2WNVB

Complex between c1q globular heads and deoxyribose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
131
Chain Sequence
b'TQKIAFSATRTIVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
molecule tags Immune system
total genus 30
structure length 131
sequence length 132
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnvB00
2JG9A 4QQLA 1PK6A 4J6GA 5KC6A 2WNUC 4G4FA 4OUSA 1TNRA 1XU2A 2R30A 2QE3A 4D7YA 1PK6C 2Q8OA 2JG9B 2E7AA 4HT1T 5TSWA 1O91A 1DU3D 3ME2A 2TNFA 4DB5A 4RSUA 2WNVC 3B9IA 4F3JA 1KXGA 1RJ8A 4TSVA 1GR3A 1C3HA 1S55A 4G3YC 4QQ2A 2R32A 2HEVF 4DOUA 1JTZX 2AZ5A 4E4DX 3K48A 1C28A 2QDNA 2JG9C 4MXWB 3K51A 5KC5A 4KGGA 1U5YA 2ZPXA 1TNFA 2HEYF 2O0OA 5BNQA 1D0GA 1D4VB 1KD7A 2OIIA 2RE9A 3MI8A 1D2QA 1XU1A 2JG8B 3B94A 3URFA 1OQDA 3TWIA 4QQOA 1OSGA 2R6QA 2RJKA 1OQEA 3QD6A 3QBQA 3ALQA 2KA3A 3AB0A 1WCKA 3B93A 3L9JT 2X29A 3IT8A 2JG8A 4MSVA 1I9RA 4N90A 4QQPA 5HBAA 3LKJA 3V56A 1A8MA 3TYJA 1JH5A 5L36A 4QPYA 2JG8C 5CIRA 1U5XA 3FC0A 4KGQA 2WNUB 5KWRA 2ZJCA 2HEWF 2TUNA 5L19A 1PK6B 2WNVA 4MXWA 4TWTA 1RJ7A 1IQAA 4EN0A 1DG6A 3WD5A 2Z5WA 4E4SA 4KG8A 4MXVA 4NN0A 4GIQA 1ALYA 2RJLA 2WNUA 2Q1MA 4OUMA 2WNVB 4OULA 4QQHA 1U5ZA
chains in the Genus database with same CATH superfamily
2JE9A 3D5OA 4WM7A 5A32B 5DQ0A 3C7HA 3FL7A 1E5RA 1PK6A 3H3UA 1I6XA 1MZ5A 3ZR5A 4CU8A 4IL7A 4QB2A 4R9CA 2AENA 2PXJA 4QHBA 3IBMA 2RS51 1H9WA 3WHTA 2ZEWA 1ST8A 4LQRA 2QNKA 2JG9B 2RMU2 2V73A 4OLLA 1OUXA 2E7AA 4JGZB 5J1XA 1F5FA 4PIYA 5FZ7A 2NQYA 1NUKA 1RUG3 2EAKA 5ERLA 1CJPA 3SCHA 2R043 1UMHA 3POEA 3W5MA 1RC6A 3VKFC 1GBGA 2JICA 2IXLA 4TZDA 3I2GA 4J1XA 1UKRA 4FFFA 4YM2A 3MBWA 5FBZA 3I97A 3OD4A 4IEPA 3T1MA 2B46X 4U2AA 4B3NA 1HRV1 4YZ2A 2OQ6A 1MR5A 4D6RA 4XPVA 3V65A 2K2SA 2AZ5A 4DXZA 1O4ZA 3RYKA 4B4QA 4ZU7A 2O8OA 3Q8EA 3GHMA 4HKWA 1WW7A 2ILMA 4PBPA 3UV9A 4LBMA 3K51A 1VMFA 4J25A 2XLAA 5I8TA 3NJVA 3HN3A 4IEYA 1S0IA 1QH6A 4FP2A 2J7MA 4D7TA 1O4YA 3X29B 3H8UA 1TNFA 1G9DA 2RS52 5J3UA 2ZGUA 2N7GA 4B4PA 1PMHX 4XHBA 5C71A 1AL0G 3SH5A 1FT9A 1U12A 2YBPA 2VOWA 4NR1A 1J58A 1KQRA 5E89A 3WW1A 4CUGA 3NJYA 5FZ1A 1UY0A 3I2IA 1F4AA 1H4GA 5FYBA 5C3PA 5DAPA 1V70A 3GM8A 4Y20B 4A4AA 5FZ0A 2VCMA 3ZVXA 4E8CA 4N9IA 3Q9OA 2IC1A 1W8HA 4ES8A 4BQ2A 1XNTA 2CGOA 1QOSA 3TRSB 4GKXA 3D8CA 3O1UA 5EZWA 4ASMB 1AYN1 5CNAA 1MQTA 2D97A 1DBNA 4IEQA 4D69A 5KXDA 4N90A 5F5AA 1Y4WA 4JDNA 3SEPA 4Q1RA 3TYJA 3WNNA 1OC1A 1B35A 3OEBA 1V0AA 2UY8A 2FDJA 4HETA 4IXLA 3T1LA 5JVVA 1BEV1 4LIVA 1F35A 4QKFA 4Q2FA 1OT5A 4FXKB 1DCSA 1GV9A 3BKZA 2WN3A 3WNLA 5ACA1 1G9CA 4UI9L 2J42A 5JSPA 5JZGA 1BKZA 2GZWA 3M3CA 3N35A 5FP4A 3DKWA 2OPWA 4XC9A 5BNNB 4IETA 3I2HA 1HB3A 1RVF1 1JZ5A 5A32A 4V2WA 3WW3A 3K77A 5CEHA 1SLBA 1H8TB 5L9VA 4XE9A 3WHUA 4RFT0 5GLTA 1VBB1 5C7GA 2E33A 2WWSA 1BCXA 4M3CE 2JG9A 4QQLA 1RINA 5A3OA 4AK3A 1A6CA 4HG6B 4JGZA 3VDDB 2VZVA 2C1FA 4XCBA 3ZFFC 2PHTA 5FY7A 2DCKA 3WY6A 4CP9B 1UQXA 2UYBA 2QBXA 4X6RB 1FOD1 2ZZJA 1UCXA 5CU1A 1O3SA 2BJSA 1LULA 2VZ1A 1JOPA 1JYIA 3THPA 1STMA 1BEV2 4GH4B 2PHXA 1LGNA 4OQ9A 2B7YA 4IE4A 5A3NA 1GZWA 1XJAA 5DZFA 1W6MB 3WQ1A 4I0BA 1QIQA 2WABA 3MYXA 5ACA2 3HBKA 3CNAA 3ECQA 4WZFA 4WVWA 4RYDA 2OZJA 4Q5OA 2GDFA 5FQ0B 1AR73 1Q43A 3LOIA 4CCCA 1RVF2 1FNZA 4JHZA 4G3YC 3BOPA 3V0AB 1WD3A 5DAQA 4Z92B 1XQNA 4ISRA 2NMOA 5BYNA 4LO4B 1JTZX 2CU5A 2NMNA 2JENA 4PJYA 2RM21 2WZPP 3KHBA 3ZYPA 4GAZA 4DFSA 2D6MA 1UX7A 4F83A 2VZUA 4AZZA 1C8M3 4Q4V3 5KHHA 1CVNA 2HWE1 1W28A 4XZPA 5A7SA 3AL5A 1HKDA 1I5ZA 1N1TA 4GB31 3HT1A 3AMPA 2PLV3 3NNGA 4PQQA 3WNPA 1PZ7A 4Y20A 1AUYA 5FZ9A 3ON7A 1LENA 3S6PA 1DDLA 5FY9A 4NROA 3NWKA 3PU8A 4XJZA 3DYOA 3NAPB 4H55A 4DINB 2XBO2 3O0XA 5FPLA 4CDUB 5JWPA 2BFUS 4Q4X3 1OQDA 1JYCA 4DZGA 1RUF3 3E5QA 3A7QA 2OA2A 4Y1UA 4QDQA 1APNA 4AHYA 1RUE1 2QQMA 1QJY2 3H1YA 4XMIA 5K0UC 3BUCA 1RUI2 3ZN6B 2YGLA 1YI7A 3VBFC 4CTEA 1W9FA 3J7LA 3Q8BA 4K9SA 1RXGA 4MADA 1RUC2 3CEWA 1POV3 1V6LA 4OHYA 2VVEA 1LHVA 2WFF2 1ZBE2 1D4M3 1QWRA 5JXJA 2PHWA 3TB0A 5C3OA 3ILFA 2VE1A 3RQ0A 2RM22 4XQDA 2VNRA 1WZXA 2H6BA 2W1WA 2PAMA 3NNJA 4LK6A 4XF1A 4W8JA 5DDJ2 2ZHLA 2PFWA 3D3AA 4OZXA 3QACA 1KS5A 1H4HA 4MVTA 4CDXB 1IS6A 4LBKA 3WCRA 2JDNA 4YW6A 4ET7A 2XQXA 5GZEA 5BY5A 2BGCA 2Q30A 3T30A 5LCWL 2YY1A 4ZZ5A 2TUNA 1H8TA 2A7AA 2CDOA 4L2NA 3MUZ1 4DXTA 2VM9A 2EIBA 2QCSB 1GOFA 2HWF2 2JEMA 5IVCA 5A3UA 3ZXAC 3NJXA 2WRAA 4KG8A 4XIOA 1MS1A 2TBVA 1TG7A 3H1WA 4HK8A 4NN0A 3VDDA 2Y60A 5KXCA 1HB1A 1C1FA 1RUE2 1WKYA 5FMDA 1UYZA 2C6SA 3TAYA 3NJZA 4XUOA 4INDA 1W6NB 4KNCA 4RGGA 2OPKA 3VZJA 3VB9A 4GH4A 3CJIC 1VBE3 2WNUC 2ZX1A 1FXZA 2ARCA 3S0MA 2UWCA 5I91A 3MW4A 2OX0A 4LOTA 4WZCA 1RITA 3DL3A 2Y6FA 1CN1A 1PGW1 4I3PA 2Q8OA 3BPSA 2ZMKA 2WKKA 2AREA 4P5YA 2GU9A 1VB4A 1FYUA 1DQ0A 3V0AA 4BQWA 2J1RA 2QQWA 3AK0A 5AVAA 4DO0A 1DFQA 4QX0A 4XF0A 4Y5Z0 1OF4A 1Y9GA 3T4HB 3JB8A 5CISA 3VD9A 2R16A 4ATEA 1PIV3 2WS91 3POYA 3N9QA 3LEMA 2IUWA 3KVAA 1GR3A 5FBJA 3I2FA 5FYYA 1ZRRA 2WSUA 2XL9A 1QJX2 5T54A 2LTNA 2WDBA 1NG0A 4W6XA 5A7PA 4DIQA 5CG9A 4S2GA 4DOUA 3DGTA 5FMOS 2FMYA 3SKVA 3BCWA 1COV1 5LRSA 2XMLA 4Q0PA 1OOPB 3R4SA 3AYEA 3NSTA 5T52A 3T0BA 4NHXA 2QZ2A 1ULEA 1UWWA 2VY0A 