2WNVB

Complex between c1q globular heads and deoxyribose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
131
Chain Sequence
TQKIAFSATRTIVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain.
pubmed doi rcsb
molecule tags Immune system
molecule keywords COMPLEMENT C1Q SUBCOMPONENT SUBUNIT A
total genus 30
structure length 131
sequence length 132
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wnvB00
1TNRA 2WNUC 4J6GA 2Q1MA 3ME2A 2WNUB 2WNVB 1U5XA 2ZJCA 2WNVC 1JH5A 2Z5WA 1XU2A 4KG8A 4RSUA 2R30A 5BNQA 3AB0A 1RJ7A 3QBQA 1OQEA 1PK6A 3TYJA 4KGQA 2JG9B 1D4VB 4QPYA 4E4DX 2JG9C 4QQPA 3B94A 5L36A 3L9JT 1RJ8A 1JTZX 4G4FA 4OUMA 2KA3A 2OIIA 2RE9A 2WNVA 4TWTA 5CIRA 4QQLA 5TSWA 4MSVA 1KXGA 1DU3D 1A8MA 3IT8A 1XU1A 4EN0A 1KD7A 3WD5A 1U5YA 3K51A 2E7AA 4MXVA 3MI8A 2TUNA 4MXWA 1I9RA 2Q8OA 4OULA 4G3YC 2ZPXA 4KGGA 2AZ5A 1ALYA 4QQ2A 1D2QA 3URFA 1DG6A 3LKJA 2HEYF 2TNFA 2RJLA 2JG8B 4GIQA 3ALQA 5KC5A 4D7YA 5L19A 2JG9A 2JG8C 4N90A 1PK6B 4NN0A 4TSVA 2O0OA 1D0GA 4MXWB 2X29A 1IQAA 4QQOA 2R32A 1TNFA 2RJKA 1PK6C 1S55A 2HEWF 4DOUA 3FC0A 1C28A 3B9IA 4E4SA 1O91A 4DB5A 2JG8A 5HBAA 4OUSA 3QD6A 1U5ZA 3V56A 3B93A 3K48A 5KC6A 1GR3A 1OSGA 1C3HA 2R6QA 4QQHA 2HEVF 1OQDA 4HT1T 3TWIA 2QDNA 5KWRA 4F3JA 1WCKA 2QE3A 2WNUA
chains in the Genus database with same CATH superfamily
4AQ2A 1FPN3 4CPBA 2Y34A 4J6GA 1A34A 2Q1MA 3B5LB 3T2QA 4B7EA 2GC1A 2FDHA 4ZU7A 3DGTA 1IPSA 1Z78A 4CCCA 1JZ8A 4BQ1A 2QJVA 2WLPA 2B9UA 2QQWA 5I0TA 3ZO0B 3CEWA 3Q8EA 3RRDA 4CDWC 3MUZ1 3O1MA 1X36A 4JTOA 4ZKTB 2O14A 1E57A 4IEOA 4LOTA 1JOBA 5J3UA 2D97A 4JC1A 4DXSA 2FZ1A 3N9NA 4DXRA 3WDTA 4I3PA 1LR5A 1IGOA 3MLLA 3OEBA 3SMHA 4FTEA 4JQRA 5FP3A 3NWKA 5F2WA 4TN7A 1YIPA 2JXAA 4GWIA 4A44A 2CV6A 3I2FA 4IEYA 2HYXA 3JBG1 4LO7A 3ZXGA 4CTEA 1C8M3 4LHSA 1XSQA 4YW1A 2BVVA 3VN4A 4NHMA 3VKOA 2ZTNA 2WYFA 5CADA 1U5YA 2RJ2A 2VOKA 1VP6A 1NLRA 5LW9A 1DDLA 4M0NA 4QM8A 4HSLA 1CAUB 1SCSA 2D44A 4NRQA 4LNVA 5C8CB 4QHBA 1U5IA 2YGMA 4QPIC 2YC2A 4UW5A 4XJ9A 2GNTA 2PHTA 3AFGA 3OGRA 2XL7A 4XUTA 5F39A 1D2QA 3DL3A 4HXCA 2FDKA 1S2KA 3QCWA 1Q8PA 4K7JA 4LBQA 4XF4A 2PLV2 3B01A 1JZ2A 1RTVA 3INAA 5C8WA 2C4XA 4NRMA 3ZDSA 1RUNA 4GAZA 2HWC1 2VZOA 4NUBA 4DY5A 2LUWA 2D5FA 3MPPG 5KXDA 1YFXA 2HWD3 4I0AA 5D8AA 1HDKA 2JG9A 3U1XA 2ZX3A 3C7EA 1RUF2 3AYAA 1Q8VA 2GC0A 1CPNA 2VPVA 3I3QA 4LITA 1ND2C 1IQDC 1L7LA 5AFBA 5CFCB 2XVGA 2Z4FA 2X5IC 2C6SA 3KGZA 1W6OA 1EPWA 1UF2C 1HJGA 1W2TA 3HR9A 3VGIA 2QNKA 3EMRA 4Y20A 5BNNA 3FC0A 4XBQA 5I8SA 5I0SA 1C1LA 2C24A 5DZFA 2XJSA 5LA0A 1NG0A 2X05A 4AG4A 2VBPA 5JCTA 4M4RA 3FN9A 3ZPOA 4CEYC 2A3WA 2MPFA 5FYBA 4D7SA 5KHIA 1HJFA 1F35A 1NQDA 2ORXA 5FJHA 4B4QA 2XUEA 3OSDA 5BPXA 3SQOA 1AX2A 1I1EA 1IG3A 2W08A 2XQXA 3POWA 3N7LA 2ZX2A 3BTYA 3VBFA 1NQJA 5FPBA 4CDWB 2CWMA 1PZ7A 4EN9B 3FZ3A 2VMGA 4ATEA 1H4HA 4MGQA 1Z7S2 1AVBA 5CYYA 4X8NA 4A6SA 5A3OA 4I0WB 2VMCA 3WXPA 1OBNA 4XPVA 3I2OA 2W95A 5GZDA 3TAYA 2OPWA 5FPVA 2DCKA 4HMZA 5LBFA 3N4MA 3MFCA 1TNRA 4LPLA 5GZEA 1LECA 5ACA2 4DQAA 2JDZA 1QU0A 3BOPA 3NJXA 3NL1A 5FMBA 2FMYA 2NMOA 1O3QA 5A1FA 2QBXA 4CRQA 5JXGA 4LO5B 3HOBA 3AC0A 3LZZA 2OW4A 5FREA 3K77A 2JX9A 1H30A 1CQ9A 2VJXA 5C5UA 1V6IA 4OZXA 5L73A 4XUPA 4CDWA 4LUKA 1OT5A 1VJ2A 4AF9A 1O4YA 5FY1A 5JOWA 1XE7A 1YJKA 1PK6A 5CBLA 3S7EA 2OVUA 3RZGA 5H9SA 5BNPA 3I54A 3QLQA 1OPOA 5JAXA 4FSJA 5FZFA 2WT2A 5T5PA 4P00B 1BLZA 1YQ8A 1JTZX 2BPA2 2P2KA 