2WNVA

Complex between c1q globular heads and deoxyribose
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
131
Chain Sequence
QPRPAFSAIRRNPPGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
molecule tags Immune system
total genus 29
structure length 131
sequence length 133
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnvA00
1GR3A 4RSUA 2AZ5A 1JH5A 4G3YC 4D7YA 3URFA 2JG9B 4NN0A 5CIRA 1PK6B 2TUNA 2JG9C 2RJKA 4F3JA 2JG8B 3QD6A 3AB0A 1D0GA 4MXWA 1A8MA 1KXGA 3IT8A 1KD7A 1TNFA 2RJLA 2R6QA 3TYJA 2R30A 2Q8OA 3K48A 1S55A 5L19A 2HEWF 1TNRA 2JG9A 2RE9A 1O91A 2KA3A 1ALYA 1PK6A 4E4DX 1XU1A 4QQHA 2JG8A 4J6GA 5KWRA 3WD5A 2HEVF 1JTZX 2ZPXA 1XU2A 1OQDA 3FC0A 4EN0A 3MI8A 3L9JT 5TSWA 2ZJCA 2WNUB 4DB5A 5BNQA 5HBAA 4QQLA 2TNFA 2WNUC 4HT1T 2WNVC 3ME2A 4DOUA 4KGQA 5KC6A 4QQPA 4N90A 4QQ2A 1D2QA 4G4FA 3LKJA 2R32A 3QBQA 4QQOA 3TWIA 4MSVA 3B9IA 3K51A 1U5XA 4QPYA 3V56A 4OULA 4MXWB 4KG8A 1OQEA 2X29A 4TSVA 1I9RA 1D4VB 5KC5A 2WNUA 2OIIA 1OSGA 1RJ8A 1U5ZA 4KGGA 1RJ7A 2WNVB 1C28A 2QDNA 3B94A 4OUMA 1U5YA 1DG6A 3B93A 4GIQA 2HEYF 2E7AA 1C3HA 3ALQA 1PK6C 4MXVA 2JG8C 4TWTA 2Q1MA 2O0OA 1WCKA 4E4SA 2QE3A 5L36A 1DU3D 2WNVA 4OUSA 2Z5WA 1IQAA
chains in the Genus database with same CATH superfamily
3LD8A 3BYWA 3H8RA 1C8M1 5EIYB 4XC9A 3I59B 3PUAA 2X5IC 2HJIA 3ZYGA 2NLRA 2QQLA 4IEPA 3WG4A 4QPIB 1G9DA 2ZX3A 2PLV3 5FMOS 5A32B 2DVFA 4BA6A 3MGUA 2NPIA 3VZNA 4EN9B 3V0BB 2I74A 4DMIA 3BVCA 3ZKYA 1UF2C 4P9GA 5LEKA 4O61A 2RS52 2WA4A 3ZSMA 5IVYA 1AZDA 4MXWA 3WZ1A 2DVDA 4Q8LA 1T6BX 3I3DA 2V4AA 2AENA 2RR13 3R4DB 1RUC3 3A4UA 4XF9A 3WQ0A 1POV0 4CE8A 4JGZA 5HCAA 5F3IA 1Q5OA 4N43C 2R7EB 5AFEA 3WDTA 1HRI3 1UN1A 4O9GA 1QKQA 2XVGA 5FWJA 4GQ7A 1C8NA 3AC0A 3J7HA 1UY0A 3HR9A 3HQUA 4WBBA 3DECA 2KA3A 1RUJ2 3POWA 1ULEA 4LE4A 4XFAA 2W52A 2VBBA 4HLTA 4C90A 4AEMA 2Q1ZB 5A3MA 1W8WA 4J6GA 2PHTA 4JKMA 3J8F2 1IZ3A 1UYXA 2EXHA 2I2SA 1ND2C 3ZFGC 1JTZX 4FOQA 5IK5A 1OFSA 1N47A 4I0AA 1VBB3 2FDIA 2JIGA 4HMZA 3VBSC 1AR61 1JXNA 2OZ6A 4AR2A 1G9BA 4UFKA 2OZJA 1GBGA 1R1A1 2J1RA 3PUQA 3FUQA 2Y6FA 3J8F1 4NHKA 5FIXA 3FE5A 5JR2A 1DYOA 4LBMA 2NM1A 1OUSA 3HT2A 4OZOA 1SPPA 1QXPA 3B3QE 5E16A 3ZM8A 3AZYA 4TLGA 2VM9A 1LODA 1VRBA 2QQIA 1A78A 2CY6A 1OVSA 1VRH2 1IGOA 4CP9B 1K5MA 5C9AB 3GM8A 1SBFA 3QBQA 1TME2 1YUDA 5JI7A 3SMHA 4CEYB 4E2GA 2FDKA 1UXZA 2UWAA 4HZFA 3VDAA 4M0HA 1SCRA 4KI5M 1SLAA 1OOPA 4AWDA 4Y26A 3OGGA 1DGLA 3T4VA 2D97A 4ORFA 4XUTA 2BPA2 4G9SB 4A44A 4B1MA 1MQTB 5C3QA 2R062 1ULGA 4JHZA 1C57A 5FOBB 1ZRDA 1VRH1 1PVC3 2RMU3 4QPGC 1QJY2 1HLCA 1HRV3 1RUD2 4FPCA 1OI6A 1C28A 5DDJ3 1TME1 5FPUA 3T1MA 1X9PA 5ACA2 1TVGA 1U5YA 1DG6A 2Q8CA 1AR71 1MS9A 1W99A 4QX1A 1IS6A 1DGRN 1TQ5A 3RYKA 4HKLA 1UX7A 4NO4A 1KDMA 1NXMA 2B42B 2JD9A 2IXCA 3NAPA 1ND3A 5J1XA 3OD4A 5CG9A 3ALQA 1G7YA 1YIFA 3MFAA 3UKTA 1IS5A 3ACGA 2XGXA 3QH7A 5KHGA 5FYSA 2EXIA 2J1UA 2UWBA 2VD7A 3USUB 2W3JA 3BU0A 4IEVA 3DEMA 2HWC1 1WCKA 3VBUB 2QFEA 1BHGA 2WNVA 2DUQA 5FZOA 2ZEWA 2YYOA 2ZGKA 4PDWC 4RGKA 4WVMA 3T2TA 2WWJA 3GYDA 5GLVA 5FRAA 4W65A 5HCBA 3SITA 4RQPB 4ARXA 3SEEA 1W2NA 3D3AA 5LBCA 1CAUB 1V6NA 5HPOA 5I0UA 4RFT0 2VTXA 5FZHA 4CCCA 1I5ZA 4CUAA 5GJ6A 3ZIWA 5BNOB 3RRDA 3UJQA 1WW5A 3SH5A 5GKAC 2FCUA 2NMOA 4S2FA 4WM8A 2RS53 1N3QA 2JDZA 1XJAA 4PLOA 4QHOA 4HANA 4UWDA 3RG0A 2P3YA 3A21A 3NV2A 1TNFA 4ZU7A 4UBGA 3TYJA 5IAXA 2R30A 1SACA 2Q8OA 1E5IA 1R1ZA 1Y3TA 3PU8A 3I3MA 2BEOA 2P6CA 2YMZA 2ZZJA 1LECA 3VL8A 4XAEA 1YFUA 3WG3A 4N7UA 1OA3A 1W3XA 1JYWA 3HN3A 2DU1A 5FO8B 3VBOA 3HNBM 3VHRA 1AR63 4I30A 1RUJ3 1NY72 2ZGRA 3HJRA 4IGOA 5I8SA 3ROUA 5IVFA 2F4PA 5JR7B 1W6NA 2D5HA 3KM5A 4YZ3A 1R1A3 3T30A 1GP5A 5FYIA 2RDRA 3J8F3 3PNAA 4EN0A 3ZXKA 2BYVE 5EPAA 1UMZA 3JB8A 2EIBA 3SQOA 4Y3OA 3P1IA 1NY71 4AAXA 3WUDA 5D8AA 2VG9A 4BM8A 3WNXA 1UOBA 2VOKA 3FBMA 1PZ8A 2WZR1 5FPBA 3VD7A 3HNYM 3RVHA 5A1FA 2ZMKA 1NA1C 5DUWA 3JBG1 4YW2A 2GN7A 1DYKA 4YZ4A 3WNNA 5JLVA 1L3JA 4Q4Y1 5JZGC 1W03A 1FOD1 4R9DA 4AE2A 4ITCA 4F83A 1VRH3 3M3IA 3ZDVA 4LBQB 2CAVA 1K3IA 3OOXA 4IV3B 4QPYA 4E27A 3JQXA 1TME3 1GYKA 4MXWB 1J3PA 3BODA 2X29A 5EYXA 4AOCA 4NIGA 4E4ZA 1I9RA 3MICA 5J98B 1CZTA 4ZS2A 2EIEA 1W8UA 2CGNA 5EV7A 1Y43B 4UW3A 4YW6A 5FZFA 1F4AA 2CU5A 3LPFA 2A6WA 4KGGA 2UY8A 2VOVA 4UF0A 5G04L 3WG1A 1DGRA 3LIHA 4D0QA 1RUD3 4AFMA 4XJ8A 4E2SA 3GALA 1KQRA 2E9QA 4IEQA 5K0UC 2HWC3 1A34A 2HEYF 4H14A 5FZDA 4WM7A 1GV9A 1S0IA 2CWSA 4D7TA 2A7AA 2KD7A 3FFQA 3NJYA 4QHZA 3RFRA 4CU6A 4NVPA 2W9XA 4NPMA 1PM4A 4JTNA 2ZKNA 1J1TA 1JMUB 3H50A 3POGA 1YC61 4ZS3A 3M7AA 4HETA 2QDRA 2ID4A 4LA3A 1CAXB 4FI9A 3WF3A 3IMNA 2B5HA 4EJRA 2FDHA 5ABJC 1W8ZA 1GFF2 2AZ5A 2DUPA 3D5OA 2WT0A 1W0NA 3VHNA 1SDWA 4QU1A 1I6XA 3W20A 1G8WA 4OHXA 3ZPYA 3OYWA 2D5FA 1AF9A 2OPWA 5FZLA 2BU9A 3AZZA 2E51A 5F5QA 4FT8A 4QWNA 1GOGA 2GAUA 3T2OA 1XSRA 3HMYA 2G9FA 3ST7A 3ZO0B 3ACHA 4RHV2 4UYBA 1BEV1 1WA6X 4AFBA 5JSPA 1WBFA 1F5FA 2ES3A 1H1IA 4AW7A 2IWGB 1GKBA 3MPPG 2A3WA 4ZONA 3ZN4A 2Z79A 1CQ9A 3IMMA 2GNBA 3ITQA 5LK7B 4HKWA 1XYOA 1MZ5A 3ZN6A 3WCRA 2YHJA 2QVSB 1VMJA 2R1BA 5FUIA 1CD3G 3W5NA 3OUHA 5HXMA 2ET7A 1COV2 3PL0A 2JG9A 1MS5A 3BPSA 4YG0A 4CRQA 3AK0A 4FPLA 