2WNVA

Complex between c1q globular heads and deoxyribose
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
131
Chain Sequence
QPRPAFSAIRRNPPGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
molecule tags Immune system
total genus 29
structure length 131
sequence length 133
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnvA00
4MXWB 2R30A 4QQOA 1D2QA 2R32A 1XU2A 2TUNA 2WNUC 2KA3A 2TNFA 2RE9A 4E4DX 2QDNA 2JG9C 2WNUB 2Q1MA 1PK6C 4QQPA 5HBAA 1U5XA 3K51A 4D7YA 2OIIA 4GIQA 2HEWF 4MXWA 5BNQA 1GR3A 2E7AA 1JTZX 2Q8OA 2ZPXA 3LKJA 1U5YA 4G4FA 2RJKA 1U5ZA 1DG6A 4NN0A 5CIRA 1C28A 3MI8A 4N90A 4MSVA 1KD7A 1RJ7A 2HEYF 4EN0A 4J6GA 3FC0A 2HEVF 1WCKA 5KC5A 2JG9B 5TSWA 1PK6B 4RSUA 1OQDA 3AB0A 4KG8A 3B93A 4QQLA 1OQEA 2WNVC 1I9RA 2WNVB 3B94A 2JG8C 4QQHA 4DB5A 3QD6A 3L9JT 2WNUA 2JG8B 1IQAA 3ALQA 4QPYA 2JG9A 4OUMA 4QQ2A 4HT1T 5KC6A 1PK6A 1ALYA 1C3HA 2QE3A 3ME2A 2Z5WA 1XU1A 4E4SA 4KGGA 2RJLA 4OUSA 1A8MA 1TNFA 2ZJCA 1RJ8A 4OULA 3TWIA 1DU3D 2O0OA 3URFA 3QBQA 3B9IA 4TWTA 1S55A 5KWRA 4F3JA 2R6QA 1D0GA 2X29A 4DOUA 1D4VB 3V56A 2AZ5A 1OSGA 3TYJA 5L36A 4KGQA 1O91A 3IT8A 1KXGA 3K48A 5L19A 4MXVA 2WNVA 3WD5A 1TNRA 4G3YC 1JH5A 4TSVA 2JG8A
chains in the Genus database with same CATH superfamily
4BISA 4QPGB 2R30A 2J1VA 2WAAA 1MS3A 2UU8A 4P14A 1RTVA 2CGNA 4TN7A 4Y1ZA 2D5HA 4GMP3 4M0HA 4XMIA 3VZLA 2B42B 4NIGA 2RE9A 3VD4A 2HYKA 3ACHA 2X53S 2J42A 5F1RA 4ITCA 1ULPA 4PIZA 3ZFFC 4CYDA 3NNMA 1OLME 1ZZ7A 2BUKA 5FPAA 1VBA3 3WP6A 5FK7A 1SDDB 3NW4A 2AC1A 2Q8OA 4CDXA 3BTYA 2BPA2 2GNMA 4COZA 2ET1A 2ZPXA 1W28A 4IQPA 2CGOA 4AEJA 3WNNA 2BNOA 1OQ1A 4KBZA 1C57A 2PHFA 3AZVA 4JCKA 4D7TA 3A4UA 3AMMA 4N8MA 3OOXA 2ZGMA 1RINA 4XF9A 5LA2A 1R081 5CEHA 1I5PA 2CGPA 1FMD1 1V9U1 2DWRA 4IV1C 4N90A 5JR2A 5IW0A 1QOSA 1H2MA 3J7MA 4URTA 5JXJA 1ZVFA 3PIGA 5D21A 2SBAA 1UZYA 5LATA 1V00A 5K9YA 4Y1XA 4ISRA 2WR9A 5FUNA 4IXLA 5T52A 1A8DA 1AJKA 3PUAA 4RHV2 3RRDA 1PX4A 2WZ8A 3AYEA 2VNVA 3SMHA 5F5AA 1VALA 3ACIA 3V0AB 1POV3 3C7EA 2DUQA 4HKOA 2FDKA 2A73B 1XNKA 2ZA9A 3FX3A 4BE3A 3P3PA 4CDUC 3P1IA 2VUJA 3RZLA 1LHNA 1IPKA 1YRZA 3RWNA 3JZVA 3O1RA 1GOGA 3OUIA 2XJPA 3I54A 4OCTA 1QEXA 3RZHA 1VB2A 3IMMA 4LO5B 3SCFA 2QE3A 3VKMA 3ILFA 4COVA 1FX5A 4B4PA 2PQQA 1DZRA 1ZZCA 5JI7A 1F31A 4LKFA 4YVWA 3LEMA 4XFBA 1RUOA 1UY2A 3VLBB 3RYPA 1W3VA 5C3OA 3T1MA 4Y1YA 5JPNB 4AI9A 1EPZA 2DVFA 5FPZA 2GP5A 4ZS2A 1XRUA 3I2DA 3WW4A 1RIRA 1B35A 1BZWA 1O8PA 2JE8A 5CNAA 5IUQA 2EIDA 1FMD2 3RNSA 1V9U2 1H8VA 3WXPA 4AVBA 1QWRA 1V6NA 4NWVA 1X33A 1WMEA 1ND3A 2MEV3 3NO8A 4M01A 3ZYFA 4D7SA 5FP4A 3ZYBA 5BNPB 4EWEA 4XMAA 5M0TA 4HFSA 4BM8A 4AI2A 1IQDC 1WLDA 5CFCB 4HG6B 3OBZA 2VVFA 4TTGA 4Q29A 4W6WA 4CVUA 2WT1A 1W8FA 2CV6A 3FHAA 2W95A 4Y3OA 1C8M3 4AI3A 1PGW1 5C6CA 4CEYC 3T2PA 1SACA 5LRSA 1IHMA 1G9DA 3A23A 4G3YC 4YW7A 3KCCA 3RJ2X 1SLIA 2VUAA 3KZ4C 4M3CA 3CLPA 3CKHA 1GNYA 1QDOA 3H50A 1H4HA 4Z07A 3JBG1 1WWYA 2RMU3 1C1LA 5KHHA 1NLQA 2Y6FA 2NMNA 5FXXA 1MVEA 5C9AC 3N7LA 2ZAAA 1AYM1 2TUNA 2ZGLA 2YBSA 4AFBA 4DEVA 1R093 1JOJA 4YVSB 4EN6B 2Q1MA 4XFIA 4YFWA 2RR11 3SCHA 5A33B 2P1BA 4YW2A 3K46A 4QGLA 5FYYA 1LHVA 3KVAA 3NJXA 5GM0A 1DQ4A 3KQRA 4PCRA 1QJU3 5A6ZA 1WZXA 1UU4A 2VNRA 4ZY9A 5LK5A 1WKYA 4YPJA 3KS7A 4KWUA 1Y43B 2K0GA 1LOBA 3KVBA 3D0JA 4QHZA 1SFYA 1AZDA 3JD71 1NA1B 4OI2A 3SXWA 3WZ1A 4AQ6A 5C33A 1GANA 4AHWA 3OGSA 1ZZBA 4A45A 3AZWA 4QD2A 3P3NA 2N7GA 4WZCA 3MI8A 2JX9A 4IW3A 4WM7A 1COV1 3AZYA 3WF3A 3FC0A 3WF4A 3FLRA 1RMU3 3EJKA 4OVEA 2OZJA 1PGW2 4Y5Z0 3LEGA 4Q26A 5LK7B 3VKFC 2C6SA 3UKTA 4G9SB 1HJFA 4Q4W1 1BHGA 4QWNA 1PK6B 5K0UB 4RSUA 2VMFA 4FO9A 1G8WA 3VDDC 2RDQA 3JBG2 4I3PA 5GZFA 3RI9A 4JZRA 1VAKA 3ECQA 3U10A 5FZ7A 1AYM2 5A32B 2OPWA 1QOTA 1VJ2A 2BBVA 5FK8A 1FI2A 3CJIC 3ZYRA 4GWJA 4M4RA 1F4AA 1RITA 4XJ8A 1JUIA 3SH5A 4CPBD 2D93A 5KXEA 5BNOB 1POV0 1YXWA 1LOFC 1NZIA 2RR12 5J3UA 2VULA 3PLQA 1PIV3 2JXAA 4XETA 4FTBA 1KFUL 3NV3A 3LEIA 2EXIA 3WDTA 2ZBJA 2WA4A 1OXCA 3NKTA 4YGDA 5KXBA 1CGPA 1YJKA 1OI6A 3EHKA 1HQWA 1W6QB 4KQ7A 1U0AA 3JD72 2VC9A 4EV0A 4TXWA 4AHXA 1NCRC 4R52A 1E5SA 2BQPA 2ZJCA 2FDIA 1T6GC 3PURA 1VRH1 5FKBA 4D6RA 2P6HA 2NP0A 4WVWA 1N1YA 1RHI1 5GALA 2WDBA 4H55A 1TMF3 4AOCA 3S6PA 3WNPA 1LOAA 4PI2A 3KT7A 3VBRC 1NCQA 2DTWA 1N3PA 1COV2 3PDQA 3VL8A 3BB6A 1MR5A 3ZIXA 4FOVA 3BN6A 4R4ZA 4HLTA 5KHKA 4Q4W2 4RGKA 1HIXA 4WZFA 4Z2AA 3VZKA 3FBMA 4AF9A 5FP9A 2QQMA 4Q0SA 4OMDA 3DF0A 4KGQA 1DYOA 5DUWA 3SKVA 4PQ9A 4FBFA 5JWPA 1KS4A 2AR6A 4QXCA 5AVPA 2ARCA 4MXVA 4XOGA 1VB4A 2WZR3 3SH3A 3ZIWA 5KR7A 3H8RA 1YQCA 3U4SA 1X50A 3I7DA 5J37A 2GC1A 4XJWA 5IWFA 4WVMA 3VDCA 5I0TA 1AX0A 5DN2A 2BVBA 3MV01 3PL0A 3ZFEA 4CU7A 4NHYA 1SBDA 2JD9A 2DCZA 3NNFA 3H42B 1H6XA 4IEVA 5A6YA 4HVQA 1WBFA 1YEWA 3POFA 4DY3A 4BLIA 1RUC3 4QKDA 4PBPA 5FZMA 5IFTA 2PLV1 4PQQA 5FP7A 4GZ9A 3ZFFB 1GYKA 2ADDA 4GIQA 2Y33A 1JYXA 4TZDA 4YZ2A 4HSJA 5B4XA 1VRH2 2EALA 2J22A 1SPPB 3J8F3 4XBLA 4CP9B 1X36A 1S0DA 1RHI2 3CF6E 1NXD1 4SBVA 2AEZA 3POSA 2WWUA 1LOEA 1V6IA 5BNPA 2BOJA 2AH2A 2R043 3AFKA 1DG6A 5LZ6A 5ACA3 1RUNA 5CFCA 2VMHA 4V1PA 2YDEA 2WFF1 1YFXA 1JI6A 3NV1A 5C8CB 4XILA 4CCOA 1W6OB 1KD7A 4LIVA 3GJAA 