3AMQA 5D21A 4CDUA 3TNPB 1LNSA 4ONUA 1Y7BA 3WQ0A 3Q8AA 2DF7A 1GQHA 5HCAA 3SH3A 3ZN6A 3KQ4B 4R8HA 2WJSA 1UN1A 3B69A 2C9KA 2MEV3 3E5XA 3T09A 3WX5A 4YZ3A 4JRAA 4FFHA 4GALA 2GALA 5D8AC 4PHZA 4WM8C 1ULOA 1OSGA 3T0AA 1ONAA 1NE4A 2XHNA 5F7UA 1JZ2A 4BHPA 3FLPA 2VVDA 1LAJA 4GMP0 1LOFA 4QPIC 3VZLA 2W68A 3AMMA 3ST7A 3B01A 1TME3 2WNOA 3MIFA 3ZYGA 4BZ4A 1W8NA 5FP7A 2C24A 2YDEA 3AXDA 5FYMA 5JUVA 1UU6A 2ZAAA 1AYM3 1EUUA 3OEAA 4Q0QA 3U14A 4CDXA 2C4XA 1W2TA 1WCQA 1R081 2Z2SB 1COV2 3BGAA 1FPN1 5E16A 1XC6A 3AJYA 1X7NA 5FREA 2CTVA 4XFIA 2QQVA 4ARXA 5FMBA 4C91A 2JG8C 4IEVA 3VHNA 2WQ4A 1OLME 4IE6A 3FC0A 5JOWA 4UFIA 1DP0A 3RYRA 4XMAA 2FDGA 2ZJCA 5A3MA 1UIJA 1W39A 2V4AA 2YU2A 4IV1C 5J37A 2BU9A 2W0XA 3ZMNA 4BK5A 4JCKA 4Y1YA 5H9QA 1QY4A 3VD5A 3CF6E 1G86A 5GLUA 3LWCA 4SBVA 3WD5A 1QJEA 2V4VA 3OTFA 1ULGA 2D93A 4Z07A 1UZVA 4R9AA 1O5LA 1PVC1 2DUOA 2AACA 2RS11 1IPSA 1SACA 2GP3A 2WNVB 4AR2A 3SMHA 4ZZ8A 3C7FA 5FO8B 3S57A 5AC91 3ZFGC 1W6OB 2Q1ZB 3R05A 1WLCA 2VGDA 3KD4A 4GD4A 4AI8A 1DGWX 1VBC3 4XFAA 2KD7A 3WP5A 4XQ4A 5FZ3A 1AJKA 1WCSA 3THTA 1CGPA 1H6YA 1MEC3 2QQKA 1LU1A 2LM3A 1F31A 4HVRA 1FPN2 3CQOA 1J83A 5FPZA 3MGUA 3WUDA 5E88A 1A34A 4ZONA 1CZSA 4XABA 5LASA 5F5IA 3VGIA 1M06G 3OPTA 2VC9A 3J8F3 3AKSA 3R0RA 3O1TA 3PURA 1JI6A 1QDCA 3MIEA 1UXXX 1NX9A 1HB2A 1H2MA 1SZBA 1KDKA 1W8OA 5CFDC 1Q8SA 4YYOA 2XVLA 1C57A 1TQ5A 2FZ1A 4AQSA 1JZ4A 1F2NA 1KXGA 3OBAA 4PIZA 4RHV1 5LEKA 5FLHA 1AR83 1HB4A 1OOPA 2HYXA 4LKFA 2VTXJ 3HN1A 3ZDSA 2RVAA 5ABJB 5DUVA 3IAPA 3AKRA 4BQYA 3SNMA 3ZYIB 2GAUA 3I2JA 3AYAA 3UGHA 5AC92 4O7XA 1HLCA 3FMGA 4KGGA 4KH9A 4PI2A 1X8EA 4IV3B 4B1MA 3RVHA 2PA7A 4QGMA 3WCSA 5A3PA 2CGPA 3BVCA 2ETEA 4QHZA 4YWAA 4BISA 1H1MA 3OBTA 2RDRA 3INAA 3KCXA 1DIWA 5FWEA 3PUHA 3HIFA 1DGRA 2GSYA 5CAZA 2P3IA 4XJ9A 1IS4A 2XJSA 3ZFEC 5HXMA 4NUBA 4NWWA 5IHRA 2VL4A 3IIIA 4AVBA 2JX9A 5CBLA 4CCKA 3GZTB 4DRRA 4UW6A 1AJOA 2D7FA 1ND2B 2A70A 2RJKA 3U07A 1JUHA 1WA6X 2A6YA 1WLDA 1BBT3 2W9XA 1GQPA 3I3DA 4RHV2 5IJRA 2IXHA 4PCRA 2HJIA 3OUIA 4NRMA 4QGNA 1PO11 1W2OA 4HL0A 4WVMA 3UYJA 2Q8EA 3VBOB 3DYMA 3POGA 2JDKA 1QXPA 3O1RA 3W59A 1AR63 2XXZA 2G1MA 3MZHA 1SLCA 2FQPA 5A70A 1HRI2 1FMD3 1ENRA 4FPFA 2XUMA 4MO3M 1AR93 5IVYA 1I3HA 2ZGNA 2IVIB 5FZKA 3T2PA 1WW6A 4KBZA 1GNHA 1AHSA 1BK0A 3N3HA 2VVFA 3UT0A 2Y0IA 3O7OA 1DGLA 4JTNA 3MICA 3B00A 5A6YA 4Y4RA 1AX2A 3GALA 1NXMA 2VXJA 1UMIA 2WA4A 2WNVA 1ZBA3 2XGXA 3HMYA 4MHUA 5DAXA 1YJKA 2IXKA 1JYWA 1W6OA 1K12A 1TMF2 3O1MA 1QJU3 4LBNA 4ZXEA 2O1QA 2Z5WA 1C4RA 1NA1B 1Y43B 2BBAA 1ALYA 4FPGA 1YHFA 4P08A 3DN7A 4CRQA 4OUMA 1MS5A 5DZEA 4C8DA 4Q0SA 4Y1ZA 1XE0A 2ZGQA 4E9KA 1UZYA 1WCDJ 2R062 2OVUA 4AAXA 1PO12 2ADEA 3OB8A 1VBA3 1JYNA 3H3LA 4QB6A 3NV2A 4G4FA 3R4DB 1N3QA 3RMXA 1YFYA 2QE3A 1MVQA 2YPJA 2VUJA 3AC0A 1ND3C 5FY0A 1YFXA 2JDUA 2C0ZA 3N9LA 4HXCA 4UBHA 1XE7A 2R1DA 1LGBA 2P17A 4YSFA 4YZ5A 2RR11 3LF7A 4XTMA 3WZ1A 5IVFA 3PHMA 3A23A 3H7JA 4LJHA 2XKPA 5ABJA 3ELNA 4L11A 1KEXA 2XOMA 1CQ9A 1AL23 3RG0A 2CSGA 3ZO0B 3JD73 4RGKA 1G6NA 3MPPG 4CE8A 1HXS3 3VHOA 2WIIB 3AJZA 4IV3A 4YG3A 3WUCA 1LOAA 1D2SA 3LOBA 3K48A 4I01A 5A80A 2BEOA 1RHI3 1V6KA 4YVSC 4ZXKA 2VULA 3M3IA 3QLQA 3LAGA 2E26A 2LUWA 2E51A 3MV11 2RG4A 1SCSA 4CEWC 1VJ2A 1OFSA 2VZOA 4QX3A 2R073 2RS31 5E1RA 2EXHA 1U5YA 3LSEA 2WSVA 3ZIWA 1JOBA 1YFUA 2KR2A 3LDRA 4ZS3A 1OD3A 3A4UA 3VZKA 4K3UA 4P00B 1QF3A 2PYTA 2YBKA 2YUEA 3OBRA 3ZXJA 4JX0A 2VNOA 1NXD1 2WN2A 4NHKA 4LKSA 1UD1A 3BTAA 4YW5A 1WUVA 4W65A 5GLZA 1FV3A 4E2SA 4A3ZA 5L9BA 1EYBA 1WGPA 1NE6A 2VUCA 4RQPA 2ZBJA 4QDSA 4Y5TA 3MIBA 5JIUA 4QM9A 2ZOEB 3MW2A 1XNCA 1WD4A 4Q29A 1ULPA 2P34A 1DF0A 3O0WA 3VBUC 1LR5A 2IXCA 3H8RA 3T3YA 1PZ9A 3LEGA 1PO22 4KL1A 3IAQA 4UFKA 4MSVA 1ZA4A 4Q27A 4C1XA 3PNAA 3LKJA 1R1A1 3PUSA 4B1LA 4GMP3 4QPWA 3VL8A 5K8SA 3HD8B 5CFCA 1JYXA 3N9MA 1BVP1 5F32A 2PQSA 5IK7A 5FY4A 1W9TA 2DCYA 1RUD1 2RS32 2DUPA 5F2WA 1RUH1 2NLRA 4V1PA 2UYAA 1G9AA 2XDVA 4HMZA 3SITA 3M8LA 3ZFFB 1VRH2 3E6CC 1NA1A 5J98B 4N9HA 3CIHA 4S2FA 4XDOA 3C3VA 4Y1VA 5GZCA 2I45A 4OFGA 4C1WA 3K3OA 4CU7A 4XDQA 4AHWA 4K8FA 4JZRA 3AVSA 4NIHA 1GP6A 5GJ6A 4AWDA 5HV0A 5GZFA 1NQDA 3TNQA 3P6BA 3WDWA 5IFTA 3DPRA 5JSRA 4HANA 3MLKA 4Q4W3 5F5QA 3PVOA 1AXZA 1HV0A 2ZKNA 4XFCA 1K5MA 3U4XA 4FTSA 2FDHA 4PDWC 1CZTA 3ZXEA 1W06A 4KG0A 3J26N 3V0BB 1VE0A 3SKJE 3WF4A 2KXLA 5FP3A 1RUD2 3WQBA 1SBDA 1JYTA 3SCGA 4XHXA 1E5HA 3A21A 2Z4FA 3ZN5A 3VBSC 4XUPA 2VZTA 4CDQC 4YG6A 2YGMA 2QQJA 4LA3A 3OGSA 4NAMA 4RN5A 4XUTA 5FO7B 2IZWA 1H8VA 3W21A 3K75B 1GYKA 2EXKA 1R093 2QZ3A 4M4RA 1OLRA 5LA0A 2YC4A 3HNMA 2DU1A 2Y6KA 4A6OA 3AFKA 3KM5A 2WZR3 3WF2A 1G9FA 1V9U3 4IGPA 5FZOB 2HEVF 3LPFA 4I0AA 5APAA 2VXRA 1OURA 4LUMA 1DYKA 3NQHA 3BTZA 1EPZA 3WR0A 5K0UB 2EA7A 2IWGB 2QDNA 4UFLA 3VBFB 4CVUA 1RUG2 1O8SA 5BXXA 4N7IA 2R042 1J3RA 1GWKA 3FHQA 1N3OA 2Q1FA 4H7MA 1XNAA 3E6BA 4QD2A 3LFIA 5FZCA 2ZPXA 3AYCA 4RR3C 4UW5A 3PDQA 3K4DA 4NIIA 1OH3A 1F5JA 2D6KA 2VH9A 4XURA 4RA0A 4LNVA 1SLTA 3JZVA 3LA7A 4LKDA 3VDCA 2O0OA 5IUQA 4NPLA 3NV1A 5HXVA 3ZYBA 2D6PA 1LHWA 3MO4A 1W9WA 5FYVA 2W3JA 5EPAA 2ZZQA 4AI9A 4AVVA 3HOBA 2GC3A 2BVBA 1BZWA 4IDZA 3IDEA 2D6OX 1IS3A 3WOGA 