2WNVA

Complex between c1q globular heads and deoxyribose
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
131
Chain Sequence
b'QPRPAFSAIRRNPPGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
molecule tags Immune system
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
total genus 29
structure length 131
sequence length 133
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnvA00
2Q1MA 2OIIA 5L36A 4QQOA 2TUNA 1WCKA 4TSVA 4G3YC 1U5ZA 2Q8OA 2O0OA 3IT8A 4HT1T 2WNUC 2TNFA 3QBQA 3URFA 2RE9A 1D2QA 4QQPA 3V56A 1D0GA 4GIQA 4MSVA 2WNUA 2E7AA 1IQAA 1KXGA 4MXVA 4F3JA 1C3HA 5HBAA 5TSWA 3B93A 2R32A 1I9RA 1PK6A 4OUSA 1DG6A 1RJ8A 3AB0A 4OULA 4QQLA 2R6QA 2JG8C 1JH5A 1OQEA 1U5XA 3LKJA 4J6GA 2JG8B 3L9JT 2WNVB 2ZJCA 1OSGA 2QDNA 1GR3A 4MXWA 5KWRA 3ALQA 4OUMA 2WNVC 3B9IA 1O91A 2HEWF 1RJ7A 2AZ5A 4RSUA 2QE3A 1XU2A 1C28A 1A8MA 3QD6A 2RJKA 2Z5WA 2KA3A 3ME2A 2HEVF 4G4FA 5L19A 5CIRA 2X29A 4KG8A 1ALYA 4NN0A 2WNVA 1U5YA 5KC5A 3TWIA 4QPYA 1KD7A 2JG9C 4N90A 4KGGA 4QQHA 4DB5A 2R30A 3B94A 3FC0A 2HEYF 1PK6B 5KC6A 1XU1A 2WNUB 1PK6C 4KGQA 3TYJA 3WD5A 3K48A 4E4SA 1TNRA 4TWTA 1DU3D 1JTZX 4DOUA 1TNFA 2JG9A 2JG9B 2RJLA 1S55A 5BNQA 1D4VB 1OQDA 2JG8A 3MI8A 4D7YA 4EN0A 2ZPXA 4MXWB 3K51A 4E4DX 4QQ2A
chains in the Genus database with same CATH superfamily
1AYM3 4EN6B 3LB9A 2DV9A 3AMQA 1G9BA 4IV1A 4XZPA 2YZ4A 2D6KA 4LBJA 4E8DA 2XLAA 4XYXA 2VCCA 2E9QA 1FNYA 1QOOA 4AI0A 3WV6A 3DN7A 1W9SA 1RYYA 5ISLA 2WABA 4NRPA 5F3EA 5FBJA 5FOBB 5DUXA 3NNMA 4NO4A 4CVUA 1S2EA 3ZX7A 1ZRRA 2ZA9A 3ZYHA 4Q4V2 5F5AA 4Q1PA 4CDQA 4L11A 3I2GA 4ZU4A 2G1MA 4BMBA 4QHZA 3E1F1 2X5IB 4WZFA 3N36A 2RMU3 1RUD1 3L2HA 5H9QA 1OUSA 1I1EA 1UKGA 3AM2A 1F15A 3JBG2 3R4UA 1OH4A 1W6OA 2MHFA 3OG2A 5HCHA 2WAOA 4PJYA 5F1RA 5IK4A 3WP6A 3O1VA 1YFXA 3ZSEA 1SBEA 4GMP3 4BQ4A 3MFAA 2HWE2 4OULA 3KQ4B 3ZR5A 2ZHMA 2FDHA 2YFUA 2ZGUA 2LROA 3FBYA 1KJRA 2IXLA 2DCZA 1U0AA 2HWD1 4IEQA 4Q4V3 4OCTA 1F8VA 3LF7A 3WY6A 2R16A 1W6MA 1Z0HA 4CDXB 1JYIA 4LBNA 3M3CA 4D6SA 2GAUA 2CDPA 1GOHA 2NMNA 3MV01 5JZGB 4JDOA 3O0WA 3TN92 1HXS1 1WLCA 2HWC2 3KT1A 4A7YA 2OQ7A 2VW0A 3DXTA 1H4GA 3DCQA 4XAAA 3PUSA 1RMU2 2WN2A 4XW3A 4QX3A 1GQHA 2ZX3A 1RUF3 1W2TA 3THDA 4LTAA 1KFUL 5CFCB 3LPFA 5DDJ3 4DIQA 2XH6A 5FLHA 3KCYA 5LWBA 2V72A 2ZGTA 1MS0A 5FP3A 1VBE3 1YQCA 4ISQA 2D3PA 3V64A 1NX9A 2SLIA 3ACLA 5JMCA 2ZHLA 5M0TA 5FYTA 1PVC1 3KHBA 3A7QA 2IVJA 3AFGA 4AEDB 5I93A 4QPIB 1N1SA 3ILNA 3THPA 3CBNA 4BLJA 4Y20B 5IVJA 4X8NA 1W6MB 4KI5M 3H50A 4Q4W3 2JENA 5EP9A 3TYJA 5K0UC 1UY4A 1CVNA 1MVEA 4LUKA 2OKXA 5AC92 4P9WA 3BIEA 4XBLA 1RTVA 4ZZ8A 3GCWA 1DLCA 1E5SA 1QJU3 3UESA 3V0BA 3A0KA 3AKQA 4ZS2A 5E16A 4KQ7A 5T5JA 4CUCA 4LORA 4IXLA 1BEV1 1S55A 3ZSKA 1VBB1 2B5HA 1JYCA 1ZBE2 2BQPA 4LE3A 3D3AA 4OHVA 1W2UA 4Q5OA 1S0IA 4INDA 3MI8A 4UW3A 2X5IA 4YVWB 4QM9A 3IAQA 3HQUA 2XDVA 4XHBA 3S7EA 2HWB1 3K51A 3O1UA 2YC2A 4A2UA 4BQWA 3LD8A 1UYXA 3POWA 2ARCA 1UWWA 2DCYA 1DGLA 2DF7A 4RR3A 1AR62 1JODA 1LECA 4GZ9A 4QPWA 1WA4A 2DWRA 1E5RA 1QOSA 3D5OA 4CU9A 4Q1RA 2Y64A 4COWA 2HBUA 3T30A 2CL2A 5C3RA 4MGTA 5FZGA 1TMF2 1AX1A 5FY0A 3URFA 4CDQC 5FYIA 2RE9A 5JDBA 4YZ2A 4Q0VA 2YU1A 3K46A 4QQPA 2JDUA 3P3NA 2P3KA 3OPTA 2GC1A 4AI1A 4GIQA 4XQWA 1SZBA 3BU7A 1HIXA 3NJVA 2V5YA 1UX7A 4MXVA 1QF3A 4QWNA 4JDNA 1MS9A 4DINB 1RIRA 1RUJ2 5GLTA 3GHNA 1ULFA 1XNAA 4TN7A 1B35B 4XABA 3RRDA 2GP5A 3E6DA 2GC2A 3POEA 3WDTA 5FTTC 2BZDA 4YGBA 4JRAA 3VBFC 1PGW1 3MYXA 5FBZA 4NVPA 1K42A 2V4VA 1RUC1 4AEJA 2VOWA 5IK8A 2GMEA 2R061 1N1YA 2VZOA 1IG3A 1H8TB 2D7FA 3PIGA 2VPVA 1PM4A 1S0DA 1AL0G 2WZEA 3B01A 4K9SA 3IB3A 4UFJA 5D8AA 2WNVC 1PNGA 1OC1A 5DAXA 3GZEA 3RJRA 3T4VA 3NMBA 4UW5A 5G05L 3BOPA 4LKEA 2GNTA 1SFYA 4S2GA 1VBA1 3B9CA 3WSOA 3OUIA 1NZIA 4IEYA 2R063 2KA3A 2PHWA 4G4FA 2V4AA 4QXKA 4KL1A 1RUNA 2W1UA 4XTMA 4YGCA 5CB7A 1C57A 5FYBA 3WQ1A 3ZFGA 3I2HA 3RSJA 2BWCA 3GZAA 3OYWB 4RD7A 3RFRA 4BLIA 4XIOA 3NAPC 1PO13 2I45A 2RS13 4AVSA 2WO3A 3RWKX 2XKPA 4AWDA 1BBT2 3J8F3 4ZKTB 3ZFEA 3I54A 2HEYF 4FOVA 2Q30A 3AP7A 5EQUA 3WNKA 5CG8A 1DLLA 2W0XA 1U5IA 1YQ5A 1D0HA 1V6MA 1RUC2 2E32A 3BALA 3PURA 4I09A 4CEWA 4CPBA 2HWB2 5JCTA 5KHIA 2ZKLA 2B45X 3K48A 2MPFA 4E4SA 1SCSA 2A5ZA 4PI0A 5IK5A 4BMEA 2NP0A 4NR1A 4C1WA 4LA2A 5J7MA 4OI0A 5EFUA 2Q4SA 3T08A 4OVEA 2JWPA 4AVCA 5CFCC 4DRVA 5DDJ2 1C8M1 1JMUB 1GZ9A 2RDRA 3WF3A 1AYN2 1GUIA 3M3EA 5FZ1A 1PO12 3FZ3A 2WQZC 2WT0A 3DPRC 3IZOA 2K46A 3USUA 1W6QB 4K20A 1L3JA 4GAZA 4XF9A 4CCKA 2RM22 5I8SA 1GLHA 3CDZB 5LEJA 2XWJB 3HBKA 5FZ9A 5EYXA 4HN0A 2IXKA 2HWD3 4Q4W2 1GZTA 4CDXC 1JYNA 3GZTB 4XF0A 1NLQA 2DVFA 4C91A 1NCRA 3HD8B 1NAEA 2ARXA 4LLOA 1LOFA 5FOJB 2B39A 4NRMA 3KVAA 4FPGA 4AGVA 1J58A 4NHMA 1EAH3 5FYMA 1D2QA 4P9GA 3OJBA 2CSGA 1HN0A 3MICA 4K8RB 3M2MA 2GNMA 5FYUA 5IVYA 2C26A 4FOQA 4HZFA 1SBFA 4YW2A 1HW5A 5JZGA 1QH7A 2XBO3 1RMU1 2YY1A 5L7OC 4MADA 1UMIA 1NLRA 1I5PA 1VRBA 2CHHA 4XFAA 5FZBA 1KITA 3OTFA 1DF0A 3TN91 4IV3A 3RZMA 4BQYA 2GH2A 2YU2A 3ZYRA 1PIV1 4JKLA 4CU6A 2Y6JA 2QKDA 5A7WA 3ZFEC 5C8CB 2XB6C 3NNGA 1WZXA 3DYPA 1BBT3 4UFKA 1ULPA 1H8VA 5I8TA 3LA3A 1US3A 2D98A 3E5QA 3ENRA 1WMDA 4PIXA 4M0HA 3RZHA 4LO8A 5BPXA 