YA 1MQTB 1KQRA 3FFZA 3S6PA 4COYA 1F9KA 2GNMA 1C3HA 3N36A 1OSGA 2UY8A 1NXMA 4XQ4A 4YM2A 3KB5A 4ASLA 3AKRA 4AI8A 3JZVA 3MF6A 2IXIA 1FPN3 3UV9A 4Y1UA 4CDQA 1YXWA 3N7KA 2EXJA 3RDIA 3WX5A 3WZ1A 1CJDA 2WS92 1CGPA 1RUI1 4JGZA 5J3UA 3H7JA 4XPVA 1ZRFA 1LESA 1K5MC 3ZYRA 2C0ZA 3MPBA 2WLQA 1PO13 1ULFA 4XJ8A 3ZFFA 1SLIA 4LT5A 2PAMA 4Q4V1 1JH5A 3USUB 1YIPA 2BQPA 3VZMA 1DQ1A 4P9LA 2ERFA 4IERA 4LBQD 4XZPA 1LOBA 4RS5B 1WBLA 4HANA 1J3PA 1GNZA 3QLQA 1MVEA 4XFCA 1IPKA 4I2OA 2UY9A 1AXZA 1S55A 4YZ4A 1FMD2 1Y43B 3RG0A 1TQ5A 4FVVA 4MX3A 3VGIA 1DFQA 2H0VA 2WT0A 4XJZA 1NY71 4XETA 4AFCA 1IPJA 1C57A 5BNOC 3V0BA 4N53B 3T2TA 1IS4A 1KJRA 5T55A 3ZMOA 4GH4A 1KS4A 4HK9A 1SLCA 2WKKA 2NQYA 2RMU1 1QJU3 4P9WA 4PDWA 1ULEA 4MXWA 1QDCA 3S30A 1V6MA 4Z92B 3V65A 2QZ3A 1IS6A 1R092 2A6VA 5FQ0A 3N7JA 1DIWA 3W59A 1I3HA 4AVAA 4S2DA 5KXDA 1RVF1 4CDQB 3SH5A 1VB4A 2RR12 2XJUA 3NAPA 4Y24A 2ETEA 3POWA 1QJX1 1BJQA 1BBT2 4JGZB 2TBVA 1LOCA 2ZMKA 5CG8A 1AR81 4YLZA 3WP5A 5EV7A 3BALA 5DUVA 4AI0A 2MPFA 2NM1A 3S0MA 3KM5A 2R6QA 1HXS2 3ZFFB 4HVQA 5CBLA 2IXJA 1LB2A 4GB31 2DVFA 1I9RA 5LK7B 1VAKA 4LBMA 4CTEA 1SMVA 4CEWC 3JD73 4XXPA 3G6JB 1HRI1 3B94A 4XHXA 3FUOA 4COZA 2YXSA 2DTWA 3J4UH 5FRAA 1MZ5A 4HN1A 2BBVA 1Q8VA 2P34A 2KA3A 1X8MA 5GZCA 4DS0A 1VBB3 4L8QA 4XBLA 4EN0A 3KGLA 2VXRA 5GJ6A 1NZCA 1Z7S3 3A4UA 4FT8A 3WHTA 5AC91 2QE3A 2P3IA 2PHTA 1W0OA 4OI1A 3FWEA 2WFPA 1QDOA 5TSWA 3CLPA 4XF4A 4AYUA 2YUEA 3AM2A 3T1MA 2Q1MA 1L3JA 1W6NB 2Z2SB 2ZHNA 4I01A 1PO12 1U5YA 4FXKB 4HT1T 1XNKA 3MEPA 3TN91 4E4DX 1RUE3 1EAH3 1QOOA 3VHNA 2CTVA 2BNOA 2D44A 4B29A 1VBC1 2ZX0A 2MEV1 5KHKA 1APNA 5T54A 1COV3 2DFCA 3NAPB 4ATEA 1QJY2 3N3HA 5KXCA 1D4M1 