1W04A 1OMIA 3HEIA 3P1IA 2BOIA 5F3EA 2ZX4A 1S2KA 3VL9A 3WP4A 1MVEA 4LK7A 4AEJA 2QQIA 1WCKA 2RMU3 3GZEA 2OW4A 4AVTA 5CADA 3K4AA 2E7QA 2HWC3 2LW8A 1I9RA 2JDMA 3A0NA 2EAAA 3ASIA 4K7JA 5HBAA 1ZRFA 3ZFFA 3H0OA 1SQ4A 3FBMA 4PBOA 2WAOA 4Y22B 5BNOC 4YGDA 5C8CC 2Y6LA 3TEXA 2WYSA 3DECA 1RIRA 2WINB 1UYPA 3UKNA 2IFRA 4CXWA 4OHZA 5C9AC 3CJIB 2WNUB 1SBEA 2DFBA 2WO7A 1UYXA 1QMJA 3J7HA 4QHOA 3CL1A 4LUKA 1RUJ3 3E1F1 4QKDA 1F9KA 2BNMA 3B7MA 3M3EA 4N53C 3O1PA 1K45A 1PMIA 4AXOA 4QKBA 4META 4DXSA 1L7LA 2ORXA 5JOZA 3OGRA 1IQAA 1W9SA 5C3RA 4YPJA 3MPBA 3VKMA 1C1LA 3MUY1 5FZAA 3HBZA 2GNDA 5HCFA 1MACA 4M3CB 2XG3A 3J7MA 2YXSA 3V0BA 5FDBA 2RS53 3L2HA 2BGPA 4FTBA 2P37A 4IW3A 4XBQA 4AHXA 1RL3A 2HWB1 2OUHA 4JHTA 4ES9A 3VBRC 2JKBA 3FBYA 2BBVA 2GN3A 3ZYJB 2ES3A 1V6IA 1LECA 2ZEYA 3WDTA 1L7RA 1GP4A 1EAH1 4YVWC 3WW4A 3RJ2X 1NKGA 1PK6C 5FPBA 5LZ6A 3Q8CA 1SFYA 5TSWA 4AI2A 4R4XA 2Y33A 1ENSA 2PHDA 2UU8A 1NT0A 4E8DA 4OI0A 5A7QA 1GQGA 2A73B 1HRV3 2YBSA 5EJ3A 3VDAA 2BZDA 4S2DA 4Q4V1 1JS9A 5K0UA 4EQVA 2PAKA 1RYYA 3WINE 1BJQA 2E32A 5FZEA 4FOQA 1QXJA 1EP0A 2QQNA 1KFXL 2Z42A 3GGLA 3JQWA 3TEZA 4HPKB 4Z1VA 1MZ6A 2J1SA 3CZUA 5D8AB 1KJRA 2BWCA 2X5IC 2QUOA 5DXDA 1AZDA 1O5UA 2DURA 2E53A 3K3NA 4OVEA 4WM8B 5CB7A 5FOJB 1TE1B 3U11A 3HQRA 1FAYA 4LO6B 1PVXA 3USSA 4OI1A 4A41A 2Y8KA 4QPIB 4Q4Y1 1DHKB 3UK9A 2VCAA 5CKMA 2HWB2 2XBO1 4YARA 4JV4A 5F6KA 2VMEA 3U1XA 5EJ1B 2AUYA 4EE2A 5BUVA 1FNYA 4Y33A 1AR72 3RWNA 1EAH2 1VB2A 5C5UA 4LE4A 2WL1A 1QJY1 2BWAA 1RUI1 2A3XA 2CNAA 4LHKA 2ZGRA 4P9LA 4P9IA 4YW1A 1MS9A 3MI8A 2JG8B 3DV8A 5JI9A 5I0DA 1RUC1 2HWD1 1LGCA 4K40A 4XF3A 3ROUA 5HI0A 2WFF1 1ZBE1 5FY8A 1AYN3 1D7PM 4QQOA 4C90A 4Q4V2 4AFDA 5EQUA 4BU2A 4FPEA 1PGSA 2OS2A 4IV1B 3RRDA 5KXEA 2BNOA 1WMDA 3ABZA 1WW4A 3PUIA 2WWJA 1SPPB 2JKXA 2BDRA 5DDJ1 5FXWA 1DZTA 1AX1A 5CYYA 2P4EA 2PLV2 5T3NA 4CU6A 3KS7A 3QH6A 1BEV3 1VAKA 2GN7A 1JMUB 4A2UA 3CJIA 2J22A 3KT1A 1K5JA 1POQA 1QHDA 2EIEA 2WT2A 4E4ZA 5LK5A 4XCAA 5ACA3 1OXCA 1Q56A 4Q4Y2 4M0HA 4XF4A 1MQTC 1ZNPA 3GCXA 3SISA 3ZFGB 5FR3A 2DVFA 4A45A 1UZWA 2HWF1 3WEZA 3GHNA 1RVF3 1QOTA 1NCQC 3ZKYA 2J1AA 1TEIA 3C8XA 2FZ2A 2WO1A 2K9ZA 1JZ8A 1LEDA 1CPNA 1REFA 1VBE1 3PJYA 3SC7X 1XB9A 1NAEA 3EB7A 1HN0A 3CKHA 1VBB3 4PLMA 1W8WA 1CX4A 4TWTA 2X53S 3AP6A 3S7EA 2BVVA 2HWD2 3A0KA 4R9DA 3VKNA 1REEA 1OLQA 3PLQA 2DTWA 1W8FA 1YC61 4FXGB 4BDVB 3KV9A 5CFDB 4YW7A 3HVDA 1QH7A 3BU0A 2EVXA 4QQHA 1GICA 2VNGA 3HPNA 4BQ3A 1FOD3 1OQ1A 1VR3A 1UZZA 1YQCA 5LBEA 2VQAA 1S0GA 2D6LX 4UW4A 4ASKA 4Z82A 5BNNA 1W6PB 5KHKA 4BH9A 5FXZA 5JIAA 2D44A 3DXTA 1GSLA 3RZGA 4BA6A 1XSQA 3H50A 3KV5A 4D94A 1NCRC 1Q8PA 2EIGA 3ZXLA 4KBBA 3KZ4C 5KXBA 5L7OC 4HKLA 4MGIE 3ME2A 2J1EA 1DZRA 1QJX1 4HPKA 5FKCA 5HV4A 4L97A 5D8AA 4XDPA 4B8EA 3WDYA 4LEJA 4WM8A 1WCUA 5F3IA 2FDKA 2W08A 1GU3A 4GWMA 4CP9A 2H0BA 2QQLA 4CA9A 1VBE2 2YZ4A 3ZLIA 2RM23 1GNYA 1ODMA 4LBQD 1JW6A 4PIXA 4CDWC 4DY5A 1CZVA 2W87A 3ZFEB 4AYUA 1PNFA 3I54A 2VCBA 2HWE3 3DKQA 5FZLA 4HZFA 2DVGA 1J59A 4K20A 1M4WA 5JMCA 1CJDA 4GB33 2Y6HA 5FYZA 3T2TA 2ZS6B 1W6MA 4XFBA 5E6HA 5DZGA 1NLRA 5FCCA 1R64A 1YQ6A 3SXWA 4ASLA 5FQ0A 4HN1A 1IS5A 2HLEA 1J84A 4QMAA 1V6NA 4XXPA 1YUDA 5JR7B 2V5YA 1YQ5A 3RZHA 4NVPA 3HNBM 4K21A 3ACLA 4P5HA 3R6SA 4HVOA 5FP8A 1HX6A 4MGYE 1RUE3 4IV1A 2PN5A 1YRZA 4FO9A 4R52A 3VKOA 4E2GA 4XVHA 2RE9A 1SPPA 3AVRA 2CYFA 2LALA 1URXA 2QJVA 2HKXA 2WLPA 1RGSA 2Q8CA 3NV3A 2VJXA 1IQDC 3P3PA 5T55A 3L2YA 3O14A 1W6QB 2ET1A 4AOCA 2NPIA 2D98A 2JECA 3V64A 1GWMA 1UXZA 2Q4SA 3M3OA 4AI0A 3KCYA 5F9TA 4SLIA 3ZFGA 1YJLA 2ZACA 2W1SA 3NAPA 2XONA 4JTOA 5FYUA 5I0UA 5A6ZA 3IT8A 4NAOA 3I8TA 5K4LA 2P6CA 5JXHA 4COYA 2F6BA 4GWIA 1MS0A 1FV2A 3FHAA 3N7MA 3NVCA 4P9JA 4YRDA 4BQ4A 1OD5A 1ASJ1 4S2HA 4XJWA 3I7DA 3EYPA 4NRPA 2ARAA 2CHHA 2B9UA 3GBGA 4JC1A 5FV3A 1QQP1 3MF9A 3ZN4A 4DUWA 3PL0A 5KHJA 1IKQA 3VN4A 1GUIA 3JXSA 3JU9A 1TME2 3PMEA 5CFDA 1ND3B 4QX7A 1JXNA 5FUIA 3SQOA 1GKBA 3I2KA 3PMSA 2QQPA 4E4SA 1NY71 1HJGA 1HQLA 1VAVA 2IVJA 2VO5A 1QU0A 4AVSA 1MS8A 1S2EA 2R49A 3OUHA 5B4NA 2H6CA 3LPGA 1VBD1 4NWVA 5FMCA 1MZFA 3M4FA 2ZTNA 3CBNA 3N7LA 2F4LA 4AGVA 3NL1A 3WG3A 4R4ZA 1Q3EA 3KT4A 1LOGA 2C26A 2J1UA 3O1OA 3RZMA 1AF9A 3UJOA 3LA2A 3AP4A 1YIPA 1H9PA 1XU2A 2R30A 2ZGLA 4H7LA 1WLWA 4YVSB 3VBHC 4XZUG 3W9AA 3I3MA 1I1EA 1ASJ2 1V6MA 1Z78A 2BFUL 2PHRA 2WLQA 4CEWB 2WS93 4D6QA 5IFPA 1W6NA 3THCA 1NZCA 1QQP2 4CPBA 2WA3A 3ZFEA 3ETQA 4Q8KA 5A1AA 1UY2A 4AEKA 4DNYA 1ZZ9A 4CCMA 4O9EA 4RSUA 1VMHA 3TOJA 1VBC2 2ERFA 2VBPA 2EXJA 4F3JA 3U0ZA 4CCDA 1V6OA 1COV3 3GZUC 4BJ0A 3APBA 3EMRA 4XAAA 1J3QA 1JUIA 4NPMA 4UFMA 4CP1A 1NY72 3JQXA 2JE7A 3ZR6A 4D8MA 5F2SA 3N9PA 2VBDA 4W6WA 5I8SA 1W9YA 1VBD2 5C4WC 4I0WB 2XJRA 4OYUA 4QPGC 3J8F2 2XLGA 5BNPC 4W6YA 2ZA9A 5KC5A 3VBUB 3WDVA 2WZ8A 4GZ9A 3O0VA 4XBLA 1YNAA 3NRUA 4YG0A 3RI8A 5FZIA 4EN7B 3FJSA 3HAGA 4HBNA 4LORA 2VZRA 2YC0A 5EYYA 1UOFA 4FI9A 1AR82 4QWNA 4XFFA 2LS6A 5EV7A 1W6QA 3RI9A 3U37A 2XPJA 2XJQA 5JXIA 1XPWA 2FCVA 3MIHA 1D0GA 1MPXA 4JAAA 2YFZA 5FRAA 3P5BA 5DAVA 3WP6A 1E5IA 2GNMA 4AEDC 2A6XA 4P9WA 5F6LB 1DQ2A 1JZ7A 2A3WA 1T6BX 1X9PA 2P5BA 3OUJA 4NMIA 1VP6A 4DRVA 2VZSA 3QD6A 4TLGA 