2DTYA 2ZX1A 4RN5A 3RZGA 1NCQB 1ND2C 3GYDA 4B4RA 1GYKA 3DL3A 3N9NA 4AAPA 2J7MA 3RJ2X 1FXZA 5FZOA 1JN2P 1SBDA 5FY1A 1HLCA 3D0JA 2EIBA 5JIAA 5B2GB 3IIAA 1NXD1 1RHI3 1BEV3 1UN1A 5FZ8A 5FPLA 4XDOA 2B46X 4FPCA 3OGRA 3ME2A 2XJSA 3VBSC 4XJUA 4LLFA 2CGNA 3MIEA 1F5FA 3N3HA 4YG0A 3SLIA 5A6XA 3O1RA 1PZ7A 4CZSA 2WNOA 4BISA 4LXLA 4NN0A 4Y1VA 1VMFA 3POGA 2WNVA 4AHZA 5JOWA 2JDZA 1U5YA 2C0ZA 1ZM1A 3N9PA 4FFIA 2YG0A 5SV8A 3RWNA 3WG2A 4DY3A 2PELA 2JDHA 4HKLA 1D2SA 3N9MA 3I59B 2A6ZA 4KGGA 1PZ9A 2YGLA 5FQ0B 4XILA 1O5UA 1IS6A 1OLME 1W6NB 4KWUA 1XNKA 5FP9A 4BA6A 5I0RA 3IM0A 3ACIA 3O1MA 1MR5A 4LHNA 3LSDA 5FPXA 2XQRA 4XDQA 4PBOA 3VBHA 3BB6A 4FPOB 2DUQA 4JGZB 4RA0A 4EWEA 2Y38A 1UO9A 4UF0A 3FFQA 4UI9L 5K0UB 1RVF2 4HK9A 2A6VA 3NQHA 1DU3D 1VALA 1B35A 3GBWA 4FXKB 2JG9A 5IVEA 1HRI2 4WBBA 5JR2A 2JG9B 1UIJA 2YYOA 1XC6A 3NVCA 2Y6GA 1XPWA 3WW2A 1VBC1 4Y22A 4WM7B 1RUG1 1EPWA 2ZGKA 1MEC3 4Q2FA 3ZFFA 3VUOA 1WMFA 1AX0A 1Q8QA 1CAVA 3I3DA 1OPMA 1YJLA 2CTVA 4QX0A 4IE7A 2WDBA 5BXXA 3VKNA 1F4HA 1O3SA 2KD7A 3AXDA 1C5IA 2VQUA 4GKYA 4AL9A 2Q1MA 4Q4V1 3GZUC 4ZZ5A 3LA2A 3VBUB 1UU4A 5FZAA 5LY2A 4G9SB 1YEWA 4FFGA 3CJXA 4KU8A 1PGL2 2VL4A 3HWJA 3WOGA 4IE4A 1IPJA 1CIYA 2SBAA 3RDIA 1MQTC 1HRI3 2TNFA 2W1WA 3U37A 3ZN6A 3ORJA 1IPSA 2XVGA 4GWMA 1VBA2 3GJAA 2EVXA 1AYN3 2ZCWA 1R093 2XVLA 3R4SA 3AMMA 2VZRA 5LBFA 4GH4B 4MSVA 4LT5A 4XBNA 2ZMLA 4P9YA 2ZGRA 2GZWA 4H3WA 4XDPA 4AFDA 1OMIA 1OLMA 3A4UA 1Q8OA 1W6PB 3B93A 4XAEA 4YGEA 1UYZA 1Y7BA 5DAVA 5A7NA 1ND3C 3T0AA 3SKJE 1VBC2 2VJXA 1IPKA 1JW6A 1ZRFA 3OBZA 4UXAA 4RS5A 2CYFA 5BNPA 2BP6A 1CX1A 3ZSLA 2JG8C 3BTXA 1N1VA 1LCLA 4ZU5A 1AR83 1UY0A 2WZR2 3INAA 3PDQA 3NJYA 2WO7A 4MHRA 4S2DA 2WO1A 3S7IA 4B29A 5IATA 3K4DA 5IK7A 1OD3A 3FHIB 3KT4A 5JVVA 3RMXA 4YFZA 5KXBA 2PQQA 2QDNA 2C9KA 3GBGA 3JD73 5ERLA 4FTEA 1GNHA 2VBDA 5FRAA 3APBA 4Q0SA 2P3IA 1Y9MA 4XFGA 2JDMA 3AP6A 3VHOA 1AR92 4BIFA 2VZ1A 1LB2A 1RXGA 2W52A 5E88A 2W87A 1ZBA3 2ZAAA 2G9FA 4JVAA 4Z82A 1C28A 2A70A 1VE0A 4ZU7A 2VNGA 4LBMA 3VZOA 5DZGA 2A6YA 3EB7A 4JGZA 3ZYIB 3RQ0A 5A1AA 2XHKA 5DMYA 5IUQA 2CAUA 4LJHA 4NOTA 2CWSA 2ZGLA 4JTOA 1RUG3 4YWAA 3O14A 5I0TA 1VBD3 3H3LA 4Z92B 4NMIA 2XKOA 2WUHA 3LOIA 3U14A 1KD7A 4P08A 3W21A 1J84A 4QQHA 1H6XA 2W9XA 3JZVA 2XLGA 5IT6A 1RUD3 2WZPP 3POSA 1BKZA 4AI2A 5J96B 2IC1A 5CZKA 1MS4A 2HLEA 1TME1 1XNTA 3NV4A 2WNUB 3A0NA 5FY7A 5B4XA 3VBHC 4ARXA 4EN9B 1PK6C 2GP3A 5F3IA 1VBB2 2C24A 3I2IA 1A3KA 1RHI1 1SLCA 4RR3B 1W0PA 5FMOS 3VHRA 1LEDA 1UOJA 3WCSA 4P14A 1W3VA 4K21A 4GB33 5LK7B 3S57A 2NLRA 3WR0A 4ZONA 3RYKA 5K8SA 1HB3A 1W2AX 2YROA 3G7DA 1TMF3 2D44A 3LEIA 5JI7A 4E8CA 1Y9GA 5DN2A 4IE6A 1J1TA 3U4SA 4YVWC 5FPVA 4E2QA 4FPLA 4WM8A 1COV2 4GA9A 1W9WA 4Y1YA 3W5NA 4XPVA 1Q3EA 2PHDA 3FLPA 3CMGA 3LA7A 4BQ5A 2ARBA 2JDYA 5C9AA 4XMIA 2VO5A 1ZZ8A 5KHGA 1T6BX 2R071 5T3NA 5IW0A 4LOSA 3OY8B 4A41A 1WCKA 2P1BA 2VQTA 2BVBA 5KXDA 4N53A 5F3GA 1UX6A 2Q8OA 4NAMA 1D7PM 2ZBJA 2I07B 2DCJA 5IWFA 2NM1A 2ZABA 3HQRA 5F2SA 2FZ1A 2FBEA 5CNAA 5LA1A 5T5OA 1LHNA 5CKNA 1POV0 2IXCA 4LQRA 2W95A 4GMP0 4WM8C 3J26N 1PHMA 4IEUA 3OF1A 1QQP3 3T2QA 1CPNA 2DVGA 1CAXA 3I4IA 4NIHA 2Q8CA 3EBRA 2P5BA 5A33B 3ZYFA 1ZBE1 5F5CA 5J37A 2FCUA 5A32B 4TTGA 1E5IA 4EN8B 3OBTA 2G9GA 2QZ2A 2R073 3WDYA 2VZQA 1PK6A 3HIFA 1UU6A 1VBD2 2XLFA 5F5IA 4C90A 1ZVFA 3SCFA 1UY3A 4KWJA 3PIJA 4ZPIA 5HCFA 4YW1A 3AP9A 1SPPA 3LEKA 3WXPA 2OPWA 1U5XA 1HRV3 2HWF2 2N7GA 4IE5A 2VD7A 4N43A 5IVBA 1FPN3 1RUOA 2BVVA 2RR13 1WW5A 4LUMA 2EAKA 4JGYB 3EQEA 4MXWA 3EXUA 2Q1FA 1QDCA 1TMF1 2HEWF 3KV4A 3LOBA 1RJ7A 5K9YA 2FDKA 4W8JA 3N9OA 3IMMA 1BVP1 4P5HA 4YM1A 2JEMA 4KNCA 3MF9A 5IAVA 3PUIA 4XUTA 3ATGA 3UV9A 5FO8B 1QQP2 3T0BA 3KF3A 1QXJA 3OOXA 4IE0A 1R1A1 1TME3 1H2LA 1NOVA 4RYDA 2EIDA 1EYBA 1W6OB 1HKDA 4NWWA 2X29A 4UBHA 3TBDA 1S2KA 1LOGA 1B09A 3HEIA 1UXZA 2WA3A 1J1LA 1NLSA 5GJ6A 4FT8A 2X05A 3WG1A 3H8UA 1UOFA 1W8TA 2VQ0A 1FATA 1RUE3 2ZEWA 5FZ4A 5FXWA 4LIUA 1O3TA 3Q9OA 5JXHA 1UY1A 3NKTA 1JU3A 4AI9A 1TE1B 1Y4WA 5G04L 5FZ0A 4RL7A 1C8M2 5BNOC 4XEZA 2A3XA 2K0GA 4A6OA 4NHKA 1DQ4A 1ZA4A 2B9VA 3GCXA 1QJEA 2YGMA 1PO23 1PGW2 2R7EB 2WSUA 3FL7A 2DYCA 5L9BA 4N53B 4QDSA 4QKDA 4RGAA 3VBOC 2D5HA 5A7QA 2VOTA 4FP2A 2P6CA 4QB2A 1OOPA 4QHBA 2A73B 1S0EA 3N7MA 1UU5A 2E33A 4OI4A 1XE0A 5A3OA 4QDQA 4CDWA 5I91A 4PQQA 2XONA 4KG0A 1RUE2 4A7ZA 3H8XA 2W1SA 4V2VA 4XE9A 3ZXEA 2ARAA 1OA2A 3BTAA 1X9TA 4EN0A 1OF3A 4W6YA 3WNXA 2ILMA 2PA7A 3VLBB 4E4DX 5BNOB 1AR72 3OCPA 4AOCA 5C33A 2XPJA 5JXIA 1FAYA 3GALA 4BPZA 3ZOIA 5C4WA 5CFDB 3OPZA 5DG1A 3VZMA 3I2OA 4IV3B 3PLQA 5L9RA 2DURA 1ZA7A 2HYKA 1VIWB 5A7WB 1DBNA 1QJZA 5IJRA 2A6WA 3M7AA 1SPPB 4MOAA 3IPVA 2AREA 4JKKA 2IVIB 3BPSA 1PO21 3QBQA 1XRUA 2JD9A 5J09A 3PUAA 5A6ZA 1VJ2A 3MLLA 4GJZA 3ILRA 1TZOA 1ZZ9A 2QQOA 4GJYA 5LRRA 4CCOA 5FFOC 2Z79A 4OHXA 4OMDA 3W9AA 3H7JA 3LDBA 4NWVA 3CF6E 4FTBA 4AEMA 1JHJA 2GH8A 5ACA1 3KSCA 1CAWA 2O14A 3B3QE 4EYUA 5C71A 2J1VA 2OT7A 1POQA 4U2AA 3UKNA 1AR73 1MS3A 4IEXA 1LU1A 1ZZ6A 4XACA 1JXNA 3LEGA 5FZ7A 5A3PA 2F6BA 1ND2B 3CJIC 4LBQA 5I0SA 1UZ0A 5K4LA 5LB6A 3A23A 4TYSA 1GICA 1JH5A 1OQEA 2H6CA 3NNFA 5GKAC 1H1IA 4BU2A 1AYN1 4CRQA 4YZ5A 4HK8A 2I74A 