4COYA 2Z2SB 5JPMB 1DQ2A 2Y6LA 2RE9A 2WAAA 3AXEA 5B2GB 3FJSA 1OKQA 1KFUL 3K4DA 3ZYHA 2YDEA 1ZZ9A 1J3RA 4K21A 4LBQD 1NE4A 2ZGNA 2AC1A 3LEGA 4UFMA 2F4LA 1FOD1 2XONA 3DN7A 3HQXA 4CDXC 1UIJA 5DDJ1 5IHRA 3PTYA 4QB1A 5EZWA 1F31A 3WF3A 5A3UA 1QDCA 2VNGA 3MYXA 4OULA 2Y64A 4YW4A 5JMOA 1QJY3 4FTBA 1V9U1 2FQPA 4Q27A 3WG1A 1V70A 5FXZA 2F6BA 2ZHNA 4CCNA 2JICA 1LU2A 1S0JA 3AP5A 4YVWB 5KXCA 1S0DA 4NPRA 4GIQA 1UW8A 4HLTA 3ALQA 4RQPA 1YQCA 3THCA 4A3XA 5JIAA 4XFCA 1DGRN 4NVPA 2DWRA 2BERA 4WBBA 1CX4A 2W92A 2RDSA 1JYCA 1AX0A 2ZHMA 4N90A 4WM7A 5FYHA 2W1WA 1S0FA 2F17A 1X33A 2E9QA 1ZA7A 1QNYA 2LALA 4TSVA 1NT0A 1UYZA 2QKDA 3ZYIB 4LBMA 5JXJA 4YZ1A 4F8AA 1ODNA 3VBRC 2ZKNA 5DUXA 2A71A 2PQQA 2ZGPA 2BTVC 1P8JA 4I01A 1H4GA 1URXA 2WS93 2ZZJA 1LGBA 1VBD1 4QB2A 4Q1RA 4M0HA 4EYUA 4IV1B 4IE6A 3LA3A 3DEMA 3D82A 5C3SA 2UU8A 1POQA 1UOFA 1UU6A 1W8UA 2VQUA 4L11A 3ZR6A 3PL0A 4BIFA 1K42A 2XB6C 2RM22 4OUSA 2DBIA 3VKLA 3O1VA 3TEXA 3CJXA 2JDPA 2VD7A 2QQKA 2ZEYA 3JQXA 2P4EA 3K3NA 4PIXA 1WA6X 4WVZA 1OUXA 1S0BA 1OSGA 4R4XA 5HXVA 3ZM8A 3RGBA 1FAYA 1UYXA 4WZCA 3BPZA 3AYDA 4HVRA 2V5DA 2FZ2A 4DPNA 1RC6A 3M3OA 3TN92 2JDAA 3H8UA 5FQ0B 1LENA 1FPN1 2VZ1A 3JZVA 1RUH1 3FUQA 4NAOA 3WW2A 2FDIA 1PGL1 4G9SB 1G86A 2JDNA 2WNUB 4YW2A 1ZNPA 2WR9A 3CU7A 3PU3A 2ZJCA 2VZTA 2WNVC 4Y20B 3WW1A 2WZEA 3ZSLA 5K0UC 3O7OA 4XQDA 1OLME 1FXZA 2WSVA 2VZUA 3NKTA 4AWDA 5LRSA 3IAPA 4YZ5A 3WSOA 1DQ5A 2VVEA 3ILNA 4ZU4A 5DDJ3 2WUHA 2YBSA 4FXKB 3JB8A 4Y3OA 4P9IA 4DINB 3RZHA 1RMU1 1M06G 4MLOA 1K5MA 1PMIA 4KGQA 2VZPA 3HAGA 4K8RB 1JYTA 3PVOA 3ZXAC 4AQ6A 3I2GA 2JG9C 2ZHLA 3JD71 4E4DX 2G9GA 4MHUA 4BISA 3S7IA 4JZRA 3W9AA 3MFAA 1W2OA 1V6KA 3MUY1 3WX5A 4YYOA 2GSYA 5FP7A 3OF1A 4M01A 1CX1A 3H42B 5A3TA 5KHJA 2WS91 4KH9A 3WZ1A 1AR92 1V6LA 2R062 3ABZA 3NV1A 4GJZA 4DIQA 4ZHNA 5C3OA 2WRAA 2OZJA 3UKNA 3A7QA 5FYIA 4IESA 4GMP1 4KBBA 1Q56A 3O1PA 3VBRB 3RPQA 1CAWB 2D43A 3RZZA 4BJ0A 5C8CC 5A80A 1UKGA 1H8TB 2VOWA 5FYMA 3HD8B 3AP4A 3HBKA 4NIIA 1RUI3 3VDBA 3GGLA 5BNOB 2XWJB 2R49A 5EIYB 4S2DA 2BBVA 3W59A 3ZR5A 2R16A 1SLTA 4F83A 4IV1A 5HXMA 3H8OA 1PGW1 5EHDA 5IVYA 3OUHA 4LULA 4Y4YA 3M3IA 4Y1UA 3W21A 4AHXA 1UY3A 3ZN6B 4Q4Y2 1N1SA 4BE3A 4F7ZA 3ST7A 5L7OC 1ZRDA 1GP4A 4Q4W2 5HPOA 2ATFA 5FZMA 4IGPA 5FUIA 1GZTA 3VBRA 2QVSB 1UCXA 1GFF2 3NRUA 4XJUA 4CXWA 2BOIA 2RMU2 2YGLA 1ZRRA 2I45A 2ARXA 4DOUA 3WF2A 1QQP1 3KLSA 5FZ8A 5JZGC 4HK9A 3DYMA 4UFLA 4M3CE 1JZ5A 1W6NB 4QU2A 4J1XA 5BNPC 3T1LA 2JKXA 1BYHA 5FPLA 5E16A 2XVKA 2ZA9A 3OGJA 3ZFGC 4CU7A 4XFAA 2K2SA 1DQ1A 2JD4A 3KV6A 4E4HA 1YC61 4Q4W3 5EYXA 3T1MA 1WZXA 4IEVA 5IWFA 1W8ZA 4AK3A 2FDJA 3B93A 2D6OX 1W9FA 2WFF2 2XOMA 3RZMA 3ON7A 4XABA 5FO8B 2LRPA 4PBPA 4UFIA 3MEPA 4OHZA 1CAXB 1ZM1A 3J7HA 2WFF1 3N36A 1UU5A 1YQ2A 3ROUA 2YUEA 1VBA2 3GXUA 1W2UA 1QQP2 1GU3A 5IJRA 5IW0A 2QTWB 1DLCA 2XVLA 5C4WC 5IAXA 3U0ZA 2QE3A 2W46A 4NIHA 2XBO2 4MGKE 2BBAA 5F3IA 2RDRA 4IEZA 5A6ZA 4MYEA 2XH6A 5EJ3A 2X09A 1U5XA 3FHAA 5T5OA 4TZDA 3BOWA 3WNXA 4JDMA 3VBUB 4AFDA 3FMGA 4XF1A 4QHZA 4DFSA 2WNOA 1XPWA 4C1XA 1JODA 2J22A 2W1UA 4LKDA 1LU1A 2RVAA 3LD8A 3F2ZA 2A6ZA 1Q8OA 1I6XA 1VIWB 4UT5A 3KVBA 3WCSA 2ZX1A 1VBE3 1RUE3 1OF3A 4BQ2A 1VBB2 1D4VB 2VZVA 3KV9A 1F2NA 2Q0AA 5F5IA 1I3HA 3K3OA 2WIIB 3LIGA 1ZZ6A 3TOJA 4XCBA 2DVDA 1UMZA 1VAMA 3POGA 3H8RA 1HIXA 1HRV2 3ITQA 4BXFA 5DZGA 2ZHKA 4JRAA 2ADEA 2JDHA 1EPZA 2ZEWA 3WT3A 4DRRA 4CUAA 1ZX5A 5IVCA 3V0AB 