3JBG3 3V64A 4NHLA 2OPKA 1J58A 3HMYA 4YZ3A 4FOWA 1JYIA 2R062 2Z42A 3KCCA 5ABJA 1DBNA 4RL7A 4DFSA 4FPFA 4FPOB 4B7EA 3ES4A 4RSUA 2EXIA 1WD3A 1QH7A 1V9U3 4D7TA 1XE8A 1MS0A 3TNQA 2Q0AA 1RUI3 2NLRA 2X8KA 5BNNB 2VGDA 2G9GA 4I30A 2TNFA 4LHNA 4OHXA 1EP0A 2RHPA 1ZZCA 2CAVA 3ZFGB 2DVBA 3AP7A 3ZSEA 2AGSA 4WM7C 1FXZA 4HLTA 2XGXA 2WQZC 4Q4V3 4WM8C 2HYKA 3LA7A 3RS6A 4OI4A 4FPJA 3U11A 4AQTA 4K3UA 3FLTA 5K7PA 4C91A 2RS33 4XE9A 3ROUA 2OYZA 1ND3B 4FPHA 1LHNA 5IK4A 4L11A 4AHZA 1O3RA 4XF9A 3LA3A 4D7SA 1OLRA 2D40A 3T1LA 1K5MA 2V73A 2JENA 4MGYE 1H8TB 2VG9A 2OUHA 4L9BA 3AFGA 3HIFA 1YRZA 4GWNA 5DZFA 1MS5A 1TNRA 3JD72 5LEKA 3IT8A 4CDWB 4JQRA 5FO8B 4CDXB 1W6QB 4H14A 5KHJA 5BUVA 3VBRB 2PAKA 2HWF1 5C33A 2PFWA 2RMU3 3EHKA 4M3CB 5F5QA 2QJVA 4LE3A 4IEZA 4UW3A 3VHPA 3GHNA 1PIV1 3HD8B 4AEDB 1Z7S2 1CONA 3N35A 4PLNA 2DCJA 3VBSB 2YYOA 4AHXA 4FAGA 1RVF3 4F83A 3AMMA 3NV4A 5HCFA 5L73A 4BIOA 4JDNA 1QJX3 4ISRA 1V6NA 5I8SA 3HQXA 1VB2A 1U12A 1AR83 1RUG2 2Q8OA 2CGNA 1UU4A 1C28A 5CIRA 2BWAA 5FREA 1DGWX 4NVPA 1ENQA 2R071 2BYVE 4YG3A 2PQQA 4GB33 3D0JA 2CY6A 2D6LX 4YZ2A 4KG8A 2CGOA 3RYPA 1HRI3 4SLIA 4Y20A 1COV2 4FOYA 1LTEA 2WNUB 3U07A 3FUQA 1O4ZA 1GR3A 3JBG2 3HT1A 3OGGA 4IEUA 2DVDA 5KC5A 2JEMA 1ZBE2 2XB6C 2Z69A 3JUUA 1H1MA 1H2NA 1AX1A 3MIBA 3QACA 3CO2A 4ZXKA 4IESA 4FPLA 2F6BA 4COUA 1REDA 1SFYA 4Q4X2 5AC93 5EZWA 1CAXB 2UWAA 1RIRA 4SBVA 5D8AB 5F1RA 1V9U2 4WVZA 1J59A 1RUI2 4A3XA 3SMHA 1RTVA 4MGZE 4JRLA 4LHKA 3VZKA 3RZZA 3WXPA 5ACA1 2ZPXA 3VUOA 1F5JA 4I09A 4LBQB 1MS8A 4LUKA 2GAUA 3KLSA 4YFZA 3TN93 1WMEA 1N3QA 2KM2A 1DU3D 2RJKA 5T5OA 5L7OB 1VBC3 1OA4A 2MEV3 2RS32 5I8YA 1Y3TA 1MS4A 1G7YA 1D4M3 2ZTNA 4YG6A 