2WNUC

Complex between c1q globular heads and heparan sulfate
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
129
structure length
129
Chain Sequence
KFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
molecule tags Immune system
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
total genus 28
structure length 129
sequence length 129
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnuC00
2Z5WA 2R30A 4MXWA 1XU1A 5L36A 4E4DX 2ZJCA 3TWIA 1DU3D 1PK6B 1XU2A 1IQAA 2JG9A 5HBAA 4HT1T 1ALYA 1S55A 4F3JA 5TSWA 4QQPA 1TNRA 1U5ZA 1O91A 4DB5A 2ZPXA 3AB0A 4J6GA 1KD7A 3TYJA 4KGQA 1D2QA 1RJ8A 4QQOA 4QQ2A 2R6QA 3ALQA 4G3YC 3B9IA 2WNUB 5KC5A 4EN0A 2JG8B 1D4VB 5BNQA 2JG8C 2WNVB 1A8MA 2HEWF 2QDNA 2Q8OA 1KXGA 2TUNA 4RSUA 3V56A 1JTZX 2JG9C 3LKJA 4OULA 4KGGA 1JH5A 1C3HA 1GR3A 4GIQA 3B93A 2E7AA 4KG8A 4TWTA 2KA3A 4G4FA 4QQHA 2OIIA 1PK6C 3URFA 3FC0A 2QE3A 4MXVA 4DOUA 1C28A 5KC6A 1D0GA 2X29A 4TSVA 5L19A 2R32A 2WNUC 1DG6A 3K51A 1OQEA 4MXWB 2WNVA 1I9RA 2O0OA 1PK6A 5KWRA 3WD5A 3MI8A 2AZ5A 3QD6A 2WNVC 1U5XA 4N90A 2WNUA 2RJKA 2Q1MA 1WCKA 4E4SA 2TNFA 2JG8A 3L9JT 4QPYA 3B94A 2HEVF 3QBQA 4OUSA 1RJ7A 2HEYF 1TNFA 4D7YA 4MSVA 2RJLA 4OUMA 1OSGA 3ME2A 2JG9B 4NN0A 1OQDA 2RE9A 5CIRA 3IT8A 1U5YA 4QQLA 3K48A
chains in the Genus database with same CATH superfamily
4BJ0A 1W6NA 3NJVA 4KBBA 5T5LA 3B02A 4FPKA 3BKZA 1U12A 5C70A 2JWPA 4I02A 1QKQA 3RDIA 3AZZA 2P6CA 5FPAA 5FXZA 1BVVA 5J96B 2ZXQA 4GA9A 1W8FA 3RZMA 1YJKA 4QKFA 3ZXEA 2FBEA 1IOAA 1OH3A 2C4XA 1U5ZA 1AF9A 1NUKA 2D6PA 3O0VA 4L8QA 4ATFA 2C26A 4BYYA 4YVSA 5JAXA 5FFOC 3UKVA 1EP0A 1NT0A 4M3CF 2DYCA 1LULA 1NXMA 2CV6A 1RUJ3 2FDHA 5CEHA 1ZRCA 4ASKA 3B3QE 1CAWB 5HXVA 1PMIA 2RM22 5E88A 2UWBA 3VD3A 4NJ4A 1V6LA 4Z07A 5A7OA 4YVWB 5HV0A 5JZGA 4MYEA 2I07B 5LRSA 1JYCA 4G3YC 1RL3A 1HX6A 2Y0OA 4IV3B 5GLUA 2XGXA 1V6NA 2VTXA 5KC5A 4K20A 1XE8A 2CAUA 3WNKA 5KHGA 2RMU1 2OPKA 1N3PA 2ORXA 3AKSA 5CKQA 2A6ZA 3OOXA 4NAOA 4RS5B 3K77A 3ZKYA 5FYUA 2YROA 5I91A 1QEXA 4IEYA 2J1TA 4LMFA 4XFAA 1JYIA 1GYKA 1G9DA 5IAXA 1BJQA 3WW4A 5FK8A 5JR2A 4XDPA 1CAUA 1VMJA 1UWWA 4YSFA 3SQOA 1NE6A 3V56A 4EN6B 1NLSA 1YEWA 4AHYA 1JOJA 1ZZ6A 2VOTA 1ND2C 1LCLA 1O4YA 4KGGA 5A7QA 5J7MA 4Y5TA 4GIQA 1UL9A 4W6WA 3ZYPA 2DFCA 1O3QA 1NCRC 1S2KA 3KZ4C 5CFDB 2GC0A 4UF0B 1VBA3 2HBUA 1N1SA 1RUJ2 1AYN3 1MS9A 1XNKA 3TOJA 3UNPA 1RUH3 5GLTA 2JXAA 1QJY3 2C9KA 3WUDA 2Y6HA 1NZCA 1VB2A 1ZVFA 1DDLA 2QBXA 4AQ2A 5IW0A 1LODA 5A6QA 1W6PA 5JMCA 1Z0HA 1X50A 5ACA3 4RS5A 2AACA 2BQPA 2VBBA 4O9EA 5C33A 2HWC2 2D97A 4XACA 1CAXA 3W58A 4HZFA 2XH6A 1GNHA 1N47A 4KBZA 4QMAA 4AVVA 3VBSB 5AFEA 1V6OA 1ZBA1 2PHUA 5FYCA 3NQHA 2DDUA 1SLBA 1JOPA 4XQDA 3USSA 3RI8A 1IS6A 1RYYA 4UI9L 5KXDA 3N4MA 1RUC3 5DQ0A 3SLIA 4QPIA 3DPRA 2ZGLA 2YMZA 4YM3A 3KSCA 5FZDA 5I8SA 2EA7A 1I3HA 3MW2A 2BVBA 2E26A 2Q1MA 3T2TA 2XJVA 5FO7B 3I2OA 3N7LA 1XC6A 4LQRA 4A7KA 1LB2A 3OUIA 1JU4A 3VL8A 3VZJA 4Q4X2 1QJFA 2DBNA 5DPNA 1ND3B 1UNBA 4QKNA 3GBFA 5FMCA 1CAWA 3NRUA 4UT5A 2DCZA 3L2YA 1VMFA 4LKEA 1W2AX 4BA6A 3UETA 4AQ6A 4FOQA 3O1TA 1UAIA 1AYM3 3OPWA 5FKBA 2CDPA 1WMXA 4NPMA 2PMWB 1NA1B 2Z5WA 2AEZA 2YY1A 4OCTA 1Y4WA 1Z7S2 5T55A 3VBUA 4O61A 4WZFA 5FY4A 4RHV1 3N35A 2WA4A 3WG4A 3DPRC 5L9VA 3E97A 3WG3A 1RUC2 1DHKB 3T4HB 4Y24A 5LEJA 5BNPB 1YFWA 2XL7A 3O14A 3WQ7A 2DF7A 3MO4A 3OGSA 4LORA 3BTXA 3HWJA 1W6MA 4FFHA 2RS31 3CBNA 3CU7A 5A3PA 3N9MA 4JAAA 3GCXA 3SCHA 1DP0A 5K0UB 5GLVA 3ST7A 1RJ8A 1URXA 4CEYA 4Y4YA 3ACHA 2EXHA 5A7NA 5LBBA 2VBPA 5J3UA 4D3WA 4IEXA 3I7DA 1RVF1 3T09A 1SBEA 2BFUL 4UWDA 4XXPA 1GP5A 3HT2A 4ZKTB 1MS4A 1ND2A 2P37A 4QM9A 4GJZA 3I2FA 4I2OA 2JJ6A 4HONA 1KGYA 2HWC1 4OLLA 4XUNA 1G86A 4QKDA 5IWFA 3JD72 2W39A 2D3SA 1CAUB 1ASJ2 3AMHA 1IG3A 1HB4A 3AMNA 2G9FA 3UESA 4BXSV 1H2NA 4J1XA 5FWJA 4NPRA 4RSUA 3RYRA 3K75B 2XL9A 3PUIA 4QGMA 2HWE1 1POV3 2GMMA 2WNEA 3LDKA 4IESA 1F8VA 1ZA4A 2DWRA 2DTYA 2EF6A 4XHBA 2XVGA 1RUG3 3Q8EA 4QPGC 2PHLA 4YM2A 4ATEA 4QU2A 1T2XA 1KRIA 3IM0A 1HB3A 3ZN6B 4LBOA 3H7YA 2D5FA 3LA3A 4LO6B 4N9HA 1LOFC 4MGZE 3NJYA 2R49A 4XJAA 1V9U3 3S5AA 1OQEA 1QJX3 4H2AA 2FZ1A 2XKOA 3NAPA 4I0AA 1F2NA 1F9KA 4BLJA 1AR71 2W5FA 1VBC3 2YV8A 3ETPA 3SH5A 2WNVC 5LA0A 3JQWA 2BYVE 4GB32 1JODA 3BGAA 1QJY1 3AP7A 1XNBA 4IV3C 2VG9A 2KM2A 4YGEA 2HEVF 4ARXA 4BQ5A 3TNQA 3HBKA 4BIFA 2ZGPA 3D4KA 4D69A 2EAKA 1SDWA 4ZXKA 5BNOC 2VQ0A 2MEV2 3MW3A 2CWMA 3R05A 4CDUA 2W3JA 5FZAA 5CAZA 3PUQA 5LA1A 1GZWB 5GM0A 1JYNA 2JD4A 4RFRB 4FBFA 5F9TA 3O0XA 5FLHA 1C8M2 5F5IA 2E33A 3F2ZA 2WYFA 4PQQA 1J1LA 4YW7A 1PNGA 2Y6FA 4YW5A 5CADA 3RZZA 4TZDA 2OX0A 1AR61 1GKBA 1H6YA 2JG9A 5FPLA 1MQTA 1CZVA 1GLHA 4JGZA 2XJSA 3VLBB 3WLUA 3ZR6A 4LO4B 3ZYFA 4XFFA 1HDKA 4UBHA 3SEEA 4A2UA 4JKMA 1AYN1 1ASJ1 1RUH1 3DXTA 1NXD1 1XE0A 2B39A 4GB33 3AYAA 2R062 4ZPIA 2A6YA 5HCBA 3AB0A 1O8PA 5K0UA 2WZR2 4KGQA 1VAVA 1J59A 4L99A 5F5CA 3ZMNA 4XXAA 3OGRA 1QQP3 5FY1A 5LY1A 2RR12 1DQ2A 4AGVA 2VE1A 3HN3A 3LE0A 1KJRA 3OSDA 3PMSA 3R4SA 1XNAA 1REEA 3QH6A 1MS3A 1LOGA 5BNNB 2JE7A 3M4FA 3NMBA 5JIUA 1UOGA 1LKNA 2Y6KA 5JDBA 1X7NA 1VBB3 1RITA 4NIAA 3WNNA 1JYXA 1EUUA 1H1MA 4IEWA 1GMMA 1LECA 1S4CA 2ZX3A 2RS32 5C3RA 