3KD4A 3VBHC 4QKBA 2CHHA 1DFQA 3V65A 3M3EA 1XRUA 1MQTB 2SBAA 5FLJA 5CEHA 4Q4V2 4AQSA 2VOVA 5GZCA 2EIEA 3WNKA 4KG0A 2JB4A 4I30A 2HBUA 2XBO3 3S5QA 1ZZBA 1UMHA 1XNDA 2GNBA 2A5ZA 1ZZCA 3CL1A 2ZPXA 4KGGA 5DAXA 1NAEA 2AZ5A 1VRH3 2VGDA 4E8DA 4PF1A 3T0BA 4AI9A 2RM21 5FOBB 3DF0A 3IB3A 3KWVA 3PUHA 2A6VA 4FOWA 4Y5Z0 1PX4A 3P5BA 4YZ4A 4CYDA 2QQPA 1COV3 5CG9A 2XWBB 5LEJA 3ORJA 3ZXFA 1LRHA 1W9YA 2XKPA 4NWWA 3WR0A 1SFPA 3MZHA 3SEPA 1G8WA 2B5HA 2VMFA 2IVJA 5FR3A 5CISA 2EVXA 4Q4V3 2ZGRA 1MACA 2HBTA 2QQMA 4R52A 3VZKA 3HEIA 4Q1PA 1WCQA 5FJKA 4CDQC 1LOEA 3LWCA 5FRAA 1BMV1 2YFUA 1QWRA 2W9XA 2ENRA 4LHKA 1X82A 4CP0A 1WD4A 3H9AA 2DUQA 3IKWA 4XVHA 1W0NA 3IN9A 5FZBA 1PMJX 1Y4WA 4BQ3A 5JZGA 1T6BX 4M3CF 1QOSA 4EZ4A 4GA9A 3T09A 5F6LB 1POV3 2ZMNA 4XZUG 5DAWA 2YC0A 1ZA4A 1PNFA 2VCBA 2LW8A 4XYXA 1ND2B 4CXXA 1SMVA 1RUD3 4LBQB 4BK5A 1PO13 4P9XA 3VBUC 2KR2A 3CDZB 4XBLA 3ZFFB 3RZLA 1ND2A 1FNYA 4H14A 4CEWB 1KS4A 4EROA 4UFKA 5HBAA 2TBVA 2BZDA 1YLLA 2VCCA 5APAA 5AVAA 4W65A 5C8CA 4Q0QA 2W0XA 4QXBA 1GZCA 1V9U3 1GR3A 4QQHA 3OPZA 5JLVA 3BUCA 2O1QA 4LBJA 2DCYA 2EXHA 2G9FA 2RV9A 5C4WA 3IDBB 1SHWB 5JR7B 2HWE2 2Y38A 1H6YA 2NM1A 4RGGA 1VBB1 1NY72 4LO4B 2VVFA 2PA7A 2KM2A 5FLHA 4Q2FA 3UT0A 4OI2A 3VBHB 2WO7A 2DYCA 2Y0OA 4NIAA 1F5FA 3AMMA 1MQTC 3OYWA 3RMXA 2X53S 1QJU1 2DF7A 1W90A 4XCAA 3FBYA 5EPAA 1QJEA 2JKBA 4ZONA 1ZZ8A 4D0QA 4NPLA 1AYM1 3C7GA 5BNQA 5CVRA 4AGVA 5BNOC 3BODA 5T50A 5BYNA 1OQEA 1RHI3 5FMOL 4CE8A 1PX3A 3R0RA 2XJVA 1ZREA 1FYUA 3WNNA 2CGPA 1JYWA 1MPXA 2VH9A 4FPLA 1BEV2 1NYWA 4HKLA 5A7PA 2HWF1 4G4FA 2EAKA 4P9YA 3V0BB 4COZA 2HWB1 2WLQA 1US3A 4TLGA 1RHI1 5A3WA 1RUC1 3N7JA 5BNNB 2VUAA 2WAOA 3M3CA 3TNQA 2HWC3 1RB8G 5JSRA 1TG7A 1DLLA 2H6CA 3IT8A 2DV9A 3KF3A 4IE4A 5I0UA 1W39A 1KD7A 5FBJA 3D0JA 4YVWC 1QH6A 3BCWA 3GZEA 2V72A 4XUOA 1WWYA 3VBSB 1W28A 4WVMB 1I9RA 3A22A 3OEAA 4QU1A 3VDDA 1UZZA 2VUJA 1XYNA 3NW4A 1UPIA 4IEPA 3LF7A 3WF4A 2J1UA 2JENA 2LS6A 5A3PA 3SKVA 4CDXB 2HEYF 2ZEZA 1RVF2 2XMLA 1AR91 1AYN1 3PMEA 3ZXJA 4RR3A 1YI7A 3PUSA 2AGSA 3SC7X 3E97A 3VL9A 1ZZ7A 2RDNA 3I8TA 5FZEA 3AP7A 2YMZA 1UOGA 2X8KA 1IZ3A 3U10A 2B7YA 1QEXA 3LOIA 5LK5A 1W6PA 3TRSB 1HRV3 3LB9A 4TYSA 3GBFA 4FPYA 3AZZA 2PFWA 5FP8A 4ONUA 2OX0A 3L2YA 1F5JA 3W20A 2R32A 1ZBE1 1PO23 1YNAA 3PJQA 1LEMA 3KSCA 4IEXA 2A1XA 1Z7S3 3M2MA 4AVAA 1IG0A 3A23A 3AJZA 1C8M2 1QJU3 5E1RA 5FXXA 4P5YA 3UETA 4D8MA 1LOBA 5A70A 3AKRA 3UKVA 2WWUA 2GNDA 1DHKB 1QDOA 5F37A 2GH8A 3ZFEA 2D6KA 4K40A 1PZ9A 4JAAA 2X5IA 5AC91 1IKQA 1N3QA 4R4ZA 2ZAAA 1PGW2 4LIUA 5CA6A 1GMMA 4DUXA 5ABJC 1DYKA 1LOCA 2E6VA 4D3WA 5DG1A 2JE7A 5J37A 2NP0A 1SLIA 1UZWA 1WCKA 5GLVA 5IAVA 5FV3A 4WVVA 5FUNA 1D4M1 1OH4A 2LM3A 3MIHA 1W3VA 4IE5A 1UD1A 2P17A 3PUIA 4Q4X2 3DYOA 3NNFA 3KCYA 3T4VA 4ZZ8A 2XPJA 1H2KA 1OVPA 2YG0A 3WEZA 3JBG3 4AI3A 5FY5A 2Z5WA 4QB6A 2W87A 2ZS6B 1DF0A 1H1AA 4N53C 3WP4A 2ZZQA 5JPNB 1LEDA 1XE8A 4H3WA 5CFCA 3BIEA 1N1VA 2D6LX 3LE0A 1HRI3 5LK7B 3LAGA 5CKMA 1BZWA 4CA9A 3BU7A 4FPJA 1GICA 4CDQA 1O3TA 1K45A 1SLBA 2YPDA 3L9JT 4WM7C 1CZSA 4K6BA 4CEWA 2GALA 1DBNA 4AVVA 4OLLA 3S5AA 3ZYBA 4L99A 4QT6A 2WO1A 3WG4A 1F15A 1MZ6A 4QAWA 1ZBA3 1NA1A 1E5SA 5GZGA 1SFYA 4YFWA 5IVEA 1UZVA 3ACIA 3LDRA 4IV3A 4QGNA 1UMIA 3MW2A 3FE5A 1RUI1 4Y24A 3IDAA 1ULEA 5A7QA 1W6PB 4QDRA 3GBWA 4COUA 1VMHA 4KU7A 4MXWA 2Q8EA 1X8EA 1V6JA 3U07A 5A6XA 1WA4A 3NNJA 3BTAA 4FFGA 1KJLA 4BPZA 4QGMA 5LA9A 3P6BA 2TNFA 