2WNVA

Complex between c1q globular heads and deoxyribose
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
131
Chain Sequence
QPRPAFSAIRRNPPGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
molecule tags Immune system
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
total genus 29
structure length 131
sequence length 133
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnvA00
5HBAA 1U5XA 2WNVC 3K48A 5TSWA 4NN0A 4D7YA 3FC0A 1RJ8A 4TWTA 4HT1T 4RSUA 1OQDA 1DG6A 3K51A 1DU3D 4MXWA 1OSGA 4QQHA 2HEVF 2RJKA 2TUNA 2JG9C 3MI8A 4QQPA 1PK6A 4N90A 1XU1A 5L36A 2WNVA 4J6GA 4QPYA 4OUMA 1WCKA 2JG9A 3ME2A 2QDNA 5CIRA 2R30A 2OIIA 2E7AA 3QBQA 3TYJA 4G3YC 5KWRA 4QQOA 3URFA 1D4VB 5KC6A 2Q8OA 1PK6B 2WNUB 4QQ2A 1OQEA 2WNUA 2HEWF 3LKJA 2AZ5A 2KA3A 4DB5A 4EN0A 3TWIA 3AB0A 4E4DX 2Q1MA 1IQAA 2JG8C 4OUSA 5BNQA 1U5ZA 4KGQA 4QQLA 4KG8A 2R32A 2WNVB 3B93A 3QD6A 1GR3A 5KC5A 3B9IA 1S55A 4G4FA 2JG9B 3IT8A 1JH5A 1KD7A 5L19A 3V56A 2HEYF 2X29A 4MXWB 2QE3A 2RJLA 2TNFA 4DOUA 1I9RA 2ZJCA 1C3HA 1TNFA 1JTZX 2R6QA 4TSVA 4MSVA 2ZPXA 1D0GA 2WNUC 1TNRA 3ALQA 1ALYA 4GIQA 2JG8B 1C28A 2RE9A 1U5YA 4OULA 1RJ7A 1A8MA 4E4SA 4MXVA 1D2QA 3B94A 1O91A 2JG8A 3L9JT 2O0OA 1KXGA 2Z5WA 4KGGA 4F3JA 1XU2A 3WD5A 1PK6C
chains in the Genus database with same CATH superfamily
2RG4A 1U5XA 2VNVA 2ZKLA 4K8FA 3VZJA 2Z42A 3WNMA 4F7ZA 2PHFA 3V0BA 5CFDB 4NN0A 4CCKA 2VBDA 5GLVA 4ZZ5A 4B4PA 1LULA 4QPGB 2DVFA 4LBQD 4MXWA 2P3IA 2VZPA 2WAOA 4LQRA 2XR4A 4Q4V3 3PMSA 3UETA 5FPXA 3PVNA 3SKJE 2YUEA 4YM0A 1G9CA 2D6OX 1UYXA 1POQA 4XXPA 1ZM1A 3MFAA 1GUIA 4Q0QA 1SLLA 4XTPA 2JDAA 1NCQB 1REFA 2WNVA 4JRAA 3N9QA 4QX8A 5EJ1B 4PLNA 1W04A 1ZBE1 1DQ6A 1RXGA 1LHUA 3RMYA 1Y9QA 2YC0A 4XFBA 4G3YC 2JDHA 1OF3A 2F17A 3JD72 3HD8B 4MX3A 1GSLA 3WP3A 3E97A 2WO7A 1G6NA 4AI9A 4H2AA 2R041 5FFOC 4R9BA 4QHBA 1DIWA 1OPMA 1H9WA 1YI7A 2ZX1A 5F3EA 1PGW2 2WABA 3VKNA 2GC2A 1PNFA 4BISA 5FYZA 1VBC3 4Z1VA 4V2VA 5GJ6A 4KNCA 5KXCA 2P17A 3BN6A 3WUDA 3PIGA 3H8RA 1WLCA 2DWRA 3EYPA 4YNIA 1V0AA 2JG8C 1RC6A 2VNRA 2XQRA 2ZOEB 3I2DA 5FYSA 3H1MA 3POEA 5CG9A 1C8NA 2ATFA 5FZ0A 4LLFA 4MH0E 4NIHA 3VKOA 2A6VA 3C3VA 1C5HA 3O0VA 1YQ8A 3FFQA 5KC5A 5FK8A 3H3ZA 3OEBA 4CE8A 3ZN4A 5JPMB 1B35C 3SNMA 4IEVA 5IVJA 2DCTA 4AOCA 2CY6A 1O4TA 2GZWA 3C7EA 3AJYA 2VU9A 3RYRA 1HB2A 1UY2A 1OOPA 3NNMA 4Q26A 1W8UA 2DCZA 4QU1A 3THCA 3ZYFA 1CX1A 4YGBA 3QOPA 5FYBA 2TNFA 1UKGA 5JZGB 1AL23 3RRDA 2ZAHA 1S4CA 4FXGB 3ZR6A 2G9FA 4KU7A 1V70A 3U4XA 2D6KA 1FPN3 4COZA 1ULGA 1K5MA 1LECA 4UF0A 1REEA 1UY0A 2YXSA 3NV3A 3ZXJA 1NX9A 3ZXAC 5H9PA 1JZ6A 1SCRA 1QQP3 3BKZA 4OFGA 1AR71 1ZRRA 1UW8A 2RMU3 3ALQA 1BVP1 4JHTA 2VMCA 4GIQA 2WFF3 3WY6A 1VLNA 4G9SB 3BTXA 2ZZQA 2W47A 2EXJA 2A6XA 5FLJA 1Q5OA 3OBAA 1YO8A 1US2A 2G19A 1UY4A 2NN8A 5KBFA 1MPXA 3WLUA 4LKDA 4TYSA 2HYXA 4GKXA 4ATEA 2OX0A 4CCNA 3RPQA 4GQ7A 3THPA 3WT3A 1JZ3A 2VO5A 2WS92 3UGHA 3WQBA 3DF0A 3O1OA 2WRAA 3MZHA 3GXUA 4DFSA 4KG0A 1HB1A 2QJVA 3EXUA 2DURA 3LZZA 4Y20A 5TSWA 2VZ3A 1V9U2 3SCHA 2PYTA 4CDWA 2EALA 5IYYA 2GAUA 4UF0B 3O1VA 5CFCC 1Y4WA 1QDOA 3MICA 3MO4A 4Y1VA 1N47A 2GNMA 1VB4A 3ASIA 1SQ4A 1S0CA 1XYOA 2RMU1 3DXTA 5DG1A 1NCRC 5FXVA 4DRVA 5B4XA 3O0XA 3RZKA 1KQRA 1UMZA 4YGCA 1NLQA 4YW1A 1RHI3 1VAVA 2GNBA 5J37A 4BXSV 5IAXA 1GNYA 5L36A 4AQ6A 3GYDA 3I2GA 2RS33 2VW1A 4OQ8A 4QPYA 4ZU5A 2HWD3 1HRI2 1RUH1 1RUJ3 3VL8A 4CUGA 3LPFA 1PGL1 3ACIA 3BUCA 3GHMA 5FDBA 5B4NA 2FMYA 3KS7A 4P9XA 3H8XA 2EIBA 4I0WB 2G9ZA 1EV11 3FJSA 5F3IA 2I07B 2PLV2 5A7PA 1JUIA 5BPXA 4LOSA 4E2SA 1MQTC 4OI0A 4XJUA 4NMIA 4I09A 1EAH3 4DIQA 1WMDA 1ND3A 5JXJA 1POV3 2GSYA 3CNAA 1LGNA 2XBO1 2WZPP 2R073 1OKOA 2OYZA 1HW5A 1ZZ8A 3I2JA 3WNNA 5CBLA 1NAEA 4IERA 3WDWA 1BBT1 1GLHA 1LU1A 1TME2 1FMD2 4XURA 4NOTA 1AL0G 4OUSA 4GWMA 1OUXA 4LIVA 1XYNA 1ZZCA 4AE2A 1ONAA 3S0MA 1FV2A 2C1FA 1O4YA 1VR3A 1QU0A 1KS5A 3J7MA 1Z7S2 2RDSA 3GF6A 3MPBA 2OVUA 1GR3A 4CPBA 2VCAA 5BNPC 2XHKA 4UAPA 1S55A 1VBD1 4K20A 1FOD1 2R062 3CHXA 4B29A 1W0NA 2BNMA 2Y26A 4DINB 1ZVFA 4AVVA 5FZ9A 3ZPOA 1LEDA 4JKKA 3U11A 3WG4A 1VRH3 1UMIA 2XLFA 5C5TA 4MGQA 3T09A 3M3QA 1FOD3 1HQWA 1BXHA 4I2OA 2W1UA 2HWB2 2XWBB 3FLPA 3ZSKA 1R1A2 1IS5A 2VL4A 5FKCA 4QD2A 1XNDA 3RSJA 2BUKA 3W9AA 3LPGA 1WLTA 5CFDA 5LA1A 4P9LA 2PLV1 5I8YA 1DZRA 4D7SA 2D3RA 1TNRA 1QJY3 4XC9A 1QJU1 3WQ7A 4LULA 3THTA 4FO9A 1IQDC 1VBB1 4GJZA 1LHVA 2A6YA 4Q2FA 3IM0A 4P5HA 1W03A 2XJUA 3OUJA 2BNOA 4ZXEA 1DZQA 2VUJA 2W87A 4A2UA 4TLGA 2YC2A 3KF3A 3JD71 5HCFA 3NW4A 4DPNA 4R9DA 5JMCA 3ZFFB 4N9IA 5F3GA 1OT5A 2DF7A 3AM2A 5E88A 2BEOA 3VBUB 4AHWA 4HSJA 1YRZA 4CP0A 1RVF1 2ADEA 1LOGA 3AC0A 1AZDA 4PLMA 3KD4A 4IV1C 3DV8A 2PAKA 4URAA 5IAVA 3VLBB 4AFCA 5FZIA 4H14A 2XJRA 5ANQA 1NQJA 1Y9MA 5FK7A 2Y60A 3PJYA 2MEV1 3A7QA 2W95A 3OPZA 4KH9A 1MS8A 3ZYGA 4LE4A 3U07A 2GN3A 1F4HA 1BYHA 2Y38A 3I2KA 4FP2A 4NPLA 2AR6A 1FMD1 4K3UA 1GOGA 5FUIA 4Y5TA 2LS6A 1HRV2 3KB5A 1LTEA 3TYJA 2ZGOA 3TRSB 5GLWA 3WOGA 2X09A 4CU8A 2JICA 4YYOA 5DAWA 3UYJA 3USUA 1PVC3 4NWVA 4XIOA 4QX2A 4FFIA 2MNGA 5KC6A 2XKOA 2XVLA 5I91A 4FTBA 1JOJA 3ES4A 1GQHA 5DAPA 3BYWA 3IDBB 2DFBA 5BNNA 3LIGA 4YW5A 2RS12 3BPSA 3I2FA 4MLOA 1R1A3 