4HVRA 3AZYA 3PHMA 3VZNA 2CGOA 1W04A 2OQ6A 3FN9A 4R9CA 5A3UA 5C4WA 1FXZA 1AR91 5IVEA 2OQ7A 3KQ4B 1JZ8A 4XUQA 4BQWA 1QOTA 2BWCA 1QJX2 3HN1A 1GANA 1RUE1 2WAOA 2GMEA 2WWSA 3IBMA 4AWDA 4DRVA 2Q1ZB 2ZGRA 3WF0A 2GALA 3LZZA 1REDA 4N53B 3I3DA 3THPA 1PO22 3I97A 1IZ3A 2QQPA 1JH5A 1HN0A 3WP6A 3VBUC 5GJ6A 1FAYA 4YYOA 1TEIA 2PELA 1VRH2 4V2VA 1E5HA 4OHVA 2FDJA 2K0GA 4I09A 4MGSA 3B5LB 1XBFA 4XF3A 5IK8A 1MACA 4NE9A 2YBSA 1C1FA 2OIIA 2R7EB 4CCKA 1QJEA 5EYXA 4Y1YA 1AX2A 2P3YA 4DZGA 2XJQA 3ZM8A 1C28A 3NKGA 4YZ4A 3AVSA 4RL7A 2DUQA 3AKRA 1F5FA 5FREA 4R52A 1VBB2 3KF3A 2PAMA 2WZR1 1GV9A 3KV5A 5FRAA 2FCTA 1YC61 3KCYA 3ZFGA 1QXRA 4YPJA 1UYPA 1SACA 3ZSKA 1RUG1 4BK4A 4DINB 1PO12 1RUI1 2VQUA 1K42A 3J4UH 1QH7A 3KF5A 5FQ0A 2PHRA 3K3NA 3O1VA 3PIJA 5GALA 1POV1 1Q5OA 3ES1A 1LEMA 2FMYA 4CCJA 2CTVA 1LOFA 1IPJA 1XB9A 2P3JA 4NHKA 1V6IA 3GALA 4LUKA 2WUHA 2IXLA 2QQOA 4XE9A 1H2MA 1QNWA 1WMDA 2JICA 4LEJA 4E27A 2QQWA 3DUIA 4V1PA 4CSWA 2YC0A 4AGRA 4XUPA 2VMEA 4D7YA 1GSLA 3POGA 5G05L 2R072 4IXLA 5JSRA 4CCOA 2P2KA 4AHXA 3UKTA 1BVP1 2RE9A 4TXWA 2QQJA 4A6OA 4JGYC 3Q8AA 4QQLA 3RSJA 1Y9QA 4HANA 4NRQA 5DUVA 4HK9A 3BPZA 5FUPA 3GZAA 1CZSA 1H4HA 1VBD1 3JBG3 3ZYIB 3ZXAC 4CDQB 3W5NA 2GNBA 3I2HA 4RD7A 5HPOA 4BK5A 5HBAA 3N3HA 5LA9A 2RS33 5FP4A 4D6RA 1BXHA 2VZOA 3HPNA 1XYOA 2ZPXA 1DGRN 4J6GA 2VMGA 2VMHA 1KS4A 4A44A 1WD3A 2BNMA 1NZIA 2EIBA 4IV1A 5D8AA 4A7YA 3POEA 4CEWB 3B01A 3E5XA 3VDDC 2OUJA 1PZ8A 3VBRA 1ULCA 4I3GA 1QJY2 2UURA 4LA2A 3S7EA 4RQPA 3NV2A 5BYNA 1ONAA 2R6QA 5DDJ3 2VXRA 3IPVB 4AF9A 1H9WA 3ENRA 2K46A 4PLNA 4AHWA 2GH8A 3PU8A 3ZYGA 2V73A 1ZBE2 2VUAA 4CRQA 4XIOA 4AI0A 5C8CA 4QDRA 2JG8B 5CKNA 1L7LA 1OVSA 1DYPA 5ACA2 5JXGA 3AYCA 4S2HA 5FZ9A 3SCFA 4FPYA 1UU6A 3OUJA 4JQRA 4P9XA 1C1LA 3IDAA 2EXIA 2ZOEB 4X6RB 3CKHA 1NQJA 4PLOA 3UGGA 1QDCA 4LR4A 1WCUA 1HB2A 1HQWA 3QACA 3LFMA 3LKJA 3VBRB 5FYSA 1UU5A 4CU6A 1SLAA 3E1F1 3DKWA 2W95A 3AZVA 4IGQA 3WG1A 4OI2A 4Q1PA 2WWUA 3GJAA 4G4FA 4Y1VA 2D43A 2QUOA 2HWE2 2IFWA 5EP9A 4GKXA 3PJQA 3WW2A 1W8HA 2ARAA 5FYTA 1W6PB 5J09A 2Y64A 1WMEA 3OCPA 4DUWA 3Q9OA 4Y20A 2RS51 4HSJA 1UX7A 3WOGA 5FO9B 1C4RA 1H0BA 1VBA1 4CP2A 1PHMA 3P3PA 4AZZA 1NCQA 3FLRA 1ASJ3 4Q4V1 4AL9A 1HV1A 4QPIC 4CDQA 1R64A 1RVF2 5A6YA 3RFRA 4D6QA 3WY6A 1BLZA 3A0NA 4XHXA 4Q8LA 4G9SB 3JQXA 4LLFA 3IDBB 4PIZA 5FMBA 4N90A 2WAAA 4Q0UA 1IKPA 2O8OA 5F3CA 2PHDA 2NZ9A 1XSRA 4KH9A 4WVZA 3USUA 4N43A 1A34A 1WCKA 2FDKA 1UY1A 4COWA 4JDNA 1I6XA 4Q27A 1KFUL 2X5IA 4JRAA 4NIIA 4BCUA 1A6CA 1EAH1 3VBHB 4AG4A 1S0CA 4ORFA 2QQMA 2F17A 5K4LA 5C9AC 4AI8A 2FZ2A 4JHTA 1BMV1 4XYXA 1WLDA 3NNLA 1NOVA 1OSGA 3ZSMA 1FMD1 3VZMA 1ND3C 2XVKA 2SBAA 2WT1A 3KM5A 4OZOA 5CIRA 4A4AA 1UZYA 4GWIA 3ZKUA 1COV1 2WABA 4FFFA 4LBNA 3FZ3A 4YFZA 4YVSC 2C5DA 3OGJA 4E2GA 4GXLA 4MGYE 2BGOA 5DG2A 4KU7A 4NHMA 4WM8C 4NOTA 4WVMB 1G9CA 4FTEA 1PO21 4YVSB 2JE8A 1AR73 3H3LA 1W8WA 2V4VA 2J1EA 3KV4A 4AVCA 5L7OC 3J7NA 3VHPA 4A3XA 2ZCWA 3R4UA 4AVTA 1NAEA 4AEDC 4B29A 3UJOA 1BMV2 3RMXA 4GMP3 4ZU5A 1RC6A 3FWEA 1ZRDA 2J1RA 4UFMA 3HAGA 4HKOA 5JWPA 1WW6A 3I4IA 1LOCA 1BZWA 1IHMA 3ECQA 1YWKA 5FPZA 1D2QA 2R041 5A3LA 3I2GA 1TME2 1ZZ8A 5I8TA 1S2BA 4QPGA 3FFZA 5FDBA 1W6MB 1SQ4A 1RUJ1 4FOWA 4QAWA 3ZXKA 1RHI3 4AE2A 3N7KA 4CUGA 2WNUB 1S0EA 1V9U2 4E4ZA 1K45A 1JYVA 3RG0A 2WRAA 3MIBA 3MIDA 2PYTA 4K6BA 5LK5A 3GJBA 2XJUA 4IEVA 4LOTA 5L7OA 1JUHA 1I1EA 4XF0A 2HWB3 1XSQA 5C3PA 2QKDA 1R092 5FXVA 4O7XA 3SC7X 4AVBA 1AL21 4BH9A 1A8MA 2Z69A 2HWD2 5FYIA 1R083 1G9FA 1GU3A 5A3OA 1RUD1 3H1YA 4XUOA 2HWB1 3ATGA 4DNYA 1ZA7A 4GALA 2A5ZA 3N9NA 1OKQA 1C8M1 4CDXB 4K7JA 2X10A 2O14A 2YXSA 2X5IB 4HSLA 3ZN5A 1G8WA 1TME3 2PLV2 3IWZA 3SITA 4CDQC 4Q4Y2 4YZ5A 2MNGA 5F2SA 1MZFA 1DQ6A 4BQ4A 3VN4A 3SH3A 1LOEA 4Q4X3 4S2DA 1C8M3 1AHSA 1RHI2 1AR83 2IWGB 2JKBA 1DG6A 1Q8OA 4GMP0 3K51A 3M8LA 5K8SA 3H7JA 2BGPA 3WDUA 3AFKA 1QJU3 2WR9A 2ZZJA 3GBWA 5JOWA 3U4SA 3AVRA 4PHZA 4MADA 4RHV3 4CYDA 4OHYA 4AI9A 1LU2A 2Q8EA 1HJFA 4Y1ZA 2BP6A 2Q30A 3MV11 4JKKA 3J7LA 3VBOA 1QOOA 4RGKA 2VL4A 1P8JA 1NCQC 1S0JA 2GU9A 5IATA 2Y33A 4LHNA 3TEYA 1PGW1 2G4IA 2UY8A 3AJYA 5A70A 2FCUA 4UFHA 1Q8SA 4RR3C 4MLOA 4UFKA 3FHAA 2FMDA 5FZ1A 3NNGA 3UK9A 3KV6A 4B4QA 4BB3A 1QDOA 2P1BA 2WZR3 3LAGA 3FLPA 1EUTA 4Y22B 2XDVA 1X8MA 2XQRA 2OKXA 3O1OA 1XYPA 3OF1A 3E6CC 3VBRC 4Y5Z0 1YFXA 4U2AA 4BZ4A 2JDPA 2XXZA 2DUPA 2OT7A 3AYEA 3HNYM 5JOZA 3K3OA 1VBD2 1JYWA 3V0AA 1RMU3 3V0BB 1PM7A 5DAWA 3BB6A 1EAH3 1W2NA 4CA9A 2BNNA 3AKQA 2XJPA 1YJLA 1T6GC 2PQQA 3TWIA 1PK6B 4LK6A 2BWAA 5DG1A 4OMCA 1FT9A 4LKDA 3TRSB 5FZ3A 1SLTA 2R071 4HL0A 4KWLA 4QX3A 1OVPA 4B4PA 1L3JA 3OPTA 4D0QA 1JZ6A 4IEUA 4N53A 4DB5A 3BIWE 1FMD3 1R1A2 5IVYA 4AW7A 1O3RA 4EV0A 2WFF1 3MIFA 3NNFA 4DO0A 5CFDC 3SMHA 1WA6X 1Y43B 3ZIWA 2RDSA 4LBJA 1LRHA 2EVXA 1DCSA 3OGVA 4H14A 4QXCA 3ZSJA 5F5QA 1APNA 1WLWA 1A78A 5CG8A 4KWUA 1K5MA 3AL5A 4AAPA 1D4M2 1H6XA 1PGL2 1YQ6A 4P5HA 3K4DA 4XAAA 5EHDA 2VVDA 3G6JB 1H4GA 4JTNA 4XJ9A 3VBSC 3E5QA 4QPWA 2ZTNA 4BISA 5C7GA 1XNDA 3VD4A 1DQ4A 2CDOA 4IERA 3LIHA 1FPN1 4R9AA 1X9PA 1IPKA 1W8OA 3WF1A 1EV11 1CIYA 2VCBA 4K1YA 3R0RA 3WINE 4IUGA 1PMHX 2Q1FA 3CJIC 3LDRA 5CFCB 2CGPA 2QJVA 3TNPB 