3AX4A 3GDBA 4XW3A 1R083 3JBG1 4K1ZA 1FPN3 3DYPA 2DU0A 4B29A 1HRI1 1G9BA 3D0JA 3DUIA 2G4IA 1HIXA 5T5LA 5JOYA 2PHUA 2A75A 1LOFC 5A7NA 2X10A 4OHVA 5LA9A 1A8MA 1GOGA 4PQ9A 1QJZA 3ILRA 4GA9A 4PF1A 2ARXA 2EALA 3RZZA 1W0PA 1W8ZA 3USUB 1LTEA 1OI6A 1FATA 3ENRA 1UY4A 4FPLA 5LY2A 5I0SA 2OYZA 1TMF1 1J3PA 1O3TA 4PDWB 1BBT2 1BHGA 2QQUA 3U4SA 1PVC3 1ZZCA 3C2UA 2RS13 4CEYC 3H8XA 1X33A 1GFF2 2GC1A 1RMU1 3KV4A 5AC93 2JDYA 2R061 4BQXA 5FMOL 1V6JA 2BUKA 3AZZA 4MXVA 5LA1A 4FPJA 3VBSB 1NYWA 2TEPA 4CDQB 3WDUA 5C6CA 1AR92 5A3WA 5A3LA 4FFGA 4MX3A 3JBG2 4YVSA 2JDHA 1VMJA 4M00A 4MLOA 1CONA 2DDUA 1GOHA 1BQPA 3O5SA 3KHCA 2CWMA 4CEWA 5DAWA 4CSWA 5FZ6A 1LKNA 2FBEA 5F3GA 3BALA 1OVSA 1PGL2 4P14A 2AEYA 2Y26A 4DXRA 5IVEA 2JB8A 1JBCA 3KGLA 3WQ7A 3TEWA 2XVGA 5B4XA 4EYUA 1QJU2 1ZX5A 3RWKX 4NE9A 4AVCA 1DGRN 3LSDA 2W94A 3WNKA 4LE3A 3KMHA 4RHV3 2DTYA 3ZMOA 3ZXGA 3ES1A 2W47A 4LO8A 4RR3B 4CUBA 4ZHNA 4AGRA 4BXFA 2CGNA 4JRLA 5DG1A 2CAVA 3AZWA 4CUCA 4FAGA 1QDOA 4BXSV 4Y4YA 1F4HA 4P02B 1VBA2 4OZOA 2B45X 1OKQA 2A1XA 4HKOA 1RMU2 4UBGA 1HV1A 1S0JA 1OPOA 1QOOA 3H42B 3I2DA 3PTYA 4Q0UA 3S30A 1S0CA 2UWBA 2WO3A 3VBUA 1JODA 3AZXA 1LOCA 1WMXA 1HQWA 4NHLA 2O8QA 1W8UA 5LEJA 1ZM1A 2BNNA 3LD8A 2B9VA 4IEUA 1NOVA 2DCZA 5DN2A 3N7JA 2CDPA 5D1IA 5A6QA 3H7YA 1HW5A 1CAXB 1H2NA 1S1AA 2VQUA 4X8PA 4HVQA 4JVAA 5CG8A 4Z8BA 4E27A 1AL22 4MH0E 1SBFA 1BK1A 1LOBA 2YC2A 2ZXQA 2WR9A 4H2AA 4LO5B 1ZZ6A 4CP0A 4MGTA 2D3PA 5C8CB 3IPVB 1H30A 1CAWB 5A33B 1D2QA 2BW8A 1MS3A 4MGSA 5H9SA 3EXUA 3URFA 5A3TA 5C9AB 2AH2A 4URTA 4GMP1 3MV01 5AFBA 1PO13 5C33A 1PO21 4FBFA 4UOJA 1XXNA 3KF3A 5DABA 4DEVA 4D3WA 4I2OA 4N53B 5HCBA 3PIJA 3U10A 3PVBB 1DGWA 4AQTA 1K3IA 3IDCB 5FZDA 2G9GA 3B93A 3IDAA 2ZGOA 3VHPA 2GH2A 2VW1A 3MIDA 1YWKA 2OUJA 4FFIA 1XRUA 3WLUA 5CZKA 4IE0A 1VRH1 2VZ3A 4PDWA 5HCHA 2VUDA 1Z7S1 4RD7A 2VMHA 3ZYHA 3BYWA 4IQPA 2V09A 1KS4A 3RJRA 1ND2A 5FUNA 5IVBA 1YCIA 3H1MA 3G7DA 3I3BA 2DVDA 1JU4A 4IEXA 3N36A 1QXRA 4OQ8A 2BP6A 3VBRB 3RFRA 1KJLA 2RDQA 4QXBA 4XFGA 3VBOA 2RDSA 3T08A 2GC0A 5I0TA 5IT6A 3K46A 3OGVA 4XOGA 4YVWB 4PT6A 3ZIXA 1N3PA 4ARYA 3CZJA 4DMIA 3LB9A 1PK6B 4YZ4A 5FYHA 2P3KA 3OPWA 1EV11 4DS0A 5F8PA 4HN0A 2EF6A 5LY1A 3EBRA 4GIQA 1Y3TA 4OCTA 1AXKA 4A6SA 2Q1MA 2XJTA 5T5JA 2D5HA 1QEXA 1R1ZA 4DUVA 2BV4A 2ARBA 5GM0A 3SEEA 3TN91 4BPZA 3KB5A 1SCRA 2Y6JA 4CYDA 2X09A 3AM2A 1L7QA 4M3CF 5IYYA 1X82A 2ZHKA 4NJ4A 2X5IB 3D82A 3R4UA 2R1BA 2IXIA 4RR3A 4BE3A 4D7YA 4ZKTB 1XOYA 2VMIA 1Z7S2 2RR13 3ZYFA 1L3JA 2HBUA 2IFWA 4GULA 1TVGA 3UETA 1UY3A 4ZU5A 2D3SA 1OVPA 3POIA 2PQQA 4LBQB 3ITQA 4LBJA 4MGZE 3UJQA 1B09A 4CCNA 1FX5A 1IPJA 2WQ8A 2R0FA 4QXHA 5FIXA 4IE7A 4L9BA 5GZDA 4Q4W2 1ODNA 2TNFA 2CAUA 4IEZA 4CZSA 3W5NA 1NLSA 2I2SA 4MYEA 1UIKA 1G7YA 3RPQA 1RUG1 1JZ6A 3ETPA 2R041 1EV12 1QJFA 1S55A 4KWJA 4QQ2A 3ZXDA 1A8DA 3M70A 3NNFA 1SMVA 1QKQA 2RS33 4YGBA 5F3CA 2XWJB 1LCLA 5BPXA 4P9YA 3ZM8A 2RV9A 2JDZA 1W3VA 1W3XA 5G04L 1PX3A 1VRBA 2J1VA 2QDRA 1CESA 4LOSA 2A71A 3TN92 5C8CA 3IPVA 4IERA 4LKEA 2BQPA 1CAWA 4AFBA 2VZPA 2XR4A 3JCIA 3KT7A 4N43C 5A33A 4COWA 5C9AA 4LULA 1R092 4YM0A 2CL2A 1TZOA 1A78A 2UWAA 2ZX0A 4WV8A 1DQ4A 5JLVA 2AC1A 2Z69A 4N53A 4YFWA 1MQTB 5L9RA 3O1VA 2A3YA 3HT2A 2JWPA 2Y34A 1JHJA 3TWIA 5LW9A 3DF0A 3EJKA 1W2UA 1Y9QA 2PMWB 4LMFA 1NCQB 4LHSA 4QB1A 3WNMA 3SH4A 1S0BA 4LR4A 4AQ6A 3D0SA 1R1A3 4YZ1A 1BLZA 2D40A 3LQCA 3AMHA 4RQPC 3RSJA 3GF6A 3WW2A 4KWKA 5HPOA 1RUD3 4LTAA 4XETA 1Q8VA 1RUH3 4FCAA 3VBRA 2XH6A 3NKGA 3V56A 4EZ4A 5BV6A 5L36A 1GLHA 5FPUA 2YV8A 4YVWA 2ET7A 2VOVA 3N7KA 4Q0VA 3QOPA 5FLJA 5FY1A 5FYSA 1U5IA 2W1QA 2XHKA 1UL9A 3ORJA 4Q1PA 3ZDVA 4F8AA 5CFCC 4AF9A 2C5DA 3BB6A 5DUWA 5AFEA 1XNKA 5C3SA 3UESA 4XYXA 1NCRB 3WNXA 2GP5A 2WBKA 1OH4A 4M0NA 1DQ5A 4Z2AA 2HWC2 3OGGA 1WA4A 5L7OB 2YMZA 1ENXA 1NA1C 2YFUA 1VALA 2A5ZA 4YGEA 4EN0A 3E97A 4JGYC 1IOAA 1GANA 2ZEZA 3LA3A 5H9PA 2X5IA 1N1VA 1E57A 1OA4A 4UWDA 5JI7A 4L0PA 5DMYA 5T5PA 1PMJX 1US3A 3WF3A 2VECA 2WZEA 1GZWB 4CDWB 2D6NA 2JB4A 4LBQA 5EP9A 1RUJ2 4J6GA 5KC6A 3T0DA 1WWYA 3DPRC 2ZAHA 2DBNA 2W1UA 3C7EA 4GWNA 3HWJA 1CD3G 3I4IA 5JAXA 1W0NA 4FSJA 4IGOA 1UU4A 3VZOA 4NO4A 3FX3A 1K5MC 1IGOA 4QXCA 5FYCA 2QFEA 5EXOA 3T2QA 3N4MA 2OQ7A 2FD8A 1BYHA 3JB4C 4COZA 2V72A 2WFPA 3FHIB 2PAEA 4LIUA 1DQ1A 1SFNA 4QDRA 4ZS2A 1O3QA 4A42A 4RS5C 4UT5A 2JIJA 2A6WA 1YQ2A 4J1WA 4D0QA 3POJA 3WP3A 2EIDA 2JDPA 2FCTA 2P1BA 1J1TA 1E5SA 5LB6A 3DEMA 4PLNA 2W52A 4E4DX 4LXLA 1N1YA 4KQ7A 1OKOA 4F7ZA 4NIDA 2LRPA 3KLSA 5D2AA 1AR71 1GP5A 4WM7C 4COUA 4XIKA 4O65A 2LROA 3LCPA 3TEYA 3AP9A 1KFUL 3FLTA 3POFA 3SLIA 1QNWA 5LWBA 1HRV2 3AXEA 2G9ZA 3F2ZA 1W8TA 2HH9A 4DUXA 5JSOA 2G19A 5FZOA 2OXBA 4CXYA 3LDBA 4XQWA 1LJ7A 1NCQA 1NQJA 1SLIA 1C8M1 5SV8A 2X05A 3SHRA 3WV6A 2OT7A 5BNQA 1KGYA 3LE0A 2OIIA 2JD4A 4I02A 4IUGA 4N7UA 3VBFA 1PX4A 3UGFA 2PLV1 3LGRA 5FY5A 3S5QA 2MHFA 2VCCA 3HQUA 5A7WB 5J09A 4LT5A 3ZSJA 2WT1A 5ANNA 2WC2A 4TTGA 1UKGA 2FMDA 1MZEA 5H9RA 1RXFA 3FFZA 4Q4X1 3VHRA 3RDIA 5EJZB 1RUF1 3CO2A 4NIAA 3MFAA 4L92A 3L9JT 1OBNA 1OHFA 2X29A 4LBLA 4NRQA 5FZFA 1SFPA 4GQ7A 4X6QB 5FK8A 3MHZA 4LHNA 4UW3A 4YLZA 4XJUA 3AP5A 4QPYA 1UO9A 3LZZA 5JPNB 