4CDUA 3ZVXA 1NA1B 1JZ5A 1E5SA 2FDJA 1NE6A 4XIKA 3VBHA 4OHZA 2CU5A 2R0FA 1CJPA 3P3PA 2VM9A 2D6NA 3AB0A 3E5UA 4Q0VA 3TWIA 4AEKA 1OD3A 1HKDA 4CXWA 2BYVE 4EWAA 2FBEA 3BVCA 2R061 1IPSA 4QAWA 2XL7A 4XABA 4DY5A 1O59A 5BNQA 1HRI1 4AFAA 4XFGA 2BBVA 3MW2A 4GD4A 1JYTA 4HZFA 3H9AA 4YW4A 1HN0A 4LA3A 2ZEYA 1Q8OA 2WZR3 3KCYA 5IW0A 3WF4A 1SFYA 2BBAA 1QH7A 4OLLA 4AR2A 2IXJA 1F15A 1AR61 4EN8B 2Q1ZB 2LTNA 1PO21 4XUNA 1XJAA 2FDFA 4AAPA 1QDCA 4NVPA 5CKMA 1DBNA 1EPWA 1A6CA 2BRTA 4NPRA 5LA0A 4MUVA 3HT1A 1IG0A 5CADA 3AKRA 1U5IA 4CXXA 4HL0A 4MGTA 3T0BA 1BLZA 5D21A 5DAXA 2J1RA 1DYPA 4E4HA 4QT6A 1BJQA 1E57A 4GMP1 4XDOA 1AR73 2HWE1 3FE5A 4ZPIA 1F9KA 4MGZE 4OMDA 1TNFA 1WA6X 4DEVA 2BVVA 2X8KA 1UU5A 1ULFA 1AYN1 3VBFC 3O1PA 3NNGA 1D2SA 4NIAA 5JMOA 3S7EA 2BGOA 5JZGA 3HQXA 1LEMA 5DDJ2 1C28A 2QZ3A 4DXRA 1W6MB 1OOPB 2V4VA 4HANA 4IV3B 3UL2A 5ISLA 4L11A 1RMU3 1NLRA 5C9AC 5ABJB 3N35A 4CCMA 3JCIA 2ZABA 1HRV3 3WP4A 1RUD2 3I3EA 4AF9A 2AREA 2ZGPA 3USSA 2GMMA 2PHRA 3CZJA 4S2DA 4XW3A 2P37A 1V6NA 3JZVA 3FMGA 1NY71 2JJ6A 4MYEA 1PK6C 5LBEA 1UYZA 2UYBA 3MUY1 3PMEA 3TB0A 4HKOA 5A7SA 4JCKA 2K2SA 5HCAA 5EV7A 1CIYA 2E33A 2HYKA 2K46A 1UIKA 2VOTA 2GNDA 3AYCA 3C2UA 3BU0A 2VECA 1EV12 1UY3A 3C7FA 4HT1T 4MHRA 4Y3OA 3OOXA 3I4IA 4FQZA 4BE3A 3GZUC 2BNNA 2QUOA 4DS0A 1S1AA 3POGA 1DGWA 3GBFA 3J7NA 4XFIA 3KGZA 4YZ3A 2VCMA 5DABA 4BH9A 2GC1A 4BYYA 1QOSA 4JQRA 4LO8A 5A7QA 3RI9A 2XPJA 1YHFA 4K40A 4O65A 2XJTA 3CQOA 3DKWA 4QKBA 5F39A 1V6LA 5GM0A 4P9YA 2LW8A 1O7FA 1N3QA 3MHZA 3P5BA 1WCKA 4COYA 1HQNA 4IXLA 4PLOA 2WQ8A 4OCTA 5DMYA 1GZWB 2P34A 3OGJA 2E7AA 5I8SA 1SACA 5C7GA 3DYPA 3D4KA 3VHOA 3O1SA 5FOBB 1VBD3 2XBO3 4XF4A 3WNXA 1PGSA 1V9U1 2CWMA 3U78A 5K7PA 3POFA 4URTA 4ZZ8A 1OH3A 1OF4A 2WNUB 4D3WA 5JI7A 1DFQA 1OQEA 2WNUA 4ORFA 2RDQA 2VZQA 1APNA 3VHNA 4JGYA 4BK5A 3LGRA 2W68A 2E31A 3TOJA 4AWDA 2ZGQA 1OVSA 3ZXKA 2P2KA 1RYYA 4HPKB 1H8TB 1OA2A 1IG3A 1W8FA 4FFFA 1GP5A 1HDKA 2WSUA 2IZWA 3CJIA 2H0VA 1Q43A 3HPNA 5T55A 3W58A 2YBSA 4CSWA 2EXKA 3GCXA 3ROUA 1VBA1 5FOJB 5K9YA 4UFLA 3PL0A 1BBT3 4AVBA 1A78A 2J42A 4W6WA 5L7OA 3HAGA 3ZFFC 2DBNA 2TBVA 4XPVA 1H1MA 3SQOA 1NZCA 4XFHA 3T2QA 3WP5A 3LFMA 5SV8A 3SCGA 4N53B 5HCBA 4YVWA 1FT9A 4XQDA 1C1LA 1CAWB 3IN9A 4FI9A 5DN2A 3SEPA 1UOBA 3GBWA 2DTYA 4I3GA 2GN7A 4ZS3A 1EP0A 5DUUA 4A45A 4B8EA 3M70A 3NJVA 4YVSA 2XGXA 4SBVA 2ZHNA 4CP9A 3DL3A 3N9LA 4E9KA 4B4QA 4P5YA 5JAXA 3EQEA 1QMJA 2HLEA 2DTWA 1W0OA 2OQ6A 5AFBA 2BWAA 1VALA 4W8JA 5EIYB 2A70A 4JGZB 4CEYA 2OQ7A 4XACA 4ZU7A 2OKXA 4W6XA 1U5YA 4RS5A 3UJQA 1AJKA 1GBGA 2E63A 2WJSA 4IV3A 4UW4A 2J1TA 3PU8A 3G6JB 3VL9A 2PLV3 3RFRA 4HKWA 3WDTA 5GZGA 5LY1A 4CDWC 4I3PA 1AR83 4RGKA 5FQ0B 2JDPA 4BLJA 1RUI3 4KGGA 2FCUA 5FJKA 4D69A 1YJKA 2CTVA 4F83A 2BFUL 5A3MA 2VZRA 1MZ6A 2PN5A 3VB9A 3UKTA 4CP1A 1DHKB 2YU2A 5HBAA 4Q8KA 3LEIA 1VBE2 1PO13 2XONA 1OLMA 5FXXA 3ABZA 3N9OA 4CU9A 4RGGA 3MFCA 3WCRA 5IVCA 4L2NA 1SLTA 1TME1 1UX6A 2HWE2 4ZXKA 2R16A 1QJU3 2YROA 1KITA 2HEVF 4FP3A 2WLPA 4BMEA 1YJLA 4IW3A 2ZGMA 4CA9A 1X82A 4Q0SA 1OLRA 4QQPA 1Y43B 4WVMA 3VBRA 3B01A 3ZSJA 2QQKA 2R063 3E5QA 3IB3A 4LBJA 5CZKA 4I30A 4QX0A 1GOHA 3AL5A 3R4DB 1XNAA 4Y5Z0 1VRH2 1AR93 4K7JA 3KVAA 4X8PA 4MG2A 5DUXA 2B9VA 1PNGA 1XSQA 3C7GA 5L73A 3QBQA 2XVGA 1OHFA 2Y64A 1FOD2 3AZWA 4N9HA 3BTYA 4LKFA 3MGUA 2XJPA 4CCEA 4HETA 3ACGA 1V6MA 3H1YA 4OMCA 2VZOA 3TNPB 3BIWE 5LB6A 4KU8A 3CJIB 1QEXA 4UW5A 2N7GA 5EZWA 3KHCA 5FY1A 1NOVA 1YQ2A 4LR4A 1NA1A 2QVSB 3MV01 2ZMKA 2W92A 4IEXA 4QQ2A 2QQWA 4COUA 4JGZC 4EN6B 3H7JA 5BNNB 2E32A 4P9GA 1OPOA 3CDZB 5A3NA 2IUWA 2MEV3 2CNAA 2OA2A 3ZO0B 3TEYA 1N3OA 4JGYB 3VBFB 3MBWA 4GAZA 1RUG2 5FYYA 1ZA7A 2IXKA 3PVBB 1MEC3 1US3A 3JU9A 4RHV1 5FXWA 1H6XA 4D8MA 3M8LA 5FZHA 5BV6A 3IKWA 2A5ZA 3ELNA 1VBE1 1KGYA 1LOCA 2PAMA 1ULEA 2UY9A 3AKSA 3KWVA 2BZDA 4YM1A 5D8AB 4XUOA 1JHJA 1LENA 2BP6A 4DUWA 1JZ8A 1LOBA 1ZNPA 5T5LA 5IK8A 1KDMA 3NL1A 1IPJA 1GU3A 2JIJA 1JBCA 4FPFA 5LA9A 1W28A 1AR82 3HBZA 2WR9A 4XDPA 5FCCA 1J1TA 2HH9A 1AXYA 2R043 3PIJA 3IT8A 4HONA 5T52A 1SFNA 3JBG3 2WIIB 1WD3A 4K21A 3LSEA 3ZYJB 4WM7C 4QX5A 5H9RA 3W20A 1AX0A 1X9PA 1BQPA 1L3JA 3OBRA 1RUE2 4DUXA 2YGMA 5A33A 1NT0A 1YWKA 1NLSA 1SLIA 3KZ4C 5AFEA 4OHXA 1JTZX 3AZZA 3EBRA 3W5MA 1WCDJ 4OUEA 4QGNA 1OA4A 3FL7A 3ZFFA 1AYM3 2EXIA 2ZPXA 4DXTA 5J36A 2P5BA 1XXNA 3M1HA 3IAQA 4MHUA 4CVUA 1VBC2 2UY8A 1W0PA 2F4LA 2WZR1 2BGCA 2YG0A 2ZX0A 4XUQA 1ENSA 4CP9B 1LJ7A 1UXXX 4LHLA 4E4SA 2NMOA 2WZR2 3Q8FA 5IVEA 2P6CA 4NE9A 3JB4C 4YLZA 3S6PA 1CAWA 1ZBA1 1S0DA 2ERFA 3JXSA 3VDDC 2FDKA 1NE4A 3D8CA 3O1UA 3WG1A 3OSDA 1ZREA 4QPIC 2OW4A 5F9TA 4A7ZA 5L7OB 3DXUA 5HXMA 1AX1A 3AVRA 4IEZA 2DVGA 4Y1YA 5C4WC 3LOIA 5DUVA 1CN1A 1AYN3 1YEWA 1JODA 3ETQA 4HK8A 5JPNB 1IOAA 1W9TA 2VTFA 2K9ZA 5FMOL 5K0UC 4Q4X2 3F95A 5C4WA 2UWAA 1H8TA 2UURA 1RMU1 5JIUA 2OUHA 4IQPA 5C8CB 5FZCA 5C3PA 3VBSB 4J6GA 4E2GA 5D2AA 3WDVA 1RMU2 1W8HA 2R1DA 1Z7S3 2WA3A 2WKKA 4B1MA 2E9QA 5A1LA 1QQP2 5BNOB 2QKDA 1VBA3 1UXZA 1YNAA 1EAH1 1NZIA 3WQ0A 2VQAA 3Q9OA 5FLHA 2EF6A 2AH2A 1DCSA 3KV6A 1OBNA 2B4KA 3H42B 5EYYA 3K4ZA 5A3PA 2I2SA 3ZYHA 1UOFA 2HBTA 4J1WA 4WM8C 3ZXLA 5FO8B 5FKBA 2XKPA 1EV13 