5APAA 2B9VA 4GAZA 3ZFGC 3ROUA 5FZ4A 3BU7A 3LQCA 1W8UA 3EB7A 4FQ4A 1GR3A 3D82A 3J8F1 4IE0A 4LIVA 4QGNA 4WV8A 2C9AA 3KS7A 3THDA 2VO5A 3D3AA 2LROA 3UT0A 2WC2A 1COV2 1EYBA 1V6MA 4YFWA 1OLQA 1TVGA 2V4AA 1HLCA 2ZGOA 5H9QA 3EXUA 3VDAA 2LRPA 1QJX1 4BQ3A 4DPNA 2BBVA 2ETEA 3LWCA 2I74A 4Y4RA 2QE3A 5L9RA 4K40A 2W08A 3LCPA 3V0AB 4NPLA 1BEV1 1Y7BA 1EAH2 1AXKA 4META 3A7QA 2E63A 1XOYA 4Y1UA 3QCWA 2W87A 3ACFA 1PK6A 4ZY9A 4M3CB 1PGL1 2PHTA 2W46A 2YHJA 2WO3A 2P17A 3ZN4A 3HOBA 1LNSA 5JLVA 2WQZC 4WM7A 2A6WA 1RXGA 2DCJA 2RR11 4K9SA 4B8EA 2N7GA 4PT6A 4XCBA 5FZCA 3K4ZA 2ADDA 1FATA 5C3QA 5JR7B 3BVCA 3ZYJB 1MEC3 4XILA 3QH7A 3TBDA 3MLLA 2R063 1UU4A 2D6NA 4MVTA 4W8JA 4OHZA 3LEGA 3KGZA 4MSVA 1IGOA 1AYN2 4FPCA 2HWC3 4H3WA 4KI5M 2PA7A 2X53S 3WF4A 1AL23 4H7LA 4NIGA 1ODNA 4OYUA 3ZN6A 3D5OA 1L7RA 4Q26A 3U07A 1U5IA 4LHSA 1UYZA 1OPOA 1OA3A 1TQ5A 2QQUA 4C0HA 2GNMA 1NY71 1XU1A 2GP3A 1NQDA 3T2OA 5IVCA 5L36A 4SLIA 3LGRA 4C1XA 4EYUA 4AEKA 3R4DB 1DQ0A 2VZUA 3I59B 1CAVA 1MQTC 1OUSA 3ETQA 1ALYA 3DYMA 3H1MA 4C0BA 4XAEA 4YW2A 5FPBA 1QMJA 1TME1 1JHJA 4R8HA 4LE4A 3V64A 4AI1A 4Q4W2 2CHHA 2GN3A 3AP9A 5D1IA 2BU9A 5T54A 1YRZA 5FTTC 1CJDA 4JX0A 4O9GA 3IMNA 3P1IA 2WINB 2D6KA 4ONUA 2BOIA 5FR3A 2DVDA 2BERA 1R081 1A8DA 3VKLA 4UXAA 4COUA 2ZEYA 1SCSA 2VZTA 1AX1A 5GZGA 3C3VA 3B9IA 4COZA 4XF4A 4H55A 2VZPA 3L2HA 3AYDA 5EXOA 1GZTA 5IHRA 4Q2FA 3T2QA 4S2GA 1AR81 4XFBA 4B1MA 5A32A 4Z2AA 3PMEA 4L0PA 1HRV2 2W1SA 3PUAA 4BMEA 5A3WA 2JG8C 1MZ6A 5JUVA 3MF6A 1RHI1 4M3CA 2EXJA 3M7AA 3WDXA 2KR2A 4RR3B 4NHLA 3M3IA 1J3PA 1SCRA 3AXEA 3HQRA 2WNVB 2HKXA 4LXLA 5ANQA 1POQA 3W9AA 5AC91 1SLLA 3T0AA 3KVBA 1W28A 2QDNA 3NAPC 1C8NA 2A75A 2Y60A 3PJYA 4XQWA 1H2KA 1JTZX 3MFCA 4LBKA 4QB6A 3KHCA 3T1MA 2BDRA 3PNAA 1HKDA 1GOHA 3N9QA 2ZGKA 3ES4A 5FLJA 1AJOA 2L9LA 3AP5A 3EMRA 4ZS3A 2XG3A 5A33A 5LBCA 4CXYA 5LCWL 5CYYA 4IEZA 4Y20B 1VAKA 5ERLA 3FJSA 1PK6C 2NMOA 4KMQA 1AL22 2BJSA 3DF0A 3I3EA 4IEOA 4QHOA 2ZGSA 4LK7A 4XF9A 4AQSA 4PF5A 4IV3A 4JTOA 4E2SA 3E5UA 2ZACA 4I0WB 5EYYA 4N9IA 4WZCA 3UGHA 5KHKA 3PTYA 4GZ9A 2DUOA 2Y6JA 4LKFA 3T4VA 1UIJA 2VOWA 3K46A 3PUSA 1ENXA 1Y9GA 2VOVA 2WNVA 1OOPB 5JXIA 2D44A 1DYKA 5H9PA 4LIUA 1UX6A 3WQBA 2W91A 4X8NA 2Q5TA 2R1DA 1W6QA 3AK0A 1X9TA 1RUE3 3WDTA 1M06G 4Q0SA 2HWF1 3TEZA 5C71A 2VNVA 4V2WA 1PZ9A 1UCXA 2J42A 1TG7A 2I2SA 3POSA 2YPDA 5FZMA 4QU1A 3LOBA 1Q43A 2R0FA 2J22A 3ON7A 5B4NA 5A3TA 5FLIA 2RHPA 1TMF2 1QNYA 4QPIB 2HJIA 2CGNA 1VBB1 2YBPA 2AEYA 5LBEA 1GOFA 4P5YA 3D8CA 4QHZA 5CU1A 4COYA 1J3QA 1HV0A 3OBZA 4PI2A 4BIOA 1GQHA 2QQLA 3KT4A 1CAXB 5JMOA 2RS11 1YXWA 3O5SA 2QZ2A 5LEKA 5ACA1 3O7OA 4RHV2 3W20A 3BIEA 1PO13 3KCCA 1CZTA 1AR82 2VZQA 3OUHA 3WQ1A 5IVFA 4OQ8A 2FDGA 2CNAA 3GXUA 2ENRA 2HYKA 4MO3M 3ZFGB 1ZBE1 5A3MA 1SHWB 3NVCA 3IB3A 3GGLA 2DU0A 1OLME 2J1VA 1HB1A 5KWRA 1AVBA 4YW6A 4EZHA 3M70A 4RYDA 1RUE2 3O1PA 5AVAA 5GKAC 1J58A 3OD4A 1WMFA 4OI1A 4AI2A 3OBRA 5LY2A 5CVRA 4PIYA 1F4HA 2D3PA 4Y5SA 2ZEZA 2YUEA 4IE4A 4AEDB 1NA1C 1YQCA 2JENA 1QH6A 3WP3A 4UOJA 4A6SA 1RUOA 1HRI1 3KMHA 1AZDA 1WCDJ 2MEV3 3ILFA 3VGIA 4AVAA 5FZIA 3VBFB 3VD7A 1WCSA 5L7OB 2RMU3 4BHPA 1UZ0A 1UN1A 5FP8A 2ATFA 3GCWA 2WNOA 1CJPA 4LHLA 4UFLA 2IXCA 4EROA 1J83A 4OI0A 2ET1A 4P08A 5CNAA 2EIEA 1YIPA 4LULA 1LEDA 4BQ2A 5AC93 4W6XA 1XPWA 2VAUA 3U10A 1SBDA 3PLQA 5FPUA 3HQUA 1BQPA 4XBNA 5DDJ1 5EV7A 3FBMA 4H7MA 3O0WA 5C8CB 2E7TA 4XF1A 4OUEA 1MPXA 1W6QB 4QX8A 3O1RA 5FWEA 2Q8OA 2BGCA 1QQP2 2XQXA 5F6KA 4K3UA 4FPFA 1VAMA 4ZZ5A 2F6BA 4OULA 1VBC2 2A3WA 2B4KA 3OY8B 3MV01 4AFCA 2P6HA 3ZSEA 3N7JA 1FV3A 2VNOA 4BQXA 2CWSA 1W8NA 2ZX4A 3F95A 1VB4A 1O59A 1SPPB 4W50A 4NHYA 2BW8A 3UV9A 2ZX2A 3ACLA 2O1QA 3I2DA 4CUBA 3H8XA 4EN8B 5KC6A 4NWWA 4FPJA 4E8CA 2ZZQA 4L2NA 4XBLA 3BALA 1D7PM 5DUXA 5L9BA 1OUXA 3FUQA 5FV3A 1S0BA 5CBLA 1JZ5A 4CUCA 1OLRA 2FCVA 2CL2A 2VNGA 4XFHA 2A70A 2VMFA 4ASMB 4JRLA 1OA4A 2W1WA 1GICA 1C57A 1QJU1 3S7IA 1AR72 3VKMA 4FPHA 4TTGA 3IDEA 4CZSA 1SG3A 1OT5A 3FLTA 2FDIA 4ZHNA 5FYVA 4IE7A 1PMJX 1WUVA 3B94A 1F4AA 1RUF1 5FMDA 2D6OX 4IDZA 4OUSA 4A3ZA 4DY3A 2RM23 4HBNA 1YUDA 1UOFA 1H8TA 2ARCA 4YVWC 1K5MC 2E7QA 1B35B 1MEC1 3OYWA 5FZGA 5EJ1B 3I54A 3POJA 4D6SA 1RUI3 4OFGA 4PJYA 4CTEA 3X29B 3NAPB 1DF0A 3UL2A 3N9OA 1OA2A 2XLFA 2VMIA 3GBGA 3OY8A 3Q8CA 4HLTA 3ZXGA 3CNAA 2VOXA 4DXTA 3J7MA 5EWSA 3ZXDA 4RR3A 2W0XA 3CHXA 1OF3A 4LBQD 1HXS2 5FBJA 1O8SA 1SFYA 1UIKA 2ID4A 5IJRA 4OZXA 3T30A 4KQ7A 2XBO1 5DAQA 3V0BA 1DZQA 1K3IA 5FO8B 1W3XA 1OFNA 3NJXA 4R9DA 1ZM1A 4EWEA 4CP9A 3ZPOA 4OMDA 2ZAHA 3AMQA 1S0DA 1H30A 3OPZA 2B46X 1KDMA 3LA2A 4XFIA 1KITA 2R061 3HBZA 1GBGA 2VTFA 2VZSA 3OD0A 3G7DA 3GNEA 1DBNA 4QQOA 2GC2A 3ZXFA 3HJRA 1WA4A 2PN5A 1UXZA 2JDAA 3BI3A 1COV3 1PO11 1AR62 2XJTA 2FDFA 5E8AA 2TEPA 1WW5A 3OTFA 2VVFA 5JI9A 4FQZA 1DQ5A 1GUIA 2WT2A 3IZOA 3EO6A 2VC9A 1IG0A 1IS5A 3JUUA 3H8RA 1G6NA 4W4ZA 3RZHA 4DXRA 2RDQA 5FPXA 3POFA 1ZBA3 1HRI3 3RPQA 5HXMA 4U36A 3RMYA 4IL7A 1S1AA 4YG0A 3ABZA 1RUC1 1JZ3A 2IXJA 4DXZA 1UO9A 3ZYHA 5CG9A 4IETA 4NHXA 2MPFA 4ZZ8A 1HRV1 5DABA 5DZFA 2Y34A 5FZOA 4E4HA 5FP9A 4QX5A 1C3HA 4IV1B 5D8AB 5KXBA 3MEPA 4XIKA 1LHNA 4NVPA 2ORZA 3NV1A 5LASA 3FBYA 2W1QA 