1NCRA 1POV1 5CKNA 1WW5A 2VU9A 4ORFA 1D4M1 1AYN2 2I07B 1W05A 4LPLA 5FTTC 3WF0A 4BLIA 4Z2WA 2Q8DA 5L7OA 4YW4A 3FZ3A 4UF0B 5FAXA 4GJZA 3GYDA 2DCJA 1S2BA 1PM4A 4FQ4A 1SG3A 1C8M2 3IMMA 4JKKA 3VBHB 2QTWB 4HLTA 4OHXA 4Y22A 3PJQA 4QGLA 2GMPA 1SDDB 2P2KA 4CDWA 3AKPA 5IWFA 4FOVA 3PUQA 1SLAA 2HWB3 2VAUA 3OSDA 4W4ZA 3UGGA 1H1IA 1IHMA 2WNUA 2AEZA 1RUNA 1LHUA 4XILA 3RZLA 4UYBA 5M0TA 1U5ZA 3ATGA 4EN6B 1EAH3 5KHIA 3B9CA 5L73A 4HK9A 4BB3A 4Q4X2 3HR9A 3CMGA 1RUF2 2Y6GA 1ZZBA 3OPZA 4GKYA 5F37A 3EHKA 3EQEA 4FVVA 1CWPA 4EJRA 5IK8A 4TYSA 3UNPA 3IZOA 1SEFA 4IEOA 1B35C 4MGKE 2SLIA 3NMBA 1VBB2 2FDFA 1YFWA 2BOJA 4A7YA 4XACA 4M3CA 5C4WB 3IKWA 3KQRA 4QPGB 3PTRB 3CHXA 1D4M2 5BNPB 2DWRA 2W46A 3M3QA 2W95A 3ZOIA 1QNYA 1XSRA 2WT0A 2UY9A 4XUNA 4ZPIA 2ATFA 3U78A 3I2OA 4W50A 4UFJA 4A7ZA 3KCCA 2ZGSA 2GNBA 2XLFA 5JZGC 2Y0OA 5IATA 1FOD2 3N9NA 3OY8B 5LK7B 3HQXA 5FWJA 2JIGA 3ILNA 3FUQA 3LIHA 1O7FA 2VMDA 3MEPA 4LHLA 3C7GA 4AQ2A 2Y38A 2QKDA 2D43A 4Q4Y3 1AX0A 2XL7A 1P8JA 1S0EA 3AMNA 1CX1A 4AEDB 2R32A 3ZPYA 2XBO3 1F8VA 3VD7A 1N1SA 3O12A 3EO6A 1PIV1 1ZYBA 2DV9A 2NM1A 4DQAA 1C28A 1UOJA 1UOBA 3ACGA 5GLWA 1LHOA 4JKLA 3ZXKA 5FOBB 4X8NA 1U0AA 2JG9C 3ZSMA 2VQ0A 3MLLA 5JCTA 1UOGA 2W2IA 1QJY3 4JGZC 4NHMA 4KMQA 2ZKLA 1RUI3 5EYXA 4E4HA 4YW2A 1RB8G 3VV1A 1ZZ8A 3IWZA 2K0GA 4AI1A 3POWA 1UMZA 1AXYA 4BLJA 2GMMA 2QVSB 1RUC3 2HWD3 1EY2A 4HONA 3MF6A 4XFHA 5A7WA 2WFF3 1ZBE3 1HQNA 4CCJA 4MOAA 1A3KA 2HWE2 1OPMA 1VAMA 2NYYA 2ZGMA 4BMBA 3NNMA 1KD7A 1YEWA 3IN9A 3M2MA 2VW0A 5C8WA 2D3RA 4QPIA 3B94A 1W0OA 4GB32 3BOWA 5DDJ3 5FZMA 3MFCA 1ACCA 5T5OA 1JZ3A 1ZRCA 2V5DA 1DLLA 4BQ1A 2XJPA 5IW0A 4BYYA 4L8QA 2VG9A 2WAAA 1X50A 5JXGA 2ZEXA 2ZX3A 1ZREA 2R7EB 5EHDA 1BMV1 4CEYB 2MEV1 3AYDA 2YG0A 3P3NA 3POSA 5F5CA 2JJ6A 4DEQA 3B5LB 3AB0A 4QX5A 5K7PA 2PHFA 4KWLA 4FPYA 5FZGA 1LRHA 2JG8A 4QQPA 2B4KA 2HWF3 4RGAA 1WMEA 1PIV2 4MGQA 3CU7A 4UF0A 5GALA 3Q8FA 4JQTA 1N47A 4OHWA 2WWUA 5FPVA 5GLVA 1TME1 2ZHNA 1KRIA 3WT3A 1UW8A 2F17A 3T2OA 3BODA 4OUEA 1DZQA 2PTMA 3VBHA 4IESA 2XJVA 1X9TA 1AYM1 2VQTA 3BPZA 4HFSA 1U5XA 1O3RA 3T4VA 4QX8A 5J96B 1US2A 5A6XA 4EN9B 2BYVE 2JDAA 5FFOC 3N9OA 1Z0HA 2X8KA 1OFNA 2ZMLA 1S0FA 1QGLA 1JYVA 1KDMA 1IG3A 5CVRA 3I49A 5ISLA 2E7TA 3NV4A 2PELA 4RL7A 5JDBA 3MW3A 3FE5A 4XJ8A 3PUAA 2AGSA 3ZSLA 5FXXA 2VMCA 1HN1A 2A6VA 3AZYA 4OMDA 4JKMA 3C7OA 2CV6A 4BIFA 1NLQA 2ZHMA 4AVAA 2VTXA 3ZYRA 1H1AA 1GZTA 1BMV2 2MEV2 4DY3A 5JPMB 1YLLA 4LO7A 4GWJA 4M4PA 5C4WA 4P9GA 2AYHA 4QPGA 4WVZA 1LOEA 3HJRA 5BNPA 2VMFA 1REDA 3B02A 1ZA7A 3VLBB 3BU7A 3GCWA 5CA6A 3KVBA 1QJX3 1V00A 2WYFA 4QKNA 3FLRA 2B5HA 3OY8A 1PM7A 1VBC1 4TLFA 5BNNC 4EROA 1O8PA 3ACIA 4HT1T 1AYM2 3IB3A 3PU3A 2B42B 4AGGA 3WXPA 1K42A 2WO2A 1I5PA 4MUVA 1MEC1 2P3YA 5FJKA 2DBIA 3M1HA 3KF5A 4JDMA 1H8TC 4AEDA 1LB2A 4LITA 3AZVA 1W6PA 1VPHA 3KWVA 1PGW2 1YQ8A 2OZ6A 3B9IA 1BXHA 4EV0A 1RJ8A 1X8MA 4XF9A 1LHNA 3J8F1 2FDIA 1UPIA 4Y5SA 3VDDC 2VBBA 1H0BA 1YI9A 3DCQA 4FTEA 3RGBA 4C0BA 2JXAA 4QU2A 2WS92 5CKQA 2VR4A 3GBWA 1AR81 5KR7A 1FI2A 3G6JB 4GH4C 2MPFA 4CCEA 2L9LA 5FUPA 2UURA 3CDZB 4LBOA 1GNZA 1IKPA 3GXUA 4QAWA 1H6XA 3K2OA 2Z79A 3IM0A 3QCWA 4ZY9A 4QX1A 5F39A 2QQOA 2ADDA 2J1TA 3BN6A 5LBFA 4QX2A 4EWAA 4N8MA 4AHZA 1AVBA 5FZHA 4WVMB 3AL6A 4CEYA 4AFAA 2YPDA 4FPHA 2G9FA 3GBFA 5K9YA 1MEC2 4BK4A 3KV6A 4FPKA 5DG2A 4WBBA 1PHMA 3QH7A 3NO8A 4L99A 1RTVA 2R6QA 2OKXA 5FPXA 1BVVA 4O61A 3NNLA 1Y9MA 1XNDA 3QBQA 5J7MA 3ALQA 4AI3A 3F95A 2O14A 4ATFA 2KA3A 3GJAA 1WBLA 4AG4A 3RZKA 1ASJ3 5IK4A 3I59B 4D7SA 4QM8A 1YXWA 5JOXA 1QQP3 4ZU4A 2XKOA 2YHJA 1BBT1 1ULFA 5SV5A 3NKTA 3NAPC 2A6ZA 4FPCA 3TBDA 1WBFA 4D6SA 1W03A 2GH8A 1RUOA 4CDUC 4KU8A 5LA2A 4CXXA 4XXAA 1AR61 4H3WA 1R082 1UU5A 4TN7A 3WF1A 2DYCA 2HEWF 2ZMNA 5B2GB 1XE8A 2VW2A 2BTVC 1FMD1 3PVEA 4K6BA 5DUUA 5FLIA 3ZSKA 1AR91 2CWSA 1OLMA 1VBD3 5FPAA 1H2KA 1RJ7A 2GC2A 5FO9B 3VDBA 3THDA 3W58A 3IIAA 5C3QA 4MG2A 3OOXA 3ZXFA 1PGL1 4CUAA 2Q5TA 4FOWA 2JE8A 1UAIA 3MDPA 5J36A 1ZBA1 3K4ZA 1UX6A 4MXWB 1UZ0A 1O4TA 4FOYA 1QJU1 3VD3A 1UY1A 1T2XA 4GJYA 1GWLA 1ND3A 3IMNA 4CDXC 3H8OA 1ZRIA 2CY6A 3FN9A 2BPA2 1XYOA 4KWUA 1IG0A 1PVC2 4Y1XA 2RS12 4BIOA 4OUSA 1TNRA 4LA2A 4P9XA 3WG2A 3WVJA 4JDOA 2D5FA 5I8YA 5EFUA 2VPVA 1OA3A 3GZAA 3RYPA 1VBA1 5FZBA 5C70A 2W92A 1DU3D 1OA2A 1CIYA 1WLTA 4HSJA 4N43B 3OF1A 2K46A 3D4KA 4COVA 1AR62 4HSLA 3UL2A 2B8MA 2NZ9A 4U36A 2ORZA 1FMD2 5FKBA 1H2LA 2Q0AA 2VMGA 1S4CA 4TSVA 3CJXA 1CAVB 4GXLA 4YFZA 4BOWA 2IXJA 2XUEA 2GNTA 5FYTA 2ZCWA 4WVVA 2RHPA 4PI0A 5IVVA 1GMMA 5FYIA 5ANQA 1VLNA 3ACFA 3O1SA 1AL21 3ZPOA 4Q8LA 1CAUB 1ZBA2 2VD7A 4R9BA 3S5AA 1YYNA 4O9GA 5A7OA 3JD71 3FFQA 4E2QA 1NZIA 3KGZA 1XBFA 2F4PA 3E5UA 2P3JA 4XJAA 4RQPB 1HXS1 5I93A 4Y3OA 3W20A 4K8RB 4QU1A 2E63A 3POBA 4EN8B 2NP0A 1DLCA 2ZGKA 5G05L 3ACHA 1X36A 1RHI1 2EXIA 5F1RA 4B7KA 3UKVA 2KM2A 2VNVA 3B3QE 2ZX2A 2HEYF 2R071 4YM3A 2BRTA 3S7IA 1SHWB 3AP7A 3VKLA 3GNEA 4IEWA 4I3GA 2DCTA 3JBG3 4OMCA 4UXAA 1XU1A 3U75A 4YNIA 3UKTA 2VOTA 4PLOA 1HRI3 3I59A 4LLOA 4QT6A 1F15A 5CFCB 3PIGA 3VZMA 3KSCA 4EWEA 1XYPA 1KITA 4FP3A 1IZ3A 1OQEA 5A1LA 2EICA 2BGOA 4NIGA 1OOPC 1YIFA 4XUQA 5FZ8A 1LEMA 1HJFA 4YGCA 