5F2WA 1OA3A 4IV1B 2MPFA 4LLFA 1MS9A 4W6YA 3MFCA 3AKTA 2D97A 2P4EA 4QKFA 4V2VA 2JG9B 2ZX2A 3USUB 1S0CA 4CU6A 2OPKA 3UGFA 5BUVA 1TQ5A 2XQXA 3TN93 2OUHA 4OLLA 4K3UA 5JIUA 4YVWC 4P9WA 4QQLA 1ACCA 2DVGA 3FUQA 3ZFGC 3ZDSA 1VP6A 3H9AA 2QQVA 2RV9A 1MACA 3PMSA 5FFOC 4BIOA 3VBSC 2X5IC 1IS5A 2J1RA 2VOVA 1HRV1 2Q0AA 1R1ZA 2VBBA 2ZZJA 3C8XA 3NWKA 1W39A 2IXJA 3QD6A 5ANNA 1DCSA 4YVSA 1ULFA 3OY8B 2FDFA 1VBC1 2B7YA 5KC6A 1ZYBA 5FJKA 4Y1UA 4MHRA 4NIAA 1AJOA 2PLV2 5A1FA 4D6QA 1Z7S3 3ME2A 1AX1A 1OMIA 2O8OA 3WT3A 3O1VA 1NA1A 1XU1A 2GC2A 2RS53 4JGYB 4WM8C 3ZX7A 4DXSA 3FWEA 3RGBA 1PVC1 1VMJA 1GP6A 4W8JA 1F15A 2FHRA 3N9QA 4FT8A 3CIHA 3S5QA 2RHPA 2JKXA 1OOPC 3GZUC 3N9MA 1OD3A 3ORJA 4QXKA 5CB7A 4ASLA 2W3JA 1OD5A 2YUEA 3BPSA 4QDSA 1CAUB 2WFF2 5JIAA 2O0OA 4P00B 1AXZA 3ZXLA 2OX0A 2A71A 4AEKA 2VCMA 3W58A 5FMCA 4ATFA 1UPIA 1XYNA 4EZ4A 1YIFA 2CTVA 1CR7A 1D4VB 2JDNA 5K0UA 1WMXA 1UW8A 5FY0A 5HV0A 2Y6JA 3OGRA 1G6NA 4KNCA 5DAVA 5DUUA 4YGCA 5GLUA 3VBOC 1JYVA 3FUOA 2EAAA 2VTFA 5DAWA 3KB5A 2W87A 2H6CA 5L7OA 4ASKA 1DYKA 3KV5A 5A7QA 4Z92B 4BK4A 4PT6A 2V5DA 4OHWA 4CEYB 5A7NA 3ZR5A 3WP5A 1H8TC 3POEA 4L8QA 1T6BX 5DZEA 4Y26A 1Q5OA 3IWZA 3LB9A 3WW2A 2VL4A 2B45X 1LEDA 1NOVA 5IJRA 5C9AB 4JGZC 1JMUB 3ACGA 2ZAHA 3AYDA 3VD9A 3HMYA 3ZXGA 2ADEA 1FNZA 1W6QA 4MO3M 1QIQA 3HR9A 4Q4V3 5I93A 1BEV1 4MGZE 1YFUA 3O7OA 2XL9A 4Q1RA 1ST8A 2WT2A 3LF7A 2DFCA 2FDJA 2JIJA 3HD8B 3T30A 5C71A 5BPXA 1X9TA 4EJRA 1OBNA 4NOTA 1UY0A 2DU0A 2YGLA 5FWJA 3VBHA 1ENSA 1ASJ3 2GZWA 1CZSA 1H1AA 5FYIA 2JECA 2F4LA 4AAPA 5GLTA 3JU9A 3OUJA 3BIEA 1BVP1 1W8HA 5JSPA 1EAH3 2P2KA 3POYA 1LHOA 4RFRB 1SLTA 3LOIA 4N53A 2ZHMA 3HT2A 5FREA 5T55A 3ZSKA 1POQA 4CDQC 4L99A 1W0PA 3KGLA 4XFHA 1OHFA 1NUKA 4BPZA 3NJVA 4GKYA 2A6YA 5EQUA 2Q30A 5FZ9A 1W9YA 3AJZA 4MADA 3MIFA 1YQ8A 4KG8A 4CEWC 2D6MA 1G9CA 4OI4A 2RM22 1MS4A 2D6OX 4ZXKA 2PAMA 4I30A 3WUDA 4AFDA 4UW4A 3KT4A 3B94A 3VDDB 1YCIA 4LT5A 4FQZA 4BQ5A 4LBJA 2GC3A 2W5FA 2GN3A 4XUNA 1W2UA 4PDWC 4Y22B 4OI1A 1PO23 2C0ZA 3DECA 4QPYA 2ZGOA 3CJIB 4ZZ5A 3NRUA 3R4UA 3ZFFA 1GWMA 1NCQC 3AC0A 2MNGA 1AUYA 3BTZA 5FZKA 4PI0A 2UWBA 1RGSA 3SHRA 1BEV2 1CAVB 3D82A 1SPPA 3HAGA 4Q4X3 3T2TA 4MOAA 2PYTA 3VDAA 3PMEA 2Y34A 1UU5A 3J7NA 3FFQA 4MGQA 4OZOA 1US3A 5FO7B 3WW1A 4QPIC 4ASMB 3U1XA 1UMZA 2BV4A 3HBZA 2D6KA 4OYUA 1S0JA 2ARXA 1W6OA 2YFUA 2VU9A 3T2OA 3O1PA 4IV1A 3O1UA 1X9PA 2A7AA 1YFWA 2XHKA 5ABJC 3IAPA 4XJ9A 5HI0A 1XQNA 1YLLA 5FY5A 3OTFA 2BYVE 2X29A 5EP9A 4ZXEA 3USUA 4BMBA 2OXBA 4AEDC 1C5IA 4LK6A 1LECA 1FYUA 3V64A 1OSGA 3DPRC 4CCDA 1W05A 1Y7BA 3BOWA 3NMBA 2XHNA 4NMIA 4XQDA 5FYUA 2YC0A 2DVBA 4CUGA 5H9SA 2ET7A 1S0BA 1IS3A 4AI8A 4CPBA 4CU9A 2CU5A 5D1IA 4DZGA 1Q56A 1SQ4A 1YQ6A 2BNMA 4YW6A 3OY8A 4CDUA 3WINE 4C90A 5IVFA 4XABA 4R4XA 4S2DA 4CDXB 1PX3A 1Q8OA 1R1A1 3GHMA 3WG1A 3HVDA 3M3IA 2R32A 1LESA 1XB9A 4C1WA 3ZYGA 1M06G 4XQ4A 3FFZA 2KA3A 3Q9OA 4LBNA 3THPA 1KRIA 1PNGA 5J1XA 2QDNA 4JDNA 2A3YA 5IVBA 4DXTA 3ZPOA 4Z2WA 4LE4A 4GMP1 5LBBA 4OHZA 4A2UA 3BTXA 3DKQA 3OG2A 1RUI3 2L9LA 1GZWB 2GU9A 1ZBE3 1GKBA 4ZZ8A 2E7AA 2ZEWA 3APBA 5DAPA 2BP6A 1NG0A 1HKDA 2DBIA 2ES3A 4FPGA 4LR4A 2HWB3 3AVSA 2WKKA 2XDVA 5CKNA 4LO7A 5FLIA 4YW1A 2IXHA 3I2FA 2IXCA 3OSDA 5A3OA 2FBEA 4RYDA 2AACA 4ARXA 3H1WA 4NHMA 2XLAA 5HCAA 1ND2C 1WLCA 1QJZA 2JENA 1VE0A 1HX6A 2WO2A 3H3UA 4YZ4A 3K3NA 4I0WB 1H9WA 5CU1A 1BMV2 1GFF2 5BY5A 1MS0A 1MEC3 5FZIA 1HXS3 4CEYA 1RUF3 1OQDA 5HCFA 2CL2A 1VPHA 2ZGTA 3WG4A 3OUHA 4XXPA 3RVHA 2ZACA 2DCJA 3IMNA 2DFBA 3GXUA 3MUY1 1FPN1 4JTOA 4YVWB 4UYBA 3VHOA 3ZFGB 4GB33 1R1A2 4P9LA 4YGBA 2YFZA 1F4HA 3V65A 1K45A 5J7MA 5C9AA 3VL9A 1VBB3 2EIBA 4BCUA 1QQP3 3GF6A 3DYMA 3I3DA 1OFSA 2H0BA 3B3QE 1UN1A 3CZJA 1B35B 3MGUA 4FPKA 4Z8BA 1LB2A 3ALQA 4LBQB 3ZYIB 2EA7A 3MYXA 1U5IA 1HV0A 1HB2A 4BQ4A 2UURA 2ZGPA 4RS5C 1ENQA 1E5IA 3GCWA 5FYZA 2B8MA 2NN8A 4MGKE 3MZHA 4J1XA 3MPPG 5CKQA 5EXOA 3LPGA 1QH6A 4MYEA 5ERLA 2V4VA 2VBPA 4JQRA 4OFGA 2BNNA 3VZOA 1AXYA 5LBFA 2E63A 3T1LA 4WM8B 5FYTA 2C26A 3GZAA 2G4IA 3MIEA 4YM1A 2VTXJ 5DAXA 1O5UA 4R9DA 4B7KA 1FOD3 1BLZA 2VUCA 3CMGA 3PVNA 1ZRFA 2PFWA 3KGZA 1OOPB 4AVSA 5A3UA 1LHWA 3AL6A 2A1XA 3ZN4A 2VVEA 2WS93 2K9ZA 4N9HA 3DXTA 3ZDVA 4ATEA 1BYHA 4LOSA 4CXYA 4JTNA 4PHZA 3MIDA 1W8WA 2MHFA 5T5OA 2BGOA 5A6XA 1S2EA 2PMWB 2BBAA 5CG8A 1AR73 3ON7A 1W2NA 3VBOB 4CP1A 3VDDA 1FPN2 5LY1A 3DV8A 3KV9A 4X6QB 1XNDA 3HNYM 2QJVA 1RUG1 2WA3A 5LA0A 1QXPA 2QDRA 3NAPC 2R0FA 4Y22A 3NNLA 3GALA 3J4UH 4W4ZA 4IGPA 1HRI3 3CJIA 4Y1VA 1QF3A 1XNCA 1HV1A 1LOFA 1DP0A 1GLHA 1N3QA 3AJYA 1CAVA 4HL0A 4C8DA 2EXHA 1K42A 1A78A 1DFQA 4AFMA 4R9BA 1QY4A 1YQ5A 5F3CA 2W1UA 1XNAA 3LIHA 3MBWA 4QX3A 3X29B 5HBAA 4LEJA 3MW4A 4B29A 4Y5TA 1I1EA 4JAAA 1A34A 5F8PA 3I2KA 1V6LA 5FMOL 4COWA 4IE4A 4MXWA 4MZUA 2VM9A 1NCRA 2XQRA 2HH9A 4CP2A 4LORA 1YI7A 2DYCA 4H14A 2VE1A 4DQAA 2ZS6B 2E32A 5LASA 4G4FA 3E5XA 3AMQA 2VOXA 3AP4A 3VBRA 1MS8A 3OYWA 2VW1A 4IEXA 5HXVA 3ROUA 4AFCA 4TLGA 1OF4A 4FFHA 1C5HA 4XIKA 1RJ7A 4YFZA 5CFDC 1DQ6A 2ZX0A 4PBOA 2W9XA 3T4HB 1ODMA 4UFJA 2YY1A 4QB2A 1PNFA 1JU4A 1W90A 4NJ4A 4KH9A 4AQTA 5A3MA 2UWAA 4IERA 1VAMA 4YGEA 5J09A 2V09A 5FZEA 1RL3A 4IEZA 