4BOWA 3HOBA 1SLLA 2NQYA 3Q8EA 4O7XA 4W6XA 3VD3A 1QEXA 1T6GC 1WKYA 1RUC3 1W2NA 4UOJA 2BBAA 3ZDVA 5F7UA 3BU0A 3KV5A 2OUJA 3P3PA 1ODNA 1CWPA 3SNMA 2QE3A 1O3RA 4D69A 1AJKA 1UXXX 1V9U1 3UL2A 4OZXA 2OA2A 5LBBA 1S0CA 2DCTA 1W0NA 2HEVF 4JKMA 1REFA 4S2HA 2P3YA 1AX2A 4LKFA 2Y6LA 4YNIA 4R52A 5FUIA 3SKVA 1V0AA 5FZIA 1H1AA 3HR9A 1RXFA 1WW7A 4GH4A 2PHTA 2Y6FA 2W1QA 4LBQB 4YZ4A 1SDDB 1POV1 3MO4A 4AI8A 3KHCA 2Q5TA 3FBMA 1HXS2 1EUUA 5JWPA 1UNBA 2X09A 1US2A 3AL6A 2Y6KA 1UZYA 2VE1A 2A6XA 4LHKA 5KHJA 3X29B 4Q0PA 4YGDA 2DUOA 2ET1A 5EPAA 4Q4Y2 1H6YA 1RITA 4WVMB 1YFWA 3AYDA 2CDOA 4AG4A 4IV3C 4J1XA 3WD5A 3DPRB 4BHPA 1CZTA 2QQLA 5CFDC 4NHXA 3U4XA 1DGWA 4PCRA 3WW3A 2ZHKA 3VD4A 3I2KA 5FP8A 1KJLA 2EAAA 3L2YA 1NY71 5GZEA 5L7OA 1FV2A 1O4ZA 1W8NA 2W5FA 3ZXJA 2R1BA 5D8AB 2UY9A 3M70A 1IGOA 1QJX2 3VD7A 3POJA 5FYSA 3KB5A 1LOFC 1PMJX 5AC91 1J3RA 1RL3A 1VPHA 2QJVA 5CEHA 2JJ6A 4MXWB 1WD4A 4FI9A 4E27A 3RVHA 1HXS3 2W39A 3MFCA 2VUJA 3FJSA 4FBFA 5L36A 1AR81 2ZHNA 1REEA 2ZGNA 3RI8A 2Z69A 1OLRA 2BWAA 4FSJA 1C5HA 3GJBA 4Y1UA 2UYAA 4LR4A 3P6BA 3W5MA 1AR82 5IVFA 4M3CA 2R0FA 4AW7A 5GM0A 2YMZA 3ACGA 2VM9A 1DQ2A 4QX5A 1WCUA 1XSRA 2RM21 2XHNA 4RGGA 2DFCA 3I59A 1ASJ3 1JZ4A 3GGLA 5T5PA 4XQ4A 2BEOA 3UT0A 4ATEA 3O1PA 3MUY1 3D4KA 1QNYA 2OX0A 1DHKB 1OKQA 2ZX2A 4CEYA 1X50A 2AACA 3VKFC 1KDMA 4K3UA 3MBWA 3JUUA 4PDWA 1HRI1 3BVCA 2PYTA 5T5LA 3ZKYA 4M4RA 2RJ2A 1PVC3 5GLZA 1RUI1 4P5YA 1LR5A 1S0GA 3AB0A 4PLNA 3OY8A 2Q1ZB 1AL23 2WS91 5H9PA 1YWKA 1EAH2 3I2FA 4Q4Y3 5DZFA 2LUWA 2F17A 1UYYA 1RUJ1 4DS0A 4DEVA 3GNEA 1VMHA 2GMMA 3DKQA 1BQPA 4MVTA 3WCRA 1CQ9A 3BIWE 2OS2A 1LTEA 2C1FA 3LQCA 4HPKB 1M06G 4MGKE 4XC9A 1I5ZA 2ZTNA 2HKXA 1MZ6A 3P1IA 1N3OA 4FPFA 3CZJA 5FYVA 3ZDSA 2HJIA 4GKXA 4Y22B 5JSOA 2O8QA 1DQ6A 3WQ0A 5AVAA 2VC9A 3MW3A 3NV1A 3J4UH 1T2XA 1WLDA 2ZX4A 1DGWX 3AMPA 4FOWA 3FHQA 4YPJA 5LBCA 1A78A 3FMGA 3UK9A 2BOIA 1XOYA 5EIYB 1AR61 1V9U2 1E57A 1IS5A 4QPYA 5A1FA 3HJRA 2BERA 5A32A 4V2WA 3CEWA 4XF4A 3LFMA 2VY0A 1SFNA 2C6SA 4YG6A 2GC0A 3IDCB 5DAWA 3T4HB 4HLTA 1JI6A 1PK6B 5FREA 2CAVA 4BH9A 3EMRA 4N53C 3LE0A 3PNAA 3POBA 1R081 1GU3A 1EV12 3AYEA 1YCIA 2Y0IA 1AZDA 1EY2A 4TWTA 3RZZA 1SFPA 4N7IA 2W92A 3MDPA 4Q8LA 4NIGA 1EV11 2KR2A 1QHDA 1D4M2 1K45A 3MIFA 4I3GA 1NCQA 1W8WA 5K7PA 4NAOA 2QNKA 4CYDA 4CTEA 4COVA 4BIOA 4COZA 4CCDA 1D4VB 3EO6A 3LGRA 2LTNA 2LRPA 1DGRA 3U11A 4JGZC 1PVC2 1EP0A 4IEPA 4XJWA 2WT2A 4QPIC 4QXCA 2RR11 4AQTA 4CEYC 5IVCA 1NA1A 3AZXA 3U0ZA 4XFHA 3ZPYA 4MLOA 3HN1A 3R4DB 3AYCA 2BYVE 2ET7A 3ZMNA 5FCCA 4Y20A 3W59A 3IT8A 4FFHA 5EHDA 4GB31 2WNUC 1YUDA 4LBLA 4QGLA 2D6NA 5EXOA 1FX5A 1OFNA 3VDDA 4C1XA 5D1IA 2OZJA 1GZCA 3HN3A 5D21A 3W58A 5FPUA 1G9AA 1GQGA 2DVBA 4XFFA 2IXIA 2V73A 1BEV2 2W91A 5GALA 3SCGA 4AE2A 5KXEA 2BBVA 1X8EA 4JRLA 4RS5C 1D0GA 1OXCA 3LDKA 5DZEA 1HX6A 1YFUA 4PDWB 5F6KA 1BVVA 4EE2A 4MGIE 2YBPA 1LODA 1PMHX 3HT1A 3KVBA 4UYBA 5LEKA 2IFWA 2ZGOA 2QQPA 3U07A 2BNNA 4QHOA 1VBD1 5C70A 3IDBB 2R32A 2WIIB 4ORFA 2BGCA 2VVDA 4R9BA 3V0AA 3OD4A 3VZJA 2VQAA 1V00A 1RUI2 4XZUG 5A3UA 3T1MA 3KGZA 3TEYA 3VKOA 1AYM2 1S0JA 2VULA 3BOWA 3SC7X 2VNRA 3KM5A 4MYEA 1WD3A 1CAVB 2VMEA 4YVSB 3L9JT 3WP5A 2WAAA 2ZGSA 4FQZA 5LK5A 1OSGA 3CO2A 1GR3A 2RS31 3ALQA 1EV13 2YC0A 3AK0A 5HCAA 3WNMA 1X7NA 4D3WA 2C4XA 4BXSV 3VBUC 2XBO2 3PJYA 4FFFA 5CFDA 1W8OA 2VAUA 1O4TA 4J25A 4JQRA 2F4LA 3USUB 4IEWA 5F3CA 2FZ2A 1ODMA 4Z07A 2A7AA 1R083 3MLKA 4HN1A 2Z5WA 4O61A 4TXWA 3H3ZA 1VRH3 2R041 1BXHA 2VZTA 3CJIB 3ZSJA 4ZS3A 3WZ1A 2UU8A 5L19A 4YARA 1ZZBA 1LGCA 2RS52 4Y5SA 3R6SA 1BHGA 4XBQA 1G8WA 1QWRA 4XJ9A 4AFCA 3ES1A 4IGPA 4SLIA 4A3ZA 5FJKA 3J7NA 2A3YA 2P3JA 5FZ3A 1AVBA 5FY9A 4LKDA 1H2KA 1UY2A 2VVEA 3N7JA 4GH4C 3PTYA 4CP2A 5DDJ1 2BU9A 3MF6A 4ZXEA 4Z8BA 5FDBA 5IVVA 3MZHA 1D4M1 4JHTA 4OQ9A 3LWCA 3S5AA 4FVVA 4WVWA 1RUH2 4MUVA 2VG9A 1YQ2A 4UW4A 4WVMA 4HONA 2ZGPA 4DMIA 2FDFA 5EJ3A 1R082 5A33A 1XNBA 3BPZA 3ZXAC 2Y6HA 5FUNA 3MW2A 1DYPA 1YI7A 3O1SA 2DDUA 5EWSA 3AVRA 3THCA 4F8AA 3SQOA 1GP6A 3K2OA 2RG4A 1K3IA 2XGXA 3CLPA 1YHFA 2CNAA 4AXOA 4S2FA 4NPRA 1MZ5A 4DO0A 3RG0A 4WM7C 1RUF1 3IWZA 1UOBA 3ZO0B 2RDSA 4R8HA 3VBSB 1CONA 1RUI3 3KD4A 2Y60A 2WO2A 1AJOA 2JG9C 3CJIA 5FP4A 5EYYA 2YHJA 3OPWA 4CU7A 4L0PA 3T0DA 1LGNA 2E7TA 4NRQA 1JS9A 4N43B 3NW4A 1BBT1 2VNOA 2OYZA 2HWE3 5DAPA 4OYUA 4L9BA 5B4NA 2ENRA 2KM2A 1LHWA 1AR93 4JGYA 2VUCA 1G9FA 1XSQA 3HT2A 2VZSA 3ZFFB 1O8PA 1U12A 4LA3A 2W3JA 2X10A 1YJKA 2QCSB 5T50A 2NMOA 5A3WA 4BQXA 4GWNA 4OLLA 1QH6A 3SH4A 3K3NA 3PVEA 5J1XA 1IS3A 4K7JA 4SBVA 1CAUA 1HV1A 1XE7A 1Q43A 4BXFA 2EXKA 1KXGA 4AR2A 5HCBA 3CHXA 1R091 2VU9A 4LBOA 4Y26A 4CXYA 4KBBA 2MNGA 3UETA 5JOYA 5A6QA 5EZWA 4DXZA 4M4PA 1I9RA 4X6QB 2Z4FA 1O59A 4HANA 4OUSA 2WQ4A 2AGSA 1RJ8A 2RVAA 4QM8A 2R6QA 3NJZA 5FZMA 1ONAA 1H8TC 1PMIA 1S2BA 3TNQA 3FN9A 4D6QA 5I8YA 3Q8AA 3QCWA 4CDWC 3C8XA 3JB8A 3OEAA 1OOPC 4MGSA 5GZCA 1NKGA 2XQXA 1NY72 4O9EA 2VTXJ 5KHKA 2KXLA 3B9IA 3I2JA 5F5QA 1UAIA 3VBOA 2P17A 4QGNA 3HNYM 3T09A 4CDXA 1FYUA 3IDAA 5FZOB 4RSUA 2DU0A 2VMCA 4JZRA 5HV0A 1MQTB 1OVPA 4HVQA 1PM7A 1QKQA 4HKOA 1HB2A 2AEYA 4XJAA 2WR9A 2NYYA 4CU8A 5AFEA 5BNOA 3EHKA 4COUA 4PDWC 2D43A 