5I0RA 1IPKA 4BMEA 4FAHA 1WMFA 5AVPA 2Y64A 4JGYB 2FHRA 1TMF3 5C5TA 3WDXA 5KBFA 4BCUA 4FQZA 1JH5A 1CR7A 3J9SA 3JD72 3ES4A 1UYYA 1G8WA 1LU2A 5BNOB 1DYPA 4NPRA 5IAXA 1S0DA 1HXS2 2VOKA 3VZNA 4KU7A 5CIRA 3WG1A 3FUOA 4KGQA 2E9QA 1RMU3 4LLFA 2W91A 4EZHA 5KWRA 1RHI2 1GZ9A 1ULDA 2R063 3DPRB 5KHGA 5LRRA 5IK5A 3LDKA 4AW7A 2DFCA 5T50A 3AKQA 1DQ6A 1W2AX 2WQZC 2XB6C 4A7KA 4BQ5A 1OF3A 1T6GC 2R072 4IGQA 1K5MB 2VTFA 1ENQA 1ULCA 4MXWA 5FP9A 4A44A 3VD4A 5FXVA 3WSOA 1C5IA 5JMOA 1DG6A 1C5HA 3USUA 4KI5M 3OD0A 2I74A 1EUTA 4NHYA 2RJLA 4FPOB 1LESA 1ZVFA 3M7AA 4A3XA 1UPSA 3FWEA 4RS5B 5JR2A 3I3QA 1SLLA 3OYWB 4K1YA 4Y26A 1W99A 3WG4A 4AL9A 5EWSA 4PF5A 1JHNA 1W2NA 4UFHA 3BI3A 4UAPA 1SDWA 5E8AA 5DUXA 3LFMA 1C8NA 1DYOA 4ISQA 4N43A 2ZABA 3BTYA 2PHLA 5LBBA 1CIWA 2YU1A 4HOOA 4Q4W1 2MNGA 3OGJA 4RFRB 3VBSA 4XBNA 2XJUA 4CDQA 5IAVA 4WM7B 3BIEA 1LODA 3MLJA 4BM8A 4CPBD 5IVJA 5FJHA 3ZKUA 1CAVA 4BWOA 3LEIA 1O91A 3GJBA 3LEKA 4CP2A 1XNBA 2YYOA 4DB5A 4AE2A 4AFCA 2R0HA 2WNVC 2VUAA 3I3EA 4B7EA 3DXUA 3WNOA 3RZJA 1CAUA 3LIGA 1PZ8A 3H9AA 2WNEA 1C3HA 4I09A 2RR12 3OBZA 2YROA 4FT8A 2HBTA 5GKAC 5GZGA 4B4RA 5LBCA 4M01A 1ZZ7A 1R091 4XAEA 3ZSEA 2VOXA 1CPMA 3RNSA 3PVNA 4MZUA 2ID4A 4CCOA 2E6VA 2WZR1 1V9U1 3J4UH 5FZ4A 2RDNA 5LATA 1UNBA 3ZX7A 2DVBA 3OG2A 2P6HA 3JUUA 4Q26A 5FK7A 1PO23 4CU9A 1UF2C 4YW3A 2XQRA 3H3ZA 2B39A 3J7NA 1Q8OA 1D4VB 2XWBB 1O6UA 5DPNA 1Q5OA 3BTXA 1POV0 4I30A 1GZCA 1CAXA 2H0VA 5ABJC 4OI4A 3BIWE 1ZRDA 2JD9A 3VUOA 2VZQA 4G9SB 2XVKA 3SCFA 3A22A 1JU3A 2W5FA 4JGYA 1VRH3 1Z7S3 3HNYM 2ENRA 4JQRA 5BNOA 4TXWA 2ZGTA 2WUHA 4IV3C 2FCUA 2YB7A 3MIGA 1D0HA 4DPNA 1JOJA 5J48A 1JN2P 5A1FA 4XEZA 4EWDA 4MV2A 4Y24A 3RMYA 1EPWA 2HYKA 4OI2A 2SBAA 4YM1A 4URAA 3AFGA 2RMU1 2WZR2 1V9U2 4QXKA 2HWC1 2C9AA 1O59A 1W90A 2NN8A 1OUSA 3OCPA 4ITCA 1HDKA 1EV13 3RS6A 1R1A2 5EIYB 1ND2C 1B35B 1J1LA 2DVAA 4AAPA 5L19A 4IE5A 4AFMA 1VIWB 3E6DA 1MS4A 1RUH2 4RS5A 2W39A 2E31A 3OYWA 4MHRA 3VBOC 4CCLA 2GMEA 1XYNA 4NOTA 3TN93 3AKTA 4XTPA 4H14A 1RUJ1 2RJ2A 3D6EA 2ZGPA 4V2VA 5JZGB 2AR6A 2BERA 4AEMA 4OULA 3IDBB 1PNGA 2DUQA 1YO8A 3OJBA 4C0HA 1Q8QA 3CLPA 3NW4A
chains in the Genus database with same CATH topology
2JE9A 3D5OA 4WM7A 5A32B 1PK6A 3H3UA 1I6XA 1MZ5A 4IL7A 4R9CA 2AENA 4QHBA 3IBMA 2RS51 1H9WA 3WHTA 2QNKA 2JG9B 2RMU2 2V73A 4OLLA 2E7AA 4JGZB 1F5FA 4PIYA 2NQYA 1RUG3 2EAKA 3SCHA 1CJPA 2R043 1RC6A 3VKFC 1GBGA 2JICA 2IXLA 4TZDA 4J1XA 1UKRA 4YM2A 5FBZA 3OD4A 4IEPA 3T1MA 2B46X 4U2AA 4B3NA 1HRV1 4YZ2A 1MR5A 4XPVA 3V65A 2K2SA 2AZ5A 4DXZA 1O4ZA 3RYKA 4B4QA 4ZU7A 2O8OA 3GHMA 4HKWA 1WW7A 2ILMA 4PBPA 3UV9A 4LBMA 3K51A 2XLAA 5I8TA 4IEYA 1S0IA 1QH6A 4FP2A 4D7TA 1O4YA 3X29B 3H8UA 1TNFA 1G9DA 2RS52 5J3UA 2ZGUA 2N7GA 4B4PA 4XHBA 1AL0G 3SH5A 1FT9A 1U12A 4NR1A 2VOWA 5E89A 1J58A 1KQRA 3WW1A 5HCAA 1H4GA 1V70A 4Y20B 3ZVXA 4N9IA 3Q9OA 2IC1A 4ES8A 2CGOA 1QOSA 3TRSB 4GKXA 3D8CA 5EZWA 4ASMB 1AYN1 5CNAA 1MQTA 2D97A 1DBNA 4IEQA 4D69A 5KXDA 4N90A 4JDNA 4Q1RA 3TYJA 1B35A 2UY8A 3T1LA 4IXLA 4HETA 5JVVA 1BEV1 4Q2FA 4FXKB 1GV9A 5ACA1 1G9CA 5JSPA 5JZGA 1BKZA 2GZWA 3M3CA 3N35A 3DKWA 5BNNB 4IETA 1RVF1 5A32A 3WW3A 1SLBA 1H8TB 4XE9A 3WHUA 4RFT0 5GLTA 1VBB1 2WWSA 1BCXA 4M3CE 2JG9A 4QQLA 1RINA 4AK3A 1A6CA 4JGZA 3VDDB 2C1FA 3ZFFC 2PHTA 2DCKA 3WY6A 2UYBA 4X6RB 1FOD1 2ZZJA 1UCXA 5CU1A 1O3SA 1LULA 1JYIA 3THPA 1BEV2 4GH4B 2PHXA 1LGNA 2B7YA 1GZWA 5DZFA 1W6MB 3WQ1A 4I0BA 3MYXA 5ACA2 3CNAA 3ECQA 4WZFA 4WVWA 2OZJA 5FQ0B 2GDFA 1AR73 1Q43A 3LOIA 1RVF2 1FNZA 4G3YC 3BOPA 3V0AB 1WD3A 4Z92B 1XQNA 4ISRA 2NMOA 5BYNA 4LO4B 1JTZX 2NMNA 2JENA 4PJYA 2RM21 2WZPP 3ZYPA 4DFSA 2D6MA 4F83A 1C8M3 4Q4V3 5KHHA 1CVNA 2HWE1 4XZPA 1HKDA 1I5ZA 1N1TA 4GB31 3HT1A 3AMPA 2PLV3 1PZ7A 4Y20A 1AUYA 1DDLA 1LENA 3S6PA 3NWKA 4XJZA 3NAPB 4H55A 4DINB 2XBO2 3O0XA 5JWPA 4CDUB 2BFUS 4Q4X3 1OQDA 1JYCA 4DZGA 1RUF3 3E5QA 2OA2A 4Y1UA 1APNA 4AHYA 1RUE1 4XMIA 1QJY2 3H1YA 5K0UC 1RUI2 3ZN6B 2YGLA 1YI7A 3VBFC 4CTEA 4K9SA 1RUC2 3CEWA 1POV3 1V6LA 4OHYA 2VVEA 1LHVA 2WFF2 1ZBE2 1D4M3 1QWRA 2PHWA 3TB0A 3ILFA 3RQ0A 2RM22 4XQDA 2VNRA 2H6BA 4XF1A 2PAMA 5DDJ2 2ZHLA 2PFWA 4OZXA 3QACA 1KS5A 1H4HA 4MVTA 4CDXB 1IS6A 4LBKA 3WCRA 5BY5A 5GZEA 2BGCA 2Q30A 2YY1A 2TUNA 1H8TA 2A7AA 4L2NA 2QCSB 2HWF2 2JEMA 3ZXAC 4XIOA 4KG8A 1MS1A 2TBVA 3H1WA 4HK8A 4NN0A 3VDDA 5KXCA 1C1FA 1RUE2 3TAYA 3NJZA 4INDA 1W6NB 4KNCA 4RGGA 2OPKA 3VZJA 4GH4A 3CJIC 1VBE3 2WNUC 2ZX1A 1FXZA 3S0MA 2UWCA 5I91A 3MW4A 4WZCA 1RITA 3DL3A 1CN1A 1PGW1 4I3PA 2Q8OA 2ZMKA 2WKKA 2AREA 2GU9A 1VB4A 1FYUA 1DQ0A 3V0AA 3AK0A 5AVAA 1DFQA 4XF0A 4Y5Z0 3JB8A 2R16A 4ATEA 1PIV3 2WS91 3POYA 1GR3A 1ZRRA 2WSUA 2XL9A 1QJX2 5T54A 2LTNA 4W6XA 1NG0A 5CG9A 4S2GA 4DOUA 3DGTA 5FMOS 2FMYA 3BCWA 1COV1 5LRSA 4Q0PA 1OOPB 3R4SA 3AYEA 3NSTA 5T52A 2QZ2A 1ULEA 2VY0A 3AMQA 4CDUA 3TNPB 4ONUA 1Y7BA 3WQ0A 2DF7A 1GQHA 3SH3A 3ZN6A 4R8HA 2WJSA 1UN1A 3B69A 2MEV3 3E5XA 3WX5A 4YZ3A 4JRAA 5D8AC 4GALA 2GALA 4WM8C 1OSGA 1ONAA 1NE4A 4BHPA 3FLPA 2VVDA 4GMP0 1LOFA 4QPIC 3VZLA 2W68A 3AMMA 3ST7A 3B01A 1TME3 3MIFA 3ZYGA 4BZ4A 2YDEA 3AXDA 1UU6A 2ZAAA 1AYM3 4CDXA 4Q0QA 1R081 2Z2SB 1COV2 1FPN1 5E16A 3AJYA 1X7NA 5FREA 