4DOUA 2R1BA 2HEYF 5BY5A 3VBOC 3ZN4A 3NW4A 3TYJA 5HBAA 4B4QA 1MQTC 5FTTC 2WS91 5FMOS 5J36A 4OHVA 2NZ9A 4AI2A 3V56A 3WP4A 2VQAA 3WHUA 1ZBA3 5A32A 5FOJB 5JOYA 3OYWA 3KGZA 4LNVA 2A71A 1UKRA 2ZACA 3RPQA 4FOVA 4OZXA 4W6YA 2E51A 4ZU7A 3APBA 4B3NA 1B09A 3B3QE 1G9AA 2WSUA 2TUNA 1GZWB 4AG4A 2HWB2 2ZOEB 1CX4A 1WW6A 3I59A 1PVC1 5CFCB 3GHMA 1FMD1 1LOFC 1YO8A 2O1QA 2A75A 4OVEA 3IMNA 1VR3A 3NV1A 4RS5C 2EIGA 3LSEA 5DG2A 3FZ3A 2N7GA 3ES1A 4TYSA 2ZZQA 2A70A 5T5JA 1YFYA 3THTA 4H7MA 1VBA1 2ENRA 1SACA 3AZWA 4Q0PA 4OLLA 4IL7A 1NE6A 2YHJA 2DVGA 3OY8A 1LU2A 4BWOA 1U0AA 3PMEA 5JOWA 1HRI2 5CFDB 2E53A 4WM8A 4IV1B 5FCCA 5JI7A 2YMZA 1SBDA 1HLCA 1R091 2R042 2BTVC 3VZNA 5GZEA 2FQPA 2ZAHA 4F7ZA 5K8SA 4C1WA 3EXUA 3GZAA 2HWF3 4CP2A 2IZWA 1FV3A 2EA7A 4K6BA 2DURA 3LGRA 1GLHA 1DG6A 4MUVA 1CR7A 1PIV3 1BBT1 1UZZA 3POYA 3D4KA 1ZREA 1EV12 3IPVB 1FOD2 2UYAA 3OYWB 3H1YA 1U5XA 1HXS1 5CADA 4CDQC 4XW3A 3DL3A 1VBE2 3AB0A 4IETA 4JGZC 4YM0A 5JOXA 2VECA 4NHMA 1G9DA 2MNGA 1XQNA 1WCKA 2R073 1AZDA 3QCWA 3W9AA 4YZ1A 4LR4A 2A7AA 3ZFFC 2GMMA 2VH9A 1PVXA 2BFUS 4QGNA 4WVMB 1W0PA 1VBC2 4AVCA 2DUPA 5FO7B 3M3EA 3MDPA 1D2QA 4IXLA 4E9KA 3JQWA 5JOZA 2D3RA 1S0JA 1TE1B 1TEIA 2JE9A 1M06G 1WGPA 2PHRA 3ALQA 1IS5A 4CZSA 1POV0 1S2KA 4Y22A 3WG3A 4XTMA 2HJIA 2ZMNA 1A3KA 1NCRB 1W2UA 4IV3A 5EWSA 1SDWA 1WUVA 1ZBA2 3GBWA 3OY8B 3CL1A 5GZFA 1ZZBA 4BLJA 1GV9A 4GH4C 3A0NA 4R9DA 3USSA 4BLIA 5ACA3 3MGUA 5H9SA 3RJ2X 4S2HA 4PBPA 4G9SB 1QJY1 3H1MA 4YGBA 2WNEA 4N43A 4BYYA 3ACLA 4GMP0 5E89A 4D3WA 3VKMA 1CAWB 1XU2A 5JR7B 2R0HA 1R1ZA 2R061 3M3CA 1GKBA 2HWD2 3HR9A 3S7EA 5L36A 2I2SA 3IDBB 3NAPC 1FI2A 2D43A 3B69A 1CAUB 3M3QA 3MIFA 2ZX4A 5DUXA 1V6KA 