1RUG2 4JDMA 2VPVA 4Q0VA 1J3PA 2W08A 1W8OA 4LKEA 2ARBA 5FZ4A 1OPOA 2P17A 4LMFA 4AFAA 1Y9GA 4FPCA 1WCSA 4IE7A 4CEWB 5IAXA 1VMHA 3AP7A 2JDYA 5FDBA 2UWCA 4YG3A 4K6BA 4DFSA 1PM4A 5JLVA 1F2NA 5FZLA 2HWC3 1W0OA 3JUUA 2ZKNA 3WVJA 1IKPA 4E8DA 1CESA 1YUDA 2VNOA 5GLWA 1C3HA 1BBT1 1GZWA 1PM7A 1SHWB 4E2SA 4OHYA 1NCQB 4CCLA 4KWKA 3DN7A 2XB6C 1WD4A 2VD7A 1EPWA 1PO13 5A3PA 1O3SA 1O3RA 2WINB 1LHUA 1E57A 2ILMA 3BYWA 3JB8A 3OF1A 4F83A 1QJU2 2RJLA 2KR2A 3O5SA 4J1WA 3GJBA 4UFIA 3Q8BA 4XF0A 5HV4A 2D98A 4GKXA 2DF7A 2HBTA 2RDNA 1DYPA 3JQWA 1DQ2A 1JS9A 3WDYA 4F8AA 5JMCA 2FD8A 4AVVA 1W6MB 4QPIB 4U36A 1BQPA 3VKOA 1Q8PA 3ENRA 2OVUA 3ATGA 4P5YA 4HONA 4QB1A 3UGHA 5F5CA 3ZXAC 4I0BA 2PAKA 4WVMB 3OD0A 2A3WA 1JUHA 2VQTA 3I8TA 1HJGA 3LFIA 5BYNA 1XOYA 5EV7A 1TMF1 1JOPA 5T5PA 5ABJB 3ZFEB 2DU1A 1O3TA 1JZ7A 3EYPA 3OBTA 2W39A 1SZBA 2QUOA 5DG1A 1UYXA 1SLLA 3IT8A 1BJQA 1KXGA 1S0IA 3DPRB 3LGRA 5JR7B 3MLKA 3ZFGA 2YBPA 3WQ1A 5C8WA 4FP3A 4HMZA 1UU6A 4YLZA 4XUPA 1UYZA 3VBSA 1NE6A 2X5IA 4Q27A 4QX7A 4ES8A 5HXMA 4LBQA 1VAVA 4YARA 2YXSA 1Q8VA 4MUVA 1KQRA 3TBDA 5FMDA 3IDAA 2Y6LA 4EYUA 2CAUA 2FZ1A 3TOJA 2WNUC 5A1LA 3AVRA 3T4VA 3M3QA 5JOZA 1BBT2 1EY2A 3P5BA 2ZGNA 4D94A 1ZRCA 2QZ2A 3LIGA 4E9KA 3DYPA 4META 1ULGA 5FBZA 2FQPA 5E16A 4CUBA 2IWGB 5IK8A 1NXMA 4KG0A 1XC6A 4WM8A 4AAXA 3H8OA 1NY71 3BI3A 5FMBA 1CZVA 1WA4A 5FY7A 5FYCA 2XWJB 5JI9A 3N9LA 1G9BA 2HWE3 2I45A 2R16A 3NVCA 4IE6A 1OOPA 5GLZA 3T0AA 2XJUA 1L7RA 4ZU4A 3U14A 1KJLA 1WW5A 1QJEA 2D7FA 3IAQA 3C7FA 3NJYA 2O1QA 4BB3A 2VMEA 2O14A 4LHLA 3QH6A 3KWVA 1TMF2 2XJQA 3AZXA 3I2OA 2XLFA 4HANA 4EN0A 1ULEA 5F6KA 1L7QA 3VBOA 1ND2B 1SFPA 2DVDA 1QDCA 4KI5M 4PJYA 1H2LA 4LXLA 3RZGA 5FPBA 4UAPA 4D69A 2ERFA 3AB0A 1W8NA 3RZJA 1H8TA 1S4CA 3AK0A 3TN91 3GBFA 1C8NA 4L2NA 1APNA 1ZRDA 5FYHA 1IPJA 3VZNA 4K7JA 1H1MA 4K8RB 2QFEA 2XLGA 2UY9A 4I0AA 4JGZA 1IQAA 3RMXA 4AQSA 4BMEA 1GP5A 2P6CA 2VCCA 1JZ5A 1H30A 4AGRA 5APAA 4RHV3 2VZRA 2E6VA 1F8VA 1GQGA 1ULDA 4PLMA 1UPSA 3M4FA 1NY72 1XXNA 4IL7A 2YHJA 4H2AA 5D2AA 1AL0G 1RUC2 1O5LA 3LWCA 2C24A 4YG6A 2Z5WA 4HN1A 4XUQA 5DABA 1AR61 1Z7S1 5E89A 1UKGA 3WDUA 1VBE1 1RVF3 3B69A 2EF6A 3EBRA 3BOPA 4HN0A 4LE3A 4N43C 4UT5A 4C0BA 4RD7A 3ACFA 5L7OB 5DZGA 3MICA 3I2GA 4YM0A 3H0OA 4UW6A 3WEZA 3C7OA 1H2KA 4FTEA 2VAUA 3TAYA 1S55A 1KS5A 2NZ9A 3SKJE 2HYXA 5FQ0A 5BNNC 3LA2A 4CDQA 3K4DA 1W8TA 3H1MA 5F6LB 3VN4A 3ZN6B 1PHMA 4M00A 2CWSA 1IS4A 2Q4SA 2D40A 5F3EA 4AXOA 2IFWA 3POBA 3INAA 3UKVA 4CEWA 1RUE1 1W0NA 1GNHA 2A75A 5FRAA 5EYXA 3OBRA 5JXGA 1MS1A 3TN92 1JYCA 1R083 3HQUA 2PHDA 4JKMA 1FMD3 4KWLA 5FUIA 4NIDA 1B09A 1V9U3 2HWD3 2QVSB 4M3CF 5EJZB 3NAPB 3ZYPA 1HW5A 4KL1A 4PDWA 1PZ8A 4QX8A 4LUKA 1S0GA 3B01A 4UW3A 4XCAA 4QMAA 5FZ8A 1EUUA 3A22A 1DGRN 3A7QA 1SCSA 3USSA 3VBHB 1DZQA 1G86A 3AYCA 4LIUA 1GOFA 1U5XA 3J7HA 3K3OA 4WVVA 4YNIA 2ENRA 1Z7S2 1AR62 1GICA 5C4WC 1IKQA 1VBE2 4N53B 2VOWA 1W6MA 1JTZX 1BK1A 2YGMA 2VZVA 4QPIA 2Q1FA 2QNKA 4Q4V1 3THTA 2EICA 4BQYA 3I49A 2WO3A 3S57A 3T0DA 1LCLA 3ABZA 4CXWA 2Y26A 4AK3A 2JWPA 1YNAA 2RJKA 2WNEA 1W9FA 3DYOA 4GQ7A 4JC1A 4I3GA 4QT6A 5ABJA 2AUYA 3OJBA 1JYNA 2XOMA 5A7OA 3JQXA 3HBKA 3U75A 1ASJ1 3NNGA 5EZWA 1CIYA 2WSVA 2XR4A 5LRRA 1AXKA 1LKNA 2GH2A 4AEDA 2A6ZA 3DPRA 1XNBA 1L7LA 3OPWA 3U78A 1IOAA 5CFDB 3PHMA 2VECA 4A7KA 1GP4A 1RUE2 2PHWA 5C3RA 5FP8A 3EMRA 5FO9B 1SG3A 3AP5A 3FE5A 1H6YA 1REDA 2XH6A 3G7DA 4W65A 3S7IA 3EQEA 4OQ8A 1JZ8A 4N9IA 1I9RA 1CWPA 5IK5A 4NWWA 2PHTA 1HB4A 2GALA 4I09A 3POWA 1DF0A 1OC1A 1UZWA 3ILNA 1S2BA 1UY4A 1W99A 4JKLA 2R073 4LO6B 5GZEA 2WNOA 2RS33 2W92A 2XBO1 3VGIA 1D4M1 2UYBA 5E6HA 2B4KA 1AR83 1LU2A 2Z2SB 3D5OA 1GWLA 1VBD3 3RZZA 3WX5A 2VZTA 4P9JA 2CYFA 2RJ2A 1R64A 4E8CA 1RUJ1 1PO21 2RS13 5JCTA 2D44A 4URAA 3M8LA 2WN3A 1IPSA 2JDHA 4MGSA 2E9QA 5I8TA 1RXFA 1W9TA 4YG0A 2X8KA 3JBG3 4NR1A 4Q4V2 4QHOA 1ZX5A 1XSQA 4FOYA 4RQPC 3IIAA 1HN0A 3LE0A 4EQVA 5CKMA 3WG2A 1DGWX 1OKQA 2A6VA 1AYM3 4XAAA 2Q1ZB 4IEOA 2XGXA 4ISQA 3MIGA 1JXNA 4CSWA 2CDPA 5T50A 1UX7A 1LOGA 3TWIA 4GAZA 1ASJ2 4NE9A 3WV6A 4F3JA 2FDGA 2IZWA 1ND2A 2CAVA 2QCSB 4CDUB 4H7LA 4HXCA 5JVVA 2GMEA 2XL7A 4Q0PA 4RL7A 2VZOA 2ZKLA 4WV8A 3N35A 4O9GA 2WAOA 1O91A 5FLJA 4P9XA 3RDIA 4Y20A 3MDPA 4V2WA 3K48A 1S0FA 1QXJA 3RQ0A 3K75B 3ZYJB 1ZM1A 1SLCA 3QOPA 3RWKX 4CCNA 3V0BA 1ZREA 3E1F1 4QX2A 4AW7A 1O59A 3NNJA 2W52A 3SQOA 4FXGB 4PF5A 5JOXA 2VXRA 1YJLA 2W1QA 3LSEA 5E1RA 1COV3 3TB0A 1AYN1 3FL7A 4BQ2A 5FOBB 3RS6A 2XBO2 2HBUA 2W0XA 1D4M2 3MF9A 2VY0A 3AYAA 4Q4W3 4BOWA 4C0HA 1WLTA 4RS5A 1Y4WA 3RSJA 1RUJ2 1PO22 4O9EA 2WNUB 3BVCA 3KV6A 4QQPA 3VHPA 2ZMNA 3K51A 1DBNA 2XPJA 1LAJA 4JKKA 1CVNA 2AEYA 4L0PA 4AVAA 2BFUL 5KHIA 4Q4X2 5BNQA 1W8UA 5FZFA 1K5JA 1PMJX 1AVBA 4BXFA 3ZXKA 4E2GA 5AVAA 5C5TA 3GCXA 3ST7A 1TME1 1RUI1 1ZBA1 3CQOA 3DXUA 3ITQA 3ZKUA 5FZGA 3AM2A 4TYSA 2R061 3SISA 1ZBE1 4CTEA 4XF3A 4BK5A 4AEMA 2WC2A 1D7PM 2RM21 4AI0A 2B46X 4NRPA 3E5UA 4QGNA 2HWB1 4IE5A 1NLSA 1CAXA 3GNEA 3UK9A 4EN8B 3ZN6A 3I3QA 3PIJA 4FXKB 3CNAA 2DV9A 4BH9A 5FMOS 4FSJA 2YPDA 4AGGA 4LULA 2AGSA 1KDMA 3ILRA 3MW2A 1VRH3 1QJY3 2JD4A 3CEWA 2LS6A 2BGCA 4INDA 1J1LA 1MQTC 3M3CA 2QKDA 4IESA 1DDLA 