2CTVA 4XFIA 4C91A 2JG8C 4IEVA 3VHNA 2WQ4A 3FC0A 5JOWA 3RYRA 4XMAA 2ZJCA 5A3MA 1UIJA 1W39A 4IV1C 5J37A 2W0XA 3ZMNA 4JCKA 4Y1YA 5H9QA 1QY4A 3CF6E 1G86A 5GLUA 3LWCA 4SBVA 3WD5A 3OTFA 1ULGA 2D93A 4Z07A 4R9AA 1O5LA 1PVC1 2DUOA 2RS11 1SACA 2WNVB 3SMHA 5FO8B 5AC91 3ZFGC 1W6OB 2Q1ZB 3R05A 1WLCA 2VGDA 3KD4A 4AI8A 1DGWX 1VBC3 4XFAA 3WP5A 4XQ4A 1AJKA 1WCSA 3THTA 1CGPA 1MEC3 4HVRA 1LU1A 2LM3A 1F31A 1FPN2 5FPZA 3MGUA 3WUDA 5E88A 1M06G 3VGIA 3J8F3 3AKSA 3R0RA 3MIEA 1QDCA 1H2MA 1KDKA 5CFDC 1Q8SA 4YYOA 2XVLA 1C57A 1TQ5A 2FZ1A 4AQSA 1F2NA 1KXGA 4PIZA 4RHV1 5LEKA 5FLHA 1AR83 1OOPA 3HN1A 3ZDSA 5ABJB 5DUVA 3AKRA 3SNMA 3ZYIB 2GAUA 3AYAA 5AC92 1HLCA 3FMGA 4KGGA 4KH9A 1X8EA 4IV3B 2PA7A 4QGMA 3WCSA 2CGPA 2ETEA 1H1MA 3OBTA 3INAA 3KCXA 1DIWA 3HIFA 1DGRA 2GSYA 5CAZA 2P3IA 4XJ9A 1IS4A 2XJSA 3ZFEC 4NWWA 4AVBA 2JX9A 3GZTB 4DRRA 4UW6A 1AJOA 2D7FA 1ND2B 2A70A 2RJKA 3U07A 1JUHA 2A6YA 1WLDA 1BBT3 4RHV2 2IXHA 4PCRA 2HJIA 4QGNA 1PO11 4HL0A 4WVMA 3VBOB 1QXPA 3W59A 1AR63 3MZHA 1SLCA 2FQPA 1HRI2 1FMD3 1ENRA 4FPFA 2XUMA 1AR93 1I3HA 2ZGNA 1WW6A 1GNHA 1AHSA 3N3HA 2VVFA 2Y0IA 3O7OA 1DGLA 4JTNA 3MICA 3B00A 1AX2A 3GALA 1NXMA 2WA4A 2WNVA 2XGXA 3HMYA 1ZBA3 1YJKA 2IXKA 1W6OA 1TMF2 1QJU3 4LBNA 2O1QA 2Z5WA 1C4RA 1NA1B 1Y43B 1ALYA 4FPGA 1YHFA 3DN7A 4CRQA 4OUMA 1MS5A 5DZEA 4Q0SA 4Y1ZA 2ZGQA 4E9KA 1UZYA 1WCDJ 2R062 2OVUA 1PO12 1VBA3 3NV2A 4G4FA 3R4DB 1N3QA 3RMXA 1YFYA 2QE3A 1MVQA 2YPJA 2VUJA 1ND3C 1YFXA 2C0ZA 4UBHA 1XE7A 2R1DA 1LGBA 2P17A 4YSFA 4YZ5A 2RR11 4XTMA 3WZ1A 3PHMA 3H7JA 2XKPA 5ABJA 3ELNA 4L11A 1CQ9A 1AL23 3RG0A 3ZO0B 3JD73 1G6NA 3MPPG 1HXS3 3VHOA 2WIIB 3AJZA 4IV3A 4YG3A 3WUCA 1LOAA 1D2SA 3LOBA 3K48A 4I01A 2BEOA 1RHI3 1V6KA 4YVSC 4ZXKA 2VULA 3M3IA 3QLQA 3LAGA 2LUWA 2E51A 1SCSA 4CEWC 1VJ2A 1OFSA 5E1RA 2R073 2RS31 2EXHA 1U5YA 3LSEA 2WSVA 3ZIWA 1YFUA 3A4UA 3VZKA 4K3UA 1QF3A 2PYTA 2YUEA 3OBRA 3ZXJA 2VNOA 1NXD1 4NHKA 1UD1A 3BTAA 4YW5A 1WUVA 4W65A 5GLZA 1FV3A 4E2SA 1EYBA 1WGPA 1NE6A 4RQPA 2ZBJA 3MIBA 5JIUA 4QM9A 2ZOEB 3MW2A 1XNCA 1WD4A 4Q29A 2P34A 1DF0A 3O0WA 3VBUC 1LR5A 2IXCA 1PZ9A 4KL1A 1PO22 4MSVA 1ZA4A 4Q27A 4C1XA 3PNAA 3LKJA 1R1A1 4GMP3 3VL8A 5K8SA 3HD8B 5CFCA 1BVP1 5IK7A 2DCYA 1RUD1 2RS32 2DUPA 1RUH1 2NLRA 4V1PA 2UYAA 1G9AA 4HMZA 3SITA 3M8LA 3ZFFB 1VRH2 3E6CC 1NA1A 5J98B 4N9HA 4S2FA 3C3VA 4Y1VA 5GZCA 2I45A 4OFGA 4C1WA 4XDQA 4AHWA 4K8FA 5GJ6A 4AWDA 5GZFA 1NQDA 3TNQA 3WDWA 3DPRA 5JSRA 4HANA 3MLKA 4Q4W3 5F5QA 3PVOA 1AXZA 1HV0A 2ZKNA 4XFCA 1K5MA 4FTSA 4PDWC 3ZXEA 4KG0A 3J26N 3V0BB 2KXLA 1RUD2 1SBDA 3SCGA 4XHXA 3ZN5A 3VBSC 4CDQC 4YG6A 2YGMA 4LA3A 5FO7B 2IZWA 1H8VA 1GYKA 2EXKA 1R093 2QZ3A 1OLRA 2DU1A 3AFKA 3KM5A 2WZR3 1G9FA 1V9U3 2HEVF 4I0AA 2VXRA 4LUMA 1DYKA 1EPZA 3WR0A 5K0UB 2EA7A 2IWGB 2QDNA 3VBFB 1RUG2 5BXXA 4N7IA 2R042 1J3RA 1N3OA 4H7MA 3E6BA 4QD2A 2ZPXA 3AYCA 4RR3C 4UW5A 1F5JA 2D6KA 2VH9A 4RA0A 4LNVA 1SLTA 3JZVA 3LA7A 2O0OA 5IUQA 5HXVA 3NV1A 2D6PA 1LHWA 2ZZQA 4AVVA 2BVBA 2GC3A 1BZWA 3IDEA 2D6OX 1IS3A 3WOGA 1OMIA 2ZX4A 1S2KA 3VL9A 3WP4A 1MVEA 4AEJA 2RMU3 1WCKA 2OW4A 4AVTA 5CADA 2E7QA 2HWC3 3A0NA 1I9RA 3ASIA 1ZRFA 2EAAA 4K7JA 5HBAA 3ZFFA 3H0OA 1SQ4A 3FBMA 4PBOA 4Y22B 5BNOC 5C8CC 4YGDA 1RIRA 2WINB 3UKNA 2IFRA 4OHZA 5C9AC 3CJIB 2WNUB 1SBEA 2DFBA 1QMJA 3CL1A 4LUKA 1RUJ3 1F9KA 2BNMA 3B7MA 3M3EA 4N53C 4AXOA 1PMIA 4META 5JOZA 1IQAA 3VKMA 3MPBA 1C1LA 3HBZA 2GNDA 5HCFA 1MACA 4M3CB 2XG3A 2YXSA 3V0BA 5FDBA 2RS53 3L2HA 4FTBA 2P37A 4XBQA 4AHXA 1RL3A 2HWB1 2OUHA 4ES9A 3VBRC 2JKBA 3FBYA 2BBVA 2GN3A 3ZYJB 2ES3A 1V6IA 1LECA 3WDTA 1EAH1 4YVWC 3WW4A 3RJ2X 1PK6C 1SFYA 5TSWA 4AI2A 4R4XA 1ENSA 2PHDA 2UU8A 1GQGA 2A73B 1HRV3 5EJ3A 4S2DA 4Q4V1 5K0UA 2PAKA 3WINE 1BJQA 4FOQA 1QXJA 1EP0A 2Z42A 1KFXL 3JQWA 4HPKB 4Z1VA 1MZ6A 5D8AB 1KJRA 2BWCA 2X5IC 2QUOA 5DXDA 1AZDA 1O5UA 2DURA 2E53A 4OVEA 4WM8B 5CB7A 5FOJB 1TE1B 3U11A 1FAYA 4LO6B 1PVXA 3USSA 4OI1A 4QPIB 4Q4Y1 1DHKB 3UK9A 2HWB2 2XBO1 4YARA 4JV4A 5F6KA 2AUYA 5BUVA 1FNYA 3RWNA 1AR72 1EAH2 1VB2A 4LE4A 2WL1A 1QJY1 2BWAA 1RUI1 2A3XA 2CNAA 4LHKA 2ZGRA 4P9LA 4P9IA 4YW1A 1MS9A 3MI8A 2JG8B 3DV8A 5JI9A 1RUC1 2HWD1 1LGCA 4K40A 4XF3A 3ROUA 5HI0A 2WFF1 1ZBE1 1AYN3 4QQOA 4C90A 4Q4V2 4AFDA 4FPEA 1PGSA 4IV1B 3RRDA 5KXEA 2BNOA 1WMDA 1WW4A 5DDJ1 1DZTA 1AX1A 2PLV2 5T3NA 3KS7A 3QH6A 1BEV3 1VAKA 2GN7A 4A2UA 3CJIA 3KT1A 1QHDA 2WT2A 4E4ZA 5LK5A 5ACA3 1Q56A 4Q4Y2 4M0HA 4XF4A 1MQTC 1ZNPA 3SISA 3ZFGB 2DVFA 2HWF1 3GHNA 1RVF3 1QOTA 1NCQC 1TEIA 2FZ2A 2K9ZA 1LEDA 1CPNA 1REFA 1VBE1 3PJYA 4TWTA 1VBB3 4PLMA 1CX4A 2X53S 3AP6A 3S7EA 2BVVA 2HWD2 3A0KA 4R9DA 3VKNA 1REEA 1OLQA 3PLQA 2DTWA 4FXGB 5CFDB 1QH7A 2EVXA 4QQHA 1GICA 2VNGA 1FOD3 1OQ1A 1VR3A 1UZZA 5BNNA 2VQAA 1S0GA 2D6LX 4UW4A 5KHKA 4Z82A 1W6PB 4BH9A 5JIAA 2D44A 1GSLA 4BA6A 3H50A 4D94A 1NCRC 1Q8PA 2EIGA 3ZXLA 4KBBA 3KZ4C 5KXBA 5L7OC 4HKLA 4MGIE 3ME2A 1DZRA 1QJX1 4HPKA 4L97A 5D8AA 4B8EA 3WDYA 4LEJA 4WM8A 2W08A 4GWMA 2H0BA 1VBE2 2YZ4A 2RM23 4LBQD 1JW6A 4PIXA 4CDWC 4DY5A 3ZFEB 4AYUA 1PNFA 3I54A 2HWE3 4HZFA 2DVGA 1J59A 4K20A 1M4WA 5JMCA 1CJDA 4GB33 3T2TA 2ZS6B 1W6MA 4XFBA 5DZGA 1NLRA 5FCCA 4ASLA 3SXWA 5FQ0A 4HN1A 1IS5A 