4HBNA 3VBSA 3T0AA 3APBA 3ZIWA 3LDBA 4DB5A 3ETPA 1ULDA 4HN1A 4AEDB 2B45X 3OD4A 3Q8AA 3C7OA 4Q27A 1CAUA 4Y33A 4LBQB 3WW3A 1WGPA 1SPPB 5L9VA 3M3IA 1N3PA 5IK7A 4HOOA 4IV1B 2C0ZA 4KGQA 5FZEA 1N1VA 1LOFA 2A73B 2BU9A 3O5SA 3USUB 1NY72 1UYPA 1GZCA 5F5AA 5AC93 2JEMA 2YMZA 4LNVA 2Y34A 1RUD1 2YDEA 3POIA 3R0RA 4HFSA 4X6RB 2VCCA 2JG9B 2R1BA 1UZYA 5I0RA 5IT6A 3GJBA 1W9WA 3D6EA 3VD7A 5CFCB 4ZHNA 4YFWA 3KV9A 3T30A 1EY2A 5FBJA 4CDXA 1VBD2 1DF0A 1J1LA 2E51A 2C5DA 4ISRA 5FY5A 3RZMA 4Q4V2 4EZ4A 3HIFA 5F5QA 1TE1B 1W8NA 3AYEA 3I7DA 4H55A 1DYKA 2XVKA 5ERLA 2VZSA 1AYN2 4Z07A 5F5IA 1T2XA 4WM8B 2YB7A 3VZNA 2R6QA 4QDQA 2ZGKA 1MQTA 3AMNA 1NCQC 2W52A 1JS9A 2E7QA 4IEOA 1XQNA 1JMUB 3BALA 3NSTA 5APAA 4CUCA 2VD7A 3P1IA 1UAIA 1DLCA 1Q8SA 1ZRCA 5T50A 1COV2 3ZYIB 4L92A 3RYKA 3GZTB 3RWNA 2RS11 4YZ5A 1AR91 4ASKA 3VBHC 1LOAA 1GKBA 2ZEWA 1HJFA 4E8DA 5LZ6A 1GQGA 1XE7A 4UFJA 5FZAA 3ZMOA 3AXDA 2HWF2 3H3UA 2VH9A 5EHDA 1ND2B 3HQRA 1O4ZA 2XG3A 4M01A 5FZ7A 1ZZBA 3DYOA 4AXOA 4FAHA 4UOJA 2ENRA 1BMV1 2RS13 2LUWA 3RDIA 2VG9A 5A6ZA 5GLUA 4QMAA 3KT7A 5GZFA 3OB8A 5JSRA 2QQPA 1CJDA 4GXLA 4DQAA 1DGRN 1QJY1 1BEV2 2H6BA 3JB8A 3I3QA 1G86A 2WZ8A 2C26A 3IPVA 2TUNA 3I2IA 4NHLA 3WDUA 5J09A 4EWDA 4MO3M 2W91A 4P08A 5FYTA 1TEIA 1DQ4A 4PIZA 4INDA 2ZACA 4CDUB 4OUMA 4MGKE 2WO2A 3DPRA 4NR1A 3KGLA 3SH3A 1CAXA 3ZN6B 4BIOA 4IESA 3FHQA 4MGSA 4XF1A 1D7PM 2LRPA 2VNGA 4AHXA 1VP6A 2CL2A 5BY5A 1KRIA 4AW7A 4Q4Y3 5HV4A 2A6WA 1OD5A 4ZONA 1IKQA 3CKHA 4BHPA 3SLIA 2J7MA 2ZX2A 3B3QE 1PVC1 3ZFGB 3RZJA 3AVSA 1G7YA 2D6MA 2A3WA 2KA3A 5LY2A 4EN0A 1GZ9A 3NO8A 3M2MA 5IK4A 2EIDA 2HWE3 1ND3B 3SMHA 1WCUA 2CDPA 5F8PA 1R1A1 4ISQA 1HN1A 3ZN6A 3V0AA 1O3SA 3SITA 1JYIA 3AP9A 4Z92B 3MIHA 2WWUA 5DXDA 2BW8A 4FOQA 4AFDA 3RVHA 5FZOB 1B35A 1LODA 4GALA 3SHRA 1NCQA 2PMWB 5L9BA 4B7KA 4E27A 1IS4A 3J8F3 5CVRA 1H2MA 4QX7A 3B9IA 4YW3A 3IPVB 1CZVA 1KD7A 4Q4Y1 2E7TA 2D3SA 2P4EA 4NAOA 3DCQA 2VBBA 2HEYF 4H3WA 4LXLA 4MXWB 4U36A 2XJVA 2AGSA 2GDFA 2AEYA 2YYOA 1BCXA 1XYPA 1QJU2 1MVEA 2PTMA 4XFCA 4YFZA 4Y1UA 1H2NA 1GYKA 2VMDA 2KR2A 3H0OA 3JBG1 3QH6A 3I3BA 3QH7A 4CDXC 2ZEZA 5A32A 4TTGA 1PVXA 3AXEA 3TN91 2DUPA 1CD3G 2RR13 1BEV3 3NNFA 4HKLA 3AYAA 4N43B 4TSVA 2D6LX 3FX3A 2WAAA 4YW2A 5LATA 1BMV2 4Y20B 4AL9A 3W5NA 4BWOA 5KHJA 2JDKA 2WNUC 4BA6A 3T2TA 2ES3A 4AEMA 3WX5A 4PI2A 4FAGA 5FIXA 2GNTA 1N1TA 2RS53 4NHMA 5A1FA 2ZKNA 1SFPA 4UXAA 3OJBA 4XXAA 3FUOA 5DDJ1 2OZ6A 3RZZA 2WQ4A 2JB4A 4YG3A 4FVVA 4OI1A 3T0DA 2GC0A 4K9SA 4B7EA 4CP2A 3WINE 4AK3A 2DUOA 1RITA 4PQ9A 2FDGA 1RUE1 3ZFGC 2R042 1CESA 1Z7S1 4YM2A 3WW1A 4D6RA 5A6YA 3OBTA 2XJSA 2H0BA 4LOTA 2IC1A 1B35B 1CR7A 1VMFA 1WLWA 1OC1A 3BPZA 4BOWA 2DBIA 3N9MA 1PZ9A 4WM8A 3EO6A 5JOXA 2ARAA 5A1AA 4NRPA 3ITQA 1RUE3 5FYCA 4DZGA 2VTXJ 1UO9A 2WN2A 1CVNA 5F5CA 2VW0A 5FBZA 1BK0A 5A7NA 4CDXB 2A7AA 3S7IA 1J3RA 2HWD1 1W06A 4K1ZA 1XB9A 1W9FA 4YPJA 5FY4A 2DDUA 3MIFA 1R083 4L9BA 4RFT0 4P14A 4XF0A 4B3NA 3OUHA 1XPWA 3AP6A 4H7LA 2W3JA 1UWWA 2L9LA 3PUQA 4YZ4A 1UMHA 2ZX4A 4UBHA 4AI3A 3KLSA 3KMHA 3I3MA 4A42A 2QDNA 1ZRFA 1S2EA 4A4AA 1GQPA 1NCRA 3BTAA 2Z79A 4Y24A 1WW5A 2WO1A 4IEYA 3HT2A 1POV1 1H1AA 3WZ1A 5DAVA 5J98B 4JVAA 4CZSA 1LOEA 5ACA3 2GMEA 2QTWB 1PK6B 5DAQA 2OUJA 2VMGA 4EN9B 2MHFA 5FZGA 4M0HA 4YZ2A 3HN3A 3ZR5A 2W94A 3LKJA 1VRH1 4RN5A 2VOXA 4XF9A 5C9AA 2ADDA 1XNTA 4YVSC 1LOFC 3VDBA 2XH6A 1RVF2 3LFIA 1X36A 2XLGA 1IGOA 1LU2A 3N3HA 2WUHA 3WP6A 4XUTA 3GZEA 4BQ2A 1O5UA 4FBFA 3ILRA 2JIGA 5C3QA 1JXNA 4FPOB 4EE2A 3R6SA 4PBPA 3CJXA 2J1VA 4RA0A 1WMFA 4Z2WA 1IHMA 1E5RA 2AC1A 3AYDA 3MUZ1 5L9RA 2G1MA 5FMBA 2XOMA 5LK5A 3TN92 4E2QA 5F2SA 2UU8A 2DCJA 5FREA 4RFRB 4QWNA 2BVBA 3U10A 5FPLA 4GZ9A 5E8AA 4PF5A 2D3PA 4QGMA 3AL6A 1N1SA 4OHWA 1KFUL 1PO12 1ZYBA 1MQTB 4LO6B 2GH2A 2X10A 2VCBA 1CPNA 3LEGA 1KJRA 2ZAAA 5EJZB 4U2AA 4LK6A 1V6JA 2E6VA 3K3OA 5HPOA 5FR3A 2O14A 4KWJA 2ZGUA 5JXGA 1Q8QA 2UWBA 5JDBA 4P00B 5KHIA 1POV0 4AHYA 5BNNC 4IDZA 4N43A 1UNBA 5FP9A 3E5XA 2KM2A 4KI5M 4OULA 5FY8A 3KF5A 3N36A 3WXPA 2IVJA 5AC91 1QJFA 2XUMA 2C6SA 3N4MA 2QFEA 3B94A 2A3YA 4IE6A 4K8RB 5CFCA 3HOBA 2JG8A 4JDMA 2PHTA 3EMRA 1OI6A 2O0OA 3DPRC 4ATFA 4PT6A 1JHNA 3ST7A 1ODNA 2W08A 4FOYA 4AFMA 2JB8A 5EJ3A 5B2GB 4LK7A 4JV4A 4NJ4A 3RS6A 4Y5SA 3SKVA 3UESA 2VZ1A 3TEZA 2DU1A 1ZX5A 3QCWA 4XETA 3IAPA 4COVA 3OUIA 1RJ8A 1NQDA 2IFRA 1ZBA2 1HIXA 2ZMLA 1C8M2 4O61A 1F5JA 4M00A 5D8AC 3P3NA 1FMD3 2WL1A 2NMNA 1MS4A 2OT7A 2Z4FA 5DZFA 3M7AA 4R52A 3K4AA 1QJX3 2VOKA 2YPJA 1LESA 3OPWA 4C0BA 1S0JA 3RJ2X 4FPGA 5FYIA 3WSOA 3J7HA 3ZFGA 4CEWC 5D1IA 4AAXA 4BMBA 1YFXA 1XSRA 5D8AA 5LBCA 1V6OA 4AG4A 3IMMA 2VTXA 4YSFA 2HWC1 4FCAA 1PIV1 1W6NB 4FOVA 4LE3A 1ZBE2 5HXVA 4IEQA 1W6QB 3HJRA 2R49A 1VBC1 1VAMA 4XDQA 5CU1A 4Y26A 1OOPC 4BQ1A 2X5IB 1Q8VA 4AVAA 3LB9A 1UOGA 1J83A 2OXBA 2Y6GA 5GLTA 3I54A 4D6QA 2WQZC 1CAXB 4OI4A 4IEWA 5F6LB 1VE0A 3F2ZA 4ITCA 2AYHA 1GANA 2IXCA 1BK1A 4Q4V1 4FXKB 2YGLA 2ZHLA 3U1XA 4NO4A 1TMF1 3M4FA 1V00A 4QPGC 4XAEA 3MPPG 1PMHX 2Q4SA 2VGDA 3OYWA 4HVQA 3WHUA 2WC2A 1COV3 1FXZA 1YI9A 3NJXA 5E1RA 4YM3A 3NAPB 5J1XA 1VBB2 2EIGA 4KMQA 4QPGA 4YRDA 4RS5C 2V73A 3IDEA 4KG8A 3LA7A 2XL9A 1HLCA 2E26A 5I93A 