3Q8BA 5LBEA 2AUYA 1ZBE3 3ZN5A 4RS5B 4CP9A 2E7QA 2UWBA 3V65A 4MO3M 2RS51 3M3OA 5H9RA 1BYHA 4PI2A 2J1TA 2E26A 3ILFA 1W06A 3F95A 2WC2A 4L2NA 4Y4YA 5KXCA 3R05A 4IGQA 1GNZA 3ELNA 5E89A 1URXA 2EA7A 3IBMA 1CJPA 2VMHA 1UIKA 3SMHA 1JU4A 3CKHA 1V6LA 4LPLA 4HSLA 2HYXA 4IGOA 4CEYB 5GZDA 5JAXA 1XU1A 2VECA 3MPPG 1N3PA 2QVSB 1PO11 3VBOB 1SACA 4QKNA 5IAXA 4AQ2A 3PTRB 4E9KA 1TNRA 4JX0A 1UYPA 1A34A 3ETPA 1O7FA 1ASJ1 3PUHA 1V6IA 3C7OA 1OA3A 1NCRB 4TZDA 1Q8SA 3VL9A 4NIAA 3TAYA 4B4QA 2D5FA 5J3UA 3USSA 3WF0A 2JD4A 4HVRA 1L7RA 1X9PA 4XHXA 3VZNA 3ZFGC 1AUYA 2WFF2 1H8TA 1IKQA 1WUVA 4O65A 4AYUA 4HG6B 4FP3A 1UCXA 4UFHA 5F6LB 2D3RA 3PU3A 2IXJA 2WQ8A 4Q4X2 3ZIXA 3QACA 3BUCA 2QQUA 5C3PA 3AX4A 3PUQA 4YW3A 4DQAA 3MEPA 1IKPA 5A80A 4QU2A 2Y33A 4TSVA 2A75A 4YG3A 5I0UA 3BTYA 2DBNA 1X82A 1U5ZA 4ZY9A 4HT1T 3E5UA 4ES8A 4TLFA 1R1A2 5FZ6A 1C8NA 2RV9A 4GWIA 4MGQA 1AL22 2ZEXA 3FE5A 4ZHNA 1ENRA 5GLVA 4BK5A 3BKZA 1LOCA 3AYAA 3VBFB 2ETEA 1DIWA 4JGYC 4N7UA 2QQNA 3NAPB 5C5TA 1LHUA 4KH9A 3O0XA 5FPBA 5LATA 4XFBA 1HB4A 5FY4A 1MS8A 2VW2A 3BCWA 4HSJA 2F4PA 1H2NA 1GWMA 2RS11 1RGSA 1J83A 3AFKA 3LPGA 4Q27A 4W50A 4AEKA 1ZREA 2QQWA 3CQOA 2V09A 1G86A 1NQDA 5C9AC 4QD2A 3O0VA 3VV1A 3RNSA 2RS12 4QB1A 2FDGA 5FZLA 4D7SA 4NIDA 4BB3A 5BNNB 2GN3A 3OB8A 3NRUA 1Y3TA 3KCCA 1GBGA 5FR3A 1MZFA 3LKJA 2HWD2 2XJTA 1ZRIA 4LHLA 5ABJC 2D97A 2J1EA 3BN6A 4YLZA 4GALA 4M00A 1O91A 2VXRA 4FQ4A 4NE9A 3M3IA 2XVKA 2D6OX 2AZ5A 2JX9A 3WP3A 1FMD2 5F39A 4CDUB 1GOFA 2W08A 3VBFA 1AXYA 1GZWB 3JD71 4BJ0A 1GSLA 1QJU2 5HV4A 3PMSA 4URTA 5BNNC 3OGJA 5F37A 1S0FA 5H9SA 4HETA 5LZ6A 4E4HA 3WW4A 4Y24A 2X5IC 4R4ZA 1QJX3 2TEPA 4P9IA 4YW6A 3H8OA 5HPOA 2WNEA 4GD4A 4AQSA 5FMCA 3KV9A 4F7ZA 4MZUA 2QDRA 2WYFA 5FXXA 4BWOA 3AMHA 3MLJA 1GP5A 4YM2A 5FK7A 3UGFA 4EV0A 5LRSA 5FY5A 3ZKUA 1UF2C 3C7HA 5FO7B 4I3PA 2YC4A 3H42B 2J22A 2R30A 2OUHA 4UF0B 5K0UA 1AHSA 3VD9A 3B00A 4JTNA 4AK3A 3IAPA 3SCHA 4ES9A 3CL1A 3OBRA 3UKVA 3K4AA 1MACA 4DUWA 2X53S 3NNJA 3TRSB 3WLUA 1QXPA 4RR3C 1APNA 4AVAA 4M3CF 5A7OA 1AR91 1FMD3 1JTZX 1QXRA 4PF5A 1GWLA 1DGRN 2XL7A 4AVBA 4E4ZA 5CADA 5CA6A 1FI2A 4Q8KA 4YRDA 2RJLA 1QIQA 2W68A 3N9QA 3T2PA 4M01A 2A1XA 1AXZA 5IFTA 5JPNB 1AYM1 1VMJA 2JG8A 2GNBA 2HBTA 1LOBA 5BNPC 1JOJA 4FCAA 1XJAA 1XNCA 1DZTA 3WW1A 3ZYGA 1CX4A 1SCRA 4D8MA 4QQ2A 1KQRA 2ZX0A 5C3OA 1QMJA 1NT0A 3KQRA 4EQVA 2VBPA 2BGPA 5FAXA 1JZ5A 4CCNA 2YB7A 3FLTA 5A7PA 2GU9A 3PJQA 4G3YC 4I0AA 2IUWA 1WWYA 4LEJA 4FAHA 5FZDA 4I2OA 1H9WA 1LJ7A 4XJZA 4DRRA 2PLV1 3EYPA 1WCDJ 4CDWB 2QQVA 4Q26A 1QDOA 3LZZA 5FXVA 2QQMA 5CAZA 3NWKA 4PT6A 4YFWA 5ABJB 2WFF3 5KR7A 2WNUA 1JUIA 2XL9A 2XXZA 1ZRDA 2VOVA 3RZKA 4MG2A 1W03A 1BCXA 1W04A 3ZXLA 2P4EA 3FX3A 1DYKA 3AJYA 2L9LA 2GN7A 4ARYA 1ZX5A 5BY5A 5C5UA 1SHWB 4QPIA 2Q0AA 4DXRA 3CNAA 4CUBA 1BK1A 2GSYA 4FAGA 4P9LA 1QGLA 4NHYA 2DVDA 2XG3A 2H0VA 1DG6A 4RQPC 2VMDA 3RYPA 1W8FA 2W46A 3FLRA 3S30A 4ET7A 5F8PA 1JZ7A 2DTWA 1TQ5A 1WCSA 4TLGA 4B1LA 1ULEA 3ETQA 3ASIA 3K3OA 3ZFFC 5KBFA 1NCQC 3Q8CA 4YZ3A 2VH9A 5JOZA 4W65A 1HRV1 3MHZA 4CA9A 5KWRA 3MPBA 3WNNA 4CXWA 1OBNA 4OUMA 4N43C 1KS4A 4DPNA 1IOAA 5JXJA 2WZ8A 1N3QA 4N9HA 3VZKA 3ZVXA 2JDPA 2WWSA 4XF3A 4D0QA 4URAA 1A8MA 1QJY1 5LA0A 2FCTA 1NYWA 1CAUB 5LA9A 1JYXA 1BLZA 2VMGA 3BYWA 3MIGA 3WHUA 1GWKA 1IS4A 2ZMKA 3KF5A 3S5QA 2C9AA 2ADDA 4DXTA 1DQ0A 4OFGA 3T2TA 2QQJA 5JSRA 2DCKA 3WF1A 3DUIA 1UMHA 2VZUA 1WMEA 1JUHA 2VMIA 1HV0A 2VNVA 3OUJA 4EWAA 1UQXA 2XJQA 5ABJA 3TWIA 3WNLA 4CCCA 1LAJA 1OI6A 3QOPA 4P00B 2UWAA 4JV4A 3OD0A 4Y1XA 3ST7A 4EJRA 4DXSA 5KC6A 1VBE1 1YFYA 2BNOA 3VBSA 2HWC1 3O1TA 4XUPA 3B7MA 1BK0A 1POV3 5EJ1B 3SXWA 3MUZ1 2VZPA 4CPBD 3I7DA 1EUTA 2CV6A 3JBG1 3WDVA 2Y26A 1ST8A 2CY6A 1PGSA 2D6MA 1RVF1 3WT3A 1W3XA 1M4WA 5DUVA 3BTZA 1QY4A 4IW3A 3M4FA 4IERA 1DQ5A 4AVVA 2VOKA 1OQDA 3WQBA 2IFRA 4YVWA 5FZFA 1GANA 2PXJA 2PHLA 2VCAA 1P8JA 3E5XA 4KBZA 4C0HA 1RB8G 1F9KA 2ZPXA 4I30A 1K5JA 1REDA 2RS33 3QH6A 3JXSA 1IG0A 2EIGA 1ULCA 2XUEA 1NUKA 3VBRC 4AI3A 5I0DA 2ORZA 2VW1A 2DVAA 4QU1A 3W20A 1CGPA 3PHMA 2TBVA 3PMEA 4HVOA 4WV8A 3SHRA 1RUD2 5A1LA 2ZEYA 2QBXA 1CESA 5JZGC 5FXZA 1A6CA 4QPGA 4AF9A 3RS6A 4HL0A 1LULA 4X8PA 3UYJA 5L9VA 3TOJA 4PBPA 2B9UA 5CG9A 3THTA 3IN9A 4OI2A 4JAAA 3PVOA 5T54A 2BGOA 4P9XA 5FIXA 4NIIA 4CCJA 3HPNA 3TEXA 2PHRA 1V6NA 5FP7A 3WVJA 4QX8A 5APAA 3TEZA 2OZ6A 1FMD1 1RINA 2PAKA 2RDQA 2E63A 4F3JA 1ULOA 2RM23 4CCMA 1C3HA 3AJZA 1J3PA 3HVDA 5TSWA 4FPKA 3ZYBA 1VRH2 2J1UA 4XMAA 1V6KA 3WG4A 1FT9A 1GQPA 2VUAA 3SEPA 3WHTA 3ZXDA 4AHXA 2WYSA 4LK7A 5T52A 3D82A 3KGLA 4CSWA 2D6LX 3DPRA 3RZJA 2V5DA 1O4YA 4Q29A 4OQ8A 2OW4A 4LKSA 2FMDA 4B4PA 1MEC1 5CFCA 2WNVB 2WJSA 3DYOA 3GF6A 4LO7A 1KS5A 3CIHA 4QPGC 4RHV3 3RGBA 2ZGQA 3WNPA 1CAXB 3H0OA 1K5MC 3RMYA 1MS5A 1PVXA 3NNLA 4BE3A 5ACA2 5BYNA 3B69A 1ULGA 4GB32 5C4WB 2EF6A 4CEWC 1DZRA 1LEMA 3VDCA 1QU0A 4NJ4A 4Q4Y1 4Z2AA 3VDDB 2BV4A 4I01A 2WS93 2P37A 2PTMA 5FMOL 1IZ3A 4R9CA 4CUAA 2OVUA 2YXSA 4JQTA 1Q56A 4WM8B 5DABA 5A70A 5GZGA 3KMHA 1W8ZA 1W90A 5KC5A 5A3TA 3O12A 2JDAA 4CP9B 1ZZ7A 5F32A 4BQ3A 1H1MA 1XNDA 2DU1A 4JC1A 1K12A 5FMDA 3ON7A 3GXUA 3VD5A 1W8HA 1MQTA 3Q8FA 4XF1A 1W6PA 5JI9A 3C3VA 3HNBM 