4QX0A 5A7OA 1XNTA 3GZUC 2G1MA 3RI9A 1OLQA 3HQUA 4IE7A 4KI5M 1H8TC 3AMQA 5L9RA 3UGHA 2CAVA 1GZ9A 2OXBA 3AZXA 3PHMA 4QD2A 3CJIB 1OXCA 1KQRA 4XF9A 1EP0A 4HVOA 1LHWA 3S0MA 4XUQA 3N9QA 4EN6B 3CO2A 1PZ8A 3I3DA 3T0DA 4N9HA 4LJHA 3QH6A 3RWKX 3I2HA 2R1DA 3AKPA 2RS31 2IXJA 1J83A 2FDGA 1R093 1PM4A 2Y60A 4OZOA 1OOPB 3VZLA 3KM5A 3THTA 5LY1A 3V0BA 2R042 2G4IA 1AR72 4K3UA 2ZGOA 1ODMA 3O0XA 3EO6A 4XFIA 5J7MA 1SZBA 3NAPC 5DXDA 1V9U2 2DCZA 1VALA 3LSDA 4DMIA 2B45X 1BBT2 5FWEA 4V2WA 1SPPB 5FZ7A 2JDKA 3VDAA 4PLMA 4LO8A 2DFBA 2FCVA 4CUGA 1R092 1VRH1 2BVBA 2QQUA 5EYYA 4AFCA 1RVF3 2WN2A 2ZEXA 4Y33A 3ZFGB 4DXTA 1UPSA 5D8AB 3TN93 5EP9A 4ARXA 1ULGA 4L97A 1OH3A 1GNZA 4YGEA 5FMOS 2E63A 3D8CA 3I2DA 1GYKA 4WM7B 5G04L 4X8PA 3JUUA 4JGYC 1OA3A 2AREA 3R05A 3T0AA 1E5HA 1VBC2 5DZEA 3K75B 1RIRA 3CBNA 1IS3A 3HPNA 1VE0A 4PDWB 4JGZA 1R083 4Y1VA 4QPIB 3W5NA 5FAXA 2BQPA 2KD7A 3TEWA 4Q8KA 3CLPA 3ZXEA 5BUVA 1SEFA 2W1SA 4NRPA 4C1WA 1OFSA 3AB0A 5CNAA 3DCQA 1YYNA 4H55A 4XXPA 1W6OB 4AI0A 4AVBA 5JUVA 3IDEA 4AEJA 1UL9A 1KJRA 2WSUA 3RS6A 3ACLA 2FCTA 2HWE1 3E5QA 1NZCA 2XJRA 4ZZ5A 4KBZA 4ISRA 1RUE1 2E51A 1VBE1 5L36A 1S0IA 3OJBA 1G9BA 1A6CA 2V5YA 2BNMA 1UQXA 3B02A 5FZDA 4TWTA 2WNVA 2JDYA 4QQLA 1GOHA 2EIGA 4UW6A 4I3GA 1Q8QA 3RNSA 4AVTA 4QGLA 5C5TA 5J1XA 2VNOA 3J7LA 4PF5A 4IL7A 2FCUA 5JSOA 2R1BA 4CCJA 1JHJA 1UWWA 4EQVA 1XNKA 3GZTB 2A75A 1H1IA 3ZMNA 2GAUA 1AUYA 4V2VA 4XHBA 1SG3A 1GV9A 2QQOA 1NUKA 3AMNA 2VXJA 2J1EA 3O1RA 1VR3A 2WT0A 2C5DA 3AMHA 1S4CA 5C70A 4W8JA 5CKNA 2RMU3 4LIVA 1ALYA 1O7FA 1JUIA 1MEC3 1JXNA 1VAVA 2PHDA 5JDBA 4XJZA 2QZ3A 1J3PA 2VZRA 3HJRA 1ST8A 1CIYA 3OYWB 1OVSA 1NCRB 2WJSA 3NSTA 1RUC2 2O8OA 1W6NA 1YIFA 4MH0E 5DAQA 3ZIWA 3O1SA 5LBCA 4URAA 1UU4A 3WHTA 4OI4A 3DYPA 4KWJA 2D3SA 5FZ3A 4NHXA 3MF6A 2WABA 2VUCA 5GM0A 4FPOB 1BXHA 3H3LA 3WVJA 2JG8C 4GQ7A 1VB4A 4UFHA 4YVSA 1ASJ3 2VULA 1HB2A 1RUD2 3M7AA 4IE0A 1RGSA 4L0PA 2GNMA 2IUWA 1WMEA 5IVBA 1RUD1 1H9PA 4YW7A 4IDZA 1AL0G 1OA4A 5FZLA 1YFWA 2IFWA 3EJKA 4YG0A 3KF5A 4CEWC 1MS4A 1FX5A 2BP6A 3LEKA 3Q8FA 3H1YA 5HV4A 2P34A 4BLJA 1AYN2 4KWKA 3RZJA 2JEMA 4MZUA 2Z42A 5CG8A 2PLV1 3KZ4C 5B4XA 3WW4A 4Z2WA 4LR4A 4CUBA 4XOGA 3B9CA 3F95A 2W39A 4UWDA 4KU8A 5IK4A 4JVAA 3RZKA 2ARBA 4OUEA 2VOXA 3K48A 1LHVA 4HPKA 3AVSA 4OMCA 3I3EA 3M1HA 1EAH1 4SLIA 5EV7A 1K5MB 1W9TA 2NZ9A 4OHVA 3GHMA 1U0AA 3RDIA 1FV2A 1GP6A 2A3YA 1Q3EA 2PHRA 3RFRA 4AI8A 4LO6B 1NA1B 4XF3A 1VAKA 2EIBA 4Q0PA 1AYN3 1STMA 3HN3A 4XXAA 4RS5B 1KEXA 2RR12 1D4M3 2VNRA 4KL1A 4Q0SA 1GNHA 4YM1A 2E7QA 1C8M1 5GJ6A 3KVAA 3UJQA 1ZRCA 3JU9A 5CFDC 2CAUA 2VC9A 2P5BA 5FY8A 5C9AA 4CXYA 2PAKA 1FV3A 4X6RB 3SLIA 2Q8CA 3WDWA 1JZ3A 3B00A 5C3PA 4XW3A 4LE4A 5FZOB 2XG3A 3JBG2 2ZX4A 3PU8A 3KV4A 5BNPB 2IVIB 1AXKA 4ET7A 4YWAA 3QBQA 3WW3A 1DQ6A 1GLHA 1HN0A 1QY4A 4Q4W1 4QX7A 4W4ZA 4XC9A 4LLOA 4AAPA 4C90A 5ACA3 3KQ4B 3SITA 1QXRA 2RS52 3ZOIA 4LK6A 2WQ4A 3B94A 1CVNA 2GP5A 1TME1 3FFQA 4Z92B 5EWSA 5FK8A 1W6MA 4CU8A 1WLTA 5A3LA 4LUMA 2VBBA 2GN7A 1PHMA 4MG2A 1CN1A 3QOPA 3VBSC 4O7XA 4A2UA 2WQZC 4CPBD 5LZ6A 4W6WA 1DYPA 2JECA 5K7PA 2YROA 4UOJA 1KS5A 5T5JA 4N7UA 3LFMA 1NCQB 2QQLA 2BGOA 4MXVA 4AEDA 1D4M2 2GDFA 3PDQA 1L3JA 2TUNA 4HG6B 3ZFEC 1XOYA 3BYWA 2EALA 2K46A 3DXTA 4EZHA 4R9BA 3IBMA 4PT6A 4RHV2 4BU2A 5F9TA 3Q8BA 4JGYA 1UX7A 5FZ4A 3VD3A 1EV11 1R1A2 1BBT1 2AR6A 3LGRA 4MGYE 4BQ5A 2YPJA 2BGPA 3RJ2X 2CSGA 2UY8A 1WW4A 4NO4A 2LTNA 