2A6WA 3CL1A 5CYYA 2WUHA 2C9AA 1O7FA 2AREA 3M3OA 3NAPA 5H9PA 3WDXA 4BZ4A 2JB8A 4CU8A 1AYN2 1UXZA 4DO0A 2ZGKA 1I5ZA 1KJRA 5EJ3A 4A4AA 3LEKA 1VIWB 4XHBA 4AG4A 2O8QA 3AKSA 4GB31 5D8AC 2Z42A 4K1YA 1KITA 3ZOIA 3ZXDA 1US2A 4YM2A 1VBB1 1WCQA 4DUXA 4XZPA 5DDJ1 1OUSA 5FZ0A 3ES1A 2OQ7A 3GYDA 3N7JA 2ATFA 1MZ5A 4FPOB 4UWDA 2D3SA 2R1BA 3FHIB 3Q8EA 3GDBA 1TME2 1RUI2 1ZBA2 2LTNA 4NRMA 2V5YA 1CQ9A 4QPGC 4ZONA 4CCJA 2R062 1ZBE2 4ONUA 3OGJA 1ULOA 2JKBA 1YYNA 4UF0B 2VZSA 1GUIA 3M3EA 1JODA 3HN3A 4IEWA 1BVVA 3T3YA 4B4RA 2HWB2 3AX4A 1TE1B 3UETA 5FJHA 1VRBA 4LNVA 5JDBA 1AR91 1DU3D 3KF5A 2R7EB 1JW6A 2GH8A 3AMHA 3CO2A 2WO1A 5CFDA 2YROA 3PU3A 4P9IA 2XUEA 2P37A 4K20A 4CRQA 2P5BA 4L11A 4DOUA 2HWF3 3H7YA 4O65A 4FVVA 3WP3A 5BNNB 4IEQA 2WBKA 1LULA 4LHKA 1W03A 5FY1A 2P34A 1SLBA 2WYSA 3A21A 1W2AX 1UZVA 3CJXA 3D0SA 2QQIA 3DL3A 3OGGA 4R9AA 3SEEA 3SNMA 1QHDA 3BU0A 5E8AA 2WQ4A 4M4PA 1KDKA 3T2QA 1I3HA 1RUF2 5B2GB 5I0SA 4BQXA 2JICA 3GM8A 3PJQA 3CBNA 1IS6A 2FCTA 4DXZA 2WFF3 1RUD1 4MXWB 3GZEA 1NCRB 1RUH1 4E4HA 2A6XA 2EAKA 2WWJA 4GB32 5C7GA 1VMFA 1D2QA 1OF3A 1VBB2 3UJQA 5DDJ2 3NV4A 2NM1A 3S7EA 2D6PA 1YFYA 3VBRB 1DLLA 2F17A 3OYWB 5EYYA 3MW3A 4Q4Y1 3K4ZA 1EV13 2QQPA 1XE0A 1G7YA 2QQKA 5IAVA 4ZU5A 1TG7A 4RN5A 1BMV1 3PVOA 4AL9A 1NQDA 4JVAA 5DG2A 4AVCA 5I91A 4KWJA 3O14A 5C4WB 1JYWA 1HRV3 2PA7A 2DBNA 3W5MA 4LOTA 1VBC3 3OEAA 1AR92 5C5UA 2OT7A 4QDQA 3KSCA 2EIEA 1GZTA 5A3LA 4FOQA 4QXBA 2BW8A 5JSOA 2ZCWA 4XUTA 5CIRA 2JDZA 3FBYA 1ULCA 4QPWA 4CP0A 3O0WA 4RR3C 1Q8SA 1UYPA 4HK9A 3LDRA 1PVC3 1WCKA 1JYIA 2D3RA 3FJSA 4OMCA 1Q8QA 2YB7A 3O12A 1NKGA 1BCXA 1Q43A 1LGCA 1GZ9A 1LR5A 2BJSA 1RUD2 1NE4A 1RUH2 3L2YA 1VBA1 2JDMA 1E5HA 3K4AA 3OB8A 2W2IA 3WNLA 1O4TA 2OS2A 4JQTA 2I2SA 4X6RB 2VVDA 4P5HA 2WNUA 1UZZA 1K5MA 3OPZA 5KBFA 4QM9A 5IK4A 2VCBA 1W04A 3CHXA 3R0RA 4W50A 4Q4Y2 4BDVB 3BUCA 1XPWA 3EB7A 3C7GA 3VUOA 2HKXA 2D6NA 2QTWB 2YMZA 4BLJA 3LFMA 4NROA 3WF2A 1OUXA 1MVQA 2W46A 3E5QA 3PJYA 3AKQA 4HBNA 5KXDA 1LU1A 3DCQA 1W3XA 2XXZA 4TLFA 1OH4A 4RQPB 4BYYA 1K12A 5T3NA 3KF3A 1SDWA 5L73A 4GWMA 1WD3A 1POV1 2PQSA 1DIWA 3URFA 4FPJA 4XACA 2A3XA 2GAUA 1W9WA 2X5IB 3E97A 1E5RA 5FIXA 3VBSB 2BOIA 5L9BA 3R6SA 4XBNA 3RYKA 4CUCA 1BEV3 3BTAA 4RFT0 1U12A 3RPQA 5B4NA 4I01A 4A42A 2AZ5A 4P02B 1UF2C 4UFLA 3ETQA 3MIBA 5LEKA 1UYYA 2BWAA 1NLRA 4XXAA 4GJYA 3WF1A 3ELNA 1O8SA 3VHRA 2ZHNA 4L92A 3I4IA 5L9RA 1VBA2 4D6SA 4UFMA 4XIOA 3KHBA 4YW3A 1Q3EA 2GNDA 5FYVA 4DRVA 1Z78A 1REFA 3U07A 3UV9A 3AP9A 5T5LA 4P9YA 4NHLA 4B1MA 1FV3A 2JB4A 3MUZ1 1YC61 4DS0A 5JMOA 3GHNA 5GZDA 5HPOA 2HWC2 3VZMA 4FAHA 1JHJA 1PK6C 3VD7A 3IDCB 1DGRA 2MEV1 1ENXA 3WQ7A 3WP4A 4XFFA 4EN9B 3HNMA 4UF0A 4A3XA 5A7WB 2HEWF 4KU7A 2XJTA 4KMQA 4PIYA 4YRDA 4N43A 4JDOA 1PO12 1OT5A 1GR3A 4GWIA 4A6OA 1WMDA 3WCSA 4B4QA 5IVVA 5JOYA 1SBEA 2XVGA 1C8M1 2FMDA 3LKJA 4IETA 5FY8A 1FXZA 3PVEA 1ZRIA 2WO7A 3IM0A 4ORFA 1PZ7A 3IN9A 5KHGA 2ZMKA 4NHXA 4YZ1A 1W2OA 2HWE1 3O0XA 1H8TB 1HQLA 2Y6HA 5BNOC 2PTMA 3JXSA 3DEMA 4EROA 4XFCA 2IXIA 5BNNA 2NPIA 1DGLA 4MGIE 3E6BA 3SC7X 2XVLA 3RG0A 3P6BA 5DUVA 1UMHA 2ZGSA 3TNQA 2RMU1 1CIWA 1KFXL 2WWSA 3BCWA 2EXKA 3TEXA 1GU3A 1O4ZA 3I3BA 3UL2A 2HEVF 4ARYA 1AX2A 1IG0A 4JGZB 4XFGA 2V73A 4S2HA 2W94A 1UNBA 1R091 2Q5TA 2G9ZA 5LY2A 4YW5A 1GZCA 1IGOA 4FTSA 1PGSA 5KXCA 2P3KA 5LB6A 1UOFA 1LNSA 2WNVC 4XJUA 1CJPA 1BXHA 3RI8A 5I0UA 3BODA 2DCYA 1OA2A 1QJU1 5F32A 4CA9A 2WZEA 4LTAA 4QM8A 3VBFA 1WCDJ 5CVRA 2V72A 3WNOA 2D3PA 5FYSA 1VR3A 3WOGA 3L9JT 3R4DB 3IKWA 3VBUC 5JXHA 5FY9A 2Q8DA 2H6BA 3UYJA 4IEYA 4BIFA 4M0NA 2AYHA 3N9OA 2Y6GA 1PVXA 2VG9A 4HT1T 4GD4A 4YSFA 2MEV2 5D8AB 2ZMLA 2ZGQA 3I2HA 5FQ0B 5C4WA 4JHTA 5F37A 5EIYB 3I59B 4CDQB 2PHRA 1C1FA 5GZCA 3AP6A 4KGGA 1C8M2 1RMU1 4A44A 1WBLA 1UZ0A 1XE7A 1ZRRA 1WCUA 2QZ3A 2ZHKA 4A7ZA 5EPAA 4H3WA 4PLNA 1GV9A 4N7IA 2HWE2 4Z1VA 3E6DA 4L97A 5FZ1A 4LBMA 4MH0E 1J1TA 1RVF1 2I74A 3MHZA 2EIGA 5AC93 3OGVA 5LW9A 1W6NB 5KWRA 2WQZC 3HIFA 4XEZA 4ET7A 2RMU2 2D6LX 3W9AA 1ZNPA 4IEUA 4UW5A 3BALA 4GULA 4NAOA 4PDWB 4LK7A 1QGLA 1XBFA 1R092 3MIHA 4XZUG 2Y38A 3J26N 3TYJA 3GBGA 2PAEA 1WW4A 4AGVA 5JZGC 1J83A 3ZN5A 3UNPA 1PIV1 2C4XA 2P3IA 5DQ0A 3BGAA 1GOHA 3VBFC 3U4XA 1TNRA 5CISA 4B8EA 1OH3A 1UOJA 1NAEA 3J9SA 3S0MA 1CPNA 4B7EA 1IZ3A 5F39A 2P3JA 1D0HA 4B1LA 3ASIA 4YM3A 2BRTA 2Z4FA 3BPZA 3AZZA 1JZ3A 3ACLA 3WNXA 2HWD1 2ZEZA 3TEZA 2OUJA 3LDBA 1YIPA 4K40A 1ONAA 1S1AA 4FOWA 4E4DX 5GLVA 2JG9C 1LRHA 3B7MA 3THDA 4ZU7A 3HN1A 4XF4A 2OKXA 1NQJA 2JIGA 5CAZA 2OIIA 2DURA 1FPN3 1RMU2 2AENA 4NPLA 4AEDB 4AQ2A 1UIJA 1H4GA 1D2SA 1LJ7A 3J7LA 3KV4A 4RQPA 3AFGA 4S2GA 5FZCA 3TRSB 1AL23 3L2HA 1QJX3 4EZHA 5CADA 5FUPA 2WABA 1RVF2 2Y8KA 1LENA 4GH4C 5ANQA 4E2QA 4XVHA 4CDWC 5F5IA 5IK7A 2E33A 2WZR1 1U5ZA 3ZKYA 4LQRA 1H9PA 1Y9MA 4CZSA 2E53A 4IGOA 3N7KA 2R1DA 1OVPA 5SV8A 5K4LA 5C3PA 1EYBA 1SCRA 1K5MC 4AVTA 2JDPA 1QNWA 4HOOA 5C8CC 3BIWE 1HDKA 4J6GA 2BFUS 3ZSEA 1M4WA 2DTYA 3GGLA 4RR3B 3I2JA 4JGYC 3U11A 2ZX3A 1PIV2 3WNMA 2WSUA 4HPKB 1UAIA 4EN7B 4D3WA 2GN7A 2GNBA 2ZX4A 4Z82A 5ISLA 1F35A 3ZVXA 2R49A 5FZDA 2XJVA 1CAWA 1RUC1 3B93A 3NV2A 4QB6A 1J84A 1K3IA 3ETPA 4CE8A 1L3JA 2ZGRA 1R082 