4HG6B 2OZ6A 3ACIA 2D6LX 3VDBA 2QQIA 5HCFA 4Q4V3 1F5JA 1Z78A 5DUWA 1LTEA 3EQEA 4MGTA 2ZKNA 4LBQA 2RS13 1UY3A 1W39A 2ZAAA 2R32A 4K8FA 1J84A 3MIGA 4A42A 5I0UA 2EICA 2G9ZA 1I9RA 3I2JA 2VUJA 2ZS6B 3AX4A 2WO1A 5FKCA 2A3YA 4XFGA 3HIFA 1RXFA 3RNSA 3NW4A 3M2MA 3RZGA 1WZXA 4RA0A 2ZHNA 5JPMB 2VJXA 3IAPA 1YNAA 5FOJB 5FZEA 2VMCA 2WLQA 5A7WB 3OEBA 5E89A 2AUYA 4AEDA 1OBNA 2RJKA 3CEWA 1NY72 3U78A 3H8OA 2JD9A 4JZRA 2AGSA 2HWF3 1ND2B 3I8TA 3L9JT 2UY9A 4HKWA 2Q8DA 1VALA 3DXUA 4M00A 3AP4A 2JDYA 3MLKA 4QDQA 4M3CE 1FYUA 2VCCA 1KDKA 1DGWX 2ZA9A 1LU1A 5FYBA 1NYWA 2EIGA 4A41A 4P9GA 4CCLA 4YM1A 1AR63 2VXJA 1QHDA 3AM2A 1Y3TA 4K8RB 3ZPYA 3CL1A 1XNTA 1LHUA 5C8CC 2NLRA 4UW6A 4ZS2A 2LW8A 1X36A 2XBO3 3ELNA 3VZOA 2BUKA 5HCHA 2QQKA 4E4DX 1IQAA 4ISRA 4QXBA 4RQPC 4AVSA 3TEWA 3T0DA 1GP4A 1H9PA 4HT1T 1W8ZA 1QY4A 2BOJA 3DKQA 1MQTB 1AJKA 1W03A 3FL7A 3U14A 3HD8B 3JBG1 4ZXEA 3USUB 3ZIXA 2NP0A 1SFNA 1EPZA 2X09A 1UKGA 1ODMA 4IEPA 2VZ3A 2ZMLA 2EAAA 2IXKA 3FFQA 5DAXA 4GWJA 1I5ZA 3RJRA 4UBGA 2X5IC 3U11A 1GZWA 3WR0A 4BMBA 2VZVA 1CESA 2QDRA 4UAPA 4FFGA 4YG6A 3AXDA 4C91A 5K9YA 4HN0A 2BRTA 2YPJA 2OS2A 1N1TA 3ORJA 5H9SA 1U0AA 1RUF3 4XPVA 2E6VA 3ACGA 4R9BA 1RUNA 4MOAA 3H3UA 2LS6A 2VCAA 2PHXA 3N9PA 2OPWA 3B9CA 3FUOA 1K5MB 3MPBA 4SBVA 1PGSA 3BYWA 3HT1A 1OOPA 4MGQA 3DPRB 1US3A 4J1WA 3BTYA 1OHFA 1N1VA 3WZ1A 3D6EA 4O65A 4BLIA 1CX1A 4ISQA 4J25A 3JB8A 3LOIA 5EPAA 1D2SA 4BWOA 5JOYA 4EWDA 5IVJA 2RR13 4HETA 4LJHA 4NWVA 2D7FA 4UFIA 3VB9A 4YG3A 4F8AA 2K2SA 3BODA 3B93A 4FXKB 2W2IA 4TLFA 3GYDA 1TE1B 3WEZA 3IDCB 3MUZ1 1SEFA 2XKPA 4YZ1A 2UWAA 4JGZB 2VU9A 2RDNA 2XLAA 1TMF3 3URFA 4MHUA 5C6CA 2P3KA 3ZO0B 3NJZA 1W9YA 3O12A 1D0GA 4CCCA 4HPKA 1ZYBA 2NMNA 1Q56A 1Z7S3 2DU1A 3I2KA 5L73A 3Q8FA 1W6NB 2OUHA 3A21A 3BUCA 1DGRA 1AYM1 1JBCA 2WWJA 3OB8A 4XW3A 1CWPA 2VBDA 1V70A 3WP4A 4F7ZA 1KEXA 3A23A 3MYXA 2XBO2 1PO23 2W1UA 3O1MA 2W92A 3LPFA 3QD6A 2DCKA 2DTWA 3EYPA 1ST8A 2D6MA 3CMGA 1W05A 3DGTA 2XWBB 2JKXA 2J7MA 1OC1A 2G1MA 3I3MA 2WT0A 3AFGA 4CU9A 2E51A 1CPMA 1AXYA 1FNZA 1PVXA 2B42B 3NNJA 4KU8A 4W65A 1QIQA 1I5PA 1JHNA 4LNVA 4NIDA 5AVPA 3O1UA 4YGBA 2P4EA 2H0VA 1VLNA 3U75A 4B4RA 3CZJA 5LWBA 1O5UA 2MEV1 1B09A 4YVWA 5IFTA 5JZGB 2ZX0A 3C8XA 4YM0A 4Y26A 3VKOA 4NMIA 3M3EA 1UYYA 1MVQA 4A7ZA 4INDA 2WBKA 4TN7A 2RMU2 2PQSA 2YZ4A 1Q8QA 3M1HA 3SHRA 2JE9A 2VW0A 4Q0VA 5JSPA 4MXWA 1JXNA 4HXCA 3GZEA 4IV1C 5D8AC 2ZJCA 3HEIA 1QJU2 4MUVA 1UPIA 4GB31 5FYZA 1UY0A 5M0TA 5FYMA 5FJKA 5FZFA 1SFPA 5A1AA 5LRRA 5FXWA 3VKFC 5LZ6A 2WFF3 4AI3A 2E53A 4JDOA 1JYTA 1OFSA 3BPSA 1MZ5A 5KXEA 2NYYA 4HOOA 2RS53 2W47A 4QB2A 2ZGUA 1KD7A 3PIGA 2WA3A 1GQPA 1LJ7A 2ET7A 2QVSB 4JKLA 3VBFA 2BBAA 3ZDSA 2GC3A 3IIAA 5J1XA 1WWYA 3NKTA 2VULA 5FUIA 4HVQA 1VR3A 2JIGA 2CSGA 2HYXA 5I0DA 3RGBA 2YB7A 3KV9A 4WVVA 4LBQB 2NPIA 1PIV1 4IE5A 5ISLA 2J1UA 1R1ZA 2HBTA 2W52A 4LITA 1XYNA 3DECA 5T3NA 2P34A 2Y0IA 5A6ZA 5LW9A 1RMU2 1VMHA 3A4UA 3BN6A 4CP1A 1VIWB 2PFWA 2PHWA 2QTWB 4LHKA 3H42B 4CCMA 1W6OB 4YW3A 3IAQA 4DEQA 4QWNA 1J3RA 2DVBA 1E5IA 4YW4A 4MV2A 5F8PA 4Q5OA 4GJYA 1VP6A 1KXGA 2A6VA 4XMAA 4RGAA 4QM8A 3WX5A 2A7AA 2JDUA 5IK5A 2DCYA 2VQAA 5FY7A 5KR7A 3INAA 2JX9A 4L97A 5C8WA 1V9U1 4RQPB 3LEIA 3B69A 3KWVA 4JV4A 2J1SA 3OBTA 4WBBA 3VD5A 3VHNA 1UZVA 4QQHA 5J98B 1D4M3 1FOD1 4B1LA 4C8DA 4CDWA 1H1AA 2GN7A 4QXHA 4XETA 2Q4SA 4Q8KA 1RB8G 3S5QA 3U37A 5GZCA 2R042 5HV4A 1CQ9A 2WL1A 2IXIA 2XUEA 3VV1A 3ZMOA 1HRI2 1NA1A 1JZ7A 2WIIB 3SXWA 3MW4A 1BEV2 1LR5A 4PDWC 4XZUG 1H1IA 2DVFA 4L11A 4GWMA 2WZEA 4R4ZA 4XVHA 3TN93 4YARA 1VBD3 2V5YA 3WD5A 3M3OA 2GC1A 5F3EA 4AFMA 3U0ZA 4DIQA 4QGLA 4XBQA 4EZ4A 2VQTA 4B7KA 2RM21 1WLCA 5A1LA 2JDKA 5HCAA 1HXS3 1Z7S1 4PI0A 5FP3A 2JG8A 3AJZA 3H9AA 5T50A 3POYA 3VDDB 3WG2A 1V6JA 2VZ1A 2YGMA 4XTMA 1REFA 3QBQA 1BBT3 1W90A 3E6DA 3MHZA 2RS12 3WNMA 5CA6A 3BTAA 3DYPA 1UPSA 1UMZA 1LHWA 1AXZA 1AR92 2UYBA 3N36A 2G9GA 2YU2A 4RN5A 1NCQB 4FFIA 3VZLA 4E2QA 5EFUA 4Q4X1 1QXJA 1OQDA 1VE0A 2JEMA 4B7EA 5KHIA 1U5YA 5FYHA 5T52A 3S30A 4JVAA 1NKGA 2VCMA 4L9BA 2QQVA 5DZEA 2ZHMA 4JHZA 5FIXA 1KJLA 1DU3D 1XU2A 3UYJA 4CCDA 1WGPA 1WW4A 1ULDA 2YC4A 2HWF2 4F3JA 4PBPA 1W9SA 1JMUB 2NN8A 4CPBD 3CJXA 5IAVA 4LO5B 1ZBA2 2X8KA 3ILNA 3ZLIA 3TYJA 4Y1XA 3I3QA 3RWNA 4XQ4A 1PX3A 4Y22A 4DUXA 3FHIB 1MR5A 1YO8A 3S0MA 1X33A 2VUCA 1D4M1 1FOD3 4NUBA 4DMIA 1W06A 1VPHA 4XFCA 3RZKA 4NAMA 2ES3A 1HXS1 3NL1A 4XDQA 4XZPA 3K2OA 1QWRA 4YGDA 2ERFA 4XCAA 3SKVA 4BDVB 1K5JA 5A6XA 5JCTA 3M3QA 1W3VA 5FZLA 5GLWA 3LPGA 1S0GA 3N7MA 1T6BX 3PUHA 1WBFA 4N7IA 2R043 4FPGA 3TN91 5J37A 2A73B 5FZ6A 1O4ZA 1OI6A 1PNFA 2OA2A 1US2A 4MHRA 1IPSA 3GDBA 5FQ0B 1XQNA 4LPLA 4CEWA 2XLGA 3H0OA 4GMP1 5A3NA 1JOBA 3PVOA 4Q0PA 5B2GB 3D0SA 5FY5A 5H9RA 5FZKA 2Y6GA 2CY6A 4FSJA 1SLCA 4LBLA 5F32A 3UKNA 2XR4A 1E5RA 1PZ7A 3VZKA 1W2UA 3C7OA 1OD3A 2YGLA 3MF9A 3MUY1 3HNBM 4FTBA 4FCAA 3I3BA 4AXOA 2RG4A 5F37A 3IMMA 3MBWA 3VBSA 4YRDA 5LBFA 4DXSA 1X8EA 3B00A 1B35A 4IGPA 5I0RA 1UKRA 2EALA 3KT7A 3THTA 1MEC2 3FMGA 3ZR5A 3K4AA 1JS9A 5AC92 2LM3A 2JB4A 2WO2A 1LESA 4KL1A 1GZCA 2WZ8A 1ZZCA 5L19A 2WJSA 1RGSA 1RUF2 2A3XA 2XONA 3ZFEC 4YZ2A 1SBFA 1Q8PA 3ITQA 2B9UA 1X82A 1K12A 3JBG2 