4AGVA 1Y9GA 1XU1A 1PX3A 2HKXA 1UYYA 2H6BA 4YLZA 5FYTA 4B4PA 1H8TC 3ZXAC 5KWRA 1EV12 5FO9B 4ZZ8A 4AEDC 2R042 5BNNA 2D98A 3NWKA 2YGLA 3O1SA 1W9TA 1OT5A 3E5XA 4P9IA 4A45A 4Y33A 1UCXA 2EIDA 1FMD1 5BV6A 2ZGQA 1Q3EA 5JSRA 4XBNA 2VVFA 2BQPA 4IGPA 1RINA 2P34A 1P8JA 4UOJA 2VE1A 4FPGA 1FOD3 4CDQC 4NHLA 4ZPIA 2R041 2UU8A 2NZ9A 4LKFA 1V6MA 1QF3A 4UFMA 1LEMA 3E6DA 3ZFFC 1RUF2 4CDXC 3KT1A 4D3WA 1R082 3GZEA 4OHWA 4P9LA 1NLSA 4H7MA 3LOBA 2ATFA 2XJPA 3KS7A 3Q8EA 4FTSA 2XOMA 4XCAA 2UY9A 1UY4A 1JYCA 3OGRA 3Q8AA 4LHKA 4QHBA 2PHLA 3PTRB 4CEYC 1DQ1A 1PNGA 3H9AA 4R9CA 4FTBA 4QXBA 1HJGA 4DY3A 2DFCA 1NT0A 1RJ8A 5JXIA 1H4GA 3GZTB 4P9YA 1CN1A 1UNBA 1GANA 5L7OA 1DYPA 2QDNA 3ZYIB 5CA6A 3MIGA 2HWB1 4XILA 4XJUA 3A0NA 3FHAA 3S30A 3HVDA 3I4IA 4K8RB 1RMU1 4I3PA 2WSVA 4XEZA 4DEQA 4NIDA 4JX0A 4CCMA 4JVAA 5FTTC 1H6YA 5FAXA 5FXZA 4BIOA 3NNMA 1BBT2 5FY8A 1JZ4A 4XIKA 4EN6B 3OGJA 2IXJA 1LHNA 4L92A 1NCRC 1SQ4A 4LLFA 4Z1VA 1AXKA 3J26N 3W9AA 3BUCA 2ZXQA 3N9QA 2LM3A 2JD4A 1XE8A 4Y20B 1MZFA 3E5UA 4O7XA 4MGZE 2HYXA 4FOWA 2R072 3C8XA 3IPVA 4Q27A 1GWKA 4AF9A 2GC0A 5D1IA 1FX5A 4F7ZA 1UPSA 4Y22B 1V6LA 2FZ2A 1UU5A 2D93A 4QXCA 4YVSB 2PA7A 1W06A 1CIYA 5FKBA 3GXUA 2BFUS 2ZEYA 4AXOA 3WG2A 1C4RA 5A33A 1DLCA 1VE0A 1JYVA 1KEXA 1T2XA 3T0AA 3IZOA 2R071 2WO3A 1MS1A 2XWBB 3B9CA 4CUCA 2XQXA 3ACLA 3X29B 2VZSA 1AR91 1OPMA 1KD7A 3TNQA 2AGSA 1VJ2A 4NJ4A 1RUE1 2Q5TA 5G05L 1NE6A 4RA0A 1QOTA 5F1RA 3DL3A 5DG1A 3NNGA 4P00B 2X5IB 1V6JA 2ZGLA 5IT6A 4UF0B 4B4RA 2P17A 1ZZBA 1LU2A 2LS6A 1ZZ9A 2EAKA 4AHWA 4QQHA 2W0XA 1PZ7A 4PCRA 4P9WA 3GJAA 5FP4A 3KSCA 1G6NA 4LKDA 2IZWA 4LITA 1EV13 2QZ2A 4WVVA 1LOFA 2PHUA 4KL1A 4XHBA 2R043 3T2QA 3WSOA 1ZZ7A 3BOWA 3WF4A 2D3RA 3H1YA 3GBFA 3AKPA 3J9SA 5TSWA 4TLFA 2YU1A 4N53A 4W8JA 1JOJA 1VBD1 2MEV1 4K20A 3VZJA 2C4XA 5LCWL 4GMP0 3VKOA 1JZ6A 3K46A 1KFUL 4I3GA 4Z82A 2ZAHA 1UO9A 4GWMA 2VY0A 5DAXA 2HYKA 5CISA 4RR3B 1OA2A 3I3QA 5L9VA 4QQPA 4CCOA 3RMXA 2HLEA 1PGW2 2RM22 3BU7A 1W2AX 5F3GA 3ZFGB 4XF4A 2BOJA 4YM3A 3BTZA 1YYNA 3B9IA 2PHXA 1BCXA 4JDMA 1LGNA 2J1VA 3OG2A 2HWB3 3AZVA 4IV3C 1RMU3 2CNAA 1RB8G 3T2PA 3N9OA 3N7LA 1QH7A 1W6MA 2WS91 3SCGA 1PGW1 4O65A 2ZKLA 2E63A 3I2JA 3CJIA 4AHZA 3ZSJA 1XRUA 4JGZC 5BNPB 1WZXA 2WIIB 2XQRA 3SKVA 3UT0A 4QX3A 2YDEA 3MZHA 5LRRA 2XBO2 4CCDA 3OEBA 4LBOA 2VOXA 2E53A 2RS12 3RPQA 1FNYA 1LNSA 5IUQA 1ODNA 4LBNA 4ZHNA 4Z2WA 2D3SA 1JODA 3U78A 4H55A 1XNDA 4DUXA 5JMOA 1Q56A 1OUXA 2VBPA 2Z2SB 4CCLA 2GNMA 3FLRA 1BBT3 2ZS6B 2WR9A 1W6QA 4Y4RA 5FQ0B 1Z78A 1M06G 1BVP1 1OHFA 3KF3A 5CVRA 3J7LA 4QPGB 5HXVA 1QJEA 5DZGA 1AX0A 2WA3A 5IVJA 1ZRCA 1RXFA 2WAAA 1PVXA 4KH9A 1Z7S1 2R073 1GR3A 1DIWA 2ILMA 1D7PM 3B69A 3S7IA 2FDGA 4XUOA 3VDDB 3AJYA 4G3YC 1HB1A 1AR93 3MIDA 4IERA 4PT6A 4AI3A 1LTEA 1YXWA 4LLOA 5FZ7A 3S0MA 4MHRA 1RUE3 2Y0OA 4ZU4A 4ISRA 4EZHA 5LZ6A 1D0HA 2W2IA 3VBHA 2VMCA 2JDPA 4BQWA 4QXKA 1QJFA 2R49A 1S2KA 1K5MC 2D6LX 2D6NA 4LUMA 4LK7A 1JZ5A 2W08A 3A22A 5EHDA 4IW3A 1I1EA 1UU6A 1F8VA 5FWEA 2WBKA 4XACA 3W59A 4PDWB 1V6IA 4RN5A 4XABA 4MH0E 4XDQA 1S55A 3K77A 3EBRA 3OGSA 1IHMA 3CEWA 2IUWA 3ES4A 2RE9A 2DCZA 3VZMA 2C1FA 5FZ6A 4JTOA 1LHOA 1O8SA 5DG2A 4UXAA 4CZSA 2JG8A 4BZ4A 4JDNA 2MEV3 2ZGSA 5GZDA 2WRAA 2C9AA 4FTEA 1XU2A 1W2UA 1XBFA 3VKLA 4X6RB 1ND3C 2QZ3A 2Q0AA 4XFBA 4P5HA 2WQ8A 1DQ6A 5A7WA 4AG4A 3DF0A 2UURA 2WZPP 2ZJCA 1CGPA 1JOPA 3IIIA 3NL1A 1J3QA 1LHUA 3JUUA 5IATA 1H9WA 1KJRA 1CJPA 3H7JA 3I54A 4HT1T 3SCHA 2WNVC 3MIBA 4IEXA 4M3CA 4Z92B 3CKHA 3CU7A 4K1YA 4Y4YA 1AYM1 2R0FA 5L9BA 1H6XA 1WCUA 1R091 2XXZA 4NWWA 1J1LA 2E31A 3LKJA 3E6CC 1H2NA 2VMGA 3LDRA 1YFXA 4QQOA 2WS93 4J1WA 2RM23 5C4WA 1NCQA 2LRPA 4R8HA 1WMXA 3PIJA 4XMIA 1VBB2 3ZXFA 3M2MA 4RS5A 5GALA 3J7MA 5AC91 1JI6A 1H8VA 3KQ4B 2ZGPA 1UYPA 4ET7A 4WM8C 1VAVA 5F3EA 5KHIA 3WVJA 4AQ6A 3N7JA 3RJ2X 1LOAA 1RUG2 2JDKA 1NOVA 1ZREA 2GZWA 1EPWA 2KXLA 4FFFA 3ZFEA 5A3UA 2VUAA 1UWWA 3KWVA 3UJOA 3HIFA 3WXPA 2XBO3 3N9PA 3WHUA 1CAWA 3MLJA 1CAVB 4DY5A 2RS13 3DKQA 2RS31 1FXZA 4QB2A 4XBLA 3ZVXA 3ZYRA 4AHXA 4XZUG 3VBOC 2ADEA 1Z7S3 3B5LB 4LUKA 1RUH1 1VB4A 3ORJA 4Q1PA 5GLZA 5FR3A 4X6QB 1O3TA 3L2YA 4AEKA 4UT5A 3WDYA 1RIRA 4FXKB 4QMAA 3BOPA 4OZXA 1YQ6A 1VBE1 2G9GA 1PVC2 2RMU2 5FY1A 1H9PA 2GN3A 1VAMA 4MUVA 3N7MA 4NR1A 3RDIA 3IDAA 5CBLA 4MZUA 1UY2A 1GP4A 1HDKA 3OUIA 4ZU5A 3RZHA 2Q30A 4XF3A 3BCWA 1JYIA 2W91A 4FSJA 2XJTA 2Y34A 5D8AC 2W39A 3EQEA 3OJBA 4NWVA 2Y60A 4YVSC 4ZY9A 4C8DA 2ARAA 4DXRA 1ULPA 1SCSA 4TTGA 2RJKA 5GZEA 1S0CA 2Y6HA 2WO7A 4QPWA 3AYAA 1C8M2 3M70A 1F31A 3SISA 5FK7A 1JUIA 1G86A 1Q8QA 2B9VA 2FZ1A 2RJLA 3VN4A 3POYA 1ODMA 3ZYJB 1UU4A 1POV3 2W5FA 3VBFA 4IUGA 2WNEA 4GALA 4CCJA 4PBPA 3AVSA 2ZCWA 1YQ8A 4META 3T1LA 5K4LA 2J22A 3CJXA 3OY8A 2GH2A 5FZAA 1ALYA 1PK6A 2RDSA 2JE9A 2ZZQA 3WY6A 4LXLA 1LU1A 1M4WA 3M4FA 3VKFC 1FV3A 4QB6A 2XH6A 1BKZA 1REFA 4Q5OA 2B7YA 2VQAA 4LO6B 3TN92 4SLIA 3SNMA 1YQ5A 3MDPA 4YGBA 3KV5A 4AGRA 4WM7C 3SC7X 1Y9MA 3KLSA 3IBMA 1CZVA 4LORA 3MV11 4HSLA 3Q8CA 2EALA 4LOSA 1R093 2ORZA 2WNUB 2C5DA 3K4AA 4HL0A 3PDQA 1K12A 3VHPA 2QNKA 5J96B 4QQLA 3ECQA 4YZ1A 4XDOA 1CX4A 3TN91 4LBJA 2X10A 4KGQA 3VBRA 1H8TB 4ONUA 1AR62 4RYDA 