2RS51 4Q1RA 3RGBA 5C6CA 3VBOB 1Q56A 2VY0A 1YQ5A 1ASJ1 1COV1 4PQQA 1ND2A 2BGPA 3WEZA 4G4FA 2B42B 2QQIA 1WCSA 4IGQA 1YLLA 1F2NA 3A22A 4HK9A 2XJQA 2GP3A 1CZSA 2R7EB 2X53S 1ZA4A 3Q8BA 1S2KA 5C70A 1JU3A 1ASJ3 1HV1A 5E16A 1CONA 3D5OA 2XMLA 4M4RA 1MS3A 4W50A 2P3JA 1QXRA 2ZBJA 5E6HA 3MIEA 1NG0A 2XQXA 3KT1A 1GOFA 2Q8EA 4R9CA 5ANNA 5C8CC 2CHHA 3J4UH 4UW3A 1EAH2 4EV0A 3NWKA 5A33B 2CAVA 2GP5A 2Y33A 4KWKA 4OI2A 3M3CA 4YGEA 2VQ0A 2FD8A 3KSCA 2MEV2 3PUIA 2E53A 3HNMA 3CJIC 5C8WA 5EYXA 4BM8A 1UYYA 1D2QA 1ZZ6A 3LA2A 4ZKTB 1HB3A 1QWRA 5I0TA 1MS0A 4WV8A 4ARYA 1ACCA 1H4HA 3PLQA 3D0SA 4BQXA 2GH8A 5FO9B 2NYYA 4UYBA 1JZ7A 4FOWA 2H6CA 3S57A 2V72A 3NJZA 4NAMA 4PDWB 3ZYPA 1C5IA 3ACHA 1QOOA 4QPWA 1FNZA 3ZXFA 4LO5B 1Z0HA 2VVEA 3RQ0A 4UFHA 1FNYA 4YG6A 3I97A 2A3XA 4GMP0 1O5LA 2Y8KA 2VXRA 3AFGA 1W3VA 1I6XA 3HVDA 3JBG2 3ZXGA 2XLAA 3LDKA 2W39A 5K0UA 2R0HA 4RSUA 1OQDA 4UFIA 5GLZA 4IV1A 3V64A 3VDAA 1O8PA 1REDA 4P9JA 1A8DA 1PX3A 2XUEA 1F35A 1UPSA 5FV3A 3LOBA 4CEYC 1ENQA 2R071 2BOJA 2WNOA 2QQVA 1H6YA 4LBQA 1CAUB 1PHMA 3KCCA 1IKPA 1C1FA 1UU4A 3VD5A 3WQ1A 4AEDA 2D40A 3PVOA 2QNKA 4QDSA 1SEFA 3OBZA 3UJOA 1SMVA 2WZEA 3LEMA 3LF7A 1AYM2 4PI0A 4QM9A 1ODMA 1QIQA 4LO4B 4TXWA 2LALA 1H2LA 4GB31 2HWB1 3QLQA 3ON7A 3AZYA 4IGOA 5C9AB 2VUCA 3VBOA 1JYWA 5HCHA 3BOPA 3PTYA 5FYVA 4B4RA 3URFA 1FPN2 4BB3A 5FPVA 3VDDB 2WLQA 2RR12 2Q8OA 2CDOA 4GB33 1UD1A 1W3XA 2JKXA 4BQ3A 3O0WA 4JRLA 1I5PA 2KD7A 3RNSA 1QJEA 1VPHA 2HEWF 4BLIA 5IUQA 1A3KA 4JDNA 3INAA 3O1RA 2WS91 1H1IA 3IIAA 4I02A 4WBBA 2O8OA 3DGTA 5EPAA 3HN1A 1HX6A 3K3NA 2VZUA 2CAUA 3ZN5A 3ATGA 2W1QA 1IQAA 5IATA 4EROA 1W6OB 5CKQA 1YC61 3GHNA 3GGLA 3KV4A 4GJYA 1GZWA 3WNPA 4Q4W3 4XMAA 4BIFA 1WMXA 1WZXA 2ZS6B 4IE4A 5FY9A 4JQTA 2HJIA 1YXWA 5A3LA 1BHGA 3PUSA 2XWJB 2A6ZA 1QNYA 4WM7A 4Q4X3 1ZRDA 2Y6FA 3ZSLA 3QD6A 2P1BA 4L8QA 1JH5A 1V9U3 2ORXA 3RI8A 4Q8LA 1SHWB 1F5FA 4D94A 3OGGA 5DG2A 2ID4A 2J22A 1EPZA 4HVOA 2RJLA 2YY1A 5FZBA 3TAYA 2VOWA 1JYVA 2DUQA 3PUHA 2VMIA 3E6BA 4LITA 2FQPA 2W5FA 3KM5A 2FCTA 3I49A 2FDHA 1DGLA 4XF3A 1PGL2 4FFHA 1C3HA 4FPKA 2ZXQA 1MACA 1R64A 4FFGA 3DYMA 5FXZA 1OQ1A 4C0HA 4QB1A 3A0NA 4GWIA 2PHLA 1TMF2 4GULA 1M06G 1AR92 2QBXA 5T3NA 1XC6A 4BU2A 1GP6A 1RUI1 3A4UA 3PTRB 1OFNA 4N53A 2VC9A 1G8WA 3HWJA 1VIWB 2NQYA 4ONUA 4BCUA 3D82A 1O91A 4RQPA 2XXZA 3FN9A 3HNBM 3L2YA 1XE0A 3IZOA 4M3CF 5J96B 1PO11 2ARBA 1I5ZA 2DVDA 2Z5WA 3POJA 1R1ZA 2Q8CA 2VVFA 2WDBA 2X5IC 4Q0UA 3VV1A 2V5YA 3L2HA 4FPCA 3H1WA 2R072 4EWEA 1VMJA 5DUWA 1W39A 2WNVC 2HKXA 5JOYA 1S2BA 2VMFA 4N7IA 1ZZ7A 4WVWA 1AL22 3VUOA 4MADA 1SLCA 2D98A 4AQTA 1S0EA 2DU0A 3H7YA 4AVCA 1YFWA 2WA4A 2ZGSA 3NKGA 4GH4A 5C3OA 4MGIE 3MLLA 1T6GC 1Y9GA 4FPYA 3FBYA 4TN7A 5JZGC 3ZSMA 1AR72 5FMCA 1OH4A 4RHV3 2ET1A 1TG7A 2WWJA 3VBFA 3WF1A 1PX4A 1FAYA 3VDDA 3H8UA 2B46X 1O3RA 4CUBA 4ARXA 4IETA 1PO22 5FP7A 3T4VA 2IVIB 1AX2A 3VD4A 2YPDA 4J25A 1UZZA 5J7MA 2C9KA 4UI9L 4IE5A 4GH4C 3FLTA 5JR7B 2OZJA 3P6BA 1MZ5A 3OY8B 4W4ZA 4IV3C 2D5HA 1KS4A 1YQ6A 3VBUC 4EZHA 4A3ZA 2SBAA 4P02B 3E6DA 5FTTC 5GZEA 4R8HA 3ILNA 2ZGLA 3KCXA 3B00A 4M3CB 3GZAA 2IFWA 1WBLA 1K12A 3O12A 1TVGA 5I0DA 3RWKX 1OUSA 5KXBA 3I59A 4ZY9A 3VBRB 5T5PA 1WW7A 4QPIB 5HI0A 3Q8CA 1OLQA 2YU1A 4FTEA 5A3UA 4XBLA 2JD9A 3N7KA 5C33A 3UV9A 1AYM1 1UY1A 1JYXA 5CA6A 1KJLA 1QQP1 4Y22B 4R9AA 4RD7A 5FP8A 1MEC1 2WNEA 4IEPA 4CCDA 5BXXA 2D43A 4CUAA 3GDBA 1NCRB 4PDWA 4Y1ZA 1PM4A 4EN7B 1AXZA 2P3YA 4PBOA 5FLIA 2RHPA 3WNOA 4XJ9A 1LNSA 1OURA 4AI8A 5ABJA 1NUKA 4UBGA 4LBOA 4RR3C 2ZZJA 4Q0PA 4XCAA 2J1AA 1ZBA3 3WVJA 2JDMA 1QOTA 4YW6A 2AACA 1PZ7A 5KXDA 2WFPA 1STMA 5FQ0A 1WWYA 1NKGA 3RMXA 3ZXDA 1YYNA 3TEXA 4XJ8A 1HB4A 5LRRA 2BQPA 1W8WA 2VOVA 3GALA 1GV9A 2JE7A 3ZFEB 1QJX2 2QQOA 3VHPA 4AGRA 1HXS2 4QXBA 4JGZA 4CEYB 5JLVA 1OVPA 3RJRA 5FY7A 1S0FA 4EYUA 4QB2A 3O1TA 1D0GA 1RUC1 3B02A 1CIWA 1R082 4XMIA 2DVAA 3CO2A 5CG8A 1RHI1 4XILA 1BEV1 1A8MA 2VVDA 3BU7A 3J8F1 2QCSB 4MXVA 1WBFA 1PO23 5EWSA 5KHHA 3S5QA 4B1LA 3MF9A 5FP4A 3WF0A 2VUAA 4IEUA 2B8MA 3OD0A 4LKSA 1KXGA 2V09A 1RUJ1 1RUH3 2XDVA 3M3EA 1GICA 4CCOA 5IVFA 3WNKA 3VBRC 3ZIXA 4DRRA 2ZGRA 1P8JA 3SH5A 3J8F2 4K1YA 5FZDA 1W8ZA 3NKTA 1X9TA 2RR11 3LE0A 4D7YA 2VMEA 3AKQA 3OGVA 5A6QA 3EJKA 3AZVA 2BPA2 4JAAA 3WNLA 1K3IA 2VPVA 2RS31 1AF9A 4XHXA 5A32B 1RGSA 2IXIA 3AFKA 3RG0A 1W8OA 1RUG1 1XNCA 1ENXA 3T1LA 3DN7A 3UGGA 4BXFA 1QJY2 4DO0A 1URXA 3ENRA 4Z2AA 3ZM8A 2GALA 3MW4A 4CCLA 1W05A 5FZ3A 1YIPA 4E4ZA 2LROA 1W6QA 1CZTA 4AEJA 5BNPB 1W6NA 5FPZA 5CIRA 2R30A 4MV2A 3VD3A 2OIIA 2QQJA 2WFF2 4W65A 3I8TA 3ZFEC 3AKPA 1MS1A 5FZOA 4S2HA 1Q8PA 5A7WA 5FYHA 2PQQA 3VDCA 5E89A 3GBGA 3V0AB 4F8AA 1UU6A 4Q5OA 2ZGTA 3VZOA 2YFZA 1JOBA 2IXLA 3POSA 4QHOA 1IZ3A 3DUIA 5LRSA 2PELA 4LA2A 2VUDA 4P9WA 1G9BA 3B69A 1SBFA 1JUHA 5A7WB 2D97A 4XQWA 4XQ4A 4AHZA 1NXMA 3EHKA 3LEKA 3VKMA 1F31A 4QU2A 4IL7A 4C1WA 2NLRA 1RUD3 3CLPA 4X6QB 4A6SA 1PGW1 5FUPA 3MLJA 4CCJA 2GMPA 3MEPA 5FZ8A 2RM21 3BCWA 4CTEA 1WW6A 3WDYA 3K77A 4Q29A 3AZXA 3DPRB 1GZTA 3C8XA 5CYYA 5FZKA 4YARA 5ACA1 3LAGA 1U12A 4FPJA 4XAAA 4X8NA 5DQ0A 5L19A 1X7NA 1RINA 4LORA 2WYSA 4P9IA 5LWBA 2DYCA 1X33A 5DZGA 2YC4A 4BQWA 3A21A 4XTMA 4CEWB 