1OPOA 1RUE1 3VHNA 1AR63 4PHZA 1OVSA 2WZR1 1QJY3 1JYVA 4P9JA 2WS92 1H30A 4RGKA 2J1RA 4LE4A 4Y5Z0 4AAXA 4DOUA 2EALA 2RHPA 1TNFA 3T2OA 1VP6A 1UZVA 5D8AC 2EICA 1DZQA 2NN8A 2C5DA 2O8OA 2E51A 4LBKA 4C8DA 3ZN6B 4LITA 3MIDA 5FO9B 5LW9A 2ZGMA 4MGYE 3ZFGB 1N1TA 1G7YA 2LALA 4D7TA 3NV3A 2RMU2 2ZMNA 3SH5A 1S4CA 4ITCA 3NL1A 1CIWA 2ERFA 3JBG3 4H2AA 1CAWB 1YLLA 1DP0A 4R9DA 3PL0A 2AH2A 1XYPA 5C3QA 1RUJ3 3JB4C 3IPVB 4E2GA 1FPN2 5E8AA 4XCAA 2CWMA 4NROA 4DFSA 3JD72 2J1AA 4IEOA 2G4IA 2BFUL 3MV11 3B02A 2IXHA 2PN5A 1DYOA 4XXAA 3DV8A 2FMYA 1FOD1 2XJVA 4WM7A 3S6PA 1Z7S1 3M3QA 1QQP1 5LA2A 3POIA 1CD3G 5IYYA 2XWBB 3KZ4C 1NXMA 3C7GA 2RR12 1QJY2 1SQ4A 2WN3A 5FY8A 1UPIA 1LRHA 1LU2A 3H8RA 2B7YA 1EAH1 1H2MA 1FOD2 2ZKNA 4IESA 4AQ6A 5BUVA 2BFUS 4HKWA 4META 3OSDA 4OI1A 2VMFA 5DUUA 4YVSC 1AF9A 2YDEA 1IQAA 4CUGA 2WFPA 2BPA2 3ZXGA 4M3CE 1G6NA 4CDUA 1OLQA 2LW8A 3RPQA 1LGBA 4HFSA 1JZ6A 2FDIA 3AC0A 4PIYA 1YXWA 4DUVA 3B5LB 2PQSA 1LENA 1JOBA 1FV3A 4IUGA 2JECA 2JDNA 3NV2A 1YNAA 1RUF2 4QQLA 5FYYA 4KMQA 4BM8A 3GDBA 1RUH3 1O8SA 4QKBA 2FQPA 2WL1A 1HJGA 3WQ7A 1SMVA 1YC61 1GKBA 2JG8B 3KCXA 3OYWA 1C8M3 3WDXA 2W94A 3EJKA 4B8EA 4XIKA 1FOD3 2UY8A 1F5JA 3SISA 4BQ2A 3LFIA 1OA4A 5AC93 5C3SA 1GP4A 3ROUA 3NKGA 1XU2A 1VLNA 4I0BA 4K8FA 4IV1B 5JIUA 3ZXKA 4K40A 1OHFA 2RJKA 4UFIA 1UMZA 5JXGA 4LMFA 2PHFA 1WLWA 2B8MA 1HB1A 3J8F1 4M3CB 3IMNA 3VBUA 2XBO1 1O5LA 1VB4A 2HH9A 4KG8A 5J98B 1X33A 2BW8A 2GMPA 3OBAA 1VAVA 3VZLA 3LSEA 4YM3A 1GNYA 1HRV2 2HWF3 5DG2A 3DKWA 4MV2A 2LS6A 3MGUA 5C8CA 1WA6X 4PLOA 5DUWA 4YW5A 3U75A 3GM8A 2PLV3 4L8QA 4H7LA 1Q8VA 1GV9A 2HWE1 3FC0A 1CPMA 1KDKA 3FFZA 3MIHA 1W9TA 2B42B 1NCRC 4GMP1 2AENA 2K9ZA 3H1WA 1CN1A 1F35A 4LK6A 3VBHB 4N9IA 2GC3A 4Q0UA 1W8UA 1ZZCA 4NPMA 3TN93 1Z78A 4Q4X1 2IWGB 1TVGA 2JKXA 1JYWA 3WNOA 2PHXA 4QGMA 2AR6A 1RMU3 3I97A 1WBFA 5L73A 4B7KA 3V0AB 5JPMB 5KHHA 2MEV2 4DUXA 5HI0A 3RI9A 5HXMA 2Z42A 4UT5A 5A3MA 2YFZA 5JUVA 2FD8A 3U78A 1WMXA 1TME2 3SEEA 2MEV1 3AZWA 3KV6A 5CYYA 2UURA 1LNSA 5JSPA 3S0MA 3LDRA 1LOEA 3VDDC 2PLV2 3IKWA 3LEMA 1E5HA 4OZOA 3ZYJB 3N9LA 3NSTA 4NUBA 5FWEA 2OQ6A 5BNNA 1UZWA 4RHV1 4FPHA 1PZ8A 3ACHA 1NA1C 3OGSA 1O6UA 2WWJA 1LESA 1S0BA 3PU8A 2JB4A 2PAMA 2DUPA 2R1DA 4LNVA 1K5MB 1XQNA 1PO22 3J7LA 4W4ZA 2O0OA 4XVHA 1XYOA 4Z2WA 4UFLA 4A3XA 2Q8DA 5JMOA 5IHRA 2FDJA 4MHUA 3UJOA 1SEFA 2YV8A 4CP0A 3JU9A 4COYA 3N7LA 2EIEA 2R042 3AP4A 3AZZA 2XOMA 3V0BB 3V56A 5CU1A 3D8CA 2R062 2WA4A 4A6SA 1WBLA 2E7AA 1JZ3A 1JBCA 3D0SA 4U36A 3ZSMA 1DFQA 1SLBA 2PAEA 3R0RA 4CE8A 3WDUA 3ZMOA 2BOJA 1HDKA 4IV1C 4LULA 2VGDA 3ZPOA 4FO9A 4K1ZA 3NO8A 4DZGA 5CBLA 2I2SA 5JOXA 1IQDC 3DGTA 1LHOA 4AFBA 3AKRA 3D6EA 3UJQA 4IEZA 2E6VA 1VBE2 1LOAA 1W9FA 2ADEA 1STMA 3H1YA 1HQNA 3H1MA 1BMV2 4EZ4A 3OEBA 1GFF2 4EWDA 5F9TA 1W0OA 1MZEA 3I2DA 2AYHA 4J6GA 3J9SA 4O9GA 4WVVA 3WEZA 2ID4A 2WRAA 3MIBA 4XQDA 2VOXA 5FK8A 2P34A 2ZJCA 1YO8A 5FYZA 1PNFA 1SLTA 3OGGA 3A22A 1VB2A 4FPYA 4KWKA 2OPKA 4RFT0 3U10A 1W28A 3JQWA 5CVRA 2ORXA 2LM3A 5FPZA 4E2SA 3HMYA 2JIGA 1DQ1A 2H0BA 1CZVA 4QMAA 1VRH1 2MEV3 2JIJA 2PHUA 2R043 2VTFA 3QD6A 4K6BA 2AC1A 3FWEA 4H55A 1ZYBA 5CKMA 1I6XA 3GHMA 1XYNA 3LIGA 1RVF3 5C9AB 3UNPA 5A3LA 2Y34A 2ZEZA 4R4XA 4AHWA 1NE4A 2BTVC 1ACCA 2BNMA 2QZ3A 2YBSA 1ALYA 1W9YA 2ZACA 4EN7B 2K2SA 1FNZA 3A21A 3KLSA 1YIPA 2CU5A 3K4ZA 4LHSA 3QH7A 5FUPA 4AGGA 4ASLA 3AL5A 2BDRA 4HMZA 4Q4X3 1PGL1 4BK4A 4D94A 3POYA 4H14A 2D93A 2JDKA 3ZM8A 3HNMA 4YW4A 1TG7A 1VAKA 2JICA 3C7FA 4LBQD 2QUOA 2WLPA 4Y33A 3E6CC 3AXEA 2BUKA 3CU7A 4HPKA 4RQPA 2XMLA 4UFMA 4LO6B 3TEWA 4MH0E 5FV3A 4L92A 2ATFA 2RDNA 2VCBA 2WT1A 2WINB 3N35A 3N7KA 2ZOEB 2ZS6B 4KGQA 5J48A 2HWC3 4GQ7A 4DNYA 5BNPB 1R64A 3ZXFA 3I3EA 3AKSA 1NA1B 3PVNA 2UWCA 5DAQA 1HQLA 5CISA 5FKCA 4FXGB 1GZWA 3JQXA 4AHYA 2WSVA 3U1XA 4XETA 1Q5OA 5SV5A 3N4MA 4ISRA 1MS1A 2J1SA 4A4AA 4EROA 5LASA 3SITA 3WP4A 3HQXA 5BNQA 4Y4RA 3AZYA 1KGYA 4UWDA 5FKBA 4WVZA 3C2UA 3H3UA 4OHYA 1ASJ2 3WG3A 4A7KA 4PIZA 3HAGA 3TB0A 1N47A 5CKQA 1UW8A 4D6RA 1ND3A 5J36A 2VZVA 2WBKA 4QT6A 3VBRB 3OUHA 2G9ZA 2ZZQA 4AFAA 2OIIA 2E31A 1UD1A 2OXBA 2QFEA 3KWVA 4JDMA 1HN1A 3ES4A 1OD5A 4PF1A 4QQOA 4QB6A 3ZN4A 4Y1ZA 3VN4A 2X8KA 2HWB3 1L7LA 4QDRA 1RUH1 3OGVA 1OUXA 3J7HA 4OHWA 4BYYA 3TNPB 4MGZE 1HJFA 4FOYA 5FPAA 2YBKA 1AR71 5C8CC 1UZZA 4RQPB 1HQWA 1V6OA 4ASKA 2VCMA 3GBFA 3IIIA 1ENXA 1QJU1 1SLIA 1H9PA 1VR3A 3NJXA 4FPEA 5FZKA 3ZLIA 4QXBA 3O1OA 5E1RA 2B4KA 2QQIA 3WX5A 1QOTA 2VUDA 4ONUA 4BQ1A 1MVQA 1GMMA 3RYRA 5HBAA 1MEC2 2NPIA 3VL8A 4AEDA 4CDUC 2UYBA 2VXJA 3T1LA 1I3HA 1KFXL 5L7OB 3DF0A 1ENQA 4H7MA 2R0HA 1Z7S3 4YVSA 1Y43B 2GALA 5JLVA 2VTXA 3PVBB 2JKBA 2RMU1 4PLMA 4QX1A 4QPGB 5FZEA 2Q8EA 2Y8KA 1ENSA 2WFF1 4B3NA 5C8WA 1SLAA 1R1A3 4ZXKA 2PMWB 2ZZJA 2XUMA 2E53A 1XB9A 2QQKA 5C6CA 3H7YA 4YW7A 3UKTA 4ASMB 1S1AA 2A3WA 3JCIA 3VB9A 2BRTA 5JR7B 1F31A 2W2IA 4A44A 1KRIA 1ZBA1 5FYHA 4XOGA 1B35C 4I0WB 1ND3B 1F4AA 5FLJA 1PX4A 4X6RB 1JHNA 2YUEA 4UBGA 4FPJA 1F2NA 5ANNA 2JE7A 1W99A 1WCQA 1YYNA 4RFRB 2D40A 5IFPA 3ECQA 1AL21 3QLQA 4YZ1A 2W47A 2VR4A 3AKTA 4OHZA 2R49A 5CIRA 2XJRA 3M8LA 4GWJA 1D4M3 4BCUA 2CGPA 4B1MA 3FHAA 5GLUA 1Y9QA 5DPNA 1OH3A 4BDVB 1UPSA 