5AC93 4RR3C 4UW6A 4I0WB 1ACCA 4KMQA 4AEDB 4AI0A 2BBVA 1G9AA 1R1A2 2G19A 3IDEA 4MGIE 4MSVA 3VBHB 3RZGA 2IXHA 1LOEA 3PU3A 4CEWB 1OQEA 3POBA 4TSVA 3IM0A 4YFZA 5I0DA 1ULFA 1ZYBA 1W39A 2RJ2A 3R4SA 4R4ZA 4D6RA 5KC5A 1LOGA 1US3A 1LB2A 3FBYA 1DP0A 4PF5A 5JAXA 2VMHA 4YVWA 1W6PB 4CDQB 2JDHA 4LIVA 3UL2A 1OLME 5FFOC 1ULDA 2PXJA 2RS33 2BGOA 3DGTA 1OKOA 4A7KA 1RUG3 1ZBA2 3JB4C 3NV3A 3R0RA 3ZFFB 4CDXB 1RUH3 3GCWA 5LK5A 3HNMA 5FZGA 4AQ2A 1VBE3 1NQJA 2E7AA 5EJZB 5C5TA 4AFCA 2BNMA 1NLRA 3RQ0A 1BVVA 2VQUA 4EV0A 1AR72 4BK5A 2WUHA 3ZDSA 1ZBA1 1H1AA 4YW4A 5BNNC 5C6CA 4NIAA 2CWMA 3M3OA 2D43A 4QDSA 1RHI1 2YGMA 4Q0QA 5T5OA 4OYUA 1EUTA 4XOGA 4O9EA 4QX5A 3AKQA 5F32A 4XUQA 1OLQA 3AMPA 4BQ5A 4COZA 5FYVA 4I2OA 2HWC2 2XJRA 2DVAA 5A3PA 2BNNA 1C1FA 4FQ4A 3UETA 3VDDC 5LA2A 5LEJA 4LPLA 3POSA 3GZAA 3PJQA 4GWJA 3O0XA 1NCRB 1OA4A 1JZ3A 1BXHA 5F7UA 4AVBA 1GZWB 5EXOA 2GC1A 1CPNA 3ZYPA 5FP8A 5D2AA 4FQZA 3IKWA 2W95A 1C8M3 1XNKA 2YY1A 4N9IA 5FZ0A 2VW1A 3PLQA 1VPHA 4HPKB 4IE4A 1L7LA 4BYYA 4MYEA 5CFCA 3DPRB 3D0JA 3LEGA 3OBTA 4DEVA 2QQOA 3NNFA 3DCQA 5L19A 1QNYA 1FV2A 4LBLA 1QMJA 2VECA 2BP6A 4JQRA 3SLIA 1NYWA 1T6GC 4FPEA 3VL9A 4OHVA 5E88A 2XHKA 4QX2A 1SMVA 4PI2A 1V70A 5L7OC 4L8QA 4CDWB 2CHHA 1A3KA 2IVIB 5L73A 5GLWA 2D6OX 2VXRA 3KVAA 4XVHA 1GLHA 2HEVF 4P9XA 4MOAA 4AL9A 4W4ZA 5JOYA 1LAJA 3DXUA 1SFNA 5A6YA 3MUY1 3MW2A 3L9JT 3TN93 1QU0A 1XYNA 1IQDC 5FXVA 5ANNA 4WZCA 1HIXA 3LCPA 2W87A 3U07A 4M4PA 5J37A 3DYMA 1QIQA 3LEMA 4NE9A 3OB8A 4HVRA 2ZABA 3ZXJA 3N3HA 5HBAA 4XQDA 2ADDA 5FJHA 3ME2A 4COVA 2OX0A 4OMCA 3ACIA 2X53S 5JXGA 4KNCA 4BMBA 4GH4A 3H42B 5IK7A 4GXLA 4M3CE 4QDQA 1STMA 5IK8A 1AHSA 4XFFA 2NYYA 4Y1UA 5LASA 1O7FA 2WZR2 3NSTA 3NJVA 4KG8A 3H3UA 1QDCA 5F2WA 5A6ZA 3AL5A 1YI9A 4AAPA 3JBG2 1BYHA 2EICA 4QB1A 5CADA 4Q4Y2 2ZMLA 2IXLA 1FOD2 2NMNA 1JOBA 1DQ2A 3GHMA 5JIAA 1ZBE1 2AREA 3LA7A 1QGLA 1PO11 1QJZA 3B01A 3VKNA 2QJVA 1N1YA 4GIQA 1ZBA3 3K3OA 2AUYA 2IFRA 1X9TA 4Y1ZA 2FBEA 1DQ4A 1TMF1 3KHCA 4N9HA 2Y6GA 2VULA 2ZAAA 5FZKA 1C3HA 1RHI3 4FP3A 1JN2P 5FBJA 2OW4A 4QX8A 5GZCA 2VC9A 3S57A 1DZRA 5A3OA 5C7GA 4MXVA 4PLNA 5A6QA 3EMRA 4YW3A 3PUHA 3LEKA 1JYXA 3H8OA 5JI9A 2RVAA 2DCYA 2JDAA 4QKBA 3FUOA 1UOGA 5LW9A 1AR73 2O0OA 2BFUL 5LBEA 4A7YA 2B9UA 1LOFC 2Y33A 4PIZA 3VDCA 3IWZA 3WW4A 2PFWA 3I2IA 2E32A 4HONA 4JGZB 3O1MA 5FCCA 1UOJA 4BIFA 2GP3A 4N53C 4CUBA 1AJOA 4J1XA 2DVBA 1JH5A 2BVBA 2G4IA 5JIUA 3IB3A 3MV01 2ZHKA 2VO5A 2CV6A 2W46A 5FZEA 2NN8A 3VDBA 3WW2A 1Z0HA 4L11A 1HXS1 2TUNA 3WNPA 1YIPA 1W8HA 4WV8A 4W6WA 5IFPA 2OXBA 4FOYA 4AI9A 3FFZA 3MF6A 2Y6LA 2WN3A 5F2SA 1SLLA 4M01A 3PMEA 5CFDA 3WDWA 5KXDA 3R05A 3H3ZA 3O0WA 5FYZA 1XPWA 3K48A 2QUOA 3L2HA 4M0NA 2VMEA 1IKPA 1BEV2 3U0ZA 3CMGA 1PNFA 4DRVA 1D2SA 3GNEA 3TEYA 1O91A 3H1WA 2PHRA 3CJIC 3IAQA 2MHFA 1O4TA 2DTWA 2AH2A 1SPPB 2ZGTA 1DGWX 1D4M2 4XETA 4ATFA 1K5MB 1LKNA 3MFCA 4BQ1A 4CXXA 4DIQA 1KJLA 3ZXEA 4I01A 4YWAA 4N43A 3UK9A 1PMJX 3MO4A 3MI8A 4AVCA 1AJKA 1OOPB 4Y5SA 3E97A 1G9CA 2LUWA 2YROA 2DURA 4CVUA 1V9U1 4NMIA 3THCA 2VUCA 1KS5A 4DB5A 1D4M1 2XKOA 4LO7A 4YNIA 4Q4X1 3PJYA 3QOPA 1GQHA 4FPFA 1BMV2 5FLIA 3BTAA 5F37A 2WNUC 5CYYA 1VBC1 1XB9A 2OS2A 1FMD2 1ND2A 5FZIA 3DV8A 4A7ZA 5FBZA 4DXTA 1KITA 5KHJA 1Q43A 3JD71 2VPVA 4ARYA 4CP1A 2VOTA 4XMAA 3RNSA 2B8MA 4GMP1 4KWUA 2BOIA 3VBSA 1YWKA 3NAPB 4OI1A 1RUI1 1GZTA 1LOBA 1ND3B 1GWMA 1H0BA 1U5XA 1ZBE3 2VVDA 1X8MA 4K3UA 4M3CF 4X8PA 1BMV1 2PTMA 4BWOA 4KBBA 3VBHC 1O5LA 1PO13 1N1VA 1LHWA 1YHFA 1OLRA 1UZWA 2ORXA 2WZR3 2ZX2A 3AFGA 3I2HA 3LEIA 4QKNA 3UKNA 2JDUA 3JBG3 2XVKA 1AR81 4QGNA 2V73A 3FN9A 4Q4Y3 2WNVB 5FZOB 4LMFA 1SFPA 3MPBA 4CCEA 2XMLA 1W2OA 3O1VA 1AL21 3AYCA 4LO4B 4WVMB 4XQWA 4EN7B 1O4ZA 1OF3A 1YQCA 2VGDA 5FV3A 1JHJA 1GSLA 1AL0G 4I02A 2PHWA 1W9SA 2DVGA 5FYCA 3RMYA 4QX7A 3O12A 1QJX2 2CL2A 2HWB2 3FLPA 2JG8C 1RMU2 3CZJA 1Y4WA 5CAZA 4WM8B 3KVBA 2QQVA 1IS3A 1HB2A 3CIHA 2Z4FA 2QE3A 4L99A 4BCUA 1UYZA 1HXS3 3S5AA 2Z5WA 2CGPA 3FJSA 5FZ1A 2YUEA 3KD4A 5GLTA 2VTFA 2X09A 5JCTA 4HXCA 3BTXA 1QJX1 5FOJB 4Y24A 3WQ7A 2H6CA 2PN5A 3J7NA 4XCBA 2RDQA 1UIKA 5JMCA 4P9JA 4AI8A 1UPIA 3SEPA 1LGBA 3VBOB 2F6BA 2WWUA 4A4AA 2R16A 2JENA 2A3XA 4QDRA 5FP3A 5FLHA 4XDPA 4QGLA 1ENQA 1W6NB 2A75A 3UNPA 3OPTA 3E6BA 3SH4A 2HWD1 4AQTA 2VZTA 5C4WC 5J36A 1NCQC 3I2FA 2JDNA 1XNBA 2R6QA 5LA0A 2C6SA 1MS8A 2QQMA 5JXHA 4LOTA 3HD8B 2E26A 1F5JA 4NRMA 4XF1A 2K2SA 4URTA 1DLLA 4EROA 4OI0A 3DPRC 2EXJA 5A7SA 3WHTA 3K4ZA 4Q4V1 3EYPA 1Y7BA 1AR92 2VCCA 4EYUA 5JSOA 5D8AB 4ATEA 3AYEA 1BEV3 4B3NA 5DQ0A 4LO5B 1F4HA 4XTMA 4DXZA 4XQ4A 2EIGA 1IS4A 3I8TA 1RUE2 4BQ3A 4NAMA 2UWCA 5FUPA 4MADA 3ZFEC 4GKYA 1W6OA 3VD9A 5KXCA 4CDWC 2DCJA 1D4M3 2BRTA 3WR0A 2ZPXA 4Q4X3 2C9KA 2XONA 3CNAA 3I3EA 3LF7A 4HOOA 2PQSA 4QKDA 1QJU1 4LO8A 4OFGA 4XURA 3WQ1A 1HV0A 2P1BA 1AXZA 3VZKA 1ZZ8A 4YYOA 4A6SA 3AX4A 4WVWA 1MS3A 1O6UA 1OVPA 2YB7A 2E7TA 2NP0A 5T3NA 3ZPOA 1I5PA 2JEMA 3V65A 4BHPA 2ZX1A 1PIV1 3B02A 4GMP3 3TEZA 4KG0A 2HBTA 4KU8A 1EAH2 2J7MA 3ZR5A 4BQXA 1IPSA 5FZMA 1WW4A 4LIUA 3DUIA 4OVEA 1CIWA 4CSWA 1VBD2 2MEV2 1FMD3 3VUOA 1H2KA 4BH9A 1IPKA 1RC6A 3N9NA 3JU9A 2WJSA 4QM9A 5LB6A 5F8PA 5CKMA 4WM7B 