4QKNA 3T3YA 1RINA 4XTPA 5FY0A 5DUVA 1YI9A 4AR2A 2D40A 2WZR3 2W47A 3CQOA 4FPGA 2KXLA 3VHPA 4CCDA 3H8XA 3NNLA 5H9RA 2YBPA 3R4UA 4CDXA 3POFA 4NR1A 2CNAA 1W8FA 4H7LA 2ZBJA 4YGCA 2J1RA 1YO8A 3GHNA 3NNGA 1V6OA 4BYYA 1QOTA 2AUYA 1CAXA 1R082 1BHGA 5FY4A 5JWPA 3UESA 4IGOA 3WNOA 3K4AA 4TXWA 4CCKA 2IC1A 1O8PA 4SBVA 2XL9A 2NMNA 2V73A 3I2KA 2CGNA 1CWPA 3UV9A 3MHZA 4B1LA 2PMWB 4FPCA 3E5XA 3RMYA 4CP9B 2HKXA 4DRVA 4XEZA 4EJRA 1FMD1 3PIJA 3V64A 2RR11 5L9VA 5G05L 4YM0A 3BB6A 2Y6GA 1OQ1A 4RS5A 1KFXL 4Y22A 5A3NA 1AJOA 1W8HA 4JHZA 4MHRA 3NNMA 2W3JA 3ZSMA 3CZJA 4UYBA 1UZ0A 1AYM3 1R081 1V6NA 1CZVA 2XKOA 2YYOA 4O65A 2PAMA 4CU9A 5EJZB 4Q4V1 3D4KA 3E5UA 4HT1T 1IS5A 1AL22 1WUVA 2CYFA 1ENXA 2VECA 1CD3G 2A6WA 2WL1A 4XURA 1VMJA 4H7MA 3DV8A 5IVJA 3ZMOA 4FOYA 1BK0A 4XFGA 4OI0A 1SQ4A 5FPAA 1OHFA 3H1WA 5LATA 4FOVA 1VBA3 3SH4A 3TNPB 1RUOA 1OPMA 3I7DA 3ZN6A 4CZSA 1SDWA 5CFDA 1BMV2 1C5IA 3VD9A 2ZCWA 1LCLA 5FK7A 3VD7A 1TEIA 5ABJB 2VMHA 4OHXA 2ET7A 2XLGA 2DTYA 4P9LA 1JH5A 3DKQA 3ASIA 4PLNA 4WZFA 5T52A 3VDDC 2IZWA 3MPBA 1HXS1 1XU2A 2EIDA 3OB8A 4BLIA 2R30A 4FP3A 3OGVA 4LOSA 1WBFA 1O4TA 2ZXQA 2E33A 2ZACA 2MNGA 5JSPA 1DCSA 2DVFA 4HKOA 1CZTA 2J1TA 3LA2A 4MGTA 3T08A 3I2JA 4GMP0 4LKFA 4C91A 2N7GA 2OZ6A 3OUJA 2IXHA 1JOJA 2NLRA 3Q9OA 5FP9A 4CCMA 2C9AA 5GLTA 5J36A 3HBZA 2KA3A 4XAEA 3N3HA 2J1AA 3A0NA 5EFUA 4AFAA 2PYTA 3H0OA 2EICA 5FZ1A 4MVTA 2E26A 1HQLA 1H2NA 2BFUL 4ASMB 5A6YA 1YCIA 1LOAA 3MW4A 4CCEA 1AF9A 1RL3A 5JZGB 5DUUA 4DS0A 1ULDA 4J1WA 2P3YA 3AYEA 1ZBA2 1FOD2 2ES3A 2WKKA 3NV4A 4IGQA 3VKNA 5L7OA 3GF6A 4Q4X3 1DGWA 2XBO1 2WO3A 4JDOA 4KWUA 2V4AA 3PLQA 1REDA 4K9SA 2B42B 3ZFFA 4Z8BA 1NX9A 1GUIA 2RJLA 3IZOA 4B8EA 5A7NA 1ULOA 2QZ2A 4HONA 5HCFA 3I59B 2I2SA 2VR4A 3M4FA 3NO8A 5JXIA 1PVC3 4BCUA 1WW6A 2B39A 1JS9A 1CR7A 1VBD2 1NKGA 2PXJA 4P9JA 3FWEA 3AFKA 4D7YA 1GWLA 5C7GA 3AL6A 1CONA 1XQNA 2B8MA 2HWB3 1ZYBA 3KB5A 3NV3A 3POYA 3R4SA 1GQPA 1Y9QA 2ARCA 3D6EA 5IVFA 1JYXA 4QM9A 5IK7A 2B46X 3NAPB 1BVP1 4HBNA 4LTAA 3WP5A 3C2UA 3GJBA 2JDUA 3HVDA 5E89A 2YC4A 1XBFA 3VZJA 1W05A 1U12A 4RHV3 3AX4A 4JGZB 2WBKA 3CIHA 5FFOC 3IIAA 3AXDA 5SV8A 1YHFA 2VMIA 2ZGMA 3G7DA 3ZYRA 4E8CA 2W5FA 5D8AC 3PVNA 3VHOA 3HMYA 4FFIA 1IS6A 3ZYFA 3NV2A 2BDRA 4YG6A 1WD3A 3V56A 4E27A 1H1MA 2CWSA 4HETA 1CAUA 3A4UA 3KCCA 5F3EA 1ZVFA 5AVPA 5LEKA 4WVWA 1EY2A 4B4PA 4E2GA 4LHNA 5F32A 2R6QA 3OBTA 3I3MA 1AR83 2UURA 2WFPA 3OGSA 1WLWA 5GLWA 1MEC1 4HL0A 1OI6A 2A3XA 3CKHA 3AYCA 3WQ7A 3E6CC 1GOGA 3RYPA 2ADDA 2G9ZA 3WDVA 3ETPA 1PIV3 5JOXA 1DGWX 3NJYA 3CMGA 4FPKA 5CB7A 3T2TA 3AZVA 4JTNA 4MADA 3WINE 1PGL2 3VHRA 3ETQA 3T4HB 5CFDB 1W6MB 5FZAA 3SH5A 4AEKA 2VUDA 4GWJA 1B35B 4RSUA 4JRLA 2IFRA 4AVSA 2FHRA 2R7EB 3OG2A 5FYZA 3H3UA 2MEV3 1SACA 1PNGA 3HQRA 1O5LA 1JU4A 5JMCA 1Y3TA 2PLV3 4QQPA 3VHNA 1OC1A 2DCTA 5BY5A 2WDBA 4Y4RA 1TME3 3J7NA 1TMF2 3WNPA 2MEV2 1RJ8A 4GWMA 4IUGA 2HWD1 1OD5A 2YFZA 3VB9A 4LE3A 4A3ZA 4FP2A 2VM9A 5AC92 5FZIA 3KHCA 3FL7A 3I59A 4QKDA 1HXS3 2MEV1 3ZKYA 1UKRA 5TSWA 1G9AA 2EXJA 2XXZA 4DEVA 5FQ0A 4A41A 4Z2AA 1XU1A 3N7KA 3BN6A 1HV0A 1KGYA 2CY6A 1RUH3 3C8XA 4N43A 3VZNA 3D0SA 2RDQA 3I4IA 3MGUA 3OBAA 4OQ9A 4A7YA 4ATFA 2G19A 3BALA 3NMBA 4G3YC 3ZFFC 2ZGUA 2D5HA 4OQ8A 2Y6JA 3USSA 5KXBA 3OPTA 4YM2A 3VBOC 5C6CA 1W03A 2JG8B 3WHUA 3O1TA 1ULCA 2C0ZA 2RMU1 1DZTA 4GXLA 4OVEA 2VAUA 3OD4A 2PHWA 4HN1A 4XZPA 1XXNA 1MR5A 1NLSA 5J48A 2AYHA 4QXCA 1PGSA 1AYM2 