1BZWA 5JCTA 2VBPA 1I9RA 1SBEA 4J1XA 2HBUA 2DV9A 1LHWA 2Y0OA 2YV8A 4DXSA 1IS3A 4FSJA 2VR4A 4ES9A 4C8DA 1AXKA 1S0BA 4HMZA 3G7DA 5A3OA 5IVYA 4NWWA 1QXPA 4MSVA 3RYPA 2C9AA 4PIXA 1IPKA 1PIV2 1RUF3 2JENA 2YBPA 3HMYA 4HLTA 2B5HA 4QHZA 5F1RA 1DZTA 2YHJA 2J1SA 2RM23 1D0HA 4UFKA 2Q5TA 2WBKA 4Q4X1 3JD73 3B5LB 3J9SA 2Z69A 3WW2A 2BV4A 3MIBA 2ZEXA 1PM7A 2Q8DA 4Z8BA 4S2GA 1I3HA 3UGFA 3MLKA 3ZDVA 4M3CE 1VBA2 4PCRA 1AR62 4MVTA 1W2AX 1DGWX 4C91A 1ZBE3 2V5DA 1NXD1 4IUGA 1GWLA 4GWNA 1WUVA 1WW4A 1UIJA 2PFWA 5JUVA 2HWC3 1KFXL 2RDNA 5JSPA 3ZSEA 4NIGA 5IVVA 4PF1A 4LPLA 3CIHA 1DQ0A 4AQ2A 1DGRA 1W99A 1GFF2 3FC0A 2VMHA 4QXKA 2BDRA 3HBKA 4RR3B 1W90A 4XFAA 1QJX1 1DU3D 2W2IA 4IGPA 5JOZA 2JDNA 4A41A 2JECA 2WN3A 4QQHA 1PZ8A 2RJKA 1TMF3 2VXJA 2CYFA 2G4IA 4HVRA 2JG9C 3MI8A 2J1UA 4DUVA 4NHYA 4LIUA 4CEWA 1PK6A 4N90A 3R05A 3ZMNA 5C8CA 3SEEA 3JQXA 1RUC2 4QM8A 1HQLA 2JDUA 1CPMA 4NRQA 4Y22A 4JC1A 3VHRA 5JR2A 1J84A 1OXCA 3BI3A 1QKQA 2JG9A 5AC92 2PHDA 4JKMA 4QXHA 1ULPA 5GZCA 5LK7B 1T6BX 1H2KA 5DPNA 4HG6B 1AHSA 3CL1A 4HN0A 4LBNA 3O14A 1B09A 1S0GA 3S5AA 2Q30A 3I59B 4XVHA 1D4VB 1UF2C 3I3DA 3B7MA 1LHOA 4XJAA 4BQ4A 1RUNA 1X50A 1K5JA 2B7YA 2CGNA 4M3CA 5JI9A 4LHSA 3OCPA 3W21A 1DDLA 4XUPA 4D6SA 5JWPA 3BGAA 3BB6A 1O6UA 1LGCA 2Y0IA 2YFUA 3H50A 4WVZA 5FJHA 1N1YA 4D0QA 4QX3A 2Q1MA 1CWPA 1FPN1 3T4HB 1ULCA 3MDPA 4XCBA 3WCSA 3S30A 1WKYA 3RZGA 1UL9A 1JOPA 1U5ZA 3FLRA 3T2PA 4IE0A 1VB2A 4RHV2 1DQ2A 3J7LA 4RR3A 5EP9A 4L97A 1SBDA 4AZZA 3VKFC 2R32A 5ABJC 2WNVB 1H30A 1DYOA 2JX9A 3B93A 5C3SA 4YG0A 3AP5A 4R4XA 1GWKA 1VBE3 4PDWC 4SLIA 5F3CA 3ILFA 1YIFA 1W9YA 5BNPA 1H4GA 4COWA 4Y4RA 2RV9A 4QGLA 3PDQA 4KWUA 4NROA 3IWZA 2F6BA 2ARCA 3AKTA 1UOJA 2JXAA 3ACLA 3FBMA 4WZFA 2QE3A 2HWF3 4LLOA 2XBO2 2PQSA 4META 1TQ5A 1LAJA 4QXCA 4DOUA 5C4WB 5IWFA 2DCYA 1VJ2A 2Z2SB 1LR5A 3UKVA 3IDCB 2EICA 5JOWA 3T3YA 1PVC2 3TBDA 5KR7A 4OYUA 3KV5A 3ZOIA 2AEZA 2Q1FA 4OVEA 4CDUC 1K5MB 3UKNA 1YUDA 4ZU4A 2CGOA 2VULA 2ZX3A 3W59A 3GNEA 1HRI3 1PMIA 4JZRA 4MOAA 3RZHA 1FV3A 1ND3C 2VE1A 3R4SA 1YQCA 4FPHA 4XEZA 1DQ5A 1WLDA 1VRBA 1SZBA 2D6PA 2B39A 4FQ4A 1TZOA 1WA4A 4RQPB 4YGDA 1W2OA 1EUTA 2WO3A 4LTAA 2IWGB 4TLFA 3U37A 1RTVA 5FZ1A 2CGPA 4XJZA 4N8MA 5ACA2 4RYDA 3ECQA 5F32A 1XRUA 5JSOA 4JHZA 2VQUA 5A6XA 4DMIA 3N9PA 3WG3A 3N7MA 4JGYC 1AL21 3MYXA 3N7JA 3WUCA 1UKRA 1QGLA 4BQ5A 1MZFA 4H7MA 4RGAA 1EYBA 2ZHMA 3OGRA 2VZTA 3CEWA 1ZRIA 3NAPC 5FZMA 1Q3EA 1YFUA 1C4RA 1SLAA 3JQWA 5FAXA 5LBFA 4FT8A 1DG6A 3K51A 5I0UA 4FTSA 3T08A 1O8SA 4OZXA 3ZFEA 1IS6A 1OSGA 4QX1A 4AVTA 5FPBA 1RB8G 3FZ3A 1CGPA 3CZUA 4ZS2A 4N43C 1RIRA 3B9CA 1UN1A 3POYA 4Q4W2 3OPTA 4Q1PA 2Y6LA 2W1SA 3KT4A 1XU1A 3U14A 2RDRA 3AMHA 4JKLA 2AUYA 1GP4A 1JW6A 2DVBA 1HRV1 2JE8A 3FWEA 3N7LA 5FMOS 5K4LA 1MS5A 2ZHKA 3ES1A 4FPLA 4Q4W1 1O3TA 3ME2A 4ASMB 2EVXA 3NNLA 1E5HA 5KXEA 4XOGA 1G9FA 1ULOA 2ET7A 1UZVA 1W6OA 1BKZA 1XNBA 2W9XA 1RUH2 2J1EA 3GJAA 3ZKYA 4A3XA 2ZA9A 2EAKA 4N53C 4R4ZA 5A3WA 3ZDSA 1JYNA 2WS93 4PHZA 1MZEA 2WYFA 3LA3A 2BWCA 1QH6A 3CU7A 2BJSA 5IFPA 5FYMA 1SG3A 3I2HA 1HV0A 5JXIA 3BODA 3Q8EA 1S0IA 2FMDA 3NQHA 2W1WA 4KL1A 2AZ5A 1WMEA 4JX0A 3O7OA 3LSDA 3VZKA 2NM1A 3DECA 3U75A 4E4DX 1SLBA 3A23A 1K42A 5CB7A 1C8M1 3WV6A 1DLLA 2PXJA 4FPEA 1RHI2 3UT0A 4OZOA 4AFBA 1M4WA 1W2TA 2K0GA 3FUQA 4S2FA 5IVBA 5LEKA 2Y6HA 4V2WA 4MZUA 1QHDA 5LASA 4AI2A 3VKLA 4LKEA 1LCLA 1L7RA 4XFFA 5CAZA 3ZPYA 5H9QA 4UT5A 5A80A 2P3KA 1PMJX 2RJ2A 5G04L 3OTFA 5SV5A 3T1MA 1RUJ2 4CDWB 4CRQA 3LCPA 1C57A 2ZGNA 4GWJA 4M4PA 1F8VA 5KHGA 1W6PB 2QQNA 3M3OA 4JTOA 2NZ9A 5CKNA 1AR81 3RZLA 5LBBA 4PIYA 4DY3A 4BDVB 1GWMA 1XBFA 2CSGA 3FHAA 5DZEA 1V6IA 5IJRA 1EUUA 3OEAA 5C71A 5C5UA 2PHUA 3A0KA 4QKNA 4XZPA 3PNAA 2C4XA 4NRMA 4GH4B 5EXOA 3PHMA 3K2OA 5FZ6A 3THDA 4V1PA 1SDDB 4NHXA 4QDRA 4Q4Y2 2FZ2A 4GB32 2DCKA 4KQ7A 1MEC2 4CYDA 1RL3A 2Y6JA 1TME3 5AVAA 4CDQA 1ALYA 1QNWA 1RXFA 2P6HA 4AVSA 2TEPA 2ORZA 1NA1C 1RJ7A 2EXHA 4PJYA 1O3QA 1QY4A 4A44A 5FWJA 2EIEA 3KHBA 1MS9A 2WWSA 3K4DA 4XJWA 1ST8A 4L0PA 2BOIA 4GKYA 2VZVA 2VAUA 5FUNA 3WF3A 1WD4A 1QJZA 2ARXA 4LEJA 4KBBA 3C7HA 5F6KA 5A70A 3ORJA 4K6BA 1YFYA 3OF1A 3WD5A 1MR5A 4AEDC 3AMMA 4RS5B 4UWDA 1DP0A 1BBT2 3QACA 4JTNA 3ACFA 1H8TC 2QQUA 1GNHA 5G05L 4DNYA 2WT1A 5FPAA 1SPPA 4I0AA 4BQYA 1CAVB 2Y6KA 5F2WA 4WVVA 1GMMA 4Z82A 3SXWA 5J48A 5JIAA 2JDZA 1ENRA 1JZ4A 5CNAA 4XE9A 4ASLA 3GCWA 1RVF3 5FPUA 4D7TA 3SCFA 3FFZA 5FY0A 3IDAA 4BK4A 3LQCA 4QPIA 3MIDA 3MW3A 5GALA 5HV0A 2YBKA 3OG2A 2RM22 3ZX7A 3IIIA 1R091 1Y3TA 1FYUA 2VNOA 3POWA 4AGVA 1H9PA 1J3PA 1QXJA 3UK9A 4AI1A 5FP3A 5LW9A 5FZFA 5F37A 2XB6C 3D0JA 3MV11 1ASJ2 5EQUA 5K8SA 2G9GA 4C90A 2RS52 2W46A 5KWRA 2A75A 1R093 2PHWA 4QQOA 4WM7B 5BNOA 3LWCA 1U0AA 3OY8A 4XBNA 1OFSA 1XNKA 5C3RA 2BFUS 4NPMA 1F4AA 1JI6A 1CQ9A 4O7XA 1UCXA 4XHBA 3DEMA 1PIV3 1RUF2 1RUI2 2BTVC 2HWF1 4HPKA 4N7UA 2JKBA 1X8EA 1K5MC 3NV4A 4LBMA 1HXS3 2X5IA 4O9EA 5IK5A 3AP7A 4GMP3 1G9AA 2NP0A 3HQUA 3VZLA 2F4PA 3NMBA 3O1MA 2O1QA 2VW2A 4LUKA 1NYWA 1UQXA 4RQPC 2RMU2 2W0XA 1AR63 2GC3A 3V65A 2RVAA 5BUVA 3BOWA 3GM8A 3IMNA 3JUUA 1RUC3 3KVBA 1I1EA 2HWC2 3V0BB 1ND2C 1D4M3 4KBZA 2FCVA 3CMGA 4E8CA 4EJRA 3AP4A 3NV2A 