2VQUA 1YI9A 4QQHA 4XF1A 4DIQA 2HWD2 3J8F1 3M1HA 1Y9QA 1NX9A 3U37A 4B3NA 4WBBA 1UO9A 2XKPA 2JEMA 4Y33A 2B9VA 4Q1PA 4YZ5A 2GP3A 3LQCA 2R071 2H0VA 2R041 5A7WA 3WF0A 4A6SA 1RB8G 5ACA1 4XQWA 4QX5A 3OEBA 2RS31 3HPNA 1RUG3 1AR81 1X8MA 2PHXA 3AMNA 1VBD1 3PTRB 4FPYA 4IV3C 4MX3A 4XUOA 2E31A 1JU3A 4YZ3A 1YO8A 4QX1A 1CX4A 1GBGA 2RS11 1CPMA 4JRLA 4OUSA 4MLOA 4UFKA 5A70A 1X7NA 5IVCA 5CA6A 2WZR2 1J3QA 4Y20B 5C3SA 2WZPP 5FWEA 3ZXEA 1XE8A 3C7HA 3TNPB 2D43A 1LOCA 2VBDA 5FPXA 1CZTA 1UKRA 1UY1A 1W06A 5EWSA 1XYOA 3V0BB 3M2MA 5FZHA 1DLCA 4BWOA 3IDBB 2JE9A 2Y60A 1N1SA 2LM3A 5C3QA 2B39A 1F9KA 5A3TA 2LALA 3C2UA 4LPLA 4Y24A 4LITA 4RS5B 5A7SA 1MQTA 4GMP0 3ZR6A 5H9QA 5L19A 3IBMA 1G9FA 4QU1A 1JZ2A 1GQHA 2NQYA 2VTXA 2ZHLA 3K77A 3FN9A 1JH5A 3KMHA 4LHNA 4COUA 3HNBM 3IPVB 3J8F2 3N9NA 4ZHNA 4X8PA 5I0RA 1EP0A 2RS51 5FKCA 5D8AA 1OLMA 2J1EA 3EO6A 2YBKA 1XU2A 4NPRA 5DXDA 2R072 2R042 3DKWA 1WW6A 3PUSA 2IXLA 4F7ZA 3PTYA 5ACA2 5F5QA 2RS32 2E26A 2CY6A 3I59A 1AR82 4QX0A 5G05L 1VBD2 1CAXB 1HN1A 2XUMA 5LA9A 5IVEA 3LOBA 2B5HA 4QKNA 2UYAA 2RS12 1H0BA 4J25A 2JDAA 3H3LA 4QPGA 3T09A 4I2OA 1HLCA 3WHUA 1YWKA 1UX6A 3D4KA 4FI9A 3N7MA 2X05A 5FTTC 3H8XA 1W6NA 3B00A 3PNAA 3W20A 4Q8KA 1UD1A 3C3VA 4XJAA 3VB9A 2VQ0A 4XAEA 1QKQA 3H7JA 1BBT3 1GMMA 4LBOA 3F2ZA 4MG2A 1ODNA 1C28A 2Z69A 1PGL1 5DZFA 3LZZA 2VR4A 4D0QA 4E4ZA 4O61A 2HEYF 3PU8A 3N3HA 2VZ1A 3AXDA 3AKPA 4SLIA 5CZKA 3QLQA 4U2AA 5JSRA 5JOWA 3JB4C 5FV3A 2IXKA 1URXA 2Y0OA 3IZOA 3LA7A 4FFIA 4UBGA 3RYRA 1WUVA 3SLIA 4A3ZA 1OKOA 2X09A 4GJZA 1YQ2A 2JE7A 1TEIA 3H1YA 5FAXA 1HB3A 2RDRA 3RJRA 1JZ6A 4HK8A 1ZZ6A 1QJY1 2RS52 1V6JA 3B5LB 3MLJA 4JV4A 5GZGA 2WNVB 2WLQA 2YU2A 4ZS3A 2JG8C 5IVJA 4K9SA 1AHSA 3WUCA 3PUIA 1T2XA 5FZOB 1JN2P 1H1IA 3UKNA 3OCPA 1DQ0A 4OUMA 3KD4A 4QQ2A 3VBUB 3VZJA 3WDWA 2ARAA 2ZEXA 4KU8A 1ZZ8A 3FHQA 3HJRA 5C70A 5A80A 4GALA 3V0AA 5H9RA 4X8NA 2J1UA 1HQNA 3LSDA 2ZEYA 1EAH1 3OBAA 4BA6A 1W6PB 4OHXA 1UWWA 2VZ3A 2C9KA 4HZFA 1WLWA 4AI1A 2ORZA 4CDXC 4LLOA 2CSGA 3RZKA 4MHUA 4HETA 2NLRA 4DUWA 1UQXA 1CONA 1PGL2 2QQNA 3LPFA 2BZDA 2VZQA 1N3OA 4JRAA 4MV2A 3KCYA 4XDPA 2YG0A 4RR3A 1XYPA 2XG3A 1D0GA 5IHRA 4HPKA 3DGTA 5EFUA 2VZUA 3POGA 1UOBA 4NVPA 4R9CA 1FV2A 5L36A 3WG3A 2OA2A 2FCVA 3ZMNA 1IG3A 3I3MA 1UMIA 1Y3TA 2HWF1 1F5JA 1MPXA 2WQ8A 4NAMA 4AHYA 3WW3A 1QJY2 2PXJA 2PELA 5JZGB 5FZAA 3OD4A 4A41A 4N7UA 3WHTA 3ZXJA 1CJDA 4CCEA 3POJA 4Q4X1 3KT1A 5I0DA 4BHPA 4K1ZA 5F2SA 2F6BA 5FZ3A 3LDKA 1V0AA 2YC2A 4YYOA 2NYYA 2WRAA 1S0EA 5A3NA 2VUDA 2YV8A 2GSYA 2RR13 1GQPA 3NKGA 1JYTA 1NYWA 3WQ0A 5DAQA 2JJ6A 2NMOA 3UT0A 2F4PA 3WDVA 1EAH2 4UBHA 4S2FA 3ES4A 4FFGA 3H8UA 3JD73 1SLAA 1N1TA 1DGWA 1RC6A 3KQ4B 1EV11 4DNYA 3W21A 3B9CA 3K2OA 2FDHA 3AMPA 2FZ2A 4GA9A 5FZ6A 5FPUA 1SEFA 3I2IA 1U5YA 5FZBA 1B35C 2GMMA 2C5DA 4GH4B 3MV11 4CDWB 3HT1A 3WY6A 4NN0A 3D8CA 3ZSLA 3BKZA 1GSLA 2WIIB 2ZOEB 5A33A 5A6QA 5LWBA 4IEPA 1NT0A 2VQAA 1ZA7A 3U0ZA 1A6CA 2CHHA 1ND3C 2VOTA 4XURA 4Y4RA 4UI9L 4BJ0A 5JPMB 2ORXA 2BU9A 1AR63 4HKLA 1K5MB 4I02A 4FP2A 4QGMA 1VBE3 2HWF2 2WJSA 1DQ5A 2WN2A 3MF6A 1FNYA 3N36A 4LUMA 1X8EA 2BEOA 1CX1A 2VZPA 3IPVA 3GBWA 4MGTA 3WSOA 4OI0A 5CBLA 1OQEA 1ENRA 5IT6A 2X10A 3NL1A 1EUTA 4H7MA 2LROA 1QH7A 3Q8CA 4XW3A 5IVYA 2OYZA 2WT0A 5T5JA 2TEPA 5FO8B 2W47A 1JOBA 1QOOA 2VMIA 4AHZA 2KM2A 5T54A 1I6XA 1YHFA 3THCA 2YPJA 3QH7A 5LCWL 4LKDA 1PK6A 1X82A 1ALYA 1FAYA 3UGGA 1RUE3 4CXXA 3MLLA 4OHVA 4RGGA 2VGDA 3M70A 1EV12 3LD8A 4FPFA 3NSTA 4PIXA 1P8JA 2RVAA 1RHI3 4IV3B 4Q0UA 1GNZA 5FXZA 4BQWA 5A32A 1JZ4A 1MZFA 1TNFA 3N4MA 1MEC1 4NRQA 1HXS1 2ETEA 1RJ8A 4MVTA 1HRV2 1RUF1 4OULA 5BNOA 1G9AA 2DDUA 1WW7A 3WCRA 3MPBA 1VBC2 4UFHA 5FXVA 4LKSA 1MZEA 5BV6A 4TWTA 4UXAA 4COYA 3FLPA 5A3WA 5A7PA 2ZX1A 4BQ3A 2ZGUA 2XJSA 4CUAA 2BVVA 4FQ4A 2GDFA 3V56A 1QQP1 4WM7C 3B02A 5BXXA 2GNTA 2PN5A 5F7UA 3D3AA 3ZLIA 2A70A 1N1VA 1PVC2 2VNGA 2Z79A 4DPNA 5AFEA 2BDRA 2CWMA 2WNVA 3O0VA 1VLNA 4XTMA 2SLIA 5DPNA 4AWDA 4EWDA 2ZZQA 3HQXA 3D6EA 2K2SA 5FZOA 4TSVA 2G9FA 1V6OA 1LTEA 3HOBA 3AXEA 4N43B 2IVJA 4FPLA 2V4AA 3TEYA 3VBUA 4K8FA 2OW4A 4QQOA 1OA4A 5F3GA 5J98B 2G19A 2BTVC 1O6UA 3OPTA 2PLV3 3NJZA 1FOD1 1W6PA 3T0BA 5JUVA 5G04L 4LBLA 4ZKTB 4AR2A 5EHDA 2WS91 3LAGA 1UOGA 3ZYHA 3BU7A 4OZXA 1QMJA 1MEC2 1HXS2 2QQLA 2Q8CA 3T08A 1LODA 3CZUA 3IDEA 1N47A 2XBO3 1AR71 3SH4A 2HLEA 1D4M3 3I97A 3Q8AA 3VKNA 5GKAC 2J7MA 5L9VA 5IATA 2XJRA 3FLTA 1LGNA 1RUJ3 1UL9A 4NIHA 4FPEA 3ZPYA 3FZ3A 1QQP2 2QQUA 1JBCA 3VBFB 1PMIA 4KBBA 1HRI1 4LBQD 2KXLA 3IIIA 2VJXA 4K21A 4QU2A 1QXRA 3CDZB 2R0HA 4Y5SA 1J58A 2VMGA 3ZXFA 4CP9A 1AF9A 5JZGA 4IGQA 4LHSA 5KC5A 5FCCA 1CN1A 4Y4YA 2XKOA 2WLPA 4LA2A 4JHZA 3VV1A 5FYMA 3R4SA 4Q0QA 1W9SA 4MGYE 3RFRA 5FY4A 1MZ6A 5LEJA 2EVXA 3RZMA 5FR3A 1JHNA 5EJ1B 3VD3A 1PZ9A 1F5FA 4BU2A 2DCTA 2JDKA 1XNTA 2BWCA 3AL5A 4BXSV 5KHJA 5DUXA 4GXLA 2IFRA 3NQHA 2TBVA 2VXJA 2JG8B 4CCCA 1WGPA 5A1AA 1OLQA 1FOD2 3ZFEC 4AYUA 3S5AA 2JG9A 2QQOA 4FPHA 5DMYA 1O3QA 4O7XA 2ID4A 1QJFA 4NO4A 4PLOA 4NHKA 2WS92 3TEWA 2VW2A 1S2KA 4DY5A 2EXJA 3G6JB 2LRPA 4QDRA 2FMYA 2CDOA 1BKZA 1KEXA 2DVAA 3MEPA 4NUBA 2UY8A 3O1TA 2XMLA 5I8SA 5FPLA 1AYN3 1DZTA 2G9GA 3A0NA 