2CU5A 3GHNA 3J7HA 4FOVA 2XB6C 4XJUA 5JVVA 2OW4A 2WO7A 3DYOA 3OGGA 1EPWA 4K21A 5ANNA 2X05A 3WF2A 1XJAA 3J26N 3WW1A 1UZWA 2WS92 4NIHA 4ZONA 4CXWA 2FD8A 5BNOB 2JIJA 3PDQA 4XMIA 2WNUA 3AKTA 3LB9A 5LK7B 4URAA 5IK4A 1ZZ9A 3I2IA 5BNPA 2BNOA 3PU3A 4CEYC 5B4XA 4YZ3A 3TAYA 1QJZA 1RJ7A 1UXXX 1NCRB 1DYOA 1QQP1 5F7UA 4Q4W1 4CEYB 3MGUA 4F83A 4YW1A 1UOBA 5F3IA 2BFUS 1D0HA 4LE3A 3JD71 4YNIA 1JI6A 4AGGA 1ZBE3 4NN0A 3CF6E 5CFCA 1VBE3 1ULEA 2JB8A 4HMZA 4MGKE 5FZ7A 3VD9A 1HRV3 1POV0 2R30A 2BTVC 5F5AA 4KNCA 1JN2P 4LLOA 4DUVA 1WD4A 5DAVA 4Z8BA 4Q1RA 3WCSA 3NV4A 4GQ7A 2XHKA 1S55A 1FI2A 2WLPA 1JU3A 3KQRA 3H1WA 2XWJB 4UW4A 1CPNA 1R091 5BNNC 3AL6A 1O91A 4XJZA 1ENRA 3T0BA 2IFRA 3VKNA 3ZXJA 1RIRA 2A71A 3GZTB 5BNNA 3VHRA 5FMOL 2B7YA 4NR1A 4CDWB 2P3IA 5CB7A 1W0PA 3LF7A 3POIA 2AC1A 3MIEA 3P6BA 2A1XA 1BK0A 2ZBJA 1SLIA 1LGCA 3FX3A 3WW3A 1CVNA 5C9AB 4CP9B 4AHZA 4QD2A 4OHWA 3WUCA 3AZXA 1YCIA 1UW8A 1LGNA 2IVJA 2R16A 5FAXA 5J48A 4LT5A 4GKYA 5C5TA 4XDOA 2ARBA 2VR4A 4E8DA 2YBKA 5BNQA 1SZBA 3VDDA 3HNMA 1YI7A 2VMDA 3VBUB 5KXCA 1A3KA 5J36A 3OJBA 4WM8B 1NCRA 3AZWA 1G7YA 2ZGTA 3ZYBA 1IKQA 4FOYA 3LD8A 3RRDA 1V00A 2JECA 4FPOB 5IUQA 1RVF3 4PBOA 3SKJE 5BNPC 2Y6LA 3CQOA 1JUIA 5JPNB 3EBRA 1QU0A 1TMF1 2GNDA 2H6BA 3J9SA 4BE3A 4TLGA 4PCRA 1J1TA 2E7AA 4KG8A 4CUAA 4P9LA 3U1XA 2KA3A 2ZABA 2WN2A 4N43B 3WP5A 1H8TC 5LA2A 2HH9A 2JDNA 1ZZ7A 2GP5A 1B35C 2GSYA 2VD7A 2D5HA 1CAVB 4XC9A 4QB1A 5BV6A 5C3SA 1YFUA 3WXPA 4DOUA 1VBE2 1RUD3 1UY2A 4N8MA 3H3ZA 3ZFEA 1W9FA 5CFDA 1OQ1A 2V5DA 2WNUC 4IE6A 2VY0A 1OD5A 4LO8A 1Q8VA 4MXWB 3KB5A 2KD7A 1LENA 4ET7A 3LDBA 3PVNA 1BBT1 3NO8A 1MZEA 3P3NA 2R0HA 4GULA 2DVAA 4IQPA 4KWJA 4DY5A 3MLJA 1CN1A 2WQ8A 3GM8A 5A33B 1DIWA 1CIWA 3WSOA 4QPYA 4YLZA 2WFF2 1F15A 3DEMA 4Q0QA 4LOSA 4Q4V2 2RDRA 4L92A 1O3TA 1YQ5A 4WM8A 1ZREA 3SCGA 1VBE1 3WDVA 4QPGB 4OUMA 2Q8CA 1ENQA 2ADEA 3ME2A 1NG0A 5JZGC 1GWMA 4QDSA 4Z2WA 5HI0A 2BVVA 4TYSA 5SV5A 1ULOA 2NM1A 3WVJA 3NV3A 3CIHA 4CVUA 3JCIA 4EWAA 4CEWC 1CR7A 3ZYRA 3OG2A 1NLQA 4GWNA 1PVC3 3OBAA 5F6LB 2J1AA 1R093 2OXBA 4PLMA 2ZGMA 3RS6A 3GHMA 2XVLA 1LHOA 4YWAA 3RYPA 1R082 3CJIB 5TSWA 4EN7B 5CFCC 5T5PA 4FI9A 2FQPA 4WM7B 3ZFFA 5AFBA 3ZFEB 3H8UA 1ZX5A 3KLSA 1MS0A 5K7PA 1NE4A 4K1ZA 1CONA 2IZWA 1TZOA 3B7MA 1SDDB 4EN9B 3RWKX 3MICA 1AR93 4XABA 4N7UA 1OLMA 3EJKA 2E9QA 1MS8A 3AC0A 4EQVA 3DCQA 1WBLA 4AAXA 4Q4Y1 4QQ2A 2ZGQA 1ND3A 2ZHLA 1EV13 3A0KA 5CZKA 3WDYA 3ALQA 4A45A 1O3SA 1O4TA 3ILRA 1MS5A 2TBVA 1CX4A 5KBFA 2JDZA 2VOKA 4M4RA 1ULFA 1FPN3 4D7TA 2YG0A 1ZRFA 1BEV3 2D40A 3CO2A 1JW6A 3KD4A 3LA7A 2Y38A 5F2WA 1G9AA 3RVHA 1OXCA 2BPA2 2PHFA 2B45X 1W9WA 4KWKA 1RUD2 5FZOB 4RFT0 2VW1A 2WYSA 2P5BA 2HWD1 4ARYA 5JI7A 3RI9A 3IKWA 4P9IA 3WNPA 3ZOIA 1O5LA 3EHKA 3T2PA 4DS0A 3WCRA 1HQLA 4P9WA 5LB6A 4AFBA 4AQTA 1YLLA 4AR2A 3BTZA 4Y3OA 2WSUA 4P9JA 2JG9C 2IC1A 4P00B 1UZZA 3LSEA 1E57A 2XMLA 3FHQA 1W0NA 4FO9A 4TWTA 4CE8A 2I45A 2WN3A 5FOBB 1VBC1 3ZX7A 4COVA 4FP2A 4HPKB 2OZJA 3JB4C 4MG2A 1C5IA 2SLIA 2R073 1XE7A 5F1RA 1YHFA 1ZNPA 2E31A 4Q29A 1RUI2 3C7HA 2DVGA 4PDWA 2B5HA 1BBT2 4I30A 5DDJ2 4E9KA 2Z2SB 4ITCA 2EXKA 3SNMA 3ZFFB 5A80A 2E32A 5C5UA 1XXNA 1WKYA 2OVUA 4XOGA 3RYKA 3LSDA 1WLTA 2EIDA 1KFXL 1SMVA 2IXHA 1MS1A 5FY0A 3AKPA 1RMU1 3V65A 1ZRRA 4AFDA 4P14A 3O1SA 5EZWA 2VZRA 3VBHC 1PX4A 2PXJA 3TB0A 4PIXA 4B3NA 1OPMA 3MI8A 4XTPA 4CDWC 3GF6A 2WZPP 1EY2A 4CCNA 3QLQA 2YYOA 2VPVA 3WNXA 2GDFA 2DCTA 1U5XA 4DRRA 3WHUA 4AEJA 2RVAA 4CU7A 2HWE3 5EJ3A 2WSVA 5DZGA 1RUG2 5E6HA 4CCEA 2GNTA 2TNFA 4BQYA 4E4SA 3SH4A 1G9BA 5FBZA 2UYAA 3TEXA 2V09A 2RJ2A 3WF3A 1ZRIA 4AYUA 3CLPA 3C2UA 4M0NA 3THCA 2HEYF 1QOSA 3W59A 3WQ0A 1TNFA 1FMD2 3PTRB 5C9AA 1UMIA 3PVBB 1LHVA 1S2EA 5JXJA 4LA3A 4FTSA 1PVC1 3WHTA 1FPN2 4HK8A 5FK7A 4JQTA 1OMIA 3AMMA 1H8VA 4N43C 1VRH1 1H8TB 3KCXA 3RZJA 3A22A 2DFBA 1O6UA 2YDEA 5IVBA 5ABJC 4MGIE 2G19A 5GZDA 3C7GA 4GH4B 3KGLA 1V6KA 5DMYA 1JZ4A 4I01A 5ABJB 2LTNA 3T1LA 3C7FA 2BZDA 2RV9A 4QQPA 4FVVA 5A7WA 1S0IA 2UU8A 3DN7A 2VGDA 3IPVA 4D94A 1UMHA 3PURA 5FUNA 5A7SA 1IQDC 4MZUA 2KXLA 5IYYA 1HIXA 4CPBA 1VBA2 2QFEA 2DURA 4QHBA 4RGGA 3WV6A 4MH0E 1RUH2 1GQGA 1L7QA 1ULPA 4JGYA 1RTVA 4M0HA 2A6XA 3S57A 2AENA 5DN2A 4BXFA 2ILMA 4XJWA 4AK3A 4XJ8A 5FPVA 1BYHA 2AH2A 2ZEXA 1ACCA 4NRPA 2QQNA 4Z92B 2QZ3A 3APBA 4HN1A 4X6QB 3HQXA 2JDHA 4I3PA 3T3YA 1W2TA 1WCQA 4EN0A 5IFPA 1D4VB 1AYM2 1LOBA 3I59A 4ZU7A 4ZU4A 4AEMA 1R1A1 2W68A 4CU8A 4X8PA 2B8MA 1HQNA 2OYZA 1GOGA 1OURA 2AREA 3ZVXA 1NX9A 2BEOA 4FP3A 2RS52 3DL3A 1AL0G 1UF2C 4Y33A 5BUVA 4QKBA 4P02B 2HEWF 3POWA 4Z82A 4UYBA 5FCCA 2WDBA 1V0AA 4S2FA 2GH2A 2XOMA 5FZ0A 5BXXA 2D93A 4XEZA 1H2LA 1UQXA 1UYXA 3H50A 4QT6A 2W9XA 2XUMA 4W6YA 4NROA 4FAGA 5DXDA 1VRBA 4DQAA 1DGLA 2ZHKA 5E1RA 5EQUA 5FMOS 5BPXA 4QX7A 2WS91 3BOWA 3E6BA 3VBHA 4D8MA 5A1FA 1PIV3 3DV8A 1YIFA 4R4XA 1F31A 4NRMA 5T5JA 2NQYA 4AOCA 4MXVA 3S6PA 2HLEA 2H6CA 4TSVA 5FY8A 5JXHA 3RQ0A 3ZDVA 4WM7C 2GZWA 4OI4A 4C90A 5CKMA 1OKOA 1QGLA 1DZTA 5IK7A 2VTXJ 1QF3A 1DQ1A 1PGW2 2O0OA 1GWKA 5CISA 2GAUA 3BU0A 4HVOA 3HMYA 3W21A 1STMA 2GMPA 4BU2A 5F39A 1YI9A 2ZMNA 4BOWA 2PAEA 1YQ8A 4OHXA 4Q4W3 3OEAA 5A7PA 3M3CA 2PAKA 3BOPA 