5H9RA 3M3CA 2CDOA 2YBPA 3WLUA 3ZKUA 4CXYA 1SZBA 5C8CA 2FDFA 1E5HA 1AL23 2HWF1 1EAH1 3AZXA 3RWKX 2A1XA 1RGSA 1LHVA 2BV4A 2JE8A 2JX9A 5CFDB 5GZGA 4LKSA 1NA1A 3BIWE 3THTA 1BZWA 1GZCA 4U36A 4D7SA 4GB31 2ZMNA 3ABZA 5JZGA 1WCDJ 2Q4SA 2WO1A 1TZOA 3MYXA 4Q4W1 3VBFC 1JU3A 1FNZA 3WP6A 1ZM1A 4LR4A 2WS92 3OYWB 1PO21 4DUVA 5BYNA 4K8FA 1PK6C 1E5RA 3F2ZA 2GC3A 3KT4A 3NJZA 2Q8EA 3WNMA 5FMDA 1QJX3 4FFGA 2PELA 1OLMA 1QQP1 5DZFA 4JGYA 2KR2A 3U1XA 3THDA 5DAQA 4Q8KA 4IEWA 1FT9A 3VZLA 3WP5A 5FPXA 1A6CA 3GBWA 1HB3A 4JQTA 3ZN6B 4XYXA 5K0UA 1Q8PA 1ZRFA 4JRLA 2VH9A 4M4RA 1MEC1 1JS9A 1ASJ1 3KZ4C 4AFDA 3H8UA 2HWD3 3ZIXA 2JG9B 2JKBA 2A3YA 2V5DA 2B39A 1OC1A 1YO8A 5AVPA 3WNKA 4DQAA 4QU2A 3WT3A 4AHYA 2E33A 3CQOA 1LOCA 3LZZA 5B2GB 3B00A 1Z7S2 1O3QA 3AXEA 2ZGMA 3RZLA 1LCLA 4LHNA 2CDPA 2FD8A 5BNNB 1A8MA 1W3VA 4PQQA 1PMIA 4Q4V3 5EWSA 1XXNA 1DFQA 1SHWB 3IT8A 4KWLA 3TB0A 2RDNA 5ABJA 3OCPA 3FMGA 4UFHA 2CYFA 2JXAA 5FMOL 5FZ4A 4W50A 3D82A 2VNGA 1N1TA 3I59A 3U75A 2G1MA 3RSJA 2XLFA 4E4HA 3V0AA 1X50A 2ZA9A 4QPIA 5A32A 5F6LB 1G9FA 2DWRA 3WNOA 1QJU3 2ZOEB 2DCTA 3PURA 3V0BA 2BWCA 4JHTA 1OH3A 1AVBA 2UYAA 3OBRA 4YGDA 1SLIA 3OD0A 3PUIA 3LIGA 1ULCA 3N7KA 1SLTA 4JDOA 5FZ8A 5F9TA 2W47A 2V4VA 3RZZA 4EQVA 3IN9A 4PBOA 3APBA 3N9LA 4D6SA 2CTVA 4K1ZA 5FZBA 2WL1A 4CYDA 1OOPC 2P4EA 1ZNPA 2GU9A 1CESA 2EVXA 3ZYHA 1PGSA 4LTAA 3Q8FA 5F3CA 3ILRA 4XTPA 1YRZA 3ZOIA 2WZEA 4BQ2A 4F8AA 5L7OB 1BJQA 3M8LA 2ZBJA 3KV4A 3ZYBA 1KS4A 1W9YA 2A71A 2JWPA 4YG3A 5E1RA 5KXBA 1EAH3 1XNTA 1S4CA 3HPNA 3EJKA 4BMEA 4DINB 4DZGA 1XNAA 2K0GA 4PI0A 5FYYA 4NIHA 2PHFA 1HV1A 3AJZA 1VBD3 4JAAA 4S2GA 1FPN1 4CDUA 1GZ9A 5GZFA 5LY1A 5JPNB 4K40A 4GB33 2WT2A 2ARBA 3NAPC 4MGQA 1AYM2 1W28A 4XJ9A 1FATA 1R092 2D40A 5IK4A 3ETPA 2ZHMA 2Y26A 4CEWC 4RGGA 1HW5A 3OUJA 3KCXA 5IVBA 3G7DA 1LJ7A 3P3NA 5FPZA 4Q0UA 5T5JA 3RYPA 5CFCC 1YJLA 3IPVB 5A3WA 4EE2A 3AKSA 2OQ7A 4NHYA 4D6QA 2ZX0A 2LROA 5AC92 4CP9A 1YJKA 2ZEXA 3NJXA 4DUWA 5C9AA 5ISLA 5JOXA 1GNHA 2DUOA 2ZGUA 1QQP3 2VZQA 4EWAA 4CEYA 5A33B 2E6VA 3OF1A 3ZR6A 3W58A 4P14A 1GUIA 4A2UA 5HCHA 4Y1VA 4IGQA 4IQPA 2PLV1 4RL7A 1MEC3 4YM0A 1ASJ3 1JZ8A 1MQTA 3AP9A 2FMYA 1WMDA 2W1QA 4GJZA 1NZCA 2DBIA 4B7EA 4OUSA 4MLOA 2RS32 2Y8KA 4IEOA 1X33A 1DBNA 2PHDA 3WQBA 3FX3A 4BB3A 1RUH2 2RR11 3MLKA 3JZVA 1LULA 1ZA4A 3BB6A 3KCYA 4IE5A 4KBZA 4ES8A 4EN8B 4LE3A 3KMHA 1WKYA 5DAVA 4LHLA 1VBE2 1XC6A 1HRI1 4TYSA 3GZUC 3NKGA 1MPXA 3D8CA 3RI9A 3S6PA 1PGL1 1XQNA 2WLPA 3QD6A 3VGIA 4GH4C 3GDBA 2YBKA 1CVNA 3USUA 1D0GA 2IC1A 5CKQA 2ENRA 4AI2A 4BJ0A 1DDLA 1J58A 3VBUA 3N9MA 4DRRA 4FP2A 5H9SA 4JKLA 1EYBA 2BWAA 3H0OA 2VAUA 2A5ZA 2C26A 4N53B 1E5SA 5DUVA 3C2UA 2XJUA 5DZEA 4RQPA 1Y9QA 1APNA 2HEWF 1TNRA 3BTYA 1VAKA 1CAUA 1C1LA 3PVNA 5I0RA 1C5IA 1MVEA 3I7DA 4JKKA 4DO0A 3SCFA 5BNOA 2XHNA 3BN6A 2A70A 3AP6A 1R64A 3MHZA 3WP4A 5A6XA 1UXXX 3CLPA 2FDJA 2VMFA 3KT7A 4FXGB 4XBQA 5FY0A 4AK3A 1NKGA 4CPBD 5CNAA 1N3PA 2EF6A 3V64A 1S0DA 2CGOA 4AQSA 3HOBA 1Q8OA 3DYPA 2P5BA 3VKMA 3WEZA 4GWNA 1HX6A 5EQUA 5FXXA 3PVBB 1YLLA 4HK9A 4WZFA 5BY5A 1F2NA 1RYYA 4OMDA 5SV8A 4YARA 2WQ4A 3KB5A 2Q1FA 1W6MB 3ZMOA 1DGWA 3LDKA 4LULA 5C8WA 4COUA 3CJIB 3LQCA 3SHRA 2ZHLA 4CU8A 4IDZA 2BGCA 3A23A 5K8SA 1VMFA 3NV4A 1X82A 4ASLA 1EUUA 4AVAA 2VJXA 5B4NA 1OQ1A 1D2QA 3AYDA 4COYA 1HRV1 1K5JA 2QTWB 3RI8A 5DDJ1 2RHPA 1WLTA 2D6KA 4JV4A 4Q26A 3HAGA 3TWIA 2E7QA 5HV0A 1YFWA 2VU9A 1OF4A 2VW2A 4EZ4A 1H2LA 4FPOB 3ACFA 2HWE2 3NNJA 4BXFA 5LBBA 1U5IA 1LESA 1W6QB 1LGCA 5FUNA 3LAGA 1AYM3 3ETQA 1LENA 1VIWB 1OFNA 3I2KA 5CFDC 4NIIA 2VZRA 3ZLIA 4YW1A 5BNPC 1XSQA 3AKRA 3V0AB 4YGEA 5CB7A 3KGLA 3HWJA 1MS0A 2HWE1 2FMDA 1RVF1 3ZMNA 5FMCA 4BDVB 4XW3A 3AKTA 3CDZB 1A8DA 2WNOA 4B29A 4LBQD 3AP4A 4LBQA 4ISQA 1DF0A 4IV3A 3EXUA 4LKEA 3ILNA 4FCAA 2WINB 5A80A 1QHDA 3NV1A 1O3SA 1KGYA 2VZ3A 1GOHA 5I8TA 4A42A 1ULOA 2GSYA 1YI7A 4AVSA 4QT6A 2VW0A 3THPA 1ENRA 4V2VA 4NPLA 4PJYA 4E4SA 1VP6A 3VV1A 4QM8A 1UY3A 1PX4A 3KCCA 4QXHA 1V6OA 2RS51 1V6KA 1UZ0A 1LEDA 1PHMA 3T0BA 4NUBA 2JDYA 4IE6A 4DNYA 1UZYA 4Z2AA 4AYUA 1ZRRA 2WDBA 2JB8A 4FPHA 3UGHA 3W5MA 5FDBA 3AMMA 1RHI2 3ENRA 5FY4A 2XR4A 1NQDA 2W92A 2J1SA 2YG0A 5AFBA 1J59A 2JG9C 1OD5A 3D0SA 5M0TA 4F3JA 2BERA 2JG8B 3AB0A 3BALA 1SG3A 3GCXA 3IDBB 4IV1A 4LJHA 3USSA 2ZX4A 3QH6A 4CDUB 3RZKA 1UMHA 4CA9A 4GAZA 1RUJ1 2OYZA 2DTYA 4NOTA 1CAXA 1H1MA 5A7WB 1UL9A 5H9PA 2Q8DA 2ZEZA 3D6EA 3GGLA 4RGAA 4K7JA 3MEPA 4Y1XA 5IJRA 2VR4A 2YC2A 2VZPA 1ZA7A 4JC1A 2BW8A 3RZMA 4Y5TA 5ERLA 4D69A 3LFIA 2D7FA 2YC0A 2OA2A 3A7QA 5T54A 3A0KA 2YU2A 4P02B 4TN7A 5A7PA 4Q29A 4R9AA 5FK8A 3BPZA 5APAA 1QH6A 5FXWA 3I49A 4M3CB 3RWNA 3LE0A 3JQWA 2IFWA 2V5YA 1ZX5A 3GBGA 3ZN5A 2N7GA 2VUDA 3U11A 5C4WB 2QQKA 1BLZA 2VCBA 1NCQB 1NZIA 1QDOA 1HQWA 2ZHNA 3TNPB 3EO6A 3VLBB 4CU7A 5DN2A 4RS5B 4HN0A 2D3PA 5EFUA 3POJA 2XWJB 2G9ZA 5T52A 4YGCA 5H9QA 1H4HA 4UFJA 5JOZA 2AEYA 4IXLA 2DYCA 1DHKB 2Y6KA 2WT1A 4A3ZA 2LTNA 2DDUA 3EHKA 2LW8A 5KC6A 4R9BA 4Q1RA 2JKXA 4HFSA 4GD4A 5A7NA 4A41A 3NNLA 1B35A 1QWRA 2A6XA 2XB6C 4QQ2A 3U10A 3ZFEB 5KR7A 1JZ7A 1CR7A 2R061 5E8AA 2R32A 1GWLA 1GQPA 3INAA 1ZZ6A 4XE9A 2DCKA 1CAWB 3K75B 1MR5A 1OH4A 3P5BA 