5CFDC 3LIHA 5A7OA 3LD8A 2RS32 5LA2A 2OPWA 3AJZA 4QKFA 4AI0A 2HWD2 2WT2A 3CF6E 3SISA 4I01A 1SCSA 2I74A 3NRUA 1JZ2A 3HR9A 2D7FA 2D93A 3DKQA 1K45A 1VMHA 4A7YA 5BNOC 1OA3A 1HXS1 4LUMA 4HSLA 1WCQA 3E1F1 4LHNA 3AMPA 2MPFA 2D44A 1JN2P 5LEJA 3BTZA 1J59A 5K0UB 4UFMA 4YW7A 1J3QA 3AX4A 5JXHA 2BERA 2ZMNA 2V4AA 3VGIA 3HEIA 1LHNA 4QKDA 3ZYRA 4CU7A 1W2UA 1XE8A 2VJXA 3WG2A 1OKQA 3K75B 2JG8B 2KXLA 3EB7A 1SDWA 1QF3A 1D4M1 1KEXA 3T2OA 1RUG3 2O8QA 3PUAA 1UX7A 5A3TA 4M0NA 1R081 3WF2A 4AGGA 4LHKA 3X29B 3D3AA 3IBMA 2WINB 3K46A 3U0ZA 3ZLIA 1HJGA 1J58A 1H0BA 2ETEA 1R092 4NUBA 1UPIA 1FI2A 5FZLA 4F3JA 1XU2A 2XHNA 5LCWL 3POBA 1FX5A 3VBSC 1W6MA 4ES8A 3UNPA 5FZ4A 1LGBA 2PAEA 4LMFA 3TEWA 1UZ0A 1OLME 2JD4A 1LKNA 3SH4A 2C24A 3K48A 3TN93 4Y4YA 4L99A 5FO7B 3CBNA 4YZ1A 1FATA 2PA7A 2X05A 4LBKA 4TWTA 5H9SA 3AK0A 2EAAA 3NNJA 3WHTA 5FRAA 4XYXA 2DFCA 1W6PA 2WFF1 3VBOC 1RUOA 4CDQC 2FDIA 5GKAC 2HWB3 2OPKA 3PVEA 1VAKA 2JWPA 5DDJ3 5T5OA 5AVPA 5CISA 2LM3A 3VD9A 3J26N 3OGSA 2QDRA 4EQVA 5BYNA 2JE9A 1D4M2 2QZ2A 2UWCA 2SLIA 4XBQA 4CU6A 2WT0A 3PJQA 3BIEA 5F7UA 5KHKA 2A71A 2I45A 2FHRA 2B9UA 2EA7A 5I0SA 3ZKUA 4RL7A 2A1XA 5T54A 5EFUA 2YZ4A 1W2NA 4MGYE 3NAPA 3HNYM 4LO7A 2ZTNA 1UZWA 4WVMB 3OYWB 3H8OA 4LJHA 1AJOA 3MF6A 4WZCA 2OS2A 4C1XA 3KQ4B 3VBHB 4ET7A 4NIIA 2Q0AA 3E6CC 2ILMA 2FZ1A 1JU4A 4Y1XA 3WDXA 3WW4A 4YWAA 4A6OA 1CAVA 4OQ9A 1A34A 3KQRA 4TZDA 3NV1A 4YVWC 1W8TA 1KDKA 4IE7A 4QQLA 4NIDA 1AVBA 1DQ1A 3FHIB 4BPZA 4O9GA 2CV6A 4CPBD 5FMDA 2QQLA 4JDOA 1C8M3 4CCCA 1L7LA 1G9DA 5L7OC 3PU3A 4DEQA 5IFTA 2PHXA 5JVVA 5T5JA 1YCIA 1LB2A 3PURA 2JDYA 4BZ4A 2AENA 5FWEA 1W9SA 4GA9A 1L7QA 2QQMA 2X29A 3V56A 4W6YA 4OHYA 4CDQB 2UYAA 1Y7BA 1RUF1 2ZJCA 4QB6A 2IXHA 3LDRA 3N9NA 5M0TA 4AQSA 3MIGA 2CWSA 5I8TA 2GU9A 4BJ0A 1XOYA 5J3UA 3VZMA 2D5FA 4HXCA 4XZUG 3I2OA 2ZCWA 4CXYA 4YVSB 4LBLA 5GZDA 1CX4A 3TNQA 1OMIA 5FYUA 5IHRA 1BVVA 5CEHA 4I0BA 3ZYBA 2NPIA 3U4SA 4OHVA 1JYCA 1AUYA 1V6KA 2RE9A 4YVWB 1H8VA 3VBUA 3NJYA 2VQTA 4NHKA 1MVQA 1GNZA 3VN4A 3L9JT 3H3LA 4A7KA 1E5IA 4DXZA 1X8MA 4AYUA 3NVCA 3AMQA 1ZZ9A 1Z78A 1VBB3 4KWLA 3SC7X 2WSVA 3ZXEA 4UW6A 3WR0A 1LRHA 4LT5A 3R4UA
chains in the Genus database with same CATH topology
2ZKLA 1U5XA 4K8FA 3VZJA 2Z42A 4F7ZA 2PHFA 3V0BA 5CFDB 4NN0A 5GLVA 4B4PA 1LULA 4QPGB 2DVFA 4LBQD 4MXWA 2P3IA 4Q4V3 3PMSA 5FPXA 3PVNA 2YUEA 4YM0A 1G9CA 2D6OX 4XXPA 1ZM1A 3MFAA 4XTPA 4Q0QA 1SLLA 1NCQB 1REFA 2WNVA 4JRAA 4PLNA 1ZBE1 1DQ6A 3RMYA 1LHUA 1Y9QA 2YC0A 4XFBA 4G3YC 3JD72 4MX3A 3HD8B 1GSLA 3WP3A 3E97A 1G6NA 2R041 5FFOC 4R9BA 4QHBA 1DIWA 1OPMA 1H9WA 1YI7A 2ZX1A 1PGW2 3VKNA 2GC2A 1PNFA 1VBC3 4Z1VA 5GJ6A 4KNCA 5KXCA 2P17A 3WUDA 1WLCA 2DWRA 4YNIA 2ZOEB 2JG8C 1RC6A 2VNRA 3I2DA 3H1MA 1C8NA 2ATFA 4LLFA 4MH0E 3VKOA 3C3VA 2A6VA 1C5HA 3O0VA 3FFQA 5KC5A 3H3ZA 3ZN4A 5JPMB 1B35C 3SNMA 4IEVA 2DCTA 2CY6A 1O4TA 2GZWA 3AJYA 2VU9A 3RYRA 1OOPA 4Q26A 2DCZA 4YGBA 3QOPA 2TNFA 1UKGA 5JZGB 1AL23 3RRDA 2ZAHA 4FXGB 2G9FA 4KU7A 1V70A 3U4XA 2D6KA 1FPN3 4COZA 1ULGA 1K5MA 1LECA 1REEA 2YXSA 3NV3A 3ZXJA 3ZXAC 5H9PA 1SCRA 1QQP3 4OFGA 1AR71 1ZRRA 1UW8A 2RMU3 3ALQA 1BVP1 5FCCA 4GIQA 3WY6A 2WFF3 1VLNA 4G9SB 2ZZQA 2EXJA 2A6XA 5FLJA 1Q5OA 1YO8A 2NN8A 5KBFA 3WLUA 4TYSA 4ATEA 4GKXA 3RPQA 4GQ7A 3THPA 3WT3A 2WS92 3DF0A 3MZHA 4DFSA 4KG0A 2QJVA 3EXUA 2DURA 3LZZA 4Y20A 5TSWA 1V9U2 3SCHA 2PYTA 4CDWA 2EALA 2GAUA 5CFCC 3MICA 1QDOA 4Y1VA 1N47A 2GNMA 1VB4A 3ASIA 1SQ4A 1S0CA 1XYOA 2RMU1 5DG1A 4DRVA 1NCRC 3O0XA 1KQRA 1UMZA 4YGCA 4YW1A 1RHI3 1VAVA 2GNBA 5J37A 5L36A 4AQ6A 3GYDA 2RS33 2VW1A 4QPYA 4ZU5A 2HWD3 1HRI2 1RUH1 1RUJ3 3VL8A 1PGL1 3GHMA 5FDBA 2FMYA 3KS7A 4P9XA 4I0WB 1EV11 3FJSA 2I07B 2PLV2 4E2SA 1JUIA 5BPXA 1MQTC 4OI0A 4XJUA 4I09A 1EAH3 1WMDA 1ND3A 1POV3 2GSYA 3CNAA 1LGNA 2XBO1 2WZPP 2R073 2OYZA 1HW5A 1ZZ8A 5CBLA 4IERA 3WDWA 1BBT1 1GLHA 1LU1A 1TME2 1FMD2 4NOTA 1AL0G 4OUSA 4GWMA 1XYNA 1ZZCA 4AE2A 1ONAA 3S0MA 1FV2A 2C1FA 1O4YA 1VR3A 1QU0A 1KS5A 1Z7S2 3GF6A 3MPBA 2OVUA 1GR3A 5BNPC 2XHKA 1S55A 1VBD1 4K20A 1FOD1 2R062 4B29A 2BNMA 2Y26A 4DINB 1ZVFA 4AVVA 1LEDA 3U11A 3WG4A 1VRH3 2XLFA 3M3QA 1FOD3 1HQWA 1BXHA 4I2OA 2HWB2 2XWBB 3FLPA 3ZSKA 1R1A2 1IS5A 4QD2A 1XNDA 3RSJA 2BUKA 3W9AA 1WLTA 5CFDA 4P9LA 2PLV1 5I8YA 1DZRA 4D7SA 2D3RA 1TNRA 1QJY3 1QJU1 3WQ7A 4LULA 3THTA 4FO9A 1VBB1 1LHVA 2A6YA 4Q2FA 3IM0A 4P5HA 2XJUA 2BNOA 1DZQA 2VUJA 4A2UA 5HCFA 3JD71 3NW4A 4DPNA 4R9DA 5JMCA 3ZFFB 4N9IA 3VBUB 3AM2A 2DF7A 5E88A 4AHWA 2BEOA 4HSJA 1YRZA 4CP0A 1RVF1 1LOGA 1AZDA 4PLMA 3KD4A 4IV1C 3DV8A 2PAKA 3VLBB 4AFCA 4H14A 2XJRA 1NQJA 3PJYA 2MEV1 3OPZA 4KH9A 1MS8A 3ZYGA 4LE4A 3U07A 2GN3A 2Y38A 1BYHA 4FP2A 2AR6A 1FMD1 4K3UA 1HRV2 3KB5A 1LTEA 3TYJA 2ZGOA 3TRSB 5GLWA 3WOGA 2JICA 4YYOA 3USUA 1PVC3 4NWVA 4XIOA 2MNGA 5KC6A 2XKOA 2XVLA 5I91A 4FTBA 1JOJA 3ES4A 1GQHA 3IDBB 2DFBA 5BNNA 4YW5A 2RS12 4MLOA 1R1A3 4CDUA 3ZVXA 1NA1B 3VBHA 1NE6A 4XIKA 5C8CB 4OHZA 3VBSB 2R0FA 1CJPA 3P3PA 3AB0A 2D6NA 4Q0VA 3E5UA 3TWIA 4AEKA 2BYVE 4EWAA 2FBEA 2R061 2XL7A 4DY5A 5BNQA 1HRI1 4AFAA 4XFGA 2BBVA 3MW2A 4HZFA 3H9AA 4YW4A 4LA3A 1Q8OA 2WZR3 3KCYA 1SFYA 4OLLA 1QH7A 2IXJA 1AR61 4EN8B 2Q1ZB 2LTNA 