1BZWA 1VAMA 2Z2SB 3UGHA 1ZNPA 3I49A 1Q8PA 3BODA 3O7OA 4OMCA 2YPDA 3IDEA 4FTSA 4DB5A 1UL9A 3F2ZA 4IETA 4XCBA 2QTWB 3B94A 1QJX1 3ACFA 4MX3A 4LOTA 3WUDA 1DCSA 1EPZA 4RHV2 4YSFA 1RHI2 5DQ0A 2HWF1 1OKOA 4KU7A 1VBA3 3POFA 4GXLA 1OURA 4W6WA 2IZWA 1QNWA 2GDFA 4A45A 4BZ4A 1ND2A 2XR4A 1ZBA2 1NQJA 2G19A 5E6HA 2EXIA 4KWLA 5FMBA 1WW6A 3ZIWA 1BJQA 1NE6A 4YYOA 1O3QA 1YQ6A 3LIHA 5FJHA 3I8TA 4Z1VA 2DFBA 4JHZA 2JE8A 2EXJA 3AMNA 2WWUA 1JYTA 1J59A 4XFCA 3ZYPA 1QJFA 4D7YA 1SG3A 5A6YA 1G9DA 3ITQA 3J8F2 1PIV2 2P6HA 4L97A 4XJ8A 1KEXA 3CZUA 4CP1A 4LIVA 4AEDC 3DXUA 4XXPA 1FPN1 4WZCA 3J7MA 1AXKA 4JCKA 2AEZA 5C4WC 1VBC3 1WLTA 2JXAA 2TUNA 5GLWA 3KT7A 4UW6A 4NHLA 3E97A 5A3NA 4YM0A 1XXNA 1WGPA 3BGAA 2H6BA 2Y0OA 1V6JA 5GZFA 1OT5A 5FLIA 5F2WA 3AZVA 4NPLA 4R9AA 3AP5A 2D6PA 3VKLA 4IL7A 2EXHA 4XFIA 4F83A 1SDWA 2XJUA 2WLQA 4XUQA 1W6QA 2VZ3A 5AVPA 2O1QA 5ANQA 3P5BA 1COV1 3K75B 1TEIA 3MW4A 4QKFA 4ATFA 1IHMA 1WW4A 1CR7A 2WKKA 1RC6A 1MPXA 1JZ2A 1RUG2 3I3QA 3WINE 4LO4B 3RZLA 4CCEA 4L99A 3G6JB 3KS7A 1C1FA 1V9U3 1C4RA 3E6BA 1H4HA 1YRZA 1OOPB 1PX3A 4CEWB 3AKPA 5LCWL 3T3YA 2RS32 2YPJA 1X8MA 3M1HA 5EJZB 4CDQB 1UKRA 4B7EA 3FUOA 1K5MA 3WF4A 2FHRA 4IEVA 5AFBA 4IQPA 3ZFEB 3DEMA 5D2AA 5EV7A 4DY5A 1OF4A 4HXCA 5A7SA 4CXXA 1G9CA 1R1ZA 2P2KA 5DXDA 1H0BA 2PFWA 4V1PA 4IDZA 1ULDA 3WUCA 1VBB3 2DBIA 1X36A 2VBBA 2ZXQA 3SH3A 3BI3A 3K77A 5FZHA 3UGGA 1J3QA 4K1YA 1COV3 3WDWA 1Z7S2 2ES3A 2J42A 2CGOA 3C7EA 4I02A 4AVTA 3AVSA 5FWJA 3O5SA 4AZZA 2A71A 4XUOA 5FZCA 1PIV3 3DYMA 2WZR3 3HBZA 2R072 3ABZA 1W05A 3NAPA 4QXHA 3VHPA 3VDBA 4Q4W1 1OFSA 3ZR6A 4AGRA 2JB8A 4P02B 4HOOA 1A8DA 3I3BA 4N90A 2GNDA 2JE9A 4Y5TA 4DEQA 3WF2A 1ZRCA 4EZHA 2XJPA 3LAGA 5C7GA 4GULA 5ACA3 5BV6A 2NZ9A 3VKMA 2VVFA 2D3SA 1UOGA 1W39A 2FCVA 4Y3OA 3VGIA 1CJDA 4M0NA 1C1LA 4Q0QA 4QX2A 1OQ1A 4QAWA 4XTPA 2ZAHA 5LY1A 3VBRA 4XURA 1YIFA 1LHVA 1W2OA 1L7QA 1R092 1CZSA 1NG0A 1GOGA 4N8MA 1JOPA 3VDAA 4A42A 4C0BA 1XBFA 3LCPA 1YQ8A 5HXVA 4OUEA 5T55A 3I3MA 1NZCA 1XE8A 5FYCA 3H9AA 1JZ8A 4HBNA 1W6NA 4CCLA 4UAPA 1BMV1 5FQ0A 4XUNA 1V70A 1YI9A 2RS53 3FUQA 4QX7A 1DDLA 3DECA 2BJSA 4PQ9A 4LO5B 4J1WA 4AFMA 1LKNA
chains in the Genus database with same CATH topology
1AYM3 4EN6B 3LB9A 2DV9A 3AMQA 1G9BA 4IV1A 4XZPA 2YZ4A 2D6KA 4LBJA 2XLAA 4XYXA 2E9QA 1FNYA 1QOOA 4AI0A 3WV6A 3DN7A 5FOBB 5DUXA 4NO4A 3ZX7A 1ZRRA 2ZA9A 4Q4V2 4Q1PA 4CDQA 4L11A 4ZU4A 4BMBA 2X5IB 4WZFA 3N36A 2RMU3 1RUD1 3L2HA 5H9QA 1I1EA 1UKGA 3AM2A 3JBG2 3R4UA 1W6OA 2MHFA 5F1RA 4PJYA 5IK4A 3WP6A 1YFXA 3ZSEA 1SBEA 4GMP3 3MFAA 2HWE2 4OULA 2ZHMA 2ZGUA 3FBYA 1KJRA 2DCZA 2HWD1 1U0AA 2IXLA 4IEQA 4Q4V3 1F8VA 3WY6A 2R16A 1W6MA 1Z0HA 4CDXB 1JYIA 4LBNA 3M3CA 2GAUA 2NMNA 5JZGB 4JDOA 3O0WA 3TN92 1HXS1 1WLCA 2HWC2 3KT1A 4A7YA 2VW0A 1H4GA 1RMU2 4XW3A 1GQHA 2ZX3A 1RUF3 4LTAA 1KFUL 5CFCB 5DDJ3 2XH6A 5FLHA 3KCYA 2ZGTA 1MS0A 1VBE3 4ISQA 2D3PA 3V64A 5JMCA 2SLIA 3ACLA 2ZHLA 1PVC1 3AFGA 4AEDB 5I93A 4QPIB 1N1SA 3ILNA 3THPA 4BLJA 4Y20B 4X8NA 1W6MB 3H50A 4Q4W3 2JENA 3TYJA 5K0UC 1CVNA 1MVEA 4LUKA 5AC92 4P9WA 4XBLA 1RTVA 3V0BA 1QJU3 3A0KA 3AKQA 5E16A 4KQ7A 5T5JA 4IXLA 1BEV1 1S55A 3ZSKA 1VBB1 2B5HA 1JYCA 1ZBE2 2BQPA 4LE3A 4OHVA 1W2UA 1S0IA 4INDA 3MI8A 4UW3A 2X5IA 4YVWB 4QM9A 4XHBA 3S7EA 2HWB1 3K51A 4A2UA 3POWA 2DCYA 1DGLA 2DF7A 4RR3A 1AR62 1LECA 1WA4A 2DWRA 1QOSA 3D5OA 4Q1RA 4COWA 2CL2A 1TMF2 1AX1A 3URFA 4CDQC 2RE9A 5JDBA 4YZ2A 4Q0VA 4QQPA 3P3NA 2P3KA 2GC1A 4AI1A 4GIQA 4XQWA 3BU7A 1HIXA 2V5YA 4MXVA 1QF3A 4JDNA 1MS9A 4DINB 1RIRA 1RUJ2 5GLTA 3GHNA 1ULFA 1B35B 3RRDA 3E6DA 2GC2A 3WDTA 5FTTC 4YGBA 4JRAA 3VBFC 1PGW1 3MYXA 5FBZA 4NVPA 4AEJA 1RUC1 5IK8A 2VOWA 2GMEA 2R061 1N1YA 2D7FA 1H8TB 2VPVA 1S0DA 1AL0G 3B01A 4K9SA 5D8AA 2WNVC 1PNGA 3RJRA 4UW5A 3BOPA 2GNTA 1SFYA 4S2GA 1VBA1 3B9CA 4IEYA 2R063 2KA3A 2PHWA 4G4FA 4QXKA 4KL1A 1RUNA 4XTMA 4YGCA 5CB7A 1C57A 3WQ1A 3ZFGA 3RSJA 2BWCA 3GZAA 3OYWB 4RD7A 4BLIA 4XIOA 3NAPC 1PO13 2I45A 2RS13 4AVSA 2XKPA 4AWDA 1BBT2 3J8F3 4ZKTB 3ZFEA 3I54A 2HEYF 4FOVA 2Q30A 3AP7A 5CG8A 1DLLA 2W0XA 1U5IA 1D0HA 1V6MA 1RUC2 3BALA 4I09A 4CEWA 5JCTA 2HWB2 5KHIA 5IK5A 2ZKLA 2B45X 3K48A 2MPFA 4E4SA 1SCSA 2A5ZA 4BMEA 2NP0A 4NR1A 4C1WA 4LA2A 5J7MA 4OI0A 5EFUA 2Q4SA 4OVEA 4AVCA 5CFCC 4DRVA 5DDJ2 1C8M1 1GZ9A 1AYN2 3M3EA 1PO12 3FZ3A 2WQZC 2WT0A 3DPRC 3USUA 1W6QB 4K20A 1L3JA 4XF9A 5LEJA 2RM22 5I8SA 1GLHA 2XWJB 5EYXA 4HN0A 2IXKA 2HWD3 4Q4W2 4CDXC 3GZTB 4XF0A 2DVFA 4C91A 1NCRA 3HD8B 2ARXA 4LLOA 5FOJB 1LOFA 2B39A 4FPGA 4AGVA 1J58A 4NHMA 1EAH3 1D2QA 4P9GA 3OJBA 3MICA 3M2MA 2GNMA 4FOQA 4HZFA 1SBFA 4YW2A 1HW5A 5JZGA 1QH7A 2XBO3 1RMU1 2YY1A 5L7OC 1NLRA 4XFAA 1KITA 3OTFA 1DF0A 3TN91 4IV3A 2GH2A 3ZYRA 1PIV1 2QKDA 3ZFEC 5C8CB 2XB6C 1BBT3 1H8VA 5I8TA 3LA3A 2D98A 3E5QA 3ENRA 1WMDA 4PIXA 4M0HA 4LO8A 5BPXA 2DTYA 2ZX1A 1NCQB 1ND2C 3GYDA 4B4RA 1GYKA 3DL3A 3RJ2X 1FXZA 1JN2P 1SBDA 1HLCA 3D0JA 5JIAA 5B2GB 3IIAA 1NXD1 1RHI3 1BEV3 1UN1A 2B46X 4FPCA 3VBSC 3ME2A 2XJSA 4XJUA 4LLFA 2CGNA 3MIEA 1F5FA 3N3HA 4YG0A 3SLIA 1PZ7A 4CZSA 4NN0A 4Y1VA 4AHZA 2WNVA 5JOWA 2JDZA 1U5YA 2C0ZA 1ZM1A 3WG2A 5SV8A 3RWNA 4DY3A 2PELA 4HKLA 1D2SA 3I59B 2A6ZA 4KGGA 