2YXSA 5HV4A 3BIEA 1UIJA 1WCQA 1QJY1 1RUD1 2OT7A 3K51A 1OBNA 2K9ZA 4GKXA 2BNOA 4OULA 1W9WA 2AC1A 3WOGA 4CP0A 5ACA1 4N7IA 1O4YA 4MGTA 1WMEA 2WO2A 3CF6E 3FHIB 2HWE3 3O14A 3MUZ1 5ANQA 5JXJA 1RVF3 3ZXLA 2W1UA 4MGKE 5EYYA 4D8MA 1RUOA 3FL7A 4MV2A 3B94A 3S5QA 1CZSA 4ZXEA 5AVAA 4COWA 1SBEA 1UKGA 4XXPA 3QLQA 2VTXJ 4HKOA 5FZ9A 1WGPA 1AX2A 4BU2A 1I3HA 2GP5A 2P6HA 4NPRA 3FWEA 2VUJA 4IE0A 4U2AA 3H1MA 4BLJA 5BUVA 2O14A 1LR5A 1EPZA 4QKFA 2BZDA 1ZBE2 1U12A 2C24A 3C7HA 5I0TA 3UV9A 1X8EA 1WLDA 4FO9A 3OGVA 1PO12 4HG6B 4LHSA 3VZOA 1O8PA 5B4XA 1WLWA 2KM2A 5EJ1B 3PMSA 1REEA 1Q8SA 2J1TA 3E5QA 5IYYA 1TMF2 4N8MA 2VMIA 4BISA 4URAA 2DBNA 4ES9A 5I91A 5E6HA 3AZWA 4JZRA 5JOWA 1IQAA 3LA2A 1LRHA 5EJ3A 4BPZA 4QD2A 3VD5A 1J3RA 2WKKA 4H2AA 5IVEA 3N4MA 2XVLA 4Y5Z0 4B7KA 2IXIA 3PVOA 5CZKA 3VBFB 1WBLA 3CL1A 3O7OA 3WX5A 1VR3A 4D7YA 5KBFA 3OY8B 5JUVA 4ZZ5A 3I3BA 3H3LA 1FYUA 1PK6B 4FFIA 5A3NA 1V0AA 2VZUA 2GMPA 2OVUA 4Y20A 4R4XA 4GULA 2SLIA 4C1XA 3UGGA 1KXGA 1SLCA 1N1SA 1FI2A 1S2EA 3WNLA 4BOWA 1GNYA 3H7YA 3PIGA 1VLNA 4MGSA 1HXS2 1W8OA 2QBXA 1JHNA 3LOIA 5C8CC 5K9YA 4LBKA 4Y22A 4B1LA 3C7GA 4Q0VA 1NAEA 3WDVA 3LB9A 4XJAA 3AP5A 1YCIA 5EZWA 4YVSA 4E8DA 5J48A 2VNOA 1URXA 1JZ2A 1JUHA 4K21A 2VCAA 3K2OA 2BTVC 3OPZA 1VMHA 4INDA 1V00A 3AMHA 3VBRB 2ET1A 4B4QA 4E4DX 4YW7A 5JWPA 3CHXA 1W8FA 2A6YA 4RFRB 3WD5A 1HQNA 1WUVA 2X8KA 2WLQA 1YEWA 4XUNA 5CKNA 3I2OA 4Z07A 1UD1A 1UZZA 5DAWA 2ZACA 4YFWA 3DYOA 5DAPA 5FP9A 2WC2A 5IVCA 1JYTA 3TEWA 2X5IA 2R063 4H7LA 5BNQA 4JGYC 1VALA 4YVWB 1TE1B 5I93A 2K46A 1QJY3 1KDKA 2EAAA 2ZGNA 2B4KA 5ACA3 3FHQA 4PIYA 2D6MA 5DABA 3MLLA 2A6VA 1V9U2 4KWKA 4XIOA 4LT5A 2GDFA 3R4UA 3POFA 4NHXA 5IFTA 3LDBA 1MS4A 5GLUA 4Q4X2 2WN2A 3IIAA 3ZSEA 1RUNA 1JYNA 2QQPA 4IV1B 1VBC2 3K3NA 2CSGA 3UYJA 4FAGA 1BQPA 1OD3A 1MZ6A 3I2DA 2WYFA 3O1OA 4H3WA 3ZYFA 3WINE 1D4VB 1AX1A 2CAUA 2PAEA 2W1WA 3DKWA 2RV9A 4LEJA 3JD72 2OIIA 2A6ZA 3OEAA 1W2TA 2WSUA 1OSGA 4IESA 2DFBA 2W68A 1XOYA 3U4XA 1RUI2 3MW4A 3RGBA 4RR3A 1O59A 2B45X 2JIJA 4KU7A 4W6XA 2QCSB 3IAPA 2EA7A 3ZSKA 5J7MA 1WW6A 2VZ1A 3HQRA 4Q2FA 1FAYA 4K9SA 2A73B 3ZFGA 1SLBA 4L0PA 4QPIC 2ZTNA 1AR82 1ONAA 1NX9A 2J1EA 1GMMA 3K4DA 1RL3A 2J42A 1AL22 3GHNA 1W05A 5FY7A 4V2WA 1MACA 2ARCA 2WAOA 1IG3A 5T5PA 1KRIA 4CP2A 3N35A 2P3KA 2F4LA 1PM7A 1W90A 3MIFA 5CFCB 1TMF3 2L9LA 3QACA 4OUEA 5BNPA 3F95A 2Z42A 5EP9A 1XYPA 1MZEA 5C71A 4AZZA 3TEXA 4LQRA 4MO3M 3DN7A 4RHV1 5FO7B 3WDUA 4RD7A 5A1LA 4IETA 1WA4A 4BLIA 1Q8VA 4XZPA 1GNZA 2AEZA 5F5IA 1WD3A 5CIRA 1B35B 4AFAA 3NKTA 2XUMA 4UW5A 1WW7A 5FPVA 1RXGA 3CBNA 4AVVA 1N3OA 4XJZA 1X7NA 3POIA 1S0JA 4GZ9A 5T50A 3P6BA 4BE3A 3ON7A 5FQ0A 1COV1 4QPGA 1F9KA 4CDUC 2VZOA 1OKQA 3WW1A 3UESA 2TBVA 4YSFA 1EV11 3M3EA 5LWBA 1W9FA 4X8NA 4XFCA 3VDDA 5DXDA 4HK8A 4L2NA 3SXWA 3JCIA 2HWD2 3D4KA 5FY9A 1H30A 5FYBA 2HH9A 2IVJA 3TAYA 1JU4A 2MNGA 2RG4A 3ASIA 1HKDA 2UYBA 4GH4B 3TOJA 1CX1A 2PMWB 3W21A 4CUGA 5C9AC 4XFGA 2JJ6A 2XJSA 3QCWA 4OI2A 4Q4V2 1TEIA 4MG2A 2ARXA 2GC2A 3GF6A 3FC0A 2VXJA 5FPAA 3M1HA 1QEXA 2WWSA 3AM2A 5LBFA 2XPJA 4P08A 3AP7A 1RUF1 4PDWA 4ZXKA 1R081 2DU0A 1SFYA 3I97A 4UI9L 3RJRA 4RS5C 1MQTC 3C3VA 2YFUA 2VZVA 3OBAA 4SBVA 4XHXA 1WMFA 2TNFA 2AYHA 1QJU2 4E9KA 4PQ9A 4DOUA 5DMYA 3C7OA 1HN1A 4GJYA 4AGGA 4A3XA 5FZ3A 4G4FA 2YC4A 3PHMA 2P2KA 1IKQA 2WFF2 5C3OA 1V9U3 3AVRA 1PIV2 4S2HA 5IHRA 1UZVA 3ZXGA 1UX6A 3VHOA 1ZZCA 2EXKA 4ASMB 4IL7A 4EWEA 3PTYA 3RZJA 3NW4A 3OSDA 1VBC3 2DV9A 5FJKA 5FY5A 5DUXA 1POQA 1NE4A 3MIEA 3VBUC 1UQXA 2J1AA 2OUJA 4DS0A 1BBT1 3JD73 1RJ7A 3AFKA 2WFF1 1CJDA 1WWYA 4FPJA 1US2A 4OUMA 4QAWA 2H0VA 3B93A 1RUI3 1W8TA 3HN1A 2P37A 2Y0IA 4PHZA 3HBKA 1CPMA 2HWF2 4RQPC 2JDMA 3WDXA 3ES1A 1AYN2 3LSDA 1GOFA 4TZDA 2GH8A 5BNOC 4L97A 1AR83 3C7EA 4GB32 4L9BA 1REDA 1XNCA 2D6PA 3HEIA 3AMNA 4TWTA 5LA1A 2WFPA 4RHV3 4UW4A 2X05A 4OQ9A 2XLGA 1HJFA 4Q4W2 1O3RA 4HVOA 4UFLA 1PMHX 1HN0A 1QOOA 5I0SA 1ZVFA 1AUYA 1S0EA 5KHKA 1IPJA 4YW5A 5LRSA 1PO22 1AYN1 2W1SA 2YPJA 1ENSA 4FPYA 3ELNA 1UOFA 2Z69A 2PAKA 4XFIA 1QOSA 4E2QA 1QQP2 1COV3 4UAPA 1K42A 2W94A 1CAVA 5FYMA 4IEUA 4NRPA 3NO8A 3LSEA 3P3PA 3RS6A 1B09A 3HQXA 4M00A 5F39A 2Y64A 1MEC2 1O5UA 1ASJ2 4MX3A 1VB2A 4OHZA 4NRQA 5FZCA 2VNRA 5A3LA 2YZ4A 4N43B 4IEZA 5T55A 4BK4A 3TBDA 1DZQA 4FOVA 4QX0A 1BK1A 5C3RA 1UW8A 3WCSA 2XUEA 5J09A 2NQYA 4YZ5A 1E57A 1L7QA 3C7FA 3OTFA 5E89A 3WV6A 4NAOA 2MPFA 2VQ0A 2FCTA 5JPMB 4Q0SA 3G6JB 3VB9A 4HBNA 1U0AA 2R1DA 4Q0PA 1S2BA 3S7EA 3U14A 1NUKA 5IAVA 4KQ7A 1HQLA 1ND2B 1RUF3 1S0FA 1XE0A 1S0BA 5FREA 4OQ8A 1R083 2O1QA 3ATGA 3VBRC 1WCSA 4QGMA 4CU9A 1GP6A 1S0GA 2VBDA 4J25A 3T0DA 3VBSB 1W0PA 3T3YA 1OQDA 4DXSA 2BBAA 1HB4A 2ZGOA 3J4UH 4FVVA 5JVVA 3WF1A 1W8NA 2PYTA 3WUCA 4DPNA 3GJBA 3WW3A 3O0VA 2P3IA 5FPLA 2AACA 2VOWA 4XPVA 2RM21 3U37A 3ZX7A 4MGYE 4XAAA 2YPDA 1VBA2 4CXWA 4FPKA 3SH3A 3R6SA 2OQ6A 4IE7A 5F6KA 4JRAA 3AL6A 2H0BA 4AI1A 2QQJA 3E1F1 2XG3A 1JW6A 4YVWC 1S1AA 3KGZA 1GICA 1YQ2A 3UKVA 4MVTA 1SBDA 3AMQA 3MBWA 5DUUA 1DQ0A 4JCKA 5CU1A 3NVCA 5L9RA 2I07B 1ENXA 2BDRA 1VBA1 3T09A 1H2MA 1IOAA 1OPOA 5LATA 4UBHA 4E8CA 5C3PA 5CG8A 2WFF3 3V56A 3KHBA 2QQUA 2O8QA 5BPXA 1PIV3 5IWFA 3ZSLA 