5GLUA 3N35A 2PELA 1FMD3 4NAMA 1G9FA 3HNBM 4BXSV 4GZ9A 1BQPA 3MV01 5A32A 1UXZA 3WLUA 2OT7A 3CHXA 4Z07A 4YPJA 1RUG1 4QPGC 2P6CA 1B35A 1LKNA 2WWSA 3GCWA 1VRH2 3X29B 4PI2A 2L9LA 4QQOA 5L9BA 1WW7A 2YXSA 5FZ6A 2ZGQA 1W9WA 1N3PA 2R0FA 2WA4A 1MEC2 4AXOA 1WW5A 5C3QA 3J26N 2QDRA 5DDJ2 4ZXKA 1K5MC 2BWAA 4AI2A 1HB4A 4R9CA 2ETEA 4XJAA 1W3XA 2BW8A 1COV1 2VZSA 4BIOA 4LK7A 2VNVA 5GALA 1JZ7A 1CESA 3EXUA 1R64A 4UW3A 4GD4A 3DPRC 1UZYA 2ERFA 4QHOA 1LHOA 5A33A 2CGOA 1HW5A 1WLDA 4RD7A 1UIKA 3M70A 3U37A 2FDFA 5KHGA 5H9QA 2X5IB 5M0TA 1HQWA 4FQZA 2IXIA 5FWJA 4DY3A 2FD8A 5FYCA 4AZZA 1JN2P 4I02A 1HV1A 1Y9MA 4RR3B 1LGNA 2J1VA 3MO4A 3LEMA 4KNCA 4YRDA 1FOD3 4Y1ZA 4FPFA 4AYUA 3R6SA 2WNUC 3RI8A 2OS2A 2WYSA 3ME2A 4XDQA 3BTXA 3VUOA 2WNVB 1D2SA 1FI2A 4FO9A 1WGPA 2HJIA 1SCRA 2H0VA 1DZQA 1BJQA 1XYPA 1WLCA 1C8NA 2W1QA 3LDBA 4Q8LA 3VDDB 1LESA 2AENA 1HB1A 4YARA 2BNOA 4N43B 4B4RA 3GZAA 5KBFA 4YW5A 3ZYGA 2XQRA 1FNZA 2R041 4N9IA 1WCSA 4GKYA 4PQQA 5LASA 5LRRA 2JG9B 1WKYA 3EHKA 1ZBE3 4QPYA 3I2IA 3I97A 1YWKA 1A78A 1DP0A 2R073 2D3PA 4XILA 4QX2A 5LBEA 1RHI2 2RG4A 2XJQA 3O14A 4K8FA 3KHBA 1C57A 4PCRA 4AOCA 4OCTA 4XFFA 3H7YA 2D7FA 3U78A 4QDSA 1HKDA 4FOQA 4AL9A 1UOBA 4ZS3A 5GZFA 3USUA 3C7OA 2PN5A 4FVVA 3AKTA 3WUCA 4EV0A 1SBEA 1MS8A 2HLEA 4DXZA 1AHSA 4CDQB 4JGYB 1L7RA 2VMDA 2RM23 2VW0A 1EV13 2VCMA 4P5HA 4CCOA 3RQ0A 3J8F1 2IXCA 4QPGB 4NROA 4Y5TA 5C3RA 1K3IA 3MI8A 4LA2A 2GMEA 1REFA 3ZDVA 4DNYA 2K0GA 3HWJA 5FLIA 3NVCA 2Q8OA 2VY0A 5F1RA 1TVGA 3HN1A 4GALA 1AL23 2FBEA 4YVSB 5A32B 1DG6A 2ILMA 3VBHA 5FBZA 3ZN5A 5F5AA 1NCQC 2O8QA 4GH4A 4R9AA 2CTVA 4R9DA 2ZGKA 5E8AA 3WP3A 3LOBA 4N7IA 2JB8A 5ABJA 2Y6HA 1W8NA 3GYDA 5IFPA 5KC5A 2DUPA 1HN1A 3K4ZA 2P3IA 1B09A 1GWKA 2E32A 3SCFA 1R1ZA 1XYOA 4AAXA 2C26A 1HX6A 2WO2A 5D1IA 5FY9A 2HWC2 4I2OA 1Q5OA 4QPGA 5LA2A 1NXMA 1BKZA 4JQTA 2O0OA 4BDVB 2Y8KA 5FPZA 4AW7A 3U4XA 1IPJA 1WMFA 4D69A 2GMPA 1TNFA 4FXGB 4NPMA 4ZPIA 4BQXA 4MO3M 4IEQA 4CDUA 3CJIA 5J09A 1YQ5A 4O9GA 3HNYM 3RYRA 5A6QA 3ES4A 4AQTA 3KMHA 1JMUB 4OI1A 3Q8AA 1JI6A 4IETA 4BWOA 1AX1A 1MS3A 1PO21 5FY7A 2GH2A 4IW3A 1JZ6A 1O91A 4O61A 3OY8B 1AR93 2DUOA 1N3OA 4A42A 2VVDA 1IKPA 1MS1A 1W2AX 2DBNA 3EB7A 3M8LA 1JZ4A 3HT1A 3O0WA 3ZX7A 5KC6A 3GNEA 4URTA 5SV5A 4OHYA 4U2AA 2XLFA 3CNAA 3MLJA 3POJA 4N53A 4PQ9A 4XIOA 2VTFA 4XTMA 3VL8A 1CGPA 1GNYA 5C33A 3IM0A 4Y1YA 4Y22B 2UY9A 1ZBE2 3IPVB 4L2NA 3J8F3 2ZGTA 5AC93 5KXEA 3TN91 5ANNA 2RHPA 1MVEA 5A7WA 3WG3A 1W6QA 2WNUA 2Z79A 3ECQA 3A21A 4I0BA 4ZS2A 1SBFA 1ENQA 3R4DB 4AHWA 4LLFA 3WDUA 4B1MA 2GMMA 1HRI2 4E2QA 3DUIA 2EF6A 1EYBA 1YRZA 2Y6FA 3LDKA 4O9EA 1UAIA 4ARYA 2QQIA 1PVC2 3JB4C 2JJ6A 3VBFC 1W8OA 3AJYA 1YJLA 1QJU2 5FYYA 1N1YA 1W8WA 2WNEA 3PIGA 1GZWB 3JXSA 4HZFA 3SKJE 3OPWA 4YNIA 1GBGA 2XHNA 1O6UA 2VMEA 3AKQA 3ELNA 3MIBA 3POEA 3ZFGA 1US2A 4JKLA 4BK4A 4XHXA 3MIGA 3G6JB 1RUC3 1OLRA 2P1BA 1LNSA 4EN7B 1PIV2 4EWDA 5AFEA 1LJ7A 1YUDA 1RXFA 4RHV1 5I0DA 5KHKA 3NQHA 1EAH2 5FIXA 1QH7A 5F5CA 5KHHA 1DGRA 1HRI1 1W0PA 1RUG2 2HWB2 5FZ0A 4QX8A 2QFEA 4H2AA 2DVBA 4CUCA 5FTTC 1IOAA 1FT9A 5DABA 3RWNA 1H8TA 3E6DA 4EN8B 2R043 1OURA 3WD5A 3WQ1A 1V00A 1CAWA 4LMFA 4ZXEA 1F4AA 1OFNA 3P1IA 1ASJ1 1LGCA 2E7AA 1ZRFA 5EJ1B 1LHNA 2NQYA 2PQSA 3AKSA 4JX0A 4GWNA 4E2SA 1G6NA 4DUWA 5FZ9A 1Q8SA 3H1MA 4QQ2A 5A3MA 1PIV1 1O5UA 4GB33 2R061 4RQPB 2OQ7A 3BTZA 2BJSA 3VBOB 2XLAA 4M00A 1LAJA 1OOPA 2H6BA 3L2HA 3PNAA 3UJOA 