4QMAA 1V6NA 4XXPA 1YUDA 5JR7B 2V5YA 4NVPA 4K21A 3ACLA 4P5HA 3R6SA 4HVOA 1HX6A 4MGYE 1RUE3 4IV1A 2PN5A 1YRZA 4FO9A 4R52A 3VKOA 4E2GA 2RE9A 2CYFA 2LALA 1URXA 2QJVA 2HKXA 2WLPA 1RGSA 3NV3A 3P3PA 5T55A 3L2YA 3O14A 1W6QB 2ET1A 2NPIA 2D98A 2JECA 3V64A 4AI0A 3M3OA 2Q4SA 5F9TA 3KCYA 4SLIA 3ZFGA 1YJLA 2ZACA 3NAPA 4JTOA 5I0UA 3IT8A 3I8TA 4COYA 2F6BA 1MS0A 1FV2A 3N7MA 3NVCA 4P9JA 4YRDA 1OD5A 1ASJ1 4S2HA 4XJWA 3I7DA 2B9UA 3GBGA 4JC1A 1QQP1 3MF9A 3ZN4A 5KHJA 1IKQA 3VN4A 3JU9A 1TME2 3PMEA 5CFDA 1ND3B 1JXNA 1GKBA 3PMSA 2QQPA 4E4SA 1NY71 1VAVA 1HQLA 1QU0A 4AVSA 1MS8A 2R49A 2H6CA 1VBD1 4NWVA 1MZFA 3M4FA 2ZTNA 3N7LA 4AGVA 3NL1A 3WG3A 4R4ZA 1Q3EA 3KT4A 1LOGA 1AF9A 3UJOA 3LA2A 3AP4A 1YIPA 1H9PA 1XU2A 2R30A 2ZGLA 4H7LA 1WLWA 4YVSB 3VBHC 3W9AA 1I1EA 1ASJ2 1V6MA 1Z78A 2BFUL 2PHRA 2WLQA 4CEWB 2WS93 1W6NA 1NZCA 1QQP2 2WA3A 3ZFEA 3ETQA 4Q8KA 4AEKA 4DNYA 1ZZ9A 4O9EA 4RSUA 3TOJA 1VBC2 2ERFA 3U0ZA 2EXJA 4F3JA 1V6OA 1COV3 3GZUC 3APBA 1J3QA 1JUIA 4CP1A 1NY72 3JQXA 2JE7A 4W6WA 5I8SA 1VBD2 5C4WC 4I0WB 2XJRA 4QPGC 3J8F2 2XLGA 5BNPC 4W6YA 2ZA9A 5KC5A 3VBUB 3WDVA 4XBLA 3O0VA 1YNAA 4YG0A 3RI8A 4EN7B 3FJSA 3HAGA 4HBNA 2YC0A 5EYYA 4XFFA 1AR82 5EV7A 3RI9A 1W6QA 2XPJA 2XJQA 3MIHA 4JAAA 1D0GA 5FRAA 3WP6A 2GNMA 4AEDC 2A6XA 4P9WA 5F6LB 1DQ2A 2A3WA 4DRVA 1VP6A 3QD6A 4XW3A 3AX4A 1R083 3JBG1 4K1ZA 1FPN3 2DU0A 4B29A 1HRI1 1G9BA 3D0JA 3DUIA 2G4IA 1HIXA 5T5LA 5JOYA 2PHUA 2A75A 1LOFC 4OHVA 1A8MA 4PQ9A 1QJZA 3ILRA 4GA9A 2ARXA 2EALA 3RZZA 1W0PA 3USUB 1LTEA 1OI6A 1FATA 3ENRA 4FPLA 5I0SA 2OYZA 1TMF1 1J3PA 1O3TA 4PDWB 1BBT2 1PVC3 1ZZCA 3C2UA 2RS13 4CEYC 1X33A 1GFF2 2GC1A 1RMU1 5AC93 2R061 5FMOL 1V6JA 2BUKA 3AZZA 4MXVA 4FPJA 3VBSB 1NYWA 2TEPA 4CDQB 3WDUA 5C6CA 1AR92 5A3LA 4MX3A 3JBG2 4YVSA 4M00A 4MLOA 1CONA 3O5SA 1BQPA 2CWMA 4CEWA 1LKNA 2FBEA 3BALA 1PGL2 4P14A 2Y26A 3KGLA 1JBCA 3WQ7A 2XVGA 1QJU2 1ZX5A 4AVCA 1DGRN 3LSDA 4LE3A 3KMHA 4RHV3 2DTYA 3ZMOA 3ZXGA 3ES1A 4LO8A 4RR3B 4AGRA 2CGNA 4JRLA 5DG1A 2CAVA 3AZWA 4FAGA 1QDOA 4Y4YA 1VBA2 2B45X 1OKQA 4HKOA 1RMU2 4UBGA 1HV1A 1S0JA 1OPOA 1QOOA 3I2DA 3PTYA 4Q0UA 3S30A 3VBUA 1S0CA 2UWBA 4OI0A 3AZXA 1LOCA 1HQWA 4NHLA 2O8QA 5LEJA 1ZM1A 2BNNA 4IEUA 1NOVA 2DCZA 3N7JA 5D1IA 3H7YA 1HW5A 1CAXB 1H2NA 1S1AA 4X8PA 4HVQA 4JVAA 5CG8A 4Z8BA 4E27A 1AL22 4MH0E 1SBFA 1BK1A 1LOBA 4LO5B 1ZZ6A 4CP0A 2D3PA 5C8CB 3IPVB 1H30A 1CAWB 5A33B 1D2QA 2BW8A 1MS3A 5H9SA 3EXUA 3URFA 5C9AB 2AH2A 4URTA 4GMP1 5C33A 5AFBA 1PO13 1PO21 4FBFA 1XXNA 4D3WA 4I2OA 4N53B 5HCBA 3U10A 3PVBB 1DGWA 4AQTA 3IDCB 2G9GA 3B93A 2ZGOA 3VHPA 2VW1A 2GH2A 3MIDA 1YWKA 2OUJA 3WLUA 1XRUA 1VRH1 4PDWA 1Z7S1 4RD7A 2VMHA 4IQPA 2V09A 1KS4A 3RJRA 1ND2A 1YCIA 3H1MA 3G7DA 2DVDA 4IEXA 3N36A 1QXRA 3VBRB 1KJLA 4XFGA 3VBOA 2GC0A 5I0TA 5IT6A 4XOGA 4YVWB 3ZIXA 1N3PA 4DMIA 3LB9A 1PK6B 4YZ4A 2P3KA 1EV11 4DS0A 4HN0A 2EF6A 3EBRA 4GIQA 1Y3TA 1AXKA 2Q1MA 2XJTA 5T5JA 2D5HA 1R1ZA 2ARBA 5GM0A 3TN91 4BPZA 3KB5A 1SCRA 4CYDA 3AM2A 4M3CF 1X82A 2ZHKA 2X5IB 3D82A 3R4UA 2R1BA 2IXIA 4RR3A 4BE3A 4D7YA 4ZKTB 2VMIA 1Z7S2 2RR13 1L3JA 2IFWA 4GULA 4ZU5A 2D3SA 2PQQA 4LBQB 4LBJA 4MGZE 3UJQA 1B09A 1FX5A 1IPJA 2R0FA 4L9BA 5GZDA 4Q4W2 2TNFA 2CAUA 4IEZA 4CZSA 1NLSA 2I2SA 4MYEA 1UIKA 1G7YA 3RPQA 1RUG1 2R041 1EV12 1S55A 4KWJA 4QQ2A 3ZXDA 1A8DA 3M70A 1SMVA 1QKQA 2RS33 4YGBA 2XWJB 1LCLA 5BPXA 4P9YA 2JDZA 2QDRA 1CESA 2A71A 3TN92 5C8CA 3IPVA 4IERA 2BQPA 1CAWA 4AFBA 3JCIA 3KT7A 4N43C 5A33A 4COWA 5C9AA 4LULA 1R092 4YM0A 2CL2A 1A78A 2UWAA 2ZX0A 4WV8A 1DQ4A 5JLVA 2Z69A 4N53A 4YFWA 1MQTB 2A3YA 3HT2A 3TWIA 3DF0A 3EJKA 1W2UA 1Y9QA 1NCQB 3SH4A 1S0BA 4LR4A 4AQ6A 3D0SA 1R1A3 4YZ1A 2D40A 3AMHA 4RQPC 3RSJA 3GF6A 3WW2A 4KWKA 1RUD3 4LTAA 4XETA 1Q8VA 1RUH3 4FCAA 3VBRA 2XH6A 3NKGA 3V56A 5BV6A 5L36A 1GLHA 2YV8A 4YVWA 2ET7A 2VOVA 3N7KA 4Q0VA 3QOPA 5FLJA 1U5IA 2XHKA 1UL9A 4Q1PA 4F8AA 5CFCC 4AF9A 2C5DA 3BB6A 5DUWA 5AFEA 1XNKA 4XYXA 1NCRB 3WNXA 4M0NA 1DQ5A 2HWC2 3OGGA 1WA4A 5L7OB 2YMZA 1ENXA 1NA1C 4EN0A 1VALA 2A5ZA 4YGEA 3E97A 4JGYC 1IOAA 1GANA 3LA3A 5H9PA 2X5IA 1N1VA 1E57A 1OA4A 5JI7A 5T5PA 2VECA 4CDWB 1GZWB 2D6NA 4LBQA 1RUJ2 4J6GA 5KC6A 3DPRC 2ZAHA 4GWNA 3HWJA 1CD3G 3I4IA 5JAXA 4FSJA 1UU4A 3VZOA 4NO4A 3FX3A 1K5MC 1IGOA 2QFEA 5EXOA 3N4MA 1BYHA 3JB4C 4COZA 2WFPA 3FHIB 2PAEA 1DQ1A 1SFNA 1O3QA 4RS5C 2A6WA 4J1WA 3WP3A 1J1TA 4PLNA 2W52A 4E4DX 1N1YA 4KQ7A 4F7ZA 3KLSA 1AR71 4WM7C 4COUA 4XIKA 3LCPA 3AP9A 1KFUL 3FLTA 3SLIA 1QNWA 1HRV2 3AXEA 5JSOA 4XQWA 1LJ7A 1NCQA 1NQJA 1SLIA 1C8M1 5SV8A 3SHRA 3WV6A 5BNQA 2OIIA 2JD4A 4I02A 4N7UA 3VBFA 2PLV1 3LGRA 2MHFA 5J09A 4LT5A 3ZSJA 2WT1A 2WC2A 1UKGA 2FMDA 1MZEA 5H9RA 3FFZA 4Q4X1 3VHRA 3RDIA 1RUF1 3CO2A 3MFAA 4L92A 3L9JT 2X29A 1OHFA 4LBLA 4GQ7A 4X6QB 4LHNA 4UW3A 4YLZA 4XJUA 3AP5A 4QPYA 3LZZA 5JPNB 1NCRA 1POV1 1WW5A 2VU9A 4ORFA 1D4M1 1AYN2 2I07B 5FTTC 4BLIA 4Z2WA 5L7OA 4YW4A 3FZ3A 5FAXA 3GYDA 2DCJA 1S2BA 4FQ4A 1C8M2 3VBHB 4HLTA 4OHXA 4Y22A 3PJQA 4QGLA 2GMPA 2P2KA 4CDWA 3AKPA 4FOVA 1SLAA 2HWB3 1H1IA 1IHMA 2WNUA 1RUNA 1LHUA 4XILA 1U5ZA 3ATGA 4EN6B 1EAH3 5KHIA 3B9CA 5L73A 4HK9A 4Q4X2 3HR9A 4GKYA 1RUF2 1ZZBA 3OPZA 3EHKA 3EQEA 4FVVA