2XBO1 3I2GA 4IV1C 4EWDA 2RS11 3MF9A 2WNUA 1SDDB 3T08A 4GWIA 4DFSA 5K7PA 3O1TA 2FQPA 4I09A 4HVQA 1XE7A 2GMEA 2XDVA 3Q8BA 1DQ5A 1FPN2 1TG7A 4PIXA 1NXD1 2WQZC 4S2DA 1H8TA 2XL9A 5KHHA 4YM2A 2FHRA 1OURA 5KXEA 4AEDA 2YBSA 3BKZA 5HCFA 3SKJE 3OBZA 2HWF3 5A7QA 3H8XA 3PVEA 5FYUA 4D94A 5FKCA 1L7RA 3OPWA 4CEWA 1AYN3 1DZTA 2DF7A 3EB7A 4MHUA 1MVQA 2XKPA 3WF2A 4LA2A 2Q1MA 2BUKA 1EP0A 4CDQA 1W6PA 3O5SA 3LPGA 1IG0A 2V09A 4Q4W3 5L36A 1DU3D 1K45A 1NG0A 1NLQA 4AEJA 5T5LA 3BI3A 4KWJA 2GNDA 2IXKA 3ZFFA 4RSUA 4CDXA 5HI0A 3NRUA 1PO23 3LFMA 4OLLA 4BXSV 5C3SA 2PLV2 2WABA 3HT1A 4P5YA 5C5UA 4BQ4A 5C70A 3O1PA 3TRSB 1QXJA 2PAMA 3CZUA 4XXAA 3URFA 3B7MA 3KV6A 3RYRA 1RITA 3AXDA 4NN0A 1POV1 3T4HB 2ERFA 4HN1A 5A1AA 1YNAA 3IDCB 2VVEA 5F5AA 2GNTA 3VD3A 4XJWA 1B35C 1W6OB 2O8OA 3HBZA 4HSJA 2RR12 3U4SA 3ZXDA 2YV8A 4OCTA 1RUC2 4ZKTB 1BK0A 5I8YA 3ILFA 4AVTA 2XJQA 2XLAA 1HRI2 2TEPA 2AR6A 3MW3A 4Z8BA 1OMIA 1F35A 1UAIA 1PGL2 4YM1A 3PUSA 1YFYA 2LALA 2WYSA 1ST8A 4K6BA 4C0BA 4C0HA 4LK6A 2PQQA 2F17A 4PF1A 1RUC1 4NROA 3NQHA 5FMBA 2I45A 1GQGA 3BGAA 2YFZA 5F5CA 2D44A 1NCRA 5IVVA 5A70A 1F15A 1GZWA 2QQWA 4V1PA 4W6YA 1UKRA 3KQRA 4YZ2A 2C0ZA 3N36A 1W0OA 2B46X 1UY1A 5J3UA 5A7OA 2XJVA 2VL4A 4HPKA 4LNVA 1CWPA 4OHYA 4B8EA 3DPRA 4NHMA 5C8CB 3FZ3A 1SEFA 4FFHA 4BQYA 5FLJA 1ZRIA 2Y6JA 3M3QA 3UGFA 5D21A 1OXCA 3JXSA 1VBA3 5IW0A 1NA1B 4XUPA 2SBAA 4C91A 1VBB1 1J84A 4FBFA 2GALA 2OPKA 5SV5A 4Y1YA 3POEA 4CDWA 5JZGB 4N90A 1CONA 2VCMA 1QY4A 1EY2A 5CEHA 5BXXA 4TXWA 4I0BA 4XFHA 5A3TA 3NMBA 5FYHA 2JECA 3CO2A 4ASKA 1RUG1 2HBUA 2OUHA 1AXYA 3MIHA 5LY2A 4CPBA 4CTEA 3FLTA 4WVZA 2QQNA 2P3JA 5GM0A 5FP7A 2R0HA 3WF0A 4C1WA 4CCKA 5JDBA 2ETEA 4R52A 1QXRA 1DCSA 1UMIA 2BGPA 4A6OA 1HRV2 4JGYB 5DDJ2 2BJSA 1U5ZA 2Y38A 2V72A 2FCVA 5K0UB 2QKDA 1FPN3 1KFXL 5DPNA 3WP3A 1RTVA 2VNVA 2XL7A 4UFIA 1J83A 1JBCA 3LA3A 4CCNA 1PZ9A 4YRDA 1PVC1 2RMU1 1X36A 2WZ8A 4GA9A 5LA9A 4YPJA 3VD4A 2JICA 1GU3A 3O1RA 4XF0A 2VQTA 3Q9OA 3LWCA 3LGRA 2JE7A 4OI4A 2BVVA 4YG6A 3KF5A 3DXTA 2VMDA 2GMMA 3O1UA 1RVF2 2JB4A 3KV9A 4PLMA 2OKXA 1C5HA 1WD4A 1WLCA 4FAHA 5ABJB 4IEYA 1W04A 1QNWA 5C33A
chains in the Genus database with same CATH topology
1C8M1 3I59B 2X5IC 2HJIA 3ZYGA 2NLRA 3WG4A 4IEPA 4QPIB 1G9DA 2ZX3A 2PLV3 5FMOS 5A32B 2DVFA 4BA6A 3MGUA 2NPIA 3VZNA 4EN9B 3V0BB 2I74A 4DMIA 1UF2C 4P9GA 5LEKA 2RS52 2WA4A 3ZSMA 1AZDA 4MXWA 3WZ1A 2DVDA 4Q8LA 2AENA 2RR13 3R4DB 1RUC3 3A4UA 4XF9A 3WQ0A 1POV0 5HCAA 4JGZA 1Q5OA 4N43C 5AFEA 3WDTA 1HRI3 1UN1A 4O9GA 1QKQA 2XVGA 4GQ7A 1C8NA 3HR9A 4WBBA 4LE4A 2KA3A 1RUJ2 3POWA 1ULEA 4XFAA 2W52A 4HLTA 4C90A 4AEMA 2Q1ZB 5A3MA 4J6GA 2PHTA 3J8F2 1IZ3A 2EXHA 2I2SA 1ND2C 3ZFGC 1JTZX 4FOQA 5IK5A 1OFSA 1N47A 4I0AA 1VBB3 4HMZA 3VBSC 1AR61 1JXNA 2OZ6A 1G9BA 2OZJA 1GBGA 1R1A1 3FUQA 3J8F1 4NHKA 3FE5A 4LBMA 5E16A 2NM1A 3HT2A 5BNPC 1QXPA 3B3QE 3AZYA 1LODA 1A78A 2CY6A 1VRH2 1IGOA 1K5MA 5C9AB 1SBFA 3QBQA 1TME2 1YUDA 5JI7A 3SMHA 4CEYB 4E2GA 2UWAA 4HZFA 4M0HA 1SCRA 4AWDA 1SLAA 1OOPA 4Y26A 3OGGA 1DGLA 2D97A 4ORFA 2BPA2 4G9SB 1MQTB 2R062 1ULGA 5FOBB 1C57A 1ZRDA 1VRH1 1PVC3 2RMU3 4QPGC 1QJY2 1HLCA 1HRV3 1RUD2 4FPCA 1OI6A 1C28A 5DDJ3 1TME1 3T1MA 5ACA2 1U5YA 1DG6A 1AR71 1MS9A 1IS6A 1DGRN 1TQ5A 3RYKA 4HKLA 4NO4A 1KDMA 1NXMA 2B42B 2IXCA 3NAPA 1ND3A 3OD4A 5CG9A 3ALQA 1G7YA 1YIFA 3MFAA 3UKTA 1IS5A 2XGXA 3QH7A 5KHGA 2EXIA 2UWBA 3USUB 4IEVA 2HWC1 1WCKA 3VBUB 2QFEA 2WNVA 2DUQA 2YYOA 2ZGKA 4PDWC 4WVMA 3T2TA 3GYDA 5GLVA 5FRAA 4W65A 5HCBA 3SITA 4RQPB 1CAUB 1V6NA 5I0UA 4RFT0 5BNOB 1I5ZA 5GJ6A 3ZIWA 3RRDA 3UJQA 1WW5A 3SH5A 5GKAC 2NMOA 4S2FA 4WM8A 2RS53 1N3QA 2JDZA 4PLOA 4HANA 3RG0A 3NV2A 1TNFA 4ZU7A 4UBGA 3TYJA 2R30A 1SACA 2Q8OA 1R1ZA 1Y3TA 2BEOA 2YMZA 2ZZJA 1LECA 3VL8A 1YFUA 3WG3A 4N7UA 1OA3A 2DU1A 5FO8B 3VBOA 3VHRA 1AR63 4I30A 1RUJ3 1NY72 2ZGRA 3ROUA 5I8SA 2F4PA 5JR7B 1W6NA 2D5HA 3KM5A 4YZ3A 1R1A3 3J8F3 3PNAA 4EN0A 3ZXKA 2BYVE 1UMZA 3JB8A 1NY71 3WUDA 5D8AA 2VG9A 4BM8A 3WNXA 3FBMA 2VOKA 1PZ8A 2WZR1 2ZMKA 1NA1C 5DUWA 3JBG1 4YW2A 2GN7A 1DYKA 4YZ4A 5JLVA 1L3JA 4Q4Y1 5JZGC 1FOD1 4R9DA 4AE2A 4ITCA 4F83A 1VRH3 3M3IA 4LBQB 2CAVA 4QPYA 4IV3B 4E27A 3JQXA 1TME3 1GYKA 4MXWB 1J3PA 3BODA 2X29A 5EYXA 4E4ZA 1I9RA 3MICA 5J98B 2CGNA 5EV7A 1Y43B 4UW3A 2A6WA 4KGGA 2UY8A 2VOVA 3WG1A 1DGRA 1RUD3 4AFMA 4XJ8A 4E2SA 3GALA 1KQRA 2E9QA 4IEQA 5K0UC 2HWC3 2HEYF 4H14A 4WM7A 1GV9A 1S0IA 2CWSA 4D7TA 2A7AA 3FFQA 4NVPA 4JTNA 2ZKNA 1J1TA 3H50A 3M7AA 4HETA 2QDRA 4LA3A 1CAXB 3IMNA 2B5HA 4EJRA 5ABJC 1GFF2 2AZ5A 2DUPA 3D5OA 2WT0A 3VHNA 1SDWA 3ZPYA 1I6XA 1G8WA 4OHXA 3OYWA 2D5FA 1AF9A 5F5QA 3AZZA 2E51A 4FT8A 2GAUA 3HMYA 2G9FA 3ST7A 3ZO0B 4RHV2 1BEV1 4AFBA 5JSPA 1WBFA 1F5FA 2ES3A 1H1IA 4AW7A 2IWGB 1GKBA 3MPPG 2A3WA 3ZN4A 2Z79A 1CQ9A 2GNBA 5LK7B 4HKWA 1XYOA 1MZ5A 3ZN6A 3WCRA 2YHJA 2QVSB 2R1BA 1CD3G 2ET7A 1COV2 2JG9A 1MS5A 4YG0A 4CRQA 3AK0A 4FPLA 4AGVA 1XU1A 2HKXA 4B4PA 2H6BA 4YLZA 1H8TC 3ZXAC 5KWRA 1EV12 5FO9B 4AEDC 2R042 5BNNA 2D98A 3NWKA 2YGLA 3E5XA 4P9IA 1UCXA 1FMD1 5BV6A 2ZGQA 1Q3EA 5JSRA 4XBNA 2VVFA 2BQPA 1RINA 2P34A 4FPGA 1FOD3 4CDQC 4NHLA 2R041 2UU8A 2NZ9A 1V6MA 1QF3A 1LEMA 3E6DA 3ZFFC 