5K8SA 1A8MA 1AR72 4GH4A 4CDWA 4D8MA 2D5FA 1A3KA 5SV5A 4OQ9A 3ZSJA 5JXIA 1HB1A 1SBFA 3I3EA 3HEIA 4YWAA 2KD7A 2J1AA 1O4YA 3H3ZA 4IUGA 5JAXA 2VW0A 2DUOA 3HWJA 4FCAA 5FBJA 2Q8EA 5BNPC 3QBQA 3UESA 3GZTB 1H2NA 1HRI2 2R6QA 3FMGA 4FFFA 5C8CA 5CFCC 2IC1A 4XHXA 5AC91 3MO4A 2WL1A 1RXGA 4JGYA 4EWAA 4Q8LA 2QQWA 1TME3 3LCPA 1ZBA3 2LUWA 2HWC1 4XCBA 3HQRA 4R8HA 2R063 3ZSMA 4EE2A 5LA1A 2RM23 3R05A 1CD3G 4XE9A 1CAUA 4HVRA 1J3RA 1QU0A 1OVSA 4OUEA 4XPVA 5FLHA 3VKLA 1REEA 1PO11 2A5ZA 2BGPA 2IUWA 1J59A 4LJHA 4IE0A 3W5NA 1FATA 1OPMA 4HSLA 4DEQA 1STMA 3KCXA 2WYFA 1DHKB 4XDQA 3WLUA 5LBCA 4RA0A 1UXXX 2TNFA 4YVSC 2YZ4A 2DCKA 1UY3A 2XONA 3PUQA 3QCWA 5FP3A 5E88A 2E7TA 4C1XA 2GC0A 1OURA 2ZABA 3SCGA 1NZCA 4IV3A 2J1SA 4IDZA 4D7YA 2RG4A 2CNAA 5HCBA 2YYOA 3ZMOA 1RYYA 2W91A 3AKRA 4YW4A 2IVIB 1GWKA 5J48A 2QBXA 3POIA 1NA1C 2LW8A 2VCAA 2Y64A 4CCKA 2XVKA 1V70A 2W1WA 1KGYA 3M7AA 4XC9A 4WVZA 1TZOA 1LGBA 5F9TA 2PHLA 1AL21 1XJAA 3O1OA 2VOKA 1QJX1 4LBKA 2VMDA 1CAWB 4NPMA 5DDJ3 3KHCA 4L9BA 2ZTNA 1UIKA 5AC92 2FCUA 3WQBA 4P08A 5J36A 4QKBA 4MSVA 4QXHA 3N9PA 5HCHA 1QNYA 1TVGA 1ND3B 4LO8A 1ZA4A 2DUPA 1FT9A 4E27A 4DUVA 5K0UC 2VMCA 2W1SA 2P3YA 5TSWA 4ZPIA 1W8ZA 5FOJB 2RDSA 4JX0A 3DUIA 4GWNA 4QAWA 5L7OC 4BQ1A 1WA6X 1AR93 2QQJA 3ZM8A 2YU1A 3O1SA 1MS5A 3VHNA 3ZO0B 4AZZA 2E7QA 4PF1A 1XSRA 3O1MA 2HJIA 3PVBB 3LA3A 2BERA 4XJZA 2PHUA 1SMVA 2XWBB 3Q8FA 4DB5A 3IB3A 1ZZ9A 1BK0A 2J1TA 2Y6KA 3EXUA 2JDUA 3KM5A 4HVOA 4M3CB 5FPVA 3S30A 1OLRA 1Z0HA 1SFNA 4DMIA 4C91A 3CU7A 1V6KA 4ES9A 4Q2FA 1UCXA 2Y0IA 3UJOA 2G1MA 4AE2A 3KLSA 5CG9A 3F95A 4XDOA 3JCIA 1PMHX 3W59A 4CCMA 4FAGA 5AFBA 5K7PA 2YC4A 2OQ6A 4XYXA 3E6CC 3A0KA 3PUHA 1RUD3 4NIIA 4A7YA 4E4SA 4DRRA 1RUH3 2B9UA 2VO5A 4DINB 5IYYA 3QACA 5FXWA 2W68A 5F3IA 1AL22 1WMFA 2ZXQA 3MFAA 4XTPA 1QJX2 5IFPA 4LA3A 5J96B 1MQTB 5LBEA 5GJ6A 5I8YA 1DQ1A 2GMPA 2E51A 3VBHC 3SEPA 3B9IA 4Q4Y3 1W2TA 3VD5A 1V6MA 4M3CE 4LO4B 2C1FA 4XBQA 2VH9A 4HKWA 1LEMA 4N53C 3WR0A 3WNKA 5FYBA 4DXRA 4Q5OA 4W6XA 2K46A 4WM7B 3RMYA 4RGAA 2WFPA 4XFAA 4QHBA 3VDBA 4RHV1 1OFNA 2OZ6A 3WD5A 4UOJA 4P9GA 3SITA 1C4RA 1R1A3 2I07B 2JG8A
chains in the Genus database with same CATH topology
4QPGB 2R30A 1MS3A 2UU8A 4P14A 1RTVA 2CGNA 4Y1ZA 2D5HA 4GMP3 4M0HA 4XMIA 3VZLA 2B42B 2RE9A 2HYKA 2X53S 5F1RA 4ITCA 4PIZA 3ZFFC 4CYDA 1ZZ7A 2BUKA 3WP6A 1VBA3 3NW4A 2BPA2 2Q8OA 4CDXA 2GNMA 4COZA 2ET1A 2ZPXA 4IQPA 2CGOA 4AEJA 2BNOA 1OQ1A 1C57A 2PHFA 3AZVA 4JCKA 4D7TA 3A4UA 3AMMA 2ZGMA 1RINA 4XF9A 1R081 2CGPA 1FMD1 1V9U1 2DWRA 4IV1C 4N90A 1QOSA 1H2MA 4URTA 1ZVFA 2SBAA 1UZYA 1V00A 5K9YA 4Y1XA 4ISRA 3RRDA 4IXLA 5T52A 1A8DA 1AJKA 4RHV2 3AYEA 3SMHA 1VALA 3V0AB 1POV3 4HKOA 2DUQA 2A73B 1XNKA 2ZA9A 3FX3A 4BE3A 3P3PA 4CDUC 2VUJA 1LHNA 1IPKA 1YRZA 3RWNA 3JZVA 2XJPA 3I54A 1VB2A 4LO5B 3SCFA 2QE3A 3VKMA 3ILFA 4COVA 1FX5A 4B4PA 2PQQA 1DZRA 1ZZCA 5JI7A 1F31A 4YVWA 1RUOA 4XFBA 3VLBB 3RYPA 3T1MA 4Y1YA 5JPNB 1EPZA 2DVFA 5FPZA 1XRUA 3I2DA 3WW4A 1RIRA 1B35A 1BZWA 5CNAA 5IUQA 1FMD2 3RNSA 1V9U2 1H8VA 3WXPA 4AVBA 1QWRA 1V6NA 4NWVA 1X33A 1WMEA 1ND3A 2MEV3 3NO8A 4M01A 4D7SA 5BNPB 4EWEA 4XMAA 4HFSA 4BM8A 4AI2A 1WLDA 5CFCB 2VVFA 4Q29A 4W6WA 2WT1A 2CV6A 1C8M3 4AI3A 1PGW1 5C6CA 4CEYC 1SACA 5LRSA 1IHMA 1G9DA 4G3YC 3KCCA 3RJ2X 1SLIA 2VUAA 3KZ4C 4M3CA 3CLPA 1QDOA 3H50A 1H4HA 4Z07A 3JBG1 2RMU3 1C1LA 5KHHA 2NMNA 1MVEA 5C9AC 3N7LA 2ZAAA 1AYM1 2TUNA 2ZGLA 4AFBA 1R093 1JOJA 4YVSB 4EN6B 2Q1MA 4XFIA 4YFWA 2RR11 3SCHA 5A33B 4YW2A 4QGLA 1LHVA 5GM0A 1DQ4A 3KQRA 4PCRA 1QJU3 2VNRA 1UU4A 5LK5A 3KS7A 1Y43B 2K0GA 1LOBA 3D0JA 1SFYA 1AZDA 3JD71 1NA1B 4OI2A 3SXWA 3WZ1A 4AQ6A 5C33A 1GANA 4AHWA 1ZZBA 3AZWA 4QD2A 3P3NA 2N7GA 4WZCA 3MI8A 2JX9A 4WM7A 1COV1 3AZYA 3FC0A 3FLRA 1RMU3 3EJKA 4OVEA 2OZJA 1PGW2 4Y5Z0 4Q26A 5LK7B 3VKFC 3UKTA 4G9SB 4Q4W1 1PK6B 5K0UB 4RSUA 4FO9A 1G8WA 3VDDC 3JBG2 4I3PA 5GZFA 3RI9A 1VAKA 3ECQA 3U10A 1AYM2 5A32B 1QOTA 1VJ2A 2BBVA 1FI2A 3CJIC 3ZYRA 1RITA 4XJ8A 1JUIA 3SH5A 2D93A 5KXEA 5BNOB 1POV0 1YXWA 1LOFC 5J3UA 2RR12 4FTBA 2VULA 3PLQA 1PIV3 2JXAA 4XETA 1KFUL 3NV3A 2EXIA 3WDTA 2ZBJA 2WA4A 3NKTA 4YGDA 5KXBA 1CGPA 1YJKA 1OI6A 3EHKA 1HQWA 1W6QB 4KQ7A 1U0AA 3JD72 4EV0A 4AHXA 1NCRC 4R52A 2BQPA 2ZJCA 1T6GC 1VRH1 2NP0A 4WVWA 1N1YA 1RHI1 5GALA 4H55A 1TMF3 3S6PA 1LOAA 3KT7A 3VBRC 1NCQA 2DTWA 1N3PA 1COV2 3VL8A 3BB6A 1MR5A 3ZIXA 4FOVA 4R4ZA 5KHKA 4HLTA 4Q4W2 1HIXA 4WZFA 3VZKA 3FBMA 4AF9A 4Q0SA 3DF0A 4KGQA 5DUWA 4PQ9A 4FBFA 5JWPA 1KS4A 2AR6A 4MXVA 4XOGA 1VB4A 2WZR3 3SH3A 3ZIWA 1X50A 3I7DA 5J37A 2GC1A 4XJWA 4WVMA 5I0TA 1AX0A 2BVBA 3ZFEA 1SBDA 2DCZA 4IEVA 4HVQA 1WBFA 4DY3A 4BLIA 1RUC3 4PBPA 2PLV1 3ZFFB 1GYKA 4GIQA 4TZDA 4YZ2A 4HSJA 1VRH2 2EALA 3J8F3 4XBLA 1X36A 1S0DA 1RHI2 3CF6E 1NXD1 4SBVA 3POSA 1LOEA 1V6IA 5BNPA 2AH2A 2R043 3AFKA 1DG6A 5ACA3 1RUNA 5CFCA 2VMHA 4V1PA 2YDEA 2WFF1 1YFXA 5C8CB 3NV1A 4XILA 1W6OB 1KD7A 1OA3A 4IV1B 2MPFA 4LLFA 1MS9A 4W6YA 3MFCA 3AKTA 2D97A 2JG9B 2ZX2A 3USUB 1S0CA 2OPKA 5BUVA 1TQ5A 3TN93 2OUHA 4OLLA 4K3UA 5JIUA 4YVWC 4P9WA 4QQLA 3ZFGC 2DVGA 3FUQA 3ZDSA 1VP6A 3H9AA 1MACA 3PMSA 5FFOC 4BIOA 3VBSC 2X5IC 1IS5A 2VOVA 1HRV1 2Q0AA 1R1ZA 