4C1WA 1DZRA 1FNYA 3P5BA 4I0BA 3POBA 1HW5A 3W5MA 2BV4A 1BK1A 3LIGA 2ZGNA 4CP0A 4FAHA 2PLV3 4ES8A 2AR6A 2YFUA 3VHOA 2Z4FA 3VBFC 2ARXA 2Y26A 1N3QA 3RJ2X 1ULGA 4RS5C 4QX0A 3NNMA 2RJLA 1UD1A 5E16A 3MZHA 4BQ1A 2JDMA 4QX2A 3WNOA 2PLV1 2JG9B 4Q4Y3 1DGWA 3KVAA 1N3OA 3TN92 1UY4A 1FOD2 2C0ZA 2CAVA 3IT8A 3J8F3 2Z79A 1LOAA 1NLRA 4P9YA 1W2OA 4PF1A 2D98A 2ZX1A 3VDCA 3CJIA 3WDWA 1M4WA 3JXSA 1DLLA 3MIHA 5BY5A 3U4XA 5ABJA 4DEVA 2HWB2 1OOPC 3JD73 1BKZA 4HFSA 3KT1A 1RINA 3AMPA 5A32B 4AFAA 4PQ9A 2HWD3 2MHFA 2ZEWA 3NWKA 1TNRA 5FZ8A 4OQ9A 5I0TA 2VUDA 5T5OA 4CXXA 2VH9A 5KHJA 1W8TA 2DV9A 4QX1A 5IVVA 3ZFFC 5JOXA 2ZKLA 3LEMA 1FX5A 5JIAA 4FPLA 1VJ2A 1GFF2 1YQ2A 4LUMA 2F4PA 5DUUA 2F4LA 3LEKA 4LBMA 3RZLA 1N1YA 1WW7A 2LUWA 3GZUC 3WNLA 4CDUB 1PIV2 3VL9A 4XURA 3ZXLA 4CDUC 1GZ9A 1OF4A 3C7EA 3ASIA 3OYWB 4JCKA 5I8YA 1BCXA 5GZFA 4NO4A 1KS5A 2IVIB 4LKSA 2YFZA 3AP6A 3IN9A 2DBIA 3FE5A 4XUTA 5D21A 4M4PA 2VNRA 2C1FA 4N53C 3N9LA 1DLCA 1SPPA 3HVDA 1AUYA 4WVWA 2VM9A 3J8F2 2YC2A 5FY9A 4PDWB 4BPZA 2Z42A 4M01A 3VUOA 1KQRA 4FT8A 2PTMA 4FPEA 4JDMA 3WT3A 1PVC2 3JZVA 2C6SA 3Q8BA 3VBOC 2IUWA 2AYHA 4IEQA 1HN1A 3SISA 5C4WC 1QXPA 1W99A 1YYNA 4UFJA 4EJRA 1R1A3 3VBOB 2WFPA 4DFSA 1XNCA 1ZZBA 3T08A 5C4WB 5G04L 5GZEA 2TUNA 5KHHA 5FP7A 1GNYA 4YGCA 3NSTA 1IS4A 5DAPA 3I49A 1FV2A 2WS93 3UJQA 1W9TA 1W6OA 4UW3A 5C3OA 2WQ4A 3HR9A 5D2AA 3R6SA 1DFQA 1AX0A 5EIYB 2K9ZA 1GNZA 1HJGA 1O7FA 2YU1A 4QXKA 5FXXA 2CYFA 5I93A 2UWCA 1CD3G 2W94A 4GH4C 1GWLA 1EV12 2VVEA 3FC0A 1GP6A 3SEPA 2FHRA 4URTA 4HKLA 5FYYA 4EE2A 1Q3EA 2X29A 3LFIA 4LTAA 1JZ2A 4CDXA 5K0UC 2VW2A 2XPJA 4ES9A 4GD4A 5IT6A 1C5HA 2C24A 4D7SA 3ZSLA 5GLZA 1CGPA 3CDZB 4UW5A 2QCSB 2Y8KA 4KG0A 5FZBA 2XJRA 2V72A 1S0FA 2D3RA 3PL0A 4JGZC 4MX3A 3MDPA 5EJZB 2LALA 1PM4A 2R1BA 2AZ5A 3MFAA 4IGOA 3IIIA 1IS3A 3BCWA 1VRH3 1ENSA 1OH4A 1MVEA 4UF0A 5F3GA 5I0SA 2H0BA 4BM8A 2WKKA 1W0OA 5SV8A 1F35A 4IW3A 1LAJA 5FZHA 1Y9MA 4LO7A 3QOPA 4JC1A 5BNOA 4CDXC 1YFYA 5LATA 4WVMA 5FJHA 2QNKA 3CZUA 3PVEA 4ASLA 5JSOA 4OVEA 3MPPG 2VECA 1LGBA 2ZMKA 2XHNA 3D0JA 4FXGB 1UOJA 4GH4A 4JGYB 3UGFA 1XRUA 1E5SA 2Q0AA 1BHGA 3KHBA 4Z1VA 3JU9A 2O8QA 3K48A
chains in the Genus database with same CATH topology
1W6NA 4KBBA 5T5LA 3B02A 4FPKA 1U12A 3RDIA 4I02A 1QKQA 3AZZA 1BVVA 4GA9A 1YJKA 3ZXEA 2FBEA 1IOAA 3O0VA 2D6PA 1U5ZA 1AF9A 4L8QA 4ATFA 4BYYA 4YVSA 5JAXA 5FFOC 3UKVA 1EP0A 4M3CF 2DYCA 1LULA 1NXMA 2CV6A 1RUJ3 1ZRCA 3B3QE 1CAWB 5HXVA 1PMIA 2RM22 5E88A 2UWBA 4Z07A 1V6LA 4YVWB 5JZGA 4MYEA 2I07B 5LRSA 1JYCA 4G3YC 1RL3A 1HX6A 2Y0OA 4IV3B 5GLUA 2XGXA 1V6NA 5KC5A 4K20A 1XE8A 2CAUA 5KHGA 2RMU1 2OPKA 1N3PA 3AKSA 2A6ZA 4RS5B 5I91A 2YROA 4IEYA 4XFAA 1JYIA 1GYKA 1G9DA 1BJQA 3WW4A 1CAUA 4YSFA 4EN6B 1NE6A 3V56A 1NLSA 4AHYA 1JOJA 1ZZ6A 1ND2C 1LCLA 1O4YA 4KGGA 5J7MA 4GIQA 1UL9A 4W6WA 3ZYPA 2DFCA 1O3QA 1NCRC 1S2KA 3KZ4C 5CFDB 2GC0A 1VBA3 1N1SA 1RUJ2 1AYN3 1MS9A 1XNKA 3TOJA 1RUH3 5GLTA 2JXAA 1QJY3 3WUDA 1NZCA 1VB2A 1ZVFA 1DDLA 4AQ2A 5JMCA 1LODA 1W6PA 1Z0HA 1X50A 5ACA3 4RS5A 2BQPA 4O9EA 5C33A 2HWC2 2D97A 1CAXA 3W58A 4HZFA 2XH6A 1GNHA 1N47A 4QMAA 4AVVA 3VBSB 5AFEA 1V6OA 1ZBA1 2PHUA 3USSA 3ZYIB 4XQDA 1SLBA 3RI8A 1IS6A 5KXDA 3N4MA 1RUC3 3SLIA 4QPIA 3DPRA 2ZGLA 2YMZA 4YM3A 3KSCA 5I8SA 2EA7A 1I3HA 3MW2A 2BVBA 2Q1MA 3T2TA 2XJVA 5FO7B 3N7LA 4A7KA 1LB2A 3VL8A 3VZJA 4Q4X2 1ND3B 3GBFA 1CAWA 2DCZA 3L2YA 4BA6A 4AQ6A 4FOQA 1UAIA 1AYM3 1NA1B 2Z5WA 2YY1A 1Z7S2 5T55A 4WZFA 4RHV1 3N35A 2WA4A 3WG4A 3DPRC 3E97A 3WG3A 1RUC2 1DHKB 4Y24A 5LEJA 5BNPB 1YFWA 2XL7A 3O14A 3WQ7A 2DF7A 3HWJA 1W6MA 2RS31 3CU7A 4JAAA 3SCHA 5K0UB 5GLVA 3ST7A 1RJ8A 1URXA 4CEYA 4Y4YA 2EXHA 5J3UA 4D3WA 4IEXA 3I7DA 1RVF1 1SBEA 2BFUL 4XXPA 3HT2A 4ZKTB 1MS4A 1ND2A 2P37A 4QM9A 4I2OA 2JJ6A 2HWC1 4OLLA 1G86A 3JD72 2W39A 2D3SA 1CAUB 1ASJ2 3AMHA 3AMNA 2G9FA 1H2NA 4J1XA 4NPRA 4RSUA 3RYRA 2XL9A 4QGMA 2HWE1 1POV3 2GMMA 2WNEA 4IESA 1F8VA 1ZA4A 2DWRA 2DTYA 2EF6A 4XHBA 2XVGA 1RUG3 4QPGC 2PHLA 4YM2A 4ATEA 4QU2A 1KRIA 3IM0A 3ZN6B 4LBOA 3H7YA 2D5FA 3LA3A 4LO6B 4N9HA 1LOFC 4MGZE 2R49A 4XJAA 1V9U3 1OQEA 1QJX3 2FZ1A 2XKOA 3NAPA 4I0AA 1F2NA 1F9KA 4BLJA 1AR71 1VBC3 2YV8A 3SH5A 2WNVC 3JQWA 2BYVE 4GB32 1QJY1 3AP7A 1XNBA 4IV3C 2VG9A 2KM2A 4YGEA 2HEVF 3TNQA 4BIFA 2ZGPA 3D4KA 4D69A 2EAKA 1SDWA 4ZXKA 5BNOC 2VQ0A 2MEV2 3MW3A 2CWMA 3R05A 4CDUA 5CAZA 1GZWB 5GM0A 2JD4A 4FBFA 5F9TA 3O0XA 5FLHA 1C8M2 4TZDA 1J1LA 1PNGA 4YW5A 5CADA 3RZZA 1AR61 1GKBA 2JG9A 1MQTA 1GLHA 4JGZA 2XJSA 3VLBB 3WLUA 4LO4B 4XFFA 1HDKA 4UBHA 4A2UA 1AYN1 1ASJ1 1RUH1 1NXD1 2B39A 4GB33 3AYAA 2R062 2A6YA 5HCBA 3AB0A 5K0UA 2WZR2 4KGQA 1VAVA 1J59A 4L99A 3ZMNA 4XXAA 1QQP3 2RR12 1DQ2A 4AGVA 1KJRA 3PMSA 3R4SA 3QH6A 1REEA 1MS3A 1LOGA 5BNNB 2JE7A 3M4FA 5JIUA 1LKNA 5JDBA 1X7NA 1VBB3 1RITA 1H1MA 4IEWA 1LECA 2ZX3A 2RS32 4HVRA 3AZYA 3PHMA 3VZNA 2CGOA 4R9CA 5C4WA 1FXZA 1AR91 1QOTA 2BWCA 1QJX2 3HN1A 1GANA 1RUE1 2WWSA 2GMEA 3IBMA 4AWDA 4DRVA 2Q1ZB 2ZGRA 2GALA 3LZZA 1REDA 4N53B 3THPA 1PO22 1IZ3A 2QQPA 1JH5A 3WP6A 3VBUC 1FAYA 4YYOA 1TEIA 2PELA 1VRH2 4OHVA 4XF3A 2K0GA 4I09A 5IK8A 3B5LB 1MACA 1C1FA 2OIIA 5EYXA 4Y1YA 1AX2A 4DZGA 2XJQA 1C28A 3NKGA 