2D6PA 2R16A 4QPIB 4Q29A 2WS93 2GMPA 5FMOL 1Q56A 1AYN3 3ZXAC 3INAA 4LBNA 4P5HA 2QFEA 4Z1VA 3SH3A 2Q5TA 4QQOA 3U0ZA 4RD7A 1AL21 3AKQA 1GNHA 1Y9QA 3KD4A 1IS3A 3RNSA 3RMYA 1TME2 1LR5A 2HWF2 4A7YA 3B93A 4BIFA 3N7MA 1GBGA 3IWZA 3MIDA 2GU9A 4FP2A 4Y22B 1PZ7A 3VBOA 2Z5WA 3ZFGC 3GALA 4Z2WA 1QY4A 1KS5A 1MQTA 1PVC3 1AR73 2NMNA 1CVNA 4QQHA 1FMD3 2VULA 1RHI1 5J98B 4KL1A 4HKLA 3I2DA 1UMZA 3E5UA 1ND3C 4AXOA 4Y26A 2ZZJA 1ONAA 4MH0E 4O9EA 4YZ5A 1LEDA 1ULCA 3AZXA 2IWGB 1ZYBA 1VBA3 4EJRA 1CIWA 2PLV2 4N43B 1H8TC 2AH2A 4R9CA 1WMFA 4BH9A 4QXKA 3ZSMA 3B00A 1AF9A 5FDBA 1O3SA 3DUIA 4F8AA 1R093 3UK9A 2F4PA 4CDWC 1LOFA 1NQDA 3NVCA 4CDXC 2PELA 3SITA 1XNDA 4FOQA 3ZN5A 3WW2A 1O4TA 4YYOA 1N1TA 2YY1A 5FOBB 4MXVA 4RS5A 1DQ4A 3VDDB 3M8LA 4LBOA 2XJQA 2D93A 1BBT3 1YJKA 3M70A 5GLVA 1BK1A 4AEKA 1RUG1 2Y0IA 1FATA 4HFSA 2VMGA 2ZGMA 3EBRA 1S0IA 3NV3A 2ZGLA 1O91A 1IKQA 1HXS3 3VBSC 1S0EA 3KT1A 4OHWA 2ZX1A 1NQJA 5JLVA 1S1AA 3ZO0B 3VKLA 3DGTA 4N53A 3H50A 4JRAA 1C8M1 1VP6A 3LWCA 2IXHA 4DXZA 1QH6A 3CJXA 1D0GA 4META 3D8CA 3ME2A 4WBBA 4AVTA 3O5SA 4DNYA 1ZBE1 2LM3A 2VOKA 4FPEA 5GALA 1OPMA 1PGSA 2XKOA 1ENXA 5EYXA 2E6VA 4JDOA 1OQEA 2BFUL 3B9CA 1IKPA 2H6CA 4XJUA 4EWDA 2C5DA 2WNUC 4Q4X1 1UIKA 1LOAA 2IFWA 3R05A 5B2GB 1MACA 1PZ8A 1KD7A 1V9U1 1QOTA 1YUDA 3FMGA 5GKAC 1ZRCA 4Q27A 2D7FA 1AYN2 3WDWA 3QH6A 4EV0A 2OZ6A 5T52A 4Z82A 1ASJ2 2Q1ZB 4AQ2A 5GLTA 5D8AC 2B7YA 1RUH2 4XDQA 3AMQA 2XJPA 4MSVA 1WCSA 1KJLA 5GLWA 3AYCA 1BYHA 2RS31 3C2UA 1QJY3 3TNPB 1X7NA 4BE3A 4XHBA 4AFBA 2NYYA 1PVC2 1AR72 4XIKA 2Q4SA 2OUJA 5C9AA 1PGW1 2ARBA 4AQ6A 3FJSA 5L7OC 3CEWA 1N47A 4HK8A 1S0CA 2R063 4E2SA 4Q2FA 3AZZA 4QGMA 3VZOA 5DXDA 2DWRA 