1PO21 1QDCA 4NVPA 1DBNA 1EPWA 1A6CA 4NPRA 4MUVA 3HT1A 5CADA 3AKRA 1U5IA 4HL0A 1DYPA 4QT6A 1BJQA 1E57A 4GMP1 1AR73 2HWE1 3FE5A 1F9KA 4MGZE 1TNFA 2BVVA 2X8KA 1UU5A 1ULFA 1AYN1 3VBFC 1D2SA 5JZGA 3S7EA 3HQXA 1LEMA 5DDJ2 1C28A 2QZ3A 1W6MB 1OOPB 4HANA 4IV3B 3UL2A 4L11A 1RMU3 1NLRA 5C9AC 5ABJB 3N35A 3JCIA 2ZABA 1HRV3 3WP4A 1RUD2 4AF9A 2ZGPA 2AREA 3USSA 2GMMA 2PHRA 4S2DA 4XW3A 2P37A 1V6NA 3JZVA 3FMGA 1NY71 2JJ6A 4MYEA 1PK6C 2UYBA 3PMEA 3TB0A 4HKOA 4JCKA 2K2SA 5HCAA 5EV7A 2HYKA 1UIKA 2GNDA 3AYCA 3C2UA 2VECA 1EV12 4HT1T 4FQZA 3I4IA 4BE3A 3GZUC 2BNNA 2QUOA 4DS0A 1S1AA 4XFIA 1DGWA 3GBFA 3KGZA 4YZ3A 4BH9A 4BYYA 2GC1A 1QOSA 4JQRA 4LO8A 3RI9A 2XPJA 1YHFA 4K40A 2XJTA 3DKWA 1V6LA 5GM0A 4P9YA 1O7FA 1N3QA 1WCKA 4COYA 1HQNA 4IXLA 4PLOA 1GZWB 2P34A 3OGJA 2E7AA 5I8SA 1SACA 3D4KA 3VHOA 5FOBB 1VBD3 2XBO3 4XF4A 3WNXA 1PGSA 1V9U1 2CWMA 5K7PA 4URTA 2WNUB 4D3WA 5JI7A 1DFQA 1OQEA 2WNUA 4ORFA 3VHNA 1APNA 4JGYA 3LGRA 2W68A 3TOJA 4AWDA 2ZGQA 3ZXKA 2P2KA 4HPKB 1H8TB 1OA2A 1HDKA 2WSUA 2IZWA 3CJIA 2H0VA 1Q43A 5T55A 3W58A 2EXKA 3ROUA 1VBA1 5FOJB 5K9YA 1BBT3 4AVBA 1A78A 4W6WA 5L7OA 3HAGA 3ZFFC 2TBVA 4XPVA 1H1MA 1NZCA 4XFHA 3WP5A 5SV8A 3SCGA 4N53B 5HCBA 4YVWA 1FT9A 4XQDA 1C1LA 1CAWB 3IN9A 3GBWA 4BMEA 2DTYA 4I3GA 2GN7A 1EP0A 5DUUA 4B8EA 3M70A 4YVSA 2XGXA 4SBVA 2ZHNA 3DL3A 4E9KA 4B4QA 5JAXA 3EQEA 1QMJA 2DTWA 1W0OA 5AFBA 2BWAA 1VALA 2A70A 4JGZB 4CEYA 4ZU7A 4W6XA 1U5YA 4RS5A 3UJQA 1AJKA 1GBGA 2E63A 2WJSA 4IV3A 4UW4A 3VL9A 3G6JB 2PLV3 4HKWA 3WDTA 5GZGA 4CDWC 4I3PA 1AR83 5FQ0B 4BLJA 1RUI3 4KGGA 4D69A 1YJKA 2CTVA 4F83A 2BFUL 5A3MA 1MZ6A 2PN5A 4CP1A 3UKTA 1DHKB 5HBAA 4Q8KA 1VBE2 1PO13 4RGGA 3MFCA 3WCRA 4L2NA 1SLTA 1TME1 1UX6A 2HWE2 4ZXKA 2R16A 1QJU3 2YROA 1KITA 2HEVF 4FP3A 2WLPA 1YJLA 2ZGMA 1X82A 4Q0SA 1OLRA 4QQPA 1Y43B 4WVMA 3VBRA 3B01A 3ZSJA 2R063 3E5QA 4LBJA 4I30A 3R4DB 4Y5Z0 1VRH2 1AR93 4K7JA 4X8PA 5DUXA 1PNGA 5L73A 5C9AA 3QBQA 2XVGA 1OHFA 3AZWA 1FOD2 4N9HA 3MGUA 2XJPA 4HETA 3TNPB 1V6MA 3H1YA 3BIWE 4KU8A 3CJIB 4UW5A 5EZWA 2N7GA 1NOVA 4LR4A 1NA1A 2QVSB 2ZMKA 4IEXA 4COUA 4QQ2A 5BNNB 4JGZC 4EN6B 3H7JA 4P9GA 1OPOA 2OA2A 2MEV3 2CNAA 3ZO0B 1N3OA 4JGYB 3VBFB 1RUG2 2IXKA 3PVBB 1MEC3 3JU9A 4RHV1 3M8LA 5BV6A 3IKWA 2A5ZA 3ELNA 1VBE1 2PAMA 1LOCA 3AKSA 1ULEA 2UY9A 4YM1A 5D8AB 1LENA 1LOBA 1ZNPA 5T5LA 5IK8A 1KDMA 3NL1A 1IPJA 1JBCA 4FPFA 1AR82 3HBZA 1J1TA 1AXYA 2R043 3IT8A 5T52A 1SFNA 3JBG3 2WIIB 1WD3A 4K21A 3LSEA 3ZYJB 4WM7C 4QX5A 5H9RA 1AX0A 1BQPA 1L3JA 3OBRA 1RUE2 2YGMA 5A33A 1YWKA 1NLSA 1SLIA 3KZ4C 5AFEA 4OHXA 1JTZX 3AZZA 3EBRA 1WCDJ 4QGNA 1OA4A 3ZFFA 1AYM3 2EXIA 2ZPXA 5J36A 1XXNA 3M1HA 1VBC2 2UY8A 1W0PA 2WZR1 2BGCA 2ZX0A 1ENSA 1LJ7A 4LHLA 4E4SA 2NMOA 2WZR2 3JB4C 4YLZA 3S6PA 1CAWA 1ZBA1 1S0DA 2ERFA 3VDDC 1NE4A 3D8CA 3WG1A 1ZREA 4QPIC 2OW4A 5F9TA 4A7ZA 5L7OB 1AX1A 4IEZA 4Y1YA 2DVGA 5C4WC 3LOIA 5DUVA 1CN1A 1AYN3 3ETQA 4HK8A 5JPNB 1IOAA 2K9ZA 5FMOL 5K0UC 4Q4X2 5C4WA 2UWAA 1H8TA 2UURA 1RMU1 5JIUA 2OUHA 4IQPA 4J6GA 4E2GA 3WDVA 1RMU2 2R1DA 1Z7S3 2WA3A 2WKKA 5BNOB 2E9QA 1QQP2 2QKDA 1VBA3 1YNAA 1EAH1 3WQ0A 2VQAA 3Q9OA 5FLHA 2EF6A 2AH2A 5EYYA 2I2SA 4J1WA 4WM8C 3ZXLA 5FO8B 2XKPA 1EV13 4HBNA 3VBSA 3ZIWA 3APBA 4DB5A 1ULDA 4HN1A 4AEDB 2B45X 3OD4A 4Q27A 1CAUA 4LBQB 3WW3A 1WGPA 3M3IA 1N3PA 5IK7A 4IV1B 2C0ZA 4KGQA 1N1VA 1LOFA 2A73B 3O5SA 3USUB 1NY72 1GZCA 5AC93 2JEMA 2YMZA 4LNVA 2YDEA 1RUD1 3R0RA 4HFSA 4X6RB 5I0RA 2JG9B 2R1BA 1UZYA 5IT6A 3D6EA 5CFCB 4YFWA 1EY2A 4CDXA 1VBD2 1DF0A 1J1LA 2E51A 2C5DA 4ISRA 4Q4V2 3HIFA 5F5QA 1TE1B 3AYEA 3I7DA 4H55A 1DYKA 2XVKA 4Z07A 1AYN2 4WM8B 3VZNA 2R6QA 2ZGKA 1MQTA 3AMNA 1NCQC 2W52A 2E7QA 4IEOA 1XQNA 3BALA 3NSTA 1UAIA 1Q8SA 1ZRCA 5T50A 1COV2 3ZYIB 4L92A 3RYKA 3GZTB 3RWNA 2RS11 4YZ5A 1AR91 3VBHC 1LOAA 1GKBA 1GQGA 1XE7A 3ZMOA 3AXDA 2HWF2 3H3UA 2VH9A 1ND2B 1O4ZA 2XG3A 4M01A 4FAHA 1ZZBA 4AXOA 2ENRA 1BMV1 2RS13 2LUWA 3RDIA 2VG9A 5GLUA 4QMAA 3KT7A 5GZFA 5JSRA 2QQPA 1CJDA 4GXLA 4DQAA 1DGRN 1QJY1 1BEV2 2H6BA 3JB8A 1G86A 3IPVA 2TUNA 4NHLA 3WDUA 5J09A 4EWDA 1TEIA 1DQ4A 4PIZA 4INDA 2ZACA 4CDUB 4OUMA 4MGKE 3DPRA 4NR1A 3KGLA 3SH3A 1CAXA 3ZN6B 4BIOA 4IESA 4XF1A 2VNGA 4AHXA 1VP6A 2CL2A 5BY5A 1KRIA 4AW7A 4Q4Y3 2A6WA 1OD5A 1IKQA 4BHPA 3SLIA 2ZX2A 3B3QE 3ZFGB 1PVC1 1G7YA 2D6MA 2A3WA 2KA3A 4EN0A 1GZ9A 3NO8A 3M2MA 5IK4A 2HWE3 1ND3B 3SMHA 1R1A1 4ISQA 3ZN6A 3V0AA 1O3SA 3SITA 1JYIA 3AP9A 4Z92B 3MIHA 5DXDA 2BW8A 4FOQA 4AFDA 1B35A 1LODA 4GALA 3SHRA 1NCQA 4B7KA 4E27A 1IS4A 3J8F3 5CVRA 1H2MA 3B9IA 4YW3A 3IPVB 1KD7A 4Q4Y1 2E7TA 2D3SA 2HEYF 4H3WA 4MXWB 4U36A 2XJVA 2AGSA 2GDFA 2YYOA 1BCXA 1XYPA 1QJU2 1MVEA 2PTMA 4XFCA 4YFZA 4Y1UA 1H2NA 1GYKA 3QH7A 3H0OA 3JBG1 3QH6A 4CDXC 5A32A 1PVXA 3AXEA 3TN91 2DUPA 1CD3G 2RR13 1BEV3 4HKLA 3AYAA 4N43B 4TSVA 2D6LX 3FX3A 4YW2A 1BMV2 4Y20B 4BWOA 5KHJA 2WNUC 4BA6A 3T2TA 2ES3A 4AEMA 3WX5A 4FAGA 2GNTA 1N1TA 2RS53 4NHMA 2ZKNA 4UXAA 3OJBA 4XXAA 3FUOA 5DDJ1 2OZ6A 3RZZA 2WQ4A 4YG3A 4OI1A 4FVVA 2GC0A 4K9SA 4B7EA 4CP2A 3WINE 4AK3A 2DUOA 1RITA 4PQ9A 1RUE1 3ZFGC 2R042 1CESA 1Z7S1 4YM2A 3WW1A 3OBTA 2XJSA 2H0BA 1WLWA 1B35B 1CR7A 2IC1A 3BPZA 4BOWA 1PZ9A 4WM8A 3EO6A 5JOXA 