5C9AB 4NOTA 4X6QB 2WFF3 4YVWA 4ZU5A 4CP9A 5B4NA 3PUQA 4J25A 3MLKA 4IEWA 1W99A 3BIWE 4XDPA 1X7NA 2Q8DA 4AHZA 2QQJA 5T5LA 2RS12 1RUF3 2P37A 4Z82A 2VBDA 4JDNA 4AEDC 1S0GA 4GMP3 2DVGA 4AI1A 1G9CA 3OBRA 1VBD3 1EUUA 3UNPA 1D0GA 4LBNA 4MXWB 2HWE3 3VKMA 4RL7A 5I93A 4MV2A 4A7ZA 3DECA 3FHQA 4PBOA 3ZN4A 2XJUA 1H2LA 1VBC3 4LBLA 2VW2A 2EA7A 1JHNA 1TE1B 4HKWA 4M3CA 4K1ZA 3SNMA 2A6XA 3AVRA 4HOOA 4W50A 2X10A 3K2OA 4C8DA 5FYSA 4RFRB 1POV1 4UBHA 4BA6A 2NN8A 2VCAA 5DPNA 2P3JA 5IATA 4QXKA 3OUIA 1UOJA 3N9PA 1V0AA 4UF0B 3KT1A 4L8QA 4CP1A 1ND3C 3O1OA 4BH9A 2P3KA 1LOFA 1VPHA 5JXHA 2XJTA 5L7OB 4R8HA 3TEYA 1C3HA 4HPKB 4S2HA 4A6OA 5FKBA 4AHYA 2UYBA 3VV1A 1IPKA 4QWNA 1NCQA 5IFTA 4EE2A 2ET1A 3VZOA 3ES1A 2RS32 3VD4A 1Y9GA 4FCAA 5DG2A 1AR81 5F6KA 5KWRA 1CPMA 1CJDA 3AP9A 1V6MA 1HQNA 2BU9A 4E4ZA 5I8YA 1LB2A 3WUDA 3QACA 3MIDA 1BK1A 3LCPA 4GB31 3FBMA 5D21A 4AGRA 5BNOA 5EQUA 1RUH2 5ERLA 1UY0A 5BV6A 1SFNA 1YXWA 4ASLA 4TTGA 4YFZA 2C1FA 4WM8C 5FCCA 1CIWA 1AZDA 1ENSA 1SLLA 4QKFA 2OPKA 2W52A 4BB3A 2WWJA 1AR63 4XACA 4BM8A 3O5SA 4KWLA 4CDUC 4Q0VA 1S0CA 1T2XA 4ASKA 1AR82 1B35C 1GQGA 4XJWA 1C5HA 3T2OA 3WOGA 3JD72 2JWPA 3BI3A 1VBC1 1ENRA 3DKWA 1NCRA 3MDPA 1O8SA 4LBOA 4OHWA 2OIIA 1A3KA 3THPA 3U11A 4FTSA 5CFCC 3M3QA 3S6PA 1Y43B 4ORFA 5IUQA 1FATA 4MSVA 1WCDJ 1OF4A 3CJIC 1IHMA 1GSLA 3IAQA 1A8MA 4B7KA 1TQ5A 3WV6A 1GKBA 4C0BA 4DO0A 5F3CA 2ZOEB 1RUJ1 3IMNA 2NYYA 3PJYA 5HCBA 1PO22 1WMDA 1MS9A 3ILFA 2UWBA 2ORZA 1DQ4A 2VOTA 4B29A 2PAEA 4IV3B 4P9GA 3OCPA 2Q30A 1RUE2 1QOOA 1VBE2 2H0BA 2Q1ZB 1MZ5A 1NOVA 1OOPC 3KCXA 2VW1A 1UYPA 1XJAA 2BOJA 2GP3A 2B9VA 2VQ0A 1LODA 1WCUA 3GCXA 3P3NA 4Q26A 4S2GA 3UK9A 5IT6A 4YW6A 2JIGA 4JHTA 3WQBA 5E6HA 1E5IA 1UO9A 2AACA 3GM8A 4ISQA 4LA3A 4XDOA 1ND3B 2DU1A 4GULA 4M3CB 3ZSKA 1C4RA 4Y26A 3JCIA 5L19A 1X50A 1PK6B 2LROA 4PJYA 4RGKA 4BHPA 5DQ0A 5F2SA 5ACA1 2X29A 1QQP3 2I07B 2HH9A 2ZAHA 3PURA 1IQAA 5LBBA 5I91A 1F8VA 3LIHA 5DUWA 4ITCA 3WNLA 1S55A 4ES9A 1AR61 4V1PA 2CDOA 5ANQA 3ZXDA 4YSFA 3B9IA 1MS5A 4PDWC 1N1TA 5FZKA 1YQ6A 3NKGA 3MF9A 4LHLA 4WM8B 3FUOA 2Z69A 4UI9L 1A8DA 4AE2A 4IQPA 2D6PA 1J58A 4FQ4A 2ZX0A 4YG3A 2C9KA 2IWGB 2V09A 3FFZA 2DCJA 3POSA 1KDKA 1RYYA 1EAH3 2D98A 1QJFA 5LY2A 4NWVA 3RYKA 2A73B 2Q1FA 1W06A 4KQ7A 3I49A 3TB0A 3DPRB 2DVAA 4NMIA 4N43C 1ASJ2 1QXPA 1VB2A 3B7MA 1O3SA 1W8TA 3DPRA 3MICA 3RG0A 3WNMA 4XMAA 3GJAA 5JOYA 3IWZA 4OMDA 2EXKA 5FO7B 3LEIA 2XUMA 5FYTA 3ZPYA 2OUHA 3WY6A 4FT8A 1ZRIA 1JYIA 4JV4A 5FOJB 1PO11 1XB9A 3OD0A 1AJKA 1RUJ3 2WZ8A 1NE6A 3SCHA 1VLNA 3EQEA 2OKXA 5FPXA 1XC6A 4U36A 4QPWA 1J3QA 4FI9A 2GN3A 1TME2 4NHYA 3RSJA 3JD73 5F8PA 4DZGA 3D3AA 3PVEA 5FYVA 4EWEA 4MGSA 1XE0A 2BNNA 3USUB 1NCRC 4OUMA 3WP6A 4BMEA 5JR2A 3WDXA 1CAVB 4PHZA 5FUPA 1JYNA 1OMIA 2Q5TA 1XSRA 2R071 4HK8A 1D0HA 1WBLA 2Y6KA 4EWAA 1HRV1 3H3ZA 5FP4A 2VZQA 2W68A 1KXGA 1REEA 4LKEA 2XR4A 1J1TA 4C0HA 4EN0A 3W5MA 1J1LA 3FLRA 3IPVA 1AL21 2YV8A 3KQRA 5E88A 1Z0HA 1AR71 4HSJA 3WQ0A 3VZMA 1I5PA 2ZMKA 2J7MA 4Q4X1 4ES8A 2W94A 1H8VA 2FMDA 1FPN2 1ND3A 3ACHA 4GJYA 3OOXA 4LBKA 4UF0A 4YGDA 4UW4A 4Q5OA 4YGBA 5CZKA 3WF1A 2JD9A 2W2IA 2VL4A 5JVVA 4CP2A 1BVVA 3SXWA 2PHXA 2XGXA 1CAVA 2YB7A 4GH4C 4XFBA 5HI0A 5FZCA 2RS13 3H50A 4AVCA 1AR62 5BNNC 3HT2A 3ILRA 1APNA 2WZR2 4MX3A 1OA2A 4D6RA 4A4AA 1NLQA 1YEWA 4RFT0 2BV4A 1XNAA 3NJZA 3AZWA 4AEDB 4CEYA 5FKCA 4XJ8A 4XAAA 4WV8A 2W91A 2VG9A 4FPHA 1NA1C 4HFSA 2YU2A 1ONAA 