2ZZJA 3NWKA 3QD6A 4YVSA 1W39A 2IXJA 1ULFA 3OY8B 1VBC1 2B7YA 5KC6A 1ZYBA 4Y1UA 1AJOA 2PLV2 1Z7S3 3ME2A 1AX1A 1OMIA 2O8OA 3WT3A 1NA1A 1XU1A 2GC2A 2RS53 4JGYB 4WM8C 3ZX7A 3FWEA 1PVC1 2FHRA 4FT8A 2RHPA 1OOPC 3GZUC 5CB7A 4ASLA 4QXKA 2YUEA 1OD5A 5JIAA 1CAUB 2WFF2 2O0OA 1AXZA 3ZXLA 2A71A 4AEKA 3W58A 4ATFA 1UPIA 1XYNA 1YIFA 2CTVA 1CR7A 1D4VB 5K0UA 1UW8A 1G6NA 4KNCA 5DUUA 4YGCA 5GLUA 3VBOC 3FUOA 2EAAA 3KB5A 2H6CA 5L7OA 1DYKA 4Z92B 4OHWA 4CEYB 3WP5A 1H8TC 4L8QA 5DZEA 4Y26A 1Q5OA 3IWZA 3LB9A 3WW2A 2B45X 1LEDA 1NOVA 5C9AB 4JGZC 3AYDA 2ZAHA 3HMYA 3ZXGA 1FNZA 1W6QA 3HR9A 4Q4V3 5I93A 1BEV1 4MGZE 1YFUA 3O7OA 2XL9A 4Q1RA 2WT2A 2DFCA 3HD8B 5BPXA 4EJRA 4NOTA 2DU0A 2YGLA 3VBHA 1ENSA 1ASJ3 2GZWA 1H1AA 2JECA 5GLTA 3JU9A 1BVP1 5JSPA 1EAH3 2P2KA 3POYA 1LHOA 1SLTA 3LOIA 4N53A 2ZHMA 3HT2A 5FREA 5T55A 3ZSKA 4CDQC 4L99A 1W0PA 3KGLA 4XFHA 1OHFA 4BPZA 4GKYA 2A6YA 2Q30A 3AJZA 3MIFA 4KG8A 4CEWC 1G9CA 2D6MA 4OI4A 2RM22 1MS4A 2D6OX 4ZXKA 2PAMA 4I30A 3WUDA 4AFDA 4UW4A 3KT4A 3B94A 3VDDB 1YCIA 4LT5A 4FQZA 4LBJA 2GC3A 2GN3A 1W2UA 4PDWC 4Y22B 4OI1A 1PO23 2C0ZA 4QPYA 2ZGOA 3CJIB 3R4UA 3ZFFA 1NCQC 2MNGA 1AUYA 2UWBA 1RGSA 3SHRA 1BEV2 1CAVB 3D82A 3HAGA 4Q4X3 3T2TA 2PYTA 3PMEA 1UU5A 3FFQA 5FO7B 3WW1A 4QPIC 4ASMB 1UMZA 3HBZA 2D6KA 1S0JA 2ARXA 1W6OA 2VU9A 4IV1A 2A7AA 1YFWA 2XHKA 5ABJC 4XJ9A 5HI0A 1XQNA 1YLLA 3OTFA 2BYVE 2X29A 3USUA 4BMBA 4AEDC 1C5IA 3V64A 1LECA 1FYUA 1OSGA 3DPRC 1Y7BA 3BOWA 4XQDA 2YC0A 2DVBA 5H9SA 2ET7A 1S0BA 1IS3A 4AI8A 5D1IA 4DZGA 1Q56A 1SQ4A 2BNMA 4CDUA 3OY8A 3WINE 4C90A 4R4XA 4S2DA 4CDXB 1Q8OA 1R1A1 3GHMA 3WG1A 3M3IA 2R32A 1LESA 4C1WA 1M06G 3ZYGA 4XQ4A 3FFZA 2KA3A 3Q9OA 4LBNA 3THPA 1PNGA 2QDNA 4JDNA 2A3YA 4Z2WA 4LE4A 4GMP1 4OHZA 4A2UA 1RUI3 1GZWB 2GU9A 1ZBE3 1GKBA 2E7AA 3APBA 1NG0A 1HKDA 2ES3A 4FPGA 4LR4A 2HWB3 2WKKA 4LO7A 5FLIA 4YW1A 2IXHA 2IXCA 2FBEA 3H1WA 4NHMA 2XLAA 5HCAA 1ND2C 1WLCA 1QJZA 2JENA 3H3UA 1HX6A 4YZ4A 4I0WB 1H9WA 5CU1A 1BMV2 1GFF2 5BY5A 1MS0A 1MEC3 1HXS3 4CEYA 1RUF3 1OQDA 5HCFA 2CL2A 2ZGTA 3WG4A 4XXPA 2ZACA 2DCJA 3IMNA 2DFBA 1FPN1 4JTOA 4YVWB 3VHOA 3ZFGB 4GB33 1R1A2 4P9LA 4YGBA 5J7MA 3V65A 5C9AA 3VL9A 1VBB3 4BCUA 1QQP3 3GF6A 5AVPA 1OFSA 2H0BA 3B3QE 1UN1A 3MGUA 1B35B 4FPKA 4Z8BA 1LB2A 3ALQA 4LBQB 3ZYIB 2EA7A 3MYXA 1U5IA 1HV0A 2UURA 2ZGPA 4RS5C 1ENQA 2B8MA 2NN8A 4MGKE 3MZHA 4J1XA 3MPPG 5EXOA 1QH6A 4MYEA 4JQRA 4OFGA 2BNNA 3VZOA 1AXYA 3T1LA 2E63A 4WM8B 3GZAA 2G4IA 3MIEA 4YM1A 1O5UA 4R9DA 4B7KA 1FOD3 3PVNA 1ZRFA 2PFWA 3KGZA 1OOPB 4AVSA 1LHWA 3ZN4A 2VVEA 2WS93 2K9ZA 4N9HA 4ATEA 1BYHA 4JTNA 3MIDA 2MHFA 5T5OA 5CG8A 1AR73 3VBOB 4CP1A 3VDDA 1FPN2 3DV8A 4X6QB 1XNDA 2QJVA 1RUG1 2WA3A 1QXPA 2QDRA 3NAPC 2R0FA 4Y22A 3GALA 3J4UH 1HRI3 3CJIA 4Y1VA 1QF3A 1XNCA 1HV1A 1LOFA 1N3QA 1GLHA 3AJYA 1CAVA 4HL0A 2EXHA 1A78A 1DFQA 4AFMA 4R9BA 1QY4A 3X29B 5HBAA 4LEJA 3MW4A 4B29A 1I1EA 4JAAA 4COWA 1V6LA 5FMOL 4MXWA 4MZUA 1NCRA 4CP2A 1YI7A 2DYCA 4H14A 4DQAA 2ZS6B 4G4FA 3E5XA 3AMQA 2VOXA 3AP4A 3VBRA 1MS8A 3OYWA 2VW1A 4IEXA 5HXVA 3ROUA 4AFCA 1C5HA 4XIKA 1RJ7A 4YFZA 5CFDC 1DQ6A 2ZX0A 4PBOA 2YY1A 1PNFA 4AQTA 4KH9A 5A3MA 2UWAA 4IERA 1VAMA 4YGEA 5J09A 2V09A 1RL3A 4IEZA 1RUG2 4JDMA 2VPVA 4Q0VA 1J3PA 2W08A 2ARBA 1OPOA 2P17A 4CEWB 4AFAA 4FPCA 1WCSA 3AP7A 5FDBA 2UWCA 4YG3A 4K6BA 4DFSA 5JLVA 1F2NA 2HWC3 1W0OA 3JUUA 2ZKNA 3WVJA 1IKPA 1CESA 1YUDA 2VNOA 5GLWA 1C3HA 1BBT1 1GZWA 1PM7A 4E2SA 4OHYA 1NCQB 4KWKA 3DN7A 2XB6C 1WD4A 1EPWA 1PO13 1O3SA 1O3RA 2WINB 1LHUA 1E57A 2ILMA 3JB8A 3OF1A 4F83A 1QJU2 2RJLA 3O5SA 4J1WA 4XF0A 2D98A 4GKXA 2DF7A 3JQWA 1DYPA 5JMCA 1DQ2A 3WDYA 4F8AA 4AVVA 1W6MB 4QPIB 4U36A 1BQPA 3VKOA 1Q8PA 3ENRA 2OVUA 3ATGA 3ZXAC 4I0BA 2PAKA 4WVMB 3OD0A 2A3WA 1JUHA 3I8TA 5BYNA 5EV7A 1TMF1 5T5PA 5ABJB 3ZFEB 2DU1A 1O3TA 3OBTA 2W39A 2QUOA 5DG1A 1SLLA 3IT8A 1BJQA 1KXGA 1S0IA 3DPRB 3LGRA 5JR7B 3MLKA 3ZFGA 3WQ1A 5C8WA 4FP3A 4HMZA 1UU6A 4YLZA 3VBSA 1NE6A 2X5IA 4Q27A 4ES8A 4LBQA 1VAVA 4YARA 2YXSA 1Q8VA 4MUVA 1KQRA 3TBDA 2CAUA 2FZ1A 3TOJA 2WNUC 3M3QA 5JOZA 1BBT2 1EY2A 2ZGNA 4D94A 1ZRCA 2QZ2A 4E9KA 5FBZA 4META 1ULGA 2FQPA 5E16A 2IWGB 5IK8A 1NXMA 4KG0A 4WM8A 1NY71 1WA4A 5JI9A 2XWJB 1G9BA 2HWE3 2I45A 2R16A 3NVCA 5GLZA 1OOPA 2XJUA 4ZU4A 1KJLA 1WW5A 2D7FA 2O1QA 4LHLA 3QH6A 1TMF2 2XJQA 3AZXA 2XLFA 4HANA 4EN0A 1ULEA 5F6KA 3VBOA 1ND2B 2DVDA 1QDCA 4PJYA 1H2LA 4D69A 2ERFA 3AB0A 1H8TA 3AK0A 3TN91 3GBFA 1C8NA 4L2NA 1APNA 1ZRDA 1IPJA 3VZNA 4K7JA 1H1MA 2XLGA 2QFEA 2UY9A 4I0AA 4JGZA 1IQAA 3RMXA 4AQSA 4BMEA 1H30A 4AGRA 4RHV3 2E6VA 1F8VA 1GQGA 1ULDA 4PLMA 1UPSA 3M4FA 1NY72 1XXNA 4IL7A 2YHJA 1AL0G 1RUC2 1O5LA 3LWCA 4YG6A 2Z5WA 4HN1A 1AR61 1Z7S1 5E89A 1UKGA 3WDUA 1VBE1 1RVF3 3B69A 2EF6A 3EBRA 3BOPA 4HN0A 4LE3A 4N43C 4C0BA 4RD7A 5L7OB 5DZGA 3MICA 4YM0A 3H0OA 4UW6A 1H2KA 4FTEA 3TAYA 1S55A 1KS5A 2NZ9A 5FQ0A 5BNNC 3LA2A 4CDQA 3H1MA 5F6LB 3VN4A 3ZN6B 1PHMA 4M00A 2CWSA 1IS4A 2Q4SA 2D40A 4AXOA 2IFWA 4CEWA 3INAA 3UKVA 1RUE1 1GNHA 2A75A 5FRAA 5EYXA 3OBRA 1MS1A 3TN92 1JYCA 1R083 2PHDA 1FMD3 4KWLA 1B09A 1V9U3 2HWD3 2QVSB 4M3CF 3NAPB 3ZYPA 1HW5A 4KL1A 4PDWA 1PZ8A 3VBFC 4LUKA 1S0GA 3B01A 4UW3A 4QMAA 