4YZ4A 4RL7A 2DUQA 3AKRA 1F5FA 5FREA 4R52A 1VBB2 3ZFGA 2WZR1 2PAMA 1GV9A 5FRAA 3KCYA 1QXRA 1SACA 3ZSKA 1RUG1 4DINB 1PO12 1RUI1 3J4UH 1QH7A 5FQ0A 2PHRA 5GALA 1POV1 1Q5OA 3ES1A 1LEMA 2FMYA 2CTVA 1LOFA 1IPJA 2P3JA 4NHKA 1V6IA 3GALA 4LUKA 2IXLA 4XE9A 1H2MA 1QNWA 1WMDA 2JICA 4LEJA 4E27A 3DUIA 4V1PA 2YC0A 4AGRA 4D7YA 1GSLA 2R072 4IXLA 5JSRA 2P2KA 4AHXA 3UKTA 1BVP1 2RE9A 4JGYC 4QQLA 3RSJA 1Y9QA 4HANA 5DUVA 4HK9A 3BPZA 3GZAA 1H4HA 1VBD1 3JBG3 3ZXAC 4CDQB 2GNBA 4RD7A 5HBAA 3N3HA 2RS33 1BXHA 1XYOA 2ZPXA 1DGRN 4J6GA 2VMGA 2VMHA 1KS4A 4A7YA 1WD3A 2BNMA 4IV1A 5D8AA 4CEWB 3B01A 3E5XA 3VDDC 2OUJA 1PZ8A 3VBRA 1ULCA 4I3GA 1QJY2 2UURA 4LA2A 3S7EA 4RQPA 3NV2A 5BYNA 1ONAA 2R6QA 5DDJ3 2VXRA 3IPVB 4AF9A 1H9WA 3ENRA 4PLNA 4AHWA 2GH8A 3ZYGA 2V73A 1ZBE2 2VUAA 4CRQA 4XIOA 4AI0A 5C8CA 2JG8B 1DYPA 5ACA2 3AYCA 4S2HA 3SCFA 4FPYA 1UU6A 4JQRA 4P9XA 1C1LA 2EXIA 2ZOEB 4X6RB 1NQJA 4PLOA 1QDCA 4LR4A 3QACA 1HQWA 3LKJA 3VBRB 1UU5A 1SLAA 3DKWA 3AZVA 3WG1A 4OI2A 4Q1PA 4G4FA 4Y1VA 2D43A 2QUOA 2HWE2 2IFWA 4GKXA 3PJQA 3WW2A 1W6PB 5J09A 1WMEA 3OCPA 3Q9OA 4Y20A 2RS51 4HSJA 5FO9B 1C4RA 1H0BA 1VBA1 4CP2A 1PHMA 3P3PA 1NCQA 3FLRA 1ASJ3 4Q4V1 1HV1A 4QPIC 4CDQA 1RVF2 3WY6A 3A0NA 4XHXA 4Q8LA 4G9SB 3JQXA 4LLFA 3IDBB 4PIZA 4N90A 4Q0UA 1IKPA 2O8OA 2PHDA 2NZ9A 4WVZA 4KH9A 3USUA 4N43A 1WCKA 4COWA 4JDNA 1I6XA 4Q27A 1KFUL 2X5IA 4JRAA 4BCUA 1A6CA 1EAH1 3VBHB 4AG4A 1S0CA 4ORFA 5C9AC 4AI8A 2FZ2A 1BMV1 4XYXA 1WLDA 1NOVA 1OSGA 3ZSMA 1FMD1 3VZMA 1ND3C 2XVKA 2SBAA 2WT1A 3KM5A 5CIRA 1UZYA 1COV1 4LBNA 3FZ3A 4YFZA 4YVSC 2C5DA 3OGJA 4E2GA 4GXLA 4MGYE 5DG2A 4KU7A 4NHMA 4WM8C 4NOTA 4WVMB 1G9CA 4FTEA 1PO21 4YVSB 1AR73 4AVCA 5L7OC 3VHPA 4A3XA 2ZCWA 3R4UA 4AVTA 4AEDC 1BMV2 4B29A 3UJOA 3RMXA 4GMP3 4ZU5A 1RC6A 3FWEA 1ZRDA 3HAGA 4HKOA 5JWPA 1WW6A 3I4IA 1LOCA 1BZWA 1IHMA 3ECQA 1YWKA 5FPZA 1D2QA 2R041 5A3LA 1TME2 1ZZ8A 5I8TA 1S2BA 4QPGA 3FFZA 5FDBA 1W6MB 1SQ4A 1RUJ1 4FOWA 3ZXKA 1RHI3 4AE2A 3N7KA 2WNUB 1S0EA 1V9U2 4E4ZA 3RG0A 3MIBA 3MIDA 2PYTA 4K6BA 5LK5A 5L7OA 2XJUA 4IEVA 1JUHA 1I1EA 4XF0A 2HWB3 2QKDA 1R092 4AVBA 1AL21 4BH9A 1A8MA 2Z69A 2HWD2 1R083 1G9FA 1RUD1 3H1YA 2HWB1 3ATGA 4DNYA 4GALA 2A5ZA 1OKQA 1C8M1 4CDXB 4K7JA 2YXSA 2X5IB 4HSLA 3ZN5A 1G8WA 1TME3 2PLV2 3IWZA 3SITA 4CDQC 4Q4Y2 4YZ5A 2MNGA 1MZFA 1DQ6A 3VN4A 3SH3A 1LOEA 4Q4X3 4S2DA 1C8M3 1AHSA 1RHI2 1AR83 2IWGB 2JKBA 1DG6A 1Q8OA 4GMP0 3K51A 3M8LA 5K8SA 3H7JA 3WDUA 3AFKA 1QJU3 2ZZJA 3GBWA 5JOWA 4RHV3 4CYDA 4OHYA 1LU2A 4Y1ZA 2Q30A 3VBOA 1QOOA 1NCQC 1S0JA 2GU9A 4LHNA 1PGW1 2G4IA 2UY8A 3AJYA 1Q8SA 4RR3C 4MLOA 3UK9A 2FMDA 4B4QA 1QDOA 2WZR3 3LAGA 3FLPA 4Y22B 1X8MA 1XYPA 3OF1A 3E6CC 3VBRC 4Y5Z0 1YFXA 4U2AA 4BZ4A 3AYEA 2DUPA 3V0AA 5JOZA 1VBD2 1RMU3 3V0BB 1PM7A 3BB6A 1EAH3 2BNNA 3AKQA 2XJPA 1YJLA 1T6GC 2PQQA 3TWIA 1PK6B 5DG1A 2BWAA 1FT9A 3TRSB 1SLTA 2R071 4HL0A 4KWLA 4B4PA 1L3JA 4IEUA 4N53A 4DB5A 3BIWE 1FMD3 1R1A2 4AW7A 1O3RA 4EV0A 2WFF1 3MIFA 5CFDC 3SMHA 1Y43B 3ZIWA 4LBJA 1LRHA 2EVXA 4H14A 3ZSJA 5F5QA 1APNA 1WLWA 1A78A 5CG8A 1K5MA 1D4M2 1PGL2 4P5HA 2VVDA 3G6JB 1H4GA 4JTNA 4XJ9A 3VBSC 3E5QA 2ZTNA 1XNDA 1DQ4A 4IERA 1FPN1 4R9AA 1IPKA 1EV11 4K1YA 3R0RA 3WINE 3CJIC 5CFCB 2CGPA 2QJVA 3TNPB 3ZFGC 3ROUA 3BU7A 3WOGA 4WV8A 4FQ4A 1GR3A 3D82A 3J8F1 4QGNA 2C9AA 3KS7A 2WC2A 1COV2 1EYBA 1V6MA 4YFWA 1OLQA 2ZGOA 1HLCA 5H9QA 3EXUA 1QJX1 4DPNA 2BBVA 2ETEA 3LWCA 2I74A 2QE3A 4K40A 2W08A 3LCPA 3V0AB 1BEV1 1Y7BA 1EAH2 1AXKA 4META 2E63A 4Y1UA 3QCWA 1PK6A 4M3CB 1PGL1 2PHTA 2YHJA 2P17A 3ZN4A 5JLVA 2WQZC 4WM7A 2A6WA 4K9SA 2DCJA 2RR11 4B8EA 2N7GA 1FATA 5JR7B 3ZYJB 1MEC3 4XILA 3QH7A 3TBDA 3MLLA 2R063 1UU4A 2D6NA 4MVTA 4OHZA 3KGZA 4MSVA 1IGOA 1AYN2 4FPCA 2HWC3 4H3WA 2PA7A 2X53S 1AL23 4H7LA 3ZN6A 3D5OA 4Q26A 3U07A 1U5IA 1OPOA 1OA3A 1TQ5A 4C0HA 2GNMA 1NY71 1XU1A 1NQDA 5L36A 4SLIA 3LGRA 4C1XA 4AEKA 3R4DB 1DQ0A 3I59B 1CAVA 1MQTC 3ETQA 3H1MA 1ALYA 4C0BA 4YW2A 1QMJA 1TME1 4R8HA 4LE4A 3V64A 4AI1A 4Q4W2 2GN3A 3AP9A 5D1IA 5T54A 1YRZA 5FTTC 1CJDA 4O9GA 3IMNA 2WINB 2D6KA 4ONUA 2DVDA 1R081 1A8DA 3VKLA 4UXAA 4COUA 1SCSA 1AX1A 5GZGA 3C3VA 3B9IA 4COZA 4XF4A 4H55A 3L2HA 3AYDA 5EXOA 4Q2FA 4S2GA 1AR81 4XFBA 5A32A 3PMEA 1HRV2 4BMEA 2JG8C 1MZ6A 3MF6A 1RHI1 4M3CA 2EXJA 3M7AA 3WDXA 4RR3B 4NHLA 3M3IA 1J3PA 1SCRA 3AXEA 3W9AA 2WNVB 2HKXA 5AC91 1SLLA 2QDNA 3NAPC 1C8NA 2A75A 3PJYA 4XQWA 1H2KA 1JTZX 3MFCA 4LBKA 3T1MA 3PNAA 1HKDA 2ZGKA 3ES4A 5FLJA 1AJOA 3AP5A 2XG3A 5A33A 4IEZA 4Y20B 1VAKA 3FJSA 1PK6C 2NMOA 1AL22 4IEOA 3DF0A 2ZGSA 4XF9A 4AQSA 4PF5A 4IV3A 4JTOA 4E2SA 3E5UA 2ZACA 4I0WB 5EYYA 4N9IA 4WZCA 5KHKA 3PTYA 2DUOA 1UIJA 2VOWA 1ENXA 2WNVA 2VOVA 1OOPB 2D44A 1DYKA 5H9PA 1UX6A 4X8NA 2Q5TA 2R1DA 1W6QA 3AK0A 1RUE3 3WDTA 4Q0SA 2HWF1 1PZ9A 1UCXA 2I2SA 3POSA 3LOBA 1Q43A 2R0FA 5FLIA 2RHPA 1TMF2 1QNYA 4QPIB 2HJIA 2CGNA 1VBB1 3D8CA 5CU1A 4COYA 1J3QA 1HV0A 4BIOA 1GQHA 3KT4A 1CAXB 2RS11 1YXWA 3O5SA 2QZ2A 5LEKA 5ACA1 3O7OA 4RHV2 1PO13 3KCCA 1AR82 3WQ1A 2CNAA 2ENRA 2HYKA 3ZFGB 1ZBE1 5A3MA 3NVCA 2DU0A 1AVBA 3M70A 1RUE2 5AVAA 5GKAC 1J58A 3OD4A 1WMFA 4OI1A 4AI2A 3OBRA 5CVRA 4PIYA 2D3PA 2YUEA 4AEDB 1NA1C 2JENA 1QH6A 3WP3A 