2DF7A 2R32A 1REFA 2MHFA 3UKNA 2EXKA 5E88A 1VBA2 1F5FA 1Y7BA 2UU8A 2VVDA 4X6QB 1W6NA 1N1SA 2ZGOA 2HWB1 4Y1YA 3PHMA 4RR3A 1AL23 3VN4A 3ZXLA 1VLNA 4I3PA 1LGBA 1GZCA 2ZX2A 5IT6A 3SXWA 5K0UA 5J09A 2XJRA 1OI6A 2RS11 4YW3A 1ZRRA 3AMNA 4K8FA 1OLQA 1LU1A 1WLTA 3ZXEA 4IEXA 3SH4A 4RGAA 4MZUA 1DQ6A 3B01A 5KXEA 2D3SA 1KDKA 1DGRA 2HEWF 4PIYA 5CFCC 1YYNA 3NKGA 1RHI3 2KXLA 2FMDA 2X5IB 4XFHA 4WV8A 4DRVA 4EWEA 1EYBA 1BVP1 5JIUA 1NG0A 2R041 2EXHA 2DUQA 5BNNA 2ZHLA 1JUIA 2GALA 3JB8A 4PJYA 5T5LA 3I7DA 1KXGA 3R4UA 5C9AB 3ZFGA 1SCSA 1RJ7A 3SISA 2Y0OA 4UW6A 1OHFA 3E5QA 5AVAA 4H55A 3ZXKA 4QQPA 4IV1C 1EV11 1FOD1 4I3GA 1SBEA 4DMIA 4AHYA 4L97A 2D6KA 2PHXA 3TOJA 1DF0A 5HCAA 1ND3A 3QD6A 3MW2A 3VHOA 1VBE1 1OA2A 1RUG3 3IN9A 2A6WA 4COVA 4F3JA 2XJTA 2OIIA 4RR3B 1H8TA 1V6LA 2W08A 3JB4C 2FZ2A 3WUDA 1AX0A 4A7ZA 4LA3A 4PQ9A 2VMHA 3ZFEA 4CRQA 5K0UB 5EYYA 1C8M3 3SLIA 2XVLA 4XEZA 4PCRA 1C8NA 3VBHB 4HL0A 1NA1B 3QH7A 4CDWA 1F8VA 1RUJ1 4CDXA 2XG3A 1W6QA 3AZVA 2GC0A 2WINB 1HIXA 4PLOA 5E16A 1WA4A 2BEOA 3VBRA 1RUOA 2ZGQA 2XVGA 4BPZA 2O0OA 1SCRA 1ZBE3 3G7DA 4M3CA 5KHIA 2AENA 1QHDA 2B46X 1FV2A 1CJPA 5FO9B 4M3CE 4AEDA 1LULA 1AHSA 3VL9A 2PHLA 1ZBA1 2XUMA 4Q4X3 4QMAA 1WW7A 5F6KA 3SHRA 4BHPA 5KBFA 3VBSA 4E4SA 4BZ4A 5A3MA 1OA3A 3NSTA 3D6EA 1LENA 4LEJA 2E9QA 1KDMA 5C4WB 1ENRA 5IUQA 2ET7A 1F31A 4K21A 3MLLA 2EAKA 1LGCA 4WVVA 1AL22 4Y1VA 2D6MA 5CG9A 3WG2A 2WA3A 2X53S 1UCXA 1RMU2 1YI9A 3BODA 4DB5A 1RB8G 2HWD1 5EJ3A 2WNUA 1XNBA 1H9PA 4M0NA 1DGLA 2VPVA 4W6WA 1DGRN 4ES8A 2HKXA 3NKTA 2SBAA 1LEMA 4U2AA 4A2UA 1BKZA 3H3UA 4IEPA 1RHI2 4XIOA 3IKWA 2HWE2 2VNRA 5FLHA 3NJZA 1QGLA 3ZFEB 1CAXA 4N7UA 5D8AA 3UJQA 2YPJA 4BCUA 