1DGRN 1SCSA 3USSA 3VBHB 1DZQA 1G86A 3AYCA 1U5XA 4WVVA 4YNIA 2ENRA 1Z7S2 1AR62 1GICA 5C4WC 1IKQA 1VBE2 4N53B 2VOWA 1W6MA 1JTZX 1BK1A 2YGMA 4QPIA 2QNKA 4Q4V1 3THTA 1LCLA 2Y26A 4AK3A 1YNAA 2RJKA 2WNEA 4GQ7A 4JC1A 4I3GA 4QT6A 5ABJA 2AUYA 3OJBA 3JQXA 1ASJ1 5EZWA 2WSVA 5LRRA 4AEDA 1AXKA 1LKNA 2GH2A 2A6ZA 3DPRA 1XNBA 1IOAA 5CFDB 3PHMA 2VECA 4A7KA 1RUE2 2PHWA 5FO9B 3AP5A 3FE5A 1REDA 2XH6A 3G7DA 4W65A 3S7IA 3EQEA 4N9IA 1I9RA 5IK5A 4NWWA 2PHTA 4I09A 2GALA 3POWA 1DF0A 3ILNA 1S2BA 2R073 4LO6B 5GZEA 2RS33 2XBO1 3VGIA 1D4M1 2UYBA 3RZZA 1AR83 1LU2A 2Z2SB 3D5OA 1VBD3 3WX5A 4P9JA 2CYFA 1RUJ1 1PO21 2RS13 5JCTA 2D44A 3M8LA 2E9QA 5I8TA 4YG0A 2X8KA 3JBG3 4NR1A 4Q4V2 1ZX5A 4FOYA 4RQPC 3IIAA 3WG2A 1DGWX 1OKQA 2A6VA 1AYM3 2Q1ZB 4IEOA 2XGXA 4ISQA 3MIGA 1JXNA 5T50A 1LOGA 3TWIA 1ASJ2 3WV6A 4F3JA 2IZWA 1ND2A 2CAVA 2QCSB 4CDUB 4H7LA 5JVVA 2GMEA 2XL7A 4Q0PA 4RL7A 2ZKLA 4WV8A 3N35A 4O9GA 1O91A 5FLJA 4P9XA 3RDIA 4Y20A 3MDPA 3K48A 1S0FA 1QXJA 3RQ0A 3ZYJB 1ZM1A 1SLCA 3QOPA 3V0BA 1ZREA 4AW7A 5JOXA 2W52A 4FXGB 4PF5A 2VXRA 1YJLA 3LSEA 5E1RA 3TB0A 1COV3 5FOBB 1AYN1 3RS6A 2XBO2 2W0XA 1D4M2 3MF9A 2VY0A 3AYAA 4Q4W3 4BOWA 4C0HA 1WLTA 4RS5A 3RSJA 1RUJ2 1PO22 4O9EA 2WNUB 3VHPA 4QQPA 2ZMNA 3K51A 1DBNA 2XPJA 1CVNA 4AVAA 2BFUL 5KHIA 4Q4X2 5BNQA 4E2GA 1AVBA 3ZXKA 5AVAA 3ST7A 1TME1 1RUI1 1ZBA1 3AM2A 4TYSA 2R061 3SISA 1ZBE1 4CTEA 4XF3A 4AEMA 2WC2A 2RM21 4AI0A 2B46X 3E5UA 4QGNA 2HWB1 1NLSA 1CAXA 3GNEA 3UK9A 4EN8B 3ZN6A 4FXKB 3CNAA 2DV9A 4BH9A 5FMOS 4FSJA 4AGGA 4LULA 2AGSA 1KDMA 3ILRA 3MW2A 1VRH3 1QJY3 2JD4A 3CEWA 2BGCA 4INDA 1J1LA 1MQTC 3M3CA 2QKDA 4IESA 1DDLA 2A6WA 3CL1A 2C9AA 1O7FA 2AREA 3M3OA 3NAPA 5H9PA 3WDXA 4BZ4A 1AYN2 2ZGKA 1I5ZA 1KJRA 5EJ3A 1VIWB 4XHBA 4AG4A 2O8QA 3AKSA 4GB31 5D8AC 2Z42A 4K1YA 1KITA 3ZXDA 4YM2A 1VBB1 4XZPA 5DDJ1 3ES1A 3GYDA 3N7JA 2ATFA 1MZ5A 4FPOB 2D3SA 2R1BA 3FHIB 1TME2 1RUI2 1ZBA2 2LTNA 2V5YA 1CQ9A 4QPGC 2R062 1ZBE2 4ONUA 3OGJA 2JKBA 1YYNA 3M3EA 4IEWA 1BVVA 4B4RA 2HWB2 3AX4A 1TE1B 4LNVA 5JDBA 1AR91 1DU3D 1JW6A 2GH8A 3AMHA 3CO2A 5CFDA 2YROA 4P9IA 4CRQA 2P37A 4K20A 4L11A 4DOUA 2HWF3 3H7YA 3WP3A 4FVVA 5BNNB 4IEQA 1LULA 4LHKA 2P34A 1SLBA 3CJXA 3OGGA 4BWOA 4R9AA 3D0SA 3DL3A 3SNMA 1QHDA 5E8AA 2WQ4A 5B2GB 1KDKA 1I3HA 1RUF2 5I0SA 2JICA 3PJQA 1IS6A 4DXZA 2WFF3 1RUD1 4MXWB 1NCRB 1RUH1 2A6XA 2EAKA 4GB32 1D2QA 1VBB2 3UJQA 5DDJ2 3NV4A 2NM1A 3S7EA 2D6PA 1YFYA 3VBRB 1DLLA 3OYWB 5EYYA 3MW3A 4Q4Y1 1EV13 2QQPA 1G7YA 4ZU5A 1BMV1 3PVOA 1NQDA 4JVAA 5DG2A 4AVCA 5I91A 4KWJA 3O14A 5C4WB 1HRV3 2PA7A 1VBC3 1AR92 3KSCA 5A3LA 4FOQA 2BW8A 5JSOA 2ZCWA 5CIRA 2JDZA 3FBYA 1ULCA 4CP0A 3O0WA 4RR3C 1Q8SA 4HK9A 1PVC3 1WCKA 1JYIA 2D3RA 3FJSA 1Q8QA 3O12A 1BCXA 1Q43A 1LGCA 1GZ9A 1LR5A 1RUD2 1NE4A 1RUH2 3L2YA 1VBA1 1O4TA 2I2SA 4X6RB 2VVDA 4P5HA 2WNUA 1UZZA 1K5MA 3OPZA 5KBFA 4QM9A 5IK4A 3R0RA 4Q4Y2 3VUOA 2HKXA 2D6NA 2YMZA 4BLJA 1MVQA 3E5QA 3PJYA 3AKQA 4HBNA 5KXDA 1LU1A 4TLFA 4RQPB 4BYYA 5T3NA 5L73A 1SDWA 4GWMA 1WD3A 1POV1 1DIWA 3URFA 4FPJA 2A3XA 2GAUA 3VBSB 2X5IB 3E97A 3RYKA 3R6SA 4XBNA 1BEV3 3BTAA 4RFT0 1U12A 3RPQA 4I01A 2AZ5A 1UF2C 3ETQA 3MIBA 5LEKA 2BWAA 1NLRA 4XXAA 3ELNA 3VHRA 2ZHNA 4L92A 3I4IA 1VBA2 4XIOA 4YW3A 1Q3EA 2GNDA 4DRVA 1Z78A 1REFA 3U07A 3UV9A 3AP9A 5T5LA 4P9YA 4NHLA 1FV3A 4DS0A 3GHNA 5GZDA 2HWC2 3VZMA 4FAHA 1PK6C 3IDCB 1DGRA 2MEV1 1ENXA 3WQ7A 3WP4A 4XFFA 4EN9B 4A3XA 2HEWF 4KU7A 2XJTA 4PIYA 4YRDA 4N43A 4JDOA 1PO12 1GR3A 1WMDA 3WCSA 4B4QA 5JOYA 1SBEA 2XVGA 1C8M1 2FMDA 3LKJA 4IETA 1FXZA 3PVEA 5KHGA 3IM0A 4ORFA 1PZ7A 3IN9A 2ZMKA 4YZ1A 2HWE1 3O0XA 5BNOC 1H8TB 1HQLA 2PTMA 4EROA 4XFCA 2IXIA 5BNNA 2NPIA 1DGLA 4MGIE 3E6BA 2XVLA 3RG0A 5DUVA 2ZGSA 3TNQA 2RMU1 2WWSA 1CIWA 1KFXL 3BCWA 2EXKA 1O4ZA 3UL2A 2HEVF 1AX2A 4JGZB 4XFGA 2V73A 4S2HA 2Q5TA 1R091 4YW5A 1GZCA 1IGOA 4FTSA 1PGSA 5KXCA 2P3KA 2WNVC 4XJUA 1CJPA 1BXHA 3RI8A 5I0UA 3BODA 2DCYA 1OA2A 1QJU1 4LTAA 4QM8A 3VBFA 1WCDJ 5CVRA 2D3PA 1VR3A 3WOGA 3L9JT 3R4DB 3IKWA 3VBUC 2H6BA 4IEYA 4BIFA 4M0NA 2AYHA 4HT1T 1PVXA 2VG9A 4YSFA 2MEV2 5D8AB 2ZMLA 2ZGQA 5FQ0B 5C4WA 3I59B 4CDQB 2PHRA 1C1FA 5GZCA 3AP6A 4KGGA 1C8M2 1RMU1 1WBLA 1XE7A 1ZRRA 2QZ3A 2ZHKA 4A7ZA 4H3WA 4PLNA 1GV9A 4N7IA 2HWE2 4Z1VA 3E6DA 4L97A 4LBMA 4MH0E 1J1TA 1RVF1 2I74A 5AC93 2EIGA 1W6NB 5KWRA 2WQZC 3HIFA 4XEZA 2RMU2 2D6LX 3W9AA 1ZNPA 4IEUA 4UW5A 3BALA 4GULA 4PDWB 1QGLA 1R092 3MIHA 2Y38A 3J26N 3TYJA 3GBGA 2PAEA 1WW4A 4AGVA 5JZGC 3ZN5A 1PIV1 2P3IA 3U4XA 1TNRA 4B8EA 3J9SA 3S0MA 1CPNA 4B7EA 1IZ3A 2P3JA 1D0HA 3ASIA 4YM3A 3BPZA 3AZZA 3ACLA 3WNXA 2HWD1 2OUJA 1YIPA 4K40A 1ONAA 1S1AA 4FOWA 4E4DX 5GLVA 2JG9C 1LRHA 3B7MA 4ZU7A 3HN1A 4XF4A 1NQJA 5CAZA 2OIIA 2DURA 1FPN3 1RMU2 2AENA 4AEDB 4AQ2A 1UIJA 1H4GA 1D2SA 1LJ7A 4RQPA 4S2GA 3TRSB 3AFGA 1AL23 3L2HA 1QJX3 5CADA 1RVF2 1LENA 4GH4C 4E2QA 4CDWC 5IK7A 2WZR1 1U5ZA 1H9PA 4CZSA 2E53A 3N7KA 2R1DA 5SV8A 1EYBA 1SCRA 1K5MC 4AVTA 5C8CC 1QNWA 3BIWE 1HDKA 4J6GA 2BFUS 3ZSEA 1M4WA 2DTYA 4RR3B 4JGYC 3U11A 2ZX3A 1PIV2 2WSUA 4HPKB 1UAIA 4EN7B 4D3WA 2GN7A 2GNBA 2ZX4A 4Z82A 3ZVXA 2R49A 2XJVA 1CAWA 1RUC1 3B93A 3NV2A 1L3JA 2ZGRA 1R082 1YI9A 4QQHA 4XF1A