1PZ9A 2YGLA 5FQ0B 4XILA 1O5UA 1IS6A 1W6NB 1XNKA 4BA6A 5I0RA 3IM0A 1MR5A 4LHNA 3LSDA 5FPXA 4XDQA 4PBOA 3VBHA 3BB6A 4FPOB 2DUQA 4JGZB 4RA0A 4EWEA 2Y38A 5K0UB 3FFQA 1RVF2 4HK9A 2A6VA 1DU3D 1VALA 1B35A 3GBWA 4FXKB 2JG9A 1HRI2 4WBBA 2JG9B 1UIJA 2YYOA 3NVCA 3WW2A 1VBC1 4Y22A 4WM7B 1RUG1 1EPWA 2ZGKA 1MEC3 4Q2FA 3ZFFA 3VUOA 1WMFA 1AX0A 1Q8QA 1CAVA 1OPMA 1YJLA 2CTVA 5BXXA 3VKNA 1O3SA 3AXDA 1C5IA 4GKYA 2Q1MA 4Q4V1 3GZUC 3LA2A 3VBUB 1UU4A 4G9SB 4KU8A 1PGL2 3CJXA 3HWJA 3WOGA 1IPJA 2SBAA 3RDIA 1MQTC 1HRI3 2TNFA 3ZN6A 2XVGA 4GWMA 1VBA2 2EVXA 1AYN3 2ZCWA 1R093 2XVLA 3R4SA 3AMMA 4LT5A 4GH4B 4MSVA 4XBNA 2ZMLA 4P9YA 2ZGRA 2GZWA 4H3WA 4AFDA 1OMIA 3A4UA 1Q8OA 1W6PB 3B93A 4YGEA 1Y7BA 1ND3C 1VBC2 1IPKA 1JW6A 1ZRFA 4UXAA 4RS5A 2CYFA 5BNPA 3ZSLA 2JG8C 1N1VA 1LCLA 4ZU5A 1AR83 2WZR2 3INAA 4S2DA 3S7IA 4B29A 5IK7A 3FHIB 3KT4A 5JVVA 3RMXA 4YFZA 5KXBA 2PQQA 2QDNA 3JD73 3GBGA 4FTEA 1GNHA 5FRAA 3APBA 4Q0SA 2P3IA 4XFGA 3AP6A 3VHOA 1AR92 4BIFA 1LB2A 2W52A 5E88A 1ZBA3 2ZAAA 2G9FA 4JVAA 4Z82A 1C28A 2A70A 4ZU7A 2VNGA 4LBMA 3VZOA 5DZGA 2A6YA 4JGZA 3ZYIB 3RQ0A 2XHKA 5IUQA 2CAUA 4NOTA 2CWSA 2ZGLA 4JTOA 1RUG3 5I0TA 3O14A 4Z92B 1VBD3 2XKOA 3LOIA 1KD7A 4QQHA 3JZVA 2XLGA 5IT6A 1RUD3 2WZPP 3POSA 1BKZA 4AI2A 5J96B 2IC1A 1MS4A 3NV4A 1TME1 3VBHC 2WNUB 3A0NA 4EN9B 1PK6C 1VBB2 1A3KA 1RHI1 1SLCA 4RR3B 1W0PA 5FMOS 3VHRA 1LEDA 3WCSA 4P14A 4K21A 4GB33 5LK7B 2NLRA 3WR0A 3RYKA 5K8SA 2YROA 3G7DA 1TMF3 2D44A 5JI7A 1J1TA 4YVWC 4E2QA 4FPLA 4WM8A 1COV2 4GA9A 4Y1YA 4XPVA 1Q3EA 2PHDA 3FLPA 3LA7A 2ARBA 5C9AA 4XMIA 1ZZ8A 5KHGA 2R071 5T3NA 3OY8B 1WCKA 2BVBA 5KXDA 4N53A 1UX6A 2Q8OA 2ZBJA 2I07B 2DCJA 2NM1A 2ZABA 2FZ1A 2FBEA 5CNAA 5T5OA 1LHNA 1POV0 2IXCA 4WM8C 4GMP0 3J26N 1PHMA 4IEUA 3OF1A 1QQP3 1CPNA 2DVGA 1CAXA 3I4IA 3EBRA 5A33B 1ZBE1 5J37A 5A32B 4EN8B 3OBTA 2G9GA 2QZ2A 2R073 3WDYA 1PK6A 3HIFA 1UU6A 1VBD2 2XLFA 4C90A 1ZVFA 3SCFA 4KWJA 5HCFA 4YW1A 3AP9A 3WXPA 1U5XA 1HRV3 2HWF2 2N7GA 4N43A 1FPN3 1RUOA 2BVVA 2RR13 1WW5A 4LUMA 2EAKA 4JGYB 3EQEA 4MXWA 3EXUA 1QDCA 1TMF1 2HEWF 3LOBA 1RJ7A 5K9YA 1BVP1 4P5HA 4YM1A 2JEMA 4KNCA 3MF9A 3ATGA 3UV9A 5FO8B 1QQP2 1QXJA 1R1A1 1TME3 1H2LA 1NOVA 1EYBA 1W6OB 1HKDA 4NWWA 2X29A 4UBHA 3TBDA 1S2KA 1LOGA 1B09A 3WG1A 2WA3A 1J1LA 1NLSA 5GJ6A 4FT8A 3H8UA 2VQ0A 1FATA 1RUE3 1O3TA 3Q9OA 3NKTA 1TE1B 4RL7A 1C8M2 5BNOC 4XEZA 2A3XA 2K0GA 4NHKA 1DQ4A 1ZA4A 2YGMA 1PO23 1PGW2 2WSUA 2DYCA 4N53B 3VBOC 4RGAA 2D5HA 4FP2A 1OOPA 4QHBA 2A73B 1S0EA 3N7MA 1UU5A 4OI4A 4CDWA 5I91A 4KG0A 1RUE2 4XE9A 3ZXEA 1OA2A 3BTAA 4EN0A 4W6YA 3WNXA 2ILMA 2PA7A 3VLBB 4E4DX 5BNOB 1AR72 3OCPA 5C33A 2XPJA 1FAYA 3GALA 4BPZA 5C4WA 5CFDB 3OPZA 5DG1A 3VZMA 4IV3B 3PLQA 2DURA 2HYKA 1VIWB 1DBNA 1QJZA 2A6WA 3M7AA 3IPVA 2AREA 3QBQA 1PO21 5J09A 1XRUA 1VJ2A 3MLLA 3ILRA 1ZZ9A 5LRRA 5FFOC 2Z79A 4OHXA 3W9AA 3H7JA 4NWVA 4FTBA 3CF6E 4AEMA 2GH8A 5ACA1 3KSCA 1CAWA 3B3QE 4U2AA 3UKNA 1AR73 1MS3A 4IEXA 1LU1A 1ZZ6A 1JXNA 2F6BA 1ND2B 3CJIC 4LBQA 5I0SA 4TYSA 1GICA 1JH5A 1OQEA 2H6CA 5GKAC 1H1IA 4CRQA 1AYN1 4YZ5A 4HK8A 2I74A 4BOWA 1SLLA 2NQYA 4W6XA 1T6GC 1RUC3 3P3PA 2OUJA 3SNMA 2QE3A 1O3RA 4D69A 1AJKA 1V9U1 3UL2A 4OZXA 2OA2A 1S0CA 2DCTA 2HEVF 4S2HA 1REFA 1AX2A 4YNIA 4R52A 1H1AA 3HR9A 1WW7A 4GH4A 2PHTA 4LBQB 4YZ4A 4AI8A 1POV1 2Q5TA 3FBMA 1HXS2 5JWPA 1UZYA 2A6XA 4LHKA 5KHJA 3X29B 4Q0PA 4YGDA 2DUOA 2ET1A 4Q4Y2 1RITA 4WVMB 1YFWA 3AYDA 4AG4A 4IV3C 4J1XA 3WD5A 3DPRB 4BHPA 5CFDC 3U4XA 1DGWA 4PCRA 3WW3A 2ZHKA 5L7OA 1KJLA 2EAAA 3L2YA 1NY71 5GZEA 1FV2A 1O4ZA 3ZXJA 2R1BA 5D8AB 2UY9A 3M70A 1IGOA 1QJX2 3KB5A 1LOFC 5AC91 1J3RA 1RL3A 2QJVA 2JJ6A 4MXWB 1WD4A 4E27A 1HXS3 2W39A 3MFCA 2VUJA 3FJSA 4FBFA 5L36A 1AR81 2ZHNA 1REEA 2ZGNA 3RI8A 2Z69A 1OLRA 2BWAA 4FSJA 1C5HA 4Y1UA 2UYAA 4LR4A 1AR82 4M3CA 2R0FA 4AW7A 5GM0A 2YMZA 4QX5A 1DQ2A 2RM21 4RGGA 2DFCA 3I59A 1ASJ3 5T5PA 4XQ4A 2BEOA 4ATEA 3D4KA 1QNYA 1DHKB 1OKQA 2ZX2A 4CEYA 1X50A 3VKFC 1KDMA 4K3UA 4PDWA 3JUUA 1HRI1 2PYTA 5T5LA 1PVC3 5GLZA 1RUI1 1LR5A 1S0GA 3AB0A 4PLNA 3OY8A 2Q1ZB 1AL23 2WS91 5H9PA 1YWKA 1EAH2 4Q4Y3 5DZFA 2LUWA 1RUJ1 4DS0A 3GNEA 2GMMA 1BQPA 4MVTA 3WCRA 1CQ9A 3BIWE 1LTEA 2C1FA 4HPKB 1M06G 4MGKE 1I5ZA 2ZTNA 2HKXA 1MZ6A 4FPFA 1N3OA 3ZDSA 2HJIA 4GKXA 4Y22B 5JSOA 2O8QA 1DQ6A 3WQ0A 5AVAA 3MW3A 3NV1A 3J4UH 1WLDA 2ZX4A 1DGWX 3AMPA 4FOWA 1A78A 3FMGA 3UK9A 1AR61 1V9U2 1E57A 1IS5A 4QPYA 5A32A 3CEWA 4XF4A 2VY0A 1SFNA 4YG6A 2GC0A 3IDCB 4HLTA 1PK6B 5FREA 2CAVA 4BH9A 4N53C 3PNAA 1R081 1EV12 3AYEA 1YCIA 2Y0IA 1AZDA 1EY2A 4TWTA 3RZZA 4N7IA 3MDPA 4Q8LA 1EV11 1QHDA 1D4M2 3MIFA 4I3GA 1NCQA 5K7PA 2QNKA 4CYDA 4CTEA 4COVA 4BIOA 4COZA 1D4VB 3EO6A 3LGRA 2LTNA 1DGRA 3U11A 4JGZC 1PVC2 1EP0A 4IEPA 4XJWA 2WT2A 4QPIC 4AQTA 2RR11 4CEYC 1NA1A 3AZXA 3U0ZA 4XFHA 3ZPYA 4MLOA 3HN1A 3R4DB 3AYCA 2BYVE 2ET7A 3ZMNA 5FCCA 4Y20A 3W59A 3IT8A 4GB31 2WNUC 1YUDA 4LBLA 4QGLA 2D6NA 5EXOA 1FX5A 1OFNA 3VDDA 4C1XA 5D1IA 2OZJA 1GZCA 3W58A 1G9AA 1GQGA 2DVBA 4XFFA 2IXIA 2V73A 1BEV2 5GALA 3SCGA 4AE2A 5KXEA 2BBVA 1X8EA 4JRLA 4RS5C 1D0GA 5DZEA 1HX6A 1YFUA 4PDWB 5F6KA 1BVVA 4MGIE 1LODA 3HT1A 2QQPA 5LEKA 2IFWA 2ZGOA 3U07A 2BNNA 1VBD1 3IDBB 2R32A 