4ASMB 2H0BA 1SEFA 3IM0A 4MLOA 1UAIA 3WDXA 2WNVA 5DUWA 3E6CC 4QPIC 1D0HA 1TME1 4QQ2A 4CP0A 3ZIXA 1MZEA 1LECA 4E2QA 5I91A 1MS1A 1ND2A 4LBQA 4TWTA 5DZEA 2HWB3 2EF6A 3GNEA 4Q0QA 4OI2A 3RI8A 5FPZA 3CNAA 1YIFA 5L7OA 4W6XA 2R0FA 5DDJ2 2DCZA 2RS13 1RUF1 1GSLA 4HBNA 1N3PA 4QHBA 5CB7A 4L92A 3AXEA 4GWMA 4KGQA 4IV3C 2D5HA 3CJIA 2A5ZA 1FNYA 2PLV1 3WP3A 1E57A 3AKSA 1PM7A 1VALA 2FZ1A 3UKVA 3VBUB 1IOAA 4C0HA 4N9IA 3N7LA 3NL1A 1HRV2 3HT2A 1C8M2 1J1LA 3L9JT 1OQ1A 1G6NA 2R043 3RYRA 4XFBA 2XKPA 1BMV2 4B7KA 4N43C 4BQ1A 2XLGA 2XLFA 3BPZA 1GZWA 1LHUA 4FO9A 3UKTA 1JYCA 4LLOA 2UYBA 2P3JA 4Q4Y2 2JECA 3AX4A 2QNKA 3ZXGA 4LO5B 1OPOA 3V0AB 3FLRA 5HCBA 1EV13 5CFCA 1FOD3 3H8UA 4LBJA 2GC3A 3KT7A 4YGDA 2Z79A 1A8MA 2WNVB 4IEWA 1NYWA 3VDDC 1VBE3 4A7KA 3MYXA 2TEPA 3K48A 4LBKA 2QZ2A 2BWCA 5C8CB 1ND2B 4HVOA 3ZIWA 2WQ4A 2AZ5A 3ZDSA 1CAVB 2VVFA 2XPJA 3SCFA 5JCTA 3RSJA 2VNOA 4AW7A 4DY5A 3AP4A 1VJ2A 2WZR2 4P9YA 2QDNA 2GSYA 5CFDA 1QNWA 1W39A 4IV1A 1RUJ3 2VW0A 4RHV2 4NHKA 1GANA 1QQP2 1HX6A 1MS3A 4JTOA 1JN2P 1A6CA 4CEYB 1PGW2 3CJIB 1HV0A 2SLIA 1DGWA 1AYN1 3WD5A 4YG0A 5HI0A 3IPVA 4YFWA 2OZJA 2FHRA 4FTEA 4FTBA 4L99A 1ASJ1 4CDUB 2YGLA 1HQWA 1DDLA 2JDZA 1RUH1 2JXAA 5SV8A 3ZSLA 5AFEA 4YGCA 2RM22 5GZDA 3PVBB 1AJKA 2ZGNA 3AMHA 1QKQA 5AFBA 4KG0A 1MR5A 4DY3A 4Y4YA 3WQ7A 4EN7B 5JZGA 3OTFA 3WG1A 3WV6A 1AR71 1UW8A 2IFRA 3WW1A 4WVMA 1W6PB 4P9GA 4YW2A 1BXHA 2XHKA 4YVWA 2RS12 1CQ9A 2XJVA 3IIAA 3VKNA 2HWD3 3M1HA 4OFGA 3VV1A 4QPGB 4Q8LA 4HVRA 1N1YA 2P37A 1PO22 2ILMA 4K7JA 2CWSA 3AK0A 2JD4A 4XOGA 1UD1A 4KWLA 4Q0SA 3WVJA 3S7IA 1O3QA 4N7IA 4KWJA 1LRHA 1NCRA 4AFMA 1BCXA 3WG4A 2DCKA 1YFXA 4NR1A 3FLPA 4X8NA 4XFGA 2ZCWA 4N53C