1RUF2 4CDXC 3KT1A 4D3WA 1R082 4OHWA 4P9LA 1NLSA 4H7MA 3LOBA 2ATFA 2XJPA 3KS7A 4FTSA 2UY9A 1JYCA 4LHKA 4QHBA 2PHLA 4CEYC 1DQ1A 1PNGA 3H9AA 4R9CA 4FTBA 4DY3A 2DFCA 1RJ8A 1H4GA 3GZTB 4P9YA 1CN1A 1GANA 5L7OA 1DYPA 2QDNA 3ZYIB 5CA6A 3MIGA 2HWB1 4XILA 4XJUA 3A0NA 3S30A 3I4IA 1RMU1 4I3PA 2WSVA 4XEZA 4JVAA 5FTTC 5FAXA 4BIOA 1BBT2 4XIKA 4EN6B 3OGJA 2IXJA 1LHNA 4L92A 1NCRC 1SQ4A 4LLFA 4Z1VA 1AXKA 3J26N 3W9AA 2LM3A 2JD4A 1XE8A 4Y20B 1MZFA 3E5UA 4MGZE 4FOWA 2R072 3IPVA 4Q27A 4AF9A 2GC0A 5D1IA 1FX5A 4F7ZA 1UPSA 4Y22B 1V6LA 2FZ2A 1UU5A 2D93A 4YVSB 2PA7A 2BFUS 4AXOA 3WG2A 1C4RA 5A33A 2R071 1MS1A 2XWBB 3B9CA 3ACLA 3X29B 1AR91 1OPMA 1KD7A 3TNQA 2AGSA 1VJ2A 1RUE1 2Q5TA 1NE6A 4RA0A 1QOTA 5F1RA 3DL3A 5DG1A 2X5IB 1V6JA 2ZGLA 5IT6A 4B4RA 2P17A 1ZZBA 1LU2A 1ZZ9A 2EAKA 4AHWA 4QQHA 2W0XA 1PZ7A 4PCRA 4P9WA 3KSCA 1G6NA 2IZWA 1EV13 2QZ2A 4WVVA 1LOFA 2PHUA 4KL1A 4XHBA 2R043 1ZZ7A 3BOWA 2D3RA 3H1YA 3GBFA 3AKPA 3J9SA 5TSWA 4TLFA 4N53A 1JOJA 1VBD1 2MEV1 4K20A 3VZJA 4GMP0 3VKOA 1KFUL 4I3GA 4Z82A 2ZAHA 4GWMA 2VY0A 2HYKA 4RR3B 1OA2A 4QQPA 3RMXA 2RM22 1PGW2 3BU7A 3ZFGB 4XF4A 4YM3A 1YYNA 3B9IA 2PHXA 1BCXA 4JDMA 1LGNA 2HWB3 3AZVA 4IV3C 1RMU3 2CNAA 1RB8G 3N7LA 1QH7A 1W6MA 2WS91 3SCGA 1PGW1 2ZKLA 2E63A 3CJIA 4AHZA 3ZSJA 1XRUA 4JGZC 5BNPB 2WIIB 2YDEA 3MZHA 5LRRA 2XBO2 4LBOA 2VOXA 2E53A 2RS12 3RPQA 1FNYA 5IUQA 4LBNA 4Z2WA 2D3SA 4H55A 1XNDA 1Q56A 2Z2SB 2GNMA 3FLRA 1BBT3 2ZS6B 1W6QA 5FQ0B 1Z78A 1M06G 1BVP1 1OHFA 5CVRA 4QPGB 5HXVA 5DZGA 2WA3A 1AX0A 1ZRCA 4KH9A 1PVXA 1Z7S1 2R073 1GR3A 1DIWA 2ILMA 3B69A 3S7IA 3VDDB 3AJYA 4G3YC 1AR93 3MIDA 4IERA 4AI3A 1LTEA 1YXWA 4LLOA 3S0MA 1RUE3 2Y0OA 4ZU4A 4ISRA 1D0HA 3VBHA 4QXKA 2R49A 1S2KA 1K5MC 2D6LX 2D6NA 4LUMA 2W08A 1I1EA 1UU6A 1F8VA 3W59A 4PDWB 1V6IA 4MH0E 4XDQA 1S55A 3EBRA 1IHMA 3CEWA 3ES4A 2RE9A 2DCZA 3VZMA 2C1FA 4JTOA 1LHOA 5DG2A 4UXAA 4CZSA 2JG8A 4BZ4A 4JDNA 2MEV3 2ZGSA 5GZDA 2C9AA 4FTEA 1XU2A 1W2UA 3VKLA 4X6RB 1ND3C 2QZ3A 2Q0AA 4XFBA 4P5HA 1DQ6A 4AG4A 3DF0A 2UURA 2WZPP 2ZJCA 1CGPA 3NL1A 1J3QA 1LHUA 3JUUA 1H9WA 1KJRA 1CJPA 3H7JA 3I54A 4HT1T 3SCHA 2WNVC 3MIBA 4IEXA 4M3CA 4Z92B 3CU7A 4K1YA 4Y4YA 1AYM1 2R0FA 1R091 4NWWA 1J1LA 3E6CC 3LKJA 1H2NA 2VMGA 4QQOA 1YFXA 2WS93 4J1WA 2RM23 5C4WA 1NCQA 4R8HA 4XMIA 1VBB2 3ZXFA 3M2MA 4RS5A 5GALA 5AC91 1H8VA 2ZGPA 5KHIA 4WM8C 1VAVA 3WVJA 4AQ6A 3N7JA 3RJ2X 1LOAA 1RUG2 1NOVA 1ZREA 2GZWA 1EPWA 2KXLA 3ZFEA 2VUAA 3UJOA 3HIFA 3WXPA 2XBO3 3WHUA 1CAWA 3MLJA 1CAVB 4DY5A 2RS13 2RS31 1FXZA 4XBLA 3ZVXA 3ZYRA 4AHXA 3VBOC 1Z7S3 3B5LB 4LUKA 1RUH1 1VB4A 4Q1PA 5GLZA 4X6QB 1O3TA 3L2YA 4AEKA 3WDYA 1RIRA 4FXKB 4QMAA 3BOPA 4OZXA 1VBE1 2G9GA 1PVC2 2RMU2 1H9PA 2GN3A 1VAMA 4MUVA 3N7MA 4NR1A 3RDIA 5CBLA 4MZUA 4ZU5A 1HDKA 1JYIA 2Q30A 4XF3A 3BCWA 4FSJA 2XJTA 5D8AC 2W39A 3EQEA 3OJBA 4NWVA 4YVSC 1SCSA 2RJKA 5GZEA 1S0CA 3AYAA 1C8M2 3M70A 1F31A 3SISA 1JUIA 1G86A 1Q8QA 2FZ1A 2RJLA 3VN4A 3POYA 3ZYJB 1UU4A 1POV3 3VBFA 2WNEA 4GALA 4PBPA 2ZCWA 3T1LA 4META 3OY8A 3CJXA 2GH2A 1ALYA 1PK6A 2JE9A 2ZZQA 3WY6A 1LU1A 1M4WA 3M4FA 3VKFC 1FV3A 2XH6A 1BKZA 1REFA 2B7YA 2VQAA 4LO6B 3TN92 4SLIA 3SNMA 3MDPA 4YGBA 4AGRA 4WM7C 3KLSA 3IBMA 4HSLA 2EALA 1R093 2WNUB 2C5DA 4HL0A 3VHPA 2QNKA 5J96B 4QQLA 3ECQA 4YZ1A 1CX4A 3TN91 4LBJA 4KGQA 3VBRA 1H8TB 4ONUA 1AR62 5AC93 4RR3C 4UW6A 4I0WB 4AEDB 4AI0A 2BBVA 1G9AA 1R1A2 3IDEA 4MGIE 4MSVA 3VBHB 2IXHA 1LOEA 4CEWB 1OQEA 4TSVA 3IM0A 4YFZA 1ULFA 1ZYBA 1W39A 3R4SA 4R4ZA 5KC5A 1LB2A 1LOGA 3FBYA 4PF5A 5JAXA 2VMHA 4YVWA 1W6PB 4CDQB 3UL2A 5FFOC 1ULDA 2RS33 3DGTA 4A7KA 1RUG3 1ZBA2 3JB4C 3NV3A 3R0RA 3ZFFB 4CDXB 1RUH3 5LK5A 4AQ2A 1VBE3 1NQJA 2E7AA 4AFCA 2BNMA 1NLRA 3RQ0A 1BVVA 4EV0A 1AR72 3ZDSA 1ZBA1 1H1AA 4YW4A 5BNNC 5C6CA 2CWMA 3M3OA 2D43A 1RHI1 2YGMA 4Q0QA 5T5OA 4XOGA 4O9EA 4QX5A 3AKQA 1OLQA 3AMPA 4COZA 4I2OA 2HWC2 2XJRA 2DVAA 2BNNA 1C1FA 4FQ4A 3VDDC 5LEJA 3POSA 3GZAA 3PJQA 3O0XA 1NCRB 1OA4A 1BXHA 4AVBA 1GZWB 5EXOA 2GC1A 1CPNA 3ZYPA 4FQZA 3IKWA 1C8M3 1XNKA 2YY1A 4N9IA 4BYYA 2VW1A 3PLQA 4HPKB 5CFCA 4MYEA 3DPRB 3D0JA 3OBTA 5L19A 1QNYA 1FV2A 4LBLA 1QMJA 2VECA 4JQRA 3SLIA 1NYWA 1T6GC 4FPEA 3VL9A 4OHVA 5E88A 2XHKA 1SMVA 5L7OC 1V70A 4L8QA 4CDWB 1A3KA 5L73A 5GLWA 2D6OX 2VXRA 1GLHA 2HEVF 4P9XA 5JOYA 1SFNA 3MW2A 3L9JT 3TN93 1QU0A 1XYNA 4WZCA 1HIXA 3LCPA 3U07A 5J37A 4HVRA 2ZABA 3ZXJA 3N3HA 5HBAA 4XQDA 3ME2A 4COVA 2X53S 4KNCA 4BMBA 4GH4A 5IK7A 4GXLA 4M3CE 5IK8A 1AHSA 4XFFA 2NYYA 4Y1UA 1O7FA 2WZR2 3NSTA 4KG8A 3H3UA 1QDCA 1YI9A 3JBG2 1BYHA 5CADA 4Q4Y2 2ZMLA 2IXLA 1FOD2 2NMNA 3GHMA 1DQ2A 5JIAA 1ZBE1 2AREA 3LA7A 1QGLA 1PO11 1QJZA 3B01A 3VKNA 2QJVA 1N1YA 4GIQA 1ZBA3 2AUYA 2IFRA 4Y1ZA 2FBEA 1DQ4A 1TMF1 4N9HA 2VULA 2ZAAA 1C3HA 1RHI3 4FP3A 1JN2P 2OW4A 5GZCA 1DZRA 4MXVA 4PLNA 4YW3A 5JI9A 2DCYA 3FUOA 1AR73 2O0OA 2BFUL 4A7YA 2B9UA 1LOFC 4PIZA 3IWZA 3WW4A 2PFWA 4JGZB 5FCCA 4BIFA 4N53C 1AJOA 4J1XA 2DVBA 1JH5A 2BVBA 2G4IA 5JIUA 2ZHKA 2CV6A 2NN8A 3WW2A 1Z0HA 4L11A 1HXS1 2TUNA 1YIPA 4WV8A 4W6WA 4FOYA 3FFZA 3MF6A 3WDWA 1SLLA 4M01A 3PMEA 5CFDA 5KXDA 3R05A 3H3ZA 3O0WA 3K48A 2QUOA 3L2HA 4M0NA 1IKPA 1BEV2 3U0ZA 1PNFA 4DRVA 1D2SA 3GNEA 