2WIIB 4ORFA 2BGCA 2VVDA 4R9BA 3V0AA 3OD4A 3VZJA 2VQAA 1V00A 1RUI2 3T1MA 3KGZA 3VKOA 1AYM2 1S0JA 2VULA 3BOWA 2VNRA 3KM5A 4MYEA 1WD3A 1CAVB 4YVSB 3WP5A 3L9JT 2ZGSA 4FQZA 5LK5A 1OSGA 3CO2A 1GR3A 2RS31 3ALQA 1EV13 2YC0A 3AK0A 5HCAA 1X7NA 4D3WA 3VBUC 2XBO2 3PJYA 5CFDA 1O4TA 4JQRA 3USUB 4IEWA 2FZ2A 4Z07A 2A7AA 1R083 3MLKA 4HN1A 2Z5WA 3H3ZA 1VRH3 2R041 1BXHA 3CJIB 3ZSJA 3WZ1A 2UU8A 5L19A 4YARA 1ZZBA 1LGCA 2RS52 3R6SA 4XBQA 1G8WA 1QWRA 4XJ9A 4AFCA 3ES1A 4SLIA 2A3YA 2P3JA 1AVBA 1H2KA 2VVEA 4GH4C 3N7JA 4CP2A 3PTYA 5DDJ1 3MF6A 5FDBA 4Z8BA 3MZHA 1D4M1 3LWCA 4FVVA 4WVWA 1RUH2 4MUVA 2VG9A 4UW4A 4WVMA 2ZGPA 4DMIA 5EJ3A 1R082 5A33A 1XNBA 3BPZA 3ZXAC 3MW2A 1DYPA 1YI7A 5EWSA 4F8AA 2XGXA 3CLPA 1YHFA 2CNAA 4AXOA 4S2FA 4NPRA 1MZ5A 3RG0A 4WM7C 1RUF1 3IWZA 3ZO0B 4R8HA 3VBSB 1CONA 1RUI3 3KD4A 3CJIA 2JG9C 1AJOA 5EYYA 2YHJA 1LGNA 2E7TA 4N43B 3NW4A 1BBT1 2VNOA 2OYZA 2HWE3 4L9BA 2ENRA 2KM2A 1LHWA 1AR93 4JGYA 1G9FA 3ZFFB 3HT2A 1U12A 4LA3A 1YJKA 2QCSB 5T50A 2NMOA 4GWNA 4OLLA 1QH6A 3SH4A 3PVEA 1IS3A 4K7JA 4SBVA 1CAUA 1HV1A 1XE7A 1Q43A 2EXKA 1KXGA 5HCBA 1R091 2VU9A 4LBOA 4Y26A 4KBBA 2MNGA 5JOYA 5EZWA 4DXZA 1I9RA 4X6QB 4HANA 4OUSA 2WQ4A 2AGSA 1RJ8A 4QM8A 2R6QA 3NJZA 1ONAA 1H8TC 1PMIA 1S2BA 3TNQA 5I8YA 3QCWA 4CDWC 3JB8A 1OOPC 5GZCA 1NY72 4O9EA 5KHKA 2KXLA 3B9IA 5F5QA 1UAIA 3VBOA 2P17A 4QGNA 4CDXA 5C9AB 1FYUA 4RSUA 2DU0A 1MQTB 4HVQA 1PM7A 1QKQA 4HKOA 4XJAA 2NYYA 5AFEA 5BNOA 3EHKA 4COUA 4PDWC 2D43A 2AUYA 1ZBE3 3ZN5A 4RS5B 2E7QA 2UWBA 3V65A 2RS51 3M3OA 5H9RA 1BYHA 3ILFA 2WC2A 4L2NA 4Y4YA 5KXCA 3R05A 1GNZA 3ELNA 5E89A 1URXA 2EA7A 3IBMA 1CJPA 2VMHA 1UIKA 3SMHA 1V6LA 4HSLA 4CEYB 5GZDA 5JAXA 1XU1A 2VECA 3MPPG 1N3PA 2QVSB 1PO11 3VBOB 1SACA 4AQ2A 4E9KA 1TNRA 1O7FA 1ASJ1 1V6IA 1OA3A 1NCRB 4TZDA 1Q8SA 3VL9A 3TAYA 4B4QA 2D5FA 5J3UA 3USSA 2JD4A 4HVRA 4XHXA 3VZNA 3ZFGC 1AUYA 2WFF2 1H8TA 1IKQA 1WUVA 4AYUA 4FP3A 1UCXA 5F6LB 2D3RA 2IXJA 4Q4X2 3ZIXA 3QACA 3AX4A 4YW3A 4DQAA 3MEPA 1IKPA 4QU2A 4TSVA 2A75A 4YG3A 5I0UA 1X82A 1U5ZA 4HT1T 3E5UA 4ES8A 4TLFA 1R1A2 1C8NA 1AL22 3FE5A 1ENRA 5GLVA 1LOCA 3AYAA 3VBFB 2ETEA 1DIWA 4JGYC 4N7UA 3NAPB 1LHUA 4KH9A 3O0XA 4XFBA 1MS8A 2VW2A 3BCWA 4HSJA 2F4PA 1H2NA 2RS11 4Q27A 1RGSA 3AFKA 4AEKA 1ZREA 2V09A 1G86A 1NQDA 5C9AC 4QD2A 3O0VA 3VV1A 3RNSA 2RS12 4D7SA 5BNNB 2GN3A 1Y3TA 3KCCA 1GBGA 1MZFA 3LKJA 2HWD2 2XJTA 4LHLA 5ABJC 2D97A 4YLZA 4GALA 4M00A 1O91A 2VXRA 4FQ4A 3M3IA 2XVKA 2D6OX 2AZ5A 2JX9A 3WP3A 1FMD2 4CDUB 2W08A 3VBFA 1AXYA 1GZWB 3JD71 1GSLA 1QJU2 3PMSA 4URTA 5BNNC 3OGJA 1S0FA 5H9SA 4HETA 3WW4A 4Y24A 2X5IC 4R4ZA 1QJX3 2TEPA 4P9IA 2WNEA 4AQSA 4F7ZA 4MZUA 2QDRA 4BWOA 3AMHA 3MLJA 4YM2A 4EV0A 5LRSA 1UF2C 5FO7B 4I3PA 2R30A 2OUHA 5K0UA 1AHSA 3B00A 4JTNA 4AK3A 3SCHA 4ES9A 3CL1A 3OBRA 3UKVA 1MACA 2X53S 3TRSB 3WLUA 1QXPA 4RR3C 1APNA 4AVAA 4M3CF 1AR91 1FMD3 1JTZX 1QXRA 4PF5A 1DGRN 2XL7A 4AVBA 4E4ZA 5CADA 5CA6A 1FI2A 4Q8KA 4YRDA 2RJLA 2W68A 4M01A 1AXZA 5JPNB 1AYM1 2JG8A 2GNBA 1LOBA 5BNPC 1JOJA 4FCAA 1XNCA 1DZTA 3WW1A 3ZYGA 1CX4A 1SCRA 4QQ2A 1KQRA 2ZX0A 1QMJA 3KQRA 3FLTA 2GU9A 3PJQA 4G3YC 4I0AA 4LEJA 4FAHA 4I2OA 1H9WA 1LJ7A 4XJZA 4DRRA 2PLV1 1WCDJ 4CDWB 4Q26A 1QDOA 3LZZA 5CAZA 3NWKA 4YFWA 5ABJB 2WFF3 2WNUA 1JUIA 2XL9A 1ZRDA 2VOVA 1BCXA 3ZXLA 3FX3A 1DYKA 3AJYA 2GN7A 1ZX5A 5BY5A 4QPIA 2Q0AA 3CNAA 4FAGA 1BK1A 2GSYA 4P9LA 1QGLA 2DVDA 2XG3A 2H0VA 1DG6A 4RQPC 3RYPA 3FLRA 3S30A 2DTWA 1TQ5A 1WCSA 1ULEA 3ETQA 3ASIA 3ZFFC 5KBFA 1NCQC 4YZ3A 2VH9A 5JOZA 4W65A 1HRV1 5KWRA 3MPBA 4OUMA 4N43C 1KS4A 4DPNA 1IOAA 4N9HA 1N3QA 3VZKA 3ZVXA 2WWSA 4XF3A 1A8MA 1QJY1 1NYWA 1CAUB 2VMGA 3MIGA 3WHUA 1IS4A 2ZMKA 2C9AA 1DQ0A 4OFGA 3T2TA 5JSRA 2DCKA 3DUIA 1WMEA 1JUHA 2VMIA 1HV0A 4EWAA 2XJQA 5ABJA 3TWIA 1OI6A 3QOPA 2UWAA 4JV4A 3OD0A 4Y1XA 3ST7A 4EJRA 5KC6A 1VBE1 1YFYA 2BNOA 3VBSA 2HWC1 3B7MA 1POV3 3SXWA 3I7DA 3JBG1 2CV6A 3WDVA 2Y26A 2CY6A 1PGSA 2D6MA 1RVF1 3WT3A 1M4WA 5DUVA 1QY4A 3M4FA 4IERA 1DQ5A 4AVVA 2VOKA 1OQDA 2IFRA 4YVWA 1GANA 3E5XA 2PHLA 4C0HA 1RB8G 1F9KA 2ZPXA 4I30A 1REDA 2RS33 3QH6A 2EIGA 1ULCA 3VBRC 4AI3A 2VW1A 2DVAA 1CGPA 3PHMA 2TBVA 3PMEA 4HVOA 4WV8A 3SHRA 1RUD2 5JZGC 1CESA 1A6CA 4QPGA 4AF9A 3RS6A 4HL0A 1LULA 4X8PA 3TOJA 4PBPA 2B9UA 5CG9A 3THTA 3IN9A 4OI2A 4JAAA 3PVOA 5T54A 4P9XA 2PHRA 1V6NA 3WVJA 2OZ6A 1FMD1 1RINA 2PAKA 2E63A 4F3JA 2RM23 1C3HA 3AJZA 1J3PA 5TSWA 4FPKA 1VRH2 3WG4A 4XMAA 1V6KA 1FT9A 2VUAA 3WHTA 3ZXDA 4AHXA 5T52A 3D82A 3KGLA 2D6LX 3DPRA 1O4YA 4Q29A 2OW4A 2FMDA 4B4PA 1MEC1 5CFCA 2WNVB 2WJSA 3GF6A 4LO7A 4QPGC 1KS5A 4RHV3 2ZGQA 1CAXB 3H0OA 1K5MC 3RMYA 1MS5A 1PVXA 4BE3A 5ACA2 5BYNA 3B69A 1ULGA 4GB32 5C4WB 2EF6A 4CEWC 1DZRA 1LEMA 1QU0A 4Q4Y1 3VDDB 4I01A 2WS93 2P37A 2PTMA 5FMOL 1IZ3A 4R9CA 2OVUA 2YXSA 4WM8B 1Q56A 5GZGA 3KMHA 5KC5A 3O12A 1ZZ7A 1H1MA 1XNDA 2DU1A 4JC1A 1MQTA 4XF1A 1W6PA 5JI9A 3C3VA 1OPOA 1RUE1 3VHNA 1AR63 2WZR1 1QJY3 4P9JA 2WS92 1H30A 4LE4A 4Y5Z0 4DOUA 2EALA 2RHPA 1TNFA 1VP6A 5D8AC 1DZQA 2NN8A 2C5DA 2O8OA 2E51A 4LBKA 3ZN6B 3MIDA 5FO9B 2ZGMA 4MGYE 3ZFGB 1N1TA 1G7YA 2LALA 4D7TA 3NV3A 2RMU2 2ZMNA 3SH5A 4ITCA 3NL1A 1CIWA 2ERFA 3JBG3 4R9DA 1CAWB 1YLLA