1RUE3 4DZGA 1CVNA 5FBZA 2VW0A 4CDXB 2A7AA 3S7IA 1J3RA 2HWD1 4K1ZA 3MIFA 4L9BA 1R083 4RFT0 4XF0A 4P14A 4B3NA 4H7LA 3AP6A 4YZ4A 2ZX4A 4UBHA 4AI3A 3KLSA 3KMHA 1ZRFA 2QDNA 3BTAA 1NCRA 4Y24A 2Z79A 1WW5A 4IEYA 3HT2A 1POV1 1H1AA 3WZ1A 5J98B 4JVAA 4CZSA 1LOEA 5ACA3 2GMEA 1PK6B 4EN9B 2OUJA 2VMGA 2MHFA 4M0HA 4YZ2A 3LKJA 1VRH1 2VOXA 4XF9A 4YVSC 1LOFC 2XH6A 1RVF2 1X36A 2XLGA 1IGOA 1LU2A 3N3HA 3WP6A 1O5UA 4FBFA 3ILRA 1JXNA 4FPOB 3R6SA 4PBPA 3CJXA 4RA0A 1WMFA 4Z2WA 1IHMA 3AYDA 5LK5A 3TN92 4E2QA 2UU8A 2DCJA 5FREA 2BVBA 3U10A 5E8AA 4PF5A 2D3PA 4QGMA 1N1SA 4OHWA 1KFUL 1PO12 1ZYBA 1MQTB 4LO6B 2GH2A 1CPNA 1KJRA 2ZAAA 4U2AA 1V6JA 2E6VA 4KWJA 2ZGUA 1Q8QA 2UWBA 5JDBA 5KHIA 1POV0 4AHYA 5BNNC 4N43A 3E5XA 2KM2A 4OULA 5AC91 3WXPA 3N36A 2XUMA 3N4MA 2QFEA 3B94A 2A3YA 5CFCA 2JG8A 4JDMA 2PHTA 1OI6A 2O0OA 3DPRC 4ATFA 1JHNA 3ST7A 2W08A 4FOYA 4AFMA 5B2GB 5EJ3A 4JV4A 3RS6A 2DU1A 1ZX5A 3QCWA 4XETA 4COVA 1RJ8A 1NQDA 2IFRA 1ZBA2 1HIXA 2ZMLA 1C8M2 1F5JA 4M00A 5D8AC 3P3NA 1FMD3 2WL1A 2NMNA 1MS4A 5DZFA 3M7AA 4R52A 1QJX3 2VOKA 2YPJA 1LESA 4C0BA 1S0JA 3RJ2X 4FPGA 3ZFGA 4CEWC 5D1IA 4BMBA 1YFXA 5D8AA 1V6OA 4AG4A 4YSFA 2HWC1 4FCAA 1PIV1 1W6NB 4FOVA 4LE3A 1ZBE2 5HXVA 4IEQA 1W6QB 5CU1A 2R49A 1VBC1 1VAMA 4XDQA 4BQ1A 4Y26A 1OOPC 2X5IB 1Q8VA 4AVAA 3LB9A 5GLTA 3I54A 2WQZC 1CAXB 4OI4A 4IEWA 5F6LB 4ITCA 2AYHA 1GANA 2IXCA 1BK1A 4Q4V1 4FXKB 2YGLA 2ZHLA 4NO4A 1TMF1 3M4FA 1V00A 4QPGC 3MPPG 2Q4SA 2VGDA 3OYWA 4HVQA 3WHUA 2WC2A 1COV3 1FXZA 1YI9A 5E1RA 4YM3A 3NAPB 1VBB2 2EIGA 4QPGA 4YRDA 4RS5C 2V73A 3IDEA 4KG8A 3LA7A 2XL9A 1HLCA 5I93A 2RS51 4Q1RA 5C6CA 3VBOB 1Q56A 2VY0A 1ASJ1 1COV1 1ND2A 4G4FA 2B42B 1WCSA 1YLLA 1F2NA 4HK9A 2XJQA 2X53S 1ZA4A 1S2KA 1ASJ3 1HV1A 5E16A 1CONA 3D5OA 1MS3A 2P3JA 1QXRA 2ZBJA 3MIEA 1NG0A 3KT1A 4R9CA 5C8CC 3J4UH 4UW3A 1EAH2 4EV0A 3NWKA 5A33B 2CAVA 4KWKA 4YGEA 4OI2A 3M3CA 2VQ0A 3KSCA 2MEV2 2E53A 5C8WA 3CJIC 5EYXA 4BM8A 1D2QA 1ZZ6A 3LA2A 4ZKTB 1QWRA 5I0TA 1MS0A 4WV8A 1H4HA 3PLQA 3D0SA 5FO9B 2GH8A 2NYYA 4FOWA 2H6CA 3NJZA 4PDWB 3ZYPA 1C5IA 3ZXFA 1QOOA 1FNZA 4LO5B 1Z0HA 2VVEA 3RQ0A 1FNYA 4YG6A 2A3XA 4GMP0 1O5LA 2VXRA 3AFGA 1I6XA 3JBG2 3ZXGA 2XLAA 2W39A 5K0UA 2R0HA 4RSUA 1OQDA 5GLZA 4IV1A 3V64A 1REDA 4P9JA 1A8DA 1UPSA 3LOBA 4CEYC 1ENQA 2R071 4LBQA 1CAUB 1PHMA 3KCCA 1IKPA 1C1FA 1UU4A 3WQ1A 4AEDA 2D40A 3PVOA 2QNKA 1SEFA 3UJOA 1SMVA 1AYM2 4QM9A 4LO4B 2LALA 1H2LA 4GB31 2HWB1 3QLQA 3AZYA 5C9AB 3VBOA 3BOPA 3PTYA 4B4RA 3URFA 1FPN2 3VDDB 2WLQA 2RR12 2Q8OA 4GB33 1UD1A 3O0WA 4JRLA 3RNSA 2HEWF 4BLIA 5IUQA 1A3KA 4JDNA 3INAA 2WS91 1H1IA 3IIAA 4I02A 4WBBA 2O8OA 3DGTA 3HN1A 1HX6A 2CAUA 3ZN5A 3ATGA 1IQAA 4EROA 1W6OB 3GHNA 1GZWA 4Q4W3 4XMAA 4BIFA 2ZS6B 2HJIA 1YXWA 5A3LA 4WM7A 2XWJB 2A6ZA 1QNYA 4Q4X3 1ZRDA 3ZSLA 3QD6A 4L8QA 1JH5A 1V9U3 3RI8A 4Q8LA 1F5FA 4D94A 3OGGA 5DG2A 4HVOA 1EPZA 2RJLA 2YY1A 3TAYA 2VOWA 2DUQA 2VMIA 3E6BA 2FQPA 3KM5A 1DGLA 4XF3A 1PGL2 1C3HA 4FPKA 1MACA 1OQ1A 4C0HA 3A0NA 2PHLA 1TMF2 4GULA 1M06G 1AR92 5T3NA 1RUI1 3A4UA 1OFNA 4N53A 1G8WA 3HWJA 1VIWB 2NQYA 4ONUA 4BCUA 3D82A 1O91A 4RQPA 3L2YA 4M3CF 5J96B 1PO11 2ARBA 1I5ZA 2DVDA 2Z5WA 1R1ZA 2VVFA 2X5IC 4Q0UA 3VV1A 2V5YA 3L2HA 4FPCA 3H1WA 2R072 4EWEA 5DUWA 1W39A 2WNVC 2HKXA 5JOYA 1S2BA 4N7IA 1ZZ7A 4WVWA 1AL22 3VUOA 1SLCA 2D98A 4AQTA 1S0EA 2DU0A 3H7YA 4AVCA 1YFWA 2WA4A 2ZGSA 3NKGA 4GH4A 4MGIE 3MLLA 1T6GC 4FPYA 3FBYA 5JZGC 3ZSMA 1AR72 4RHV3 2ET1A 3VBFA 1FAYA 3VDDA 3H8UA 2B46X 1O3RA 4IETA 1PO22 1AX2A 5J7MA 1UZZA 4GH4C 3FLTA 5JR7B 2OZJA 1MZ5A 3OY8B 4IV3C 2D5HA 1KS4A 3VBUC 2SBAA 5FTTC 3E6DA 5GZEA 4R8HA 3ILNA 2ZGLA 3KCXA 3B00A 4M3CB 3GZAA 2IFWA 1WBLA 3O12A 5KXBA 3I59A 3VBRB 5T5PA 1WW7A 4QPIB 5HI0A 1OLQA 4FTEA 4XBLA 3N7KA 5C33A 3UV9A 1AYM1 5CA6A 1KJLA 1QQP1 4Y22B 4R9AA 4RD7A 1MEC1 2WNEA 4IEPA 5BXXA 2D43A 1NCRB 4PDWA 4Y1ZA 4EN7B 1AXZA 4PBOA 5FLIA 2RHPA 4XJ9A 4AI8A 5ABJA 4UBGA 4LBOA 4RR3C 2ZZJA 4Q0PA 3WVJA 1ZBA3 1QOTA 1PZ7A 5KXDA 2WFPA 5FQ0A 3RMXA 3ZXDA 1YYNA 4XJ8A 5LRRA 2BQPA 2VOVA 3GALA 3ZFEB 1GV9A 2JE7A 1QJX2 3VHPA 4AGRA 1HXS2 4JGZA 4CEYB 5JLVA 3RJRA 1S0FA 1D0GA 1RUC1 3B02A 1CIWA 1R082 4XMIA 3CO2A 2DVAA 5CG8A 1RHI1 4XILA 1BEV1 1A8MA 2VVDA 3BU7A 3J8F1 2QCSB 4MXVA 1WBFA 1PO23 5EWSA 5KHHA 3MF9A 2VUAA 4IEUA 2B8MA 3OD0A 1KXGA 2V09A 1RUJ1 1RUH3 3M3EA 1GICA 3VBRC 3ZIXA 4DRRA 2ZGRA 3SH5A 3J8F2 4K1YA 3NKTA 2RR11 4D7YA 3AKQA 3EJKA 3AZVA 2BPA2 4JAAA 2VPVA 2RS31 1AF9A 4XHXA 5A32B 1RGSA 2IXIA 3AFKA 3RG0A 1RUG1 1XNCA 1ENXA 3T1LA 3DN7A 1QJY2 1URXA 3ENRA 2GALA 3MW4A 1YIPA 4E4ZA 1W6QA 4AEJA 5BNPB 1W6NA 5FPZA 5CIRA 2R30A 4MV2A 2OIIA 2WFF2 4W65A 3I8TA 3ZFEC 3AKPA 1MS1A 4S2HA 1Q8PA 2PQQA 5E89A 3GBGA 3V0AB 4F8AA 1UU6A 2ZGTA 3VZOA 2IXLA 3POSA 1IZ3A 3DUIA 5LRSA 2PELA 4LA2A 4P9WA 1G9BA 3B69A 1SBFA 1JUHA 2D97A 4XQWA 4XQ4A 4AHZA 1NXMA 3EHKA 3VKMA 1F31A 4QU2A 4IL7A 4C1WA 2NLRA 1RUD3 3CLPA 4X6QB 1PGW1 3MLJA 2GMPA 3MEPA 2RM21 3BCWA 4CTEA 1WW6A 3WDYA 4Q29A 3AZXA 3DPRB 4YARA 5ACA1 3LAGA 1U12A 4FPJA 5L19A 4X8NA 1X7NA 1RINA 4P9IA 2DYCA 1X33A 5DZGA 4XTMA 4CEWB 1BZWA 5JCTA 1I9RA 1SBEA 4J1XA 4FSJA 2DV9A 1LHWA 2Y0OA 2YV8A 1IS3A 4ES9A 1AXKA 1S0BA 4HMZA 3G7DA