1O91A 3H1WA 2PHRA 3CJIC 2MHFA 1O4TA 2DTWA 2AH2A 2ZGTA 1DGWX 1D4M2 4XETA 4ATFA 1K5MB 1LKNA 3MFCA 4BQ1A 1KJLA 3ZXEA 4I01A 4N43A 3MI8A 4AVCA 1AJKA 1OOPB 3E97A 1G9CA 2LUWA 2YROA 2DURA 1V9U1 1KS5A 4DB5A 1D4M1 2XKOA 4LO7A 4YNIA 4Q4X1 3PJYA 3QOPA 1GQHA 4FPFA 1BMV2 5FLIA 3BTAA 2WNUC 1VBC1 1FMD2 1ND2A 3DV8A 4A7ZA 5FBZA 1KITA 5KHJA 1Q43A 3JD71 2VPVA 4CP1A 4XMAA 3RNSA 2B8MA 4GMP1 3VBSA 1YWKA 3NAPB 4OI1A 1RUI1 1LOBA 1ND3B 1U5XA 1H0BA 4K3UA 2VVDA 1ZBE3 4M3CF 1X8MA 4X8PA 1BMV1 2PTMA 4BWOA 4KBBA 3VBHC 1O5LA 1PO13 2WZR3 1N1VA 1LHWA 1OLRA 1YHFA 2ZX2A 3AFGA 3UKNA 4CEWC 3JBG3 2XVKA 1AR81 4QGNA 2V73A 4Q4Y3 2WNVB 3MPBA 1AL21 3AYCA 4LO4B 4WVMB 4XQWA 4EN7B 1O4ZA 2VGDA 1GSLA 1AL0G 4I02A 2PHWA 2DVGA 3RMYA 3O12A 1QJX2 2CL2A 2HWB2 3FLPA 2JG8C 1RMU2 5CAZA 4WM8B 1IS3A 4L99A 2QE3A 4BCUA 1HXS3 2Z5WA 2CGPA 3FJSA 2YUEA 3KD4A 5GLTA 5JCTA 1QJX1 5FOJB 4Y24A 3WQ7A 2H6CA 2PN5A 1UIKA 5JMCA 4P9JA 4AI8A 1UPIA 3VBOB 1LGBA 2F6BA 2R16A 2JENA 2A3XA 5FLHA 4QGLA 1ENQA 1W6NB 2A75A 3E6BA 3SH4A 2HWD1 4AQTA 5C4WC 5J36A 1NCQC 1XNBA 2R6QA 1MS8A 3HD8B 4EROA 1F5JA 4XF1A 2K2SA 4URTA 1DLLA 4OI0A 3DPRC 2EXJA 3WHTA 4Q4V1 1Y7BA 1AR92 5JSOA 5D8AB 4ATEA 3AYEA 1BEV3 4B3NA 4LO5B 4DXZA 4XTMA 4XQ4A 2EIGA 1IS4A 3I8TA 1RUE2 2UWCA 3ZFEC 4GKYA 1W6OA 5KXCA 4CDWC 2DCJA 1D4M3 3WR0A 2ZPXA 4Q4X3 3CNAA 1QJU1 4LO8A 4OFGA 3WQ1A 1HV0A 1AXZA 3VZKA 1ZZ8A 4YYOA 3AX4A 4WVWA 1MS3A 2NP0A 2E7TA 5T3NA 2JEMA 3V65A 4BHPA 2ZX1A 1PIV1 3B02A 4GMP3 4KG0A 4KU8A 1EAH2 1WW4A 3DUIA 4OVEA 1CIWA 3VUOA 1VBD2 2MEV2 1FMD3 1H2KA 4BH9A 1IPKA 1RC6A 3JU9A 2WJSA 4QM9A 4WM7B 5H9RA 3M3CA 3WLUA 5C8CA 1AL23 2HWF1 1EAH1 3AZXA 5CFDB 1RGSA 1LHVA 5GZGA 2JX9A 1NA1A 3BIWE 3THTA 1BZWA 1GZCA 4U36A 4D7SA 4GB31 2ZMNA 5JZGA 1WCDJ 2Q4SA 3MYXA 4Q4W1 3VBFC 1FNZA 3WP6A 1ZM1A 4LR4A 2WS92 3OYWB 1PO21 5BYNA 4K8FA 1PK6C 2GC3A 3KT4A 3NJZA 1QJX3 2PELA 1QQP1 5DZFA 4JGYA 4Q8KA 4IEWA 1FT9A 3VZLA 3WP5A 5FPXA 1A6CA 3GBWA 3ZN6B 4XYXA 5K0UA 1Q8PA 1ZRFA 4JRLA 2VH9A 1MEC1 1ASJ1 3KZ4C 4AFDA 3H8UA 2HWD3 3ZIXA 2JG9B 2JKBA 2A3YA 2B39A 5AVPA 1YO8A 4DQAA 4QU2A 3WT3A 4AHYA 5B2GB 1LOCA 3LZZA 1O3QA 3B00A 1Z7S2 3AXEA 2ZGMA 1LCLA 4LHNA 5BNNB 1A8MA 5EWSA 1PMIA 4Q4V3 1XXNA 1DFQA 3IT8A 4KWLA 3TB0A 5ABJA 3OCPA 3FMGA 2CYFA 2JXAA 5FMOL 3D82A 2VNGA 1N1TA 3I59A 3RSJA 2XLFA 3V0AA 1X50A 2ZA9A 4QPIA 5A32A 5F6LB 1G9FA 2DWRA 1QJU3 2ZOEB 2DCTA 3V0BA 2BWCA 1AVBA 2UYAA 3OBRA 4YGDA 1SLIA 3OD0A 1ULCA 3N7KA 1SLTA 4JDOA 5F9TA 3RZZA 3IN9A 4PBOA 3APBA 2CTVA 4K1ZA 2WL1A 4CYDA 1OOPC 1ZNPA 2GU9A 1CESA 2EVXA 1PGSA 4LTAA 3ILRA 4XTPA 1YRZA 4F8AA 5L7OB 1BJQA 3M8LA 2ZBJA 1KS4A 2A71A 4YG3A 5E1RA 5KXBA 1EAH3 3EJKA 4BMEA 4DINB 4DZGA 2K0GA 2PHFA 1HV1A 3AJZA 1VBD3 4JAAA 4S2GA 1FPN1 4CDUA 1GZ9A 5GZFA 5JPNB 4K40A 4GB33 2WT2A 2ARBA 3NAPC 1AYM2 4XJ9A 1FATA 1R092 2D40A 5IK4A 2ZHMA 2Y26A 4RGGA 1HW5A 3KCXA 3G7DA 1LJ7A 3P3NA 5FPZA 4Q0UA 5T5JA 3RYPA 5CFCC 1YJLA 3IPVB 3AKSA 2ZX0A 5AC92 1YJKA 5C9AA 5JOXA 1GNHA 2DUOA 2ZGUA 1QQP3 4EWAA 4CEYA 5A33B 2E6VA 3OF1A 3W58A 4P14A 4A2UA 4Y1VA 4IQPA 4RL7A 2PLV1 1MEC3 4YM0A 1ASJ3 1MQTA 3AP9A 2FMYA 1WMDA 1NZCA 4B7EA 4OUSA 4MLOA 2RS32 4IEOA 1X33A 1DBNA 2PHDA 3FX3A 1RUH2 2RR11 3MLKA 3JZVA 1LULA 1ZA4A 3BB6A 3KCYA 4ES8A 4EN8B 4LE3A 3KMHA 4LHLA 1VBE2 1HRI1 4TYSA 3GZUC 3NKGA 3RI9A 3D8CA 3S6PA 1PGL1 1XQNA 2WLPA 3QD6A 3VGIA 4GH4C 1CVNA 3USUA 1D0GA 2IC1A 2ENRA 4AI2A 1DDLA 1J58A 3VBUA 4DRRA 4FP2A 5H9SA 1EYBA 2BWAA 3H0OA 2A5ZA 4N53B 5DUVA 3C2UA 2XJUA 5DZEA 4RQPA 1Y9QA 1APNA 2HEWF 1TNRA 1VAKA 1CAUA 1C1LA 3PVNA 5I0RA 1C5IA 1MVEA 3I7DA 3SCFA 5BNOA 2A70A 3AP6A 3WP4A 3CLPA 4XBQA 3KT7A 4FXGB 4AK3A 5CNAA 1N3PA 2EF6A 3V64A 1S0DA 2CGOA 4AQSA 1Q8OA 3VKMA 4GWNA 1HX6A 3PVBB 1YLLA 4HK9A 4WZFA 5BY5A 1F2NA 5SV8A 4YARA 2WQ4A 3KB5A 1W6MB 3ZMOA 1DGWA 4LULA 5C8WA 4COUA 3CJIB 3SHRA 2ZHLA 2BGCA 5K8SA 3NV4A 1X82A 4ASLA 4AVAA 1OQ1A 1D2QA 3AYDA 4COYA 1HRV1 3RI8A 5DDJ1 2RHPA 1WLTA 2D6KA 4JV4A 4Q26A 3HAGA 3TWIA 2E7QA 1YFWA 2VU9A 2VW2A 1H2LA 4FPOB 2HWE2 1U5IA 1LESA 1W6QB 1LGCA 3LAGA 1AYM3 3ETQA 1LENA 1VIWB 1OFNA 5CFDC 4YW1A 3AKRA 3V0AB 4YGEA 5CB7A 3KGLA 3HWJA 1MS0A 2HWE1 2FMDA 1RVF1 3ZMNA 4XW3A 3AKTA 1A8DA 4B29A 4LBQD 3AP4A 4LBQA 4ISQA 1DF0A 4IV3A 3EXUA 3ILNA 4FCAA 2WINB 1QHDA 3NV1A 1O3SA 5I8TA 2GSYA 1YI7A 4AVSA 4QT6A 2VW0A 3THPA 1ENRA 4E4SA 4PJYA 1VP6A 3VV1A 4QM8A 3KCCA 1V6OA 2RS51 1V6KA 1LEDA 1PHMA 4DNYA 1UZYA 4AYUA 1ZRRA 4FPHA 5FDBA 3AMMA 1RHI2 3ENRA 1NQDA 5AFBA 1J59A 2JG9C 1OD5A 3D0SA 4F3JA 2JG8B 3BALA 3AB0A 4IV1A 3IDBB 3USSA 2ZX4A 3QH6A 4CDUB 1RUJ1 2OYZA 2DTYA 4NOTA 1CAXA 1H1MA 1UL9A 5H9PA 3D6EA 4RGAA 4K7JA 3MEPA 4Y1XA 4JC1A 2BW8A 4D69A 2D7FA 2YC0A 2OA2A 5T54A 3A0KA 4Q29A 4R9AA 3BPZA 1QH6A 4M3CB 3RWNA 3JQWA 2IFWA 2V5YA 1ZX5A 3GBGA 3ZN5A 2N7GA 3U11A 5C4WB 1NCQB 1QDOA 1HQWA 2ZHNA 3TNPB 3EO6A 3VLBB 4RS5B 4HN0A 2D3PA 5EFUA 2XWJB 5T52A 4YGCA 5H9QA 1H4HA 5JOZA 4IXLA 2DYCA 1DHKB 2WT1A 2LTNA 3EHKA 5KC6A 4R9BA 4Q1RA 4HFSA 4QQ2A 1B35A 1QWRA 2A6XA 2XB6C 3ZFEB 3U10A 1CR7A 2R061 5E8AA 2R32A 3INAA 1ZZ6A 4XE9A 2DCKA 1CAWB 1MR5A 2YXSA 1QJY1 1UIJA 3K51A 1RUD1 3WOGA 2K9ZA 4GKXA 2BNOA 4OULA 5ACA1 4CP0A 4N7IA 1O4YA 1WMEA