1RUOA 1HRI1 3KMHA 1AZDA 1WCDJ 2MEV3 3ILFA 3VGIA 4AVAA 3VBFB 1WCSA 5L7OB 2RMU3 4BHPA 1UN1A 2ATFA 4LHLA 1CJPA 2IXCA 4EROA 4OI0A 2ET1A 5CNAA 1YIPA 4LULA 1LEDA 5AC93 4W6XA 3U10A 1SBDA 3PLQA 1BQPA 4XBNA 5DDJ1 5EV7A 3FBMA 4H7MA 3O0WA 5C8CB 2E7TA 4XF1A 1W6QB 2Q8OA 2BGCA 1QQP2 5F6KA 4K3UA 4FPFA 1VAMA 2F6BA 4OULA 1VBC2 2A3WA 3OY8B 4AFCA 3ZSEA 3N7JA 1FV3A 2VNOA 2CWSA 2ZX4A 1VB4A 2BW8A 3UV9A 2ZX2A 3ACLA 2O1QA 3I2DA 4EN8B 5KC6A 4NWWA 4FPJA 2ZZQA 4L2NA 4XBLA 3BALA 5DUXA 3FUQA 1S0BA 5CBLA 1OLRA 2CL2A 2VNGA 4XFHA 2A70A 4ASMB 4JRLA 1OA4A 1GICA 1C57A 1QJU1 3S7IA 1AR72 3VKMA 4FPHA 3IDEA 4CZSA 3FLTA 1WUVA 3B94A 1RUF1 4DY3A 2D6OX 4OUSA 2RM23 4HBNA 1YUDA 1H8TA 4YVWC 1K5MC 2E7QA 1B35B 1MEC1 3OYWA 3I54A 1RUI3 4OFGA 4PJYA 4CTEA 3X29B 3NAPB 1DF0A 3UL2A 1OA2A 2XLFA 2VMIA 3GBGA 3OY8A 4HLTA 3ZXGA 3CNAA 2VOXA 5EWSA 3ZXDA 4RR3A 2W0XA 4LBQD 1HXS2 1UIKA 1SFYA 4OZXA 4KQ7A 2XBO1 3V0BA 1DZQA 5FO8B 1OFNA 4R9DA 4EWEA 1ZM1A 2ZAHA 3AMQA 1S0DA 1H30A 3OPZA 2B46X 1KDMA 3LA2A 4XFIA 1KITA 2R061 3HBZA 1GBGA 3OD0A 3G7DA 3GNEA 1DBNA 4QQOA 2GC2A 3ZXFA 1WA4A 2PN5A 1COV3 1PO11 1AR62 2XJTA 5E8AA 2TEPA 1WW5A 3OTFA 2VVFA 5JI9A 4FQZA 1DQ5A 2WT2A 3EO6A 1IS5A 3JUUA 1G6NA 5FPXA 1ZBA3 1HRI3 3RPQA 4U36A 3RMYA 4IL7A 1S1AA 4YG0A 1RUC1 2IXJA 4DXZA 5CG9A 4IETA 2MPFA 1HRV1 5DZFA 4QX5A 1C3HA 4IV1B 5D8AB 5KXBA 3MEPA 4XIKA 1LHNA 4NVPA 3NV1A 3FBYA 2OZ6A 2D6LX 5HCFA 4Q4V3 1F5JA 1Z78A 5DUWA 1LTEA 3EQEA 2ZKNA 4LBQA 2RS13 1W39A 2ZAAA 2R32A 4K8FA 3MIGA 5I0UA 1I9RA 2VUJA 2ZS6B 3AX4A 2A3YA 4XFGA 3HIFA 3RNSA 3NW4A 3M2MA 4RA0A 2ZHNA 5JPMB 5FOJB 1YNAA 2WLQA 5E89A 2AUYA 4AEDA 2RJKA 3CEWA 1NY72 2AGSA 2HWF3 1ND2B 3I8TA 3L9JT 2UY9A 4HKWA 1VALA 4M00A 3AP4A 3MLKA 4M3CE 1FYUA 1KDKA 1DGWX 2ZA9A 1LU1A 1NYWA 2EIGA 4P9GA 4YM1A 1AR63 3AM2A 1QHDA 1Y3TA 3ZPYA 3CL1A 5C8CC 1LHUA 2NLRA 4UW6A 1X36A 2XBO3 3ELNA 3VZOA 2BUKA 4E4DX 1IQAA 4ISRA 4RQPC 4AVSA 1H9PA 4HT1T 1QY4A 1MQTB 1AJKA 3USUB 3HD8B 3JBG1 3ZIXA 2NP0A 1SFNA 1EPZA 1UKGA 4IEPA 2ZMLA 2EAAA 2IXKA 3FFQA 1I5ZA 3RJRA 4UBGA 2X5IC 3U11A 1GZWA 3WR0A 4BMBA 1CESA 2QDRA 5K9YA 4YG6A 4C91A 3AXDA 4HN0A 2YPJA 1N1TA 5H9SA 1U0AA 1RUF3 4XPVA 2E6VA 4R9BA 1RUNA 3H3UA 2PHXA 3B9CA 3FUOA 1K5MB 3MPBA 4SBVA 1PGSA 3HT1A 1OOPA 3DPRB 4J1WA 1OHFA 1N1VA 3WZ1A 3D6EA 4BLIA 4ISQA 5JOYA 3JB8A 3LOIA 4BWOA 1D2SA 4EWDA 2RR13 4HETA 4NWVA 2D7FA 4YG3A 4F8AA 2K2SA 3BODA 3B93A 4FXKB 4TLFA 3GYDA 1TE1B 3IDCB 1SEFA 2XKPA 4YZ1A 2UWAA 4JGZB 2VU9A 2XLAA 1TMF3 3URFA 5C6CA 2P3KA 3ZO0B 3NJZA 3O12A 1D0GA 4HPKA 1ZYBA 2NMNA 1Q56A 1Z7S3 2DU1A 5L73A 1W6NB 2OUHA 1DGRA 1AYM1 1JBCA 4XW3A 1V70A 3WP4A 4F7ZA 3MYXA 2XBO2 1PO23 3QD6A 2DCKA 2DTWA 2D6MA 3DGTA 2XWBB 2WT0A 3AFGA 2E51A 1CPMA 1AXYA 1FNZA 1PVXA 2B42B 4KU8A 4W65A 1JHNA 4LNVA 5AVPA 4YGBA 2H0VA 1VLNA 4B4RA 1O5UA 2MEV1 1B09A 4YVWA 5JZGB 2ZX0A 4YM0A 4Y26A 3VKOA 3M3EA 1MVQA 4A7ZA 4INDA 3SHRA 2RMU2 2YZ4A 1Q8QA 3M1HA 2JE9A 2VW0A 4Q0VA 5JSPA 4MXWA 1JXNA 4IV1C 5D8AC 2ZJCA 1QJU2 4MUVA 1UPIA 4GB31 5LRRA 3VKFC 2WFF3 4AI3A 2E53A 4JDOA 1OFSA 1MZ5A 5KXEA 2NYYA 2RS53 2ZGUA 1KD7A 2WA3A 1LJ7A 2ET7A 2QVSB 3VBFA 3ZDSA 2GC3A 3IIAA 3NKTA 2VULA 4HVQA 1VR3A 4WVVA 4LBQB 2NPIA 1PIV1 1R1ZA 2W52A 1XYNA 5T3NA 2P34A 2Y0IA 1RMU2 3A4UA 4CP1A 1VIWB 2PFWA 2PHWA 4LHKA 1W6OB 4YW3A 1J3RA 2DVBA 4YW4A 4MV2A 1VP6A 1KXGA 2A6VA 4XMAA 4RGAA 4QM8A 3WX5A 2A7AA 5IK5A 2DCYA 2VQAA 3INAA 2JX9A 4L97A 5C8WA 1V9U1 4RQPB 3B69A 4JV4A 4WBBA 3OBTA 3VHNA 4QQHA 5J98B 4CDWA 1D4M3 1FOD1 1H1AA 2GN7A 4XETA 2Q4SA 4Q8KA 1RB8G 5GZCA 2R042 1CQ9A 2WL1A 2IXIA 3VV1A 3ZMOA 1HRI2 1NA1A 2WIIB 3SXWA 3MW4A 1BEV2 1LR5A 4PDWC 1H1IA 2DVFA 4L11A 4GWMA 4R4ZA 3TN93 4YARA 1VBD3 2V5YA 3WD5A 3M3OA 2GC1A 4AFMA 3U0ZA 4QGLA 4XBQA 4B7KA 2RM21 1WLCA 5HCAA 1HXS3 1Z7S1 2JG8A 3AJZA 3H9AA 5T50A 3POYA 3VDDB 3WG2A 1V6JA 2YGMA 4XTMA 1REFA 3QBQA 1BBT3 3E6DA 2RS12 5CA6A 3BTAA 1UPSA 1UMZA 1LHWA 1AXZA 1AR92 2UYBA 3N36A 2G9GA 4E2QA 1NCQB 3VZLA 5EFUA 4Q4X1 1QXJA 1OQDA 2JEMA 5KHIA 4B7EA 1U5YA 5T52A 3S30A 4JVAA 4L9BA 5DZEA 2ZHMA 1KJLA 1DU3D 1XU2A 1WGPA 1WW4A 1ULDA 2HWF2 4F3JA 4PBPA 2NN8A 3CJXA 4LO5B 1ZBA2 2X8KA 3ILNA 3TYJA 4Y1XA 3RWNA 4XQ4A 4Y22A 3FHIB 1MR5A 1YO8A 3S0MA 1X33A 1D4M1 1FOD3 4DMIA 4XFCA 2ES3A 1HXS1 3NL1A 4XDQA 4XZPA 1QWRA 4YGDA 2ERFA 5JCTA 3M3QA 5GLWA 1S0GA 3N7MA 1WBFA 4N7IA 2R043 4FPGA 3TN91 5J37A 2A73B 1O4ZA 1OI6A 1PNFA 2OA2A 5FQ0B 1XQNA 4CEWA 2XLGA 3H0OA 4GMP1 5B2GB 3PVOA 4Q0PA 3D0SA 5H9RA 4FSJA 2CY6A 1SLCA 4LBLA 3UKNA 1PZ7A 3VZKA 1W2UA 2YGLA 3MF9A 4FTBA 4FCAA 4AXOA 3VBSA 4YRDA 5I0RA 1X8EA 3B00A 1B35A 1M06G 1UKRA 2EALA 3KT7A 3THTA 1MEC2 3FMGA 5AC92 2LM3A 1LESA 4KL1A 1GZCA 1ZZCA 5L19A 2WJSA 1RGSA 1RUF2 2A3XA 3ZFEC 4YZ2A 1SBFA 1Q8PA 2B9UA 1X82A 3JBG2 3GHNA 4FOVA 2XB6C 4XJUA 5JVVA 2OW4A 3OGGA 1EPWA 4K21A 3J26N 3WW1A 2WS92 5BNOB 4XMIA 2WNUA 3AKTA 3LB9A 5LK7B 5IK4A 1ZZ9A 5BNPA 2BNOA 4CEYC 4YZ3A 3TAYA 1QJZA 1RJ7A 1NCRB 1QQP1 4Q4W1 4CEYB 3MGUA 4F83A 4YW1A 2BFUS 1D0HA 4LE3A 3JD71 4YNIA 4AGGA 1ZBE3 4NN0A 3CF6E 5CFCA 1VBE3 1ULEA 4HMZA 4MGKE 1HRV3 1POV0 2R30A 2BTVC 4KNCA 1JN2P 4LLOA 1WD4A 4Z8BA 4Q1RA 3WCSA 3NV4A 4GQ7A 2XHKA 1S55A 1FI2A 2WLPA 3KQRA 3H1WA 2XWJB