3GALA 2J42A 2DU0A 3VDCA 4CEYB 4D6QA 4XBNA 1TMF3 3QH7A 5K0UB 5CU1A 5GLZA 4K1YA 3TEZA 4FFHA 1C28A 3BU0A 3MV11 4E4SA 3OGGA 1NY71 1H2MA 4P08A 3ZKUA 2DTWA 2CL2A 1NZIA 1OUSA 1TMF1 4QDQA 4HN0A 4JKMA 2HWD2 3LSEA 1AXYA 4QX1A 2ZKLA 5FZHA 5K0UA 2JDMA 1RUG3 3LA7A 3AM2A 2YU1A 3GDBA 4OYUA 5T55A 3AMPA 3POIA 2WT1A 4RA0A 3APBA 3UGFA 2GC2A 3N9OA 5K9YA 2DFCA 5IK5A 2R063 4S2FA 2HEVF 2A7AA 5JI7A 1PO12 5FMDA 1X9TA 3N9MA 4BQ4A 3AL5A 1VBB3 2TEPA 2OA2A 4Y1XA 3IMMA 1SLCA 3HIFA 5JIUA 4NJ4A 4P02B 3ZYJB 1O3RA 2MHFA 3EBRA 5H9PA 3FLTA 4A45A 2WC2A 3U14A 1JOPA 4OFGA 1S1AA 4PI0A 1W6QB 2K9ZA 4CU6A 4INDA 1KITA 4JCKA 1IS4A 3U75A 1AR73 2VQTA 3PTRB 4XF0A 5JI9A 4P14A 4K20A 1G7YA 4XMIA 3UL2A 1JU3A 3C7HA 5T3NA 3THDA 2RR13 1KRIA 3O12A 3K46A 4UXAA 1E5RA 5F3GA 2NPIA 2UWAA 2VXRA 3J8F2 1S2EA 4P9WA 3CZUA 2BUKA 1COV2 4AFBA 3VBUA 4BZ4A 1DQ0A 1SPPA 4PDWA 4RYDA 3ZXKA 5HCAA 4LXLA 4IERA 5IK8A 4CSWA 4GB32 5FXWA 5FO9B 3S57A 4M4PA 4DUVA 1TZOA 5K8SA 1HLCA 1O59A 5CIRA 4LT5A 3GBGA 3MIEA 5CKQA 4YLZA 5BXXA 5LB6A 1RITA 4UBGA 4A7KA 1HXS2 2PHFA 4RR3C 4MGZE 4QX3A 1SDDB 4YZ3A 5IYYA 5C71A 1JYVA 4N53B 1BBT3 3EYPA 3FHIB 4LORA 4RQPC 2VTXJ 2WA3A 4N8MA 1SBDA 1O4ZA 5CAZA 4JGZC 1ULFA 1H0BA 4I09A 2WZR1 1W0OA 1H6XA 3O1UA 2R0HA 3URFA 1MQTA 2J1SA 2VTXA 2OYZA 5F5QA 1D7PM 3RVHA 2WS92 3T2PA 5ISLA 4GKXA 3ZVXA 4COWA 4FAHA 3J9SA 3V0AA 4D7TA 2BWCA 1RXGA 2JE8A 1RVF1 2D6MA 3BVCA 1DIWA 1N47A 1AXZA 2YHJA 1JUHA 3JQWA 2XJPA 2E7TA 3BPSA 2Y33A 5C4WB 1FMD2 2PTMA 1ZBA1 2QCSB 4MGIE 4NN0A 1K12A 2VE1A 1UYYA 3J4UH 4TLFA 4XIKA 5FZOA 5J98B 1YFUA 5LWBA 1K5JA 3LPGA 2BRTA 3IDCB 4QXHA 5HV0A 5IVVA 1MZFA 1BEV3 2RJKA 2E31A 1VMFA 1Z7S1 3SISA 1UNBA 3ZSEA 4B3NA 5FZGA 3S30A 3ZSJA 3KT7A 2ARAA 1QJY2 4NHKA 4XE9A 3RJRA 2IXLA 4XFHA 2BYVE 2UYAA 1OLMA 1BEV1 1POV0 1RUJ2 4BQWA 1QXJA 1OKOA 3MBWA 3FX3A 1VRBA 2JG8A 2QQNA 4YVSC 1QGLA 5A7WB 1S0EA 1U5ZA 3QD6A 1WMXA 1PVXA 3SHRA 3O0VA 1F4HA 2BFUS 1QIQA 4IV1C 4Q4Y3 5FYUA 5J96B 4XQ4A 4AEMA 4PLOA 2WN3A 1G9DA 4IXLA 2R072 2PHLA 2CDPA 1Q43A 3N9LA 2UWCA 1LULA 1YFYA 4L92A 3UGGA 1EUTA 4COVA 3KGLA 4KMQA 1R1A3 2F4PA 4YW3A 1GOFA 4RGAA 3POBA 2Q4SA 4UAPA 3TWIA 4QPIA 4CCLA 2ZGSA 5T54A 3PMSA 1UY2A 1L7QA 1UY1A 4RS5C 1X9PA 3J7MA 3OY8A 3WDYA 1QJY1 4FBFA 3ZXLA 4Q29A 3C3VA 1OD3A 1LOGA 1DGLA 2EXIA 2PHUA 1SLAA 2Y26A 1ULPA 3VD5A 1DZRA 1EV12 1R1A1 3VBOA 5JOZA 3LQCA 1MS0A 2AH2A 2I74A 2Y0IA 5A7SA 3PUAA 4KG8A 2GC3A 2XDVA 3BGAA 4CVUA 4W6YA 2BEOA 2HYKA 1S2BA 2YZ4A 3P3PA 1X8MA 4NHLA 5HCHA 1LTEA 5I0RA 4NIDA 1F9KA 4E9KA 5DMYA 2WQ8A 1J84A 1HB3A 1RJ7A 2CU5A 2DDUA 1Y7BA 1QJX3 1RMU2 3A0KA 3I3BA 4META 3TYJA 4JKKA 1PMHX 4LQRA 3MIFA 4QX5A 2A70A 2D93A 3KS7A 4UFJA 4Q0UA 2GU9A 3VLBB 3D5OA 3NJVA 3ENRA 4YZ2A 4AGGA 1KDMA 2ZGLA 3SH3A 3WG2A 1QJX2 1ACCA 1RMU3 4L9BA 3ZYPA 4WM8A 4HVQA 2HWF3 2EAAA 5LA1A 3SCGA 3AK0A 3U4SA 2B4KA 1LHUA 5LCWL 1QJX1 1W2NA 1UN1A 2BGCA 2YBKA 4CDUB 3SEEA 5DAVA 3MW3A 3WF0A 3B69A 3ATGA 3ACGA 1DU3D 4XQWA 5DN2A 4BQYA 2ID4A 2JE9A 4IEUA 1DYOA 5I8TA 3K51A 1CJPA 1MZEA 5A33B 2V4VA 2IXKA 2YY1A 4BMBA 1QJZA 3ZFEB 2ZMLA 2DURA 2D3RA 5EXOA 1W9SA 1T6GC 3C7FA 5FMCA 3VBFB 1PVC1 1GZWA 1QNWA 1LOFC 1NXD1 3LKJA 1BCXA 3FLPA 3CF6E 3AZYA 3LPFA 4FFFA 5DAPA 2P6HA 3B3QE 3E6BA 3UYJA 4QMAA 5GKAC 4GH4B 4MOAA 4YM3A 1XNBA 4IV3C 4PIZA 1J59A 2SLIA 2E53A 3AP6A 4Q4Y1 2QUOA 1QKQA 4FPEA 3VKFC 2AEZA 2RS51 4DEQA 3NAPA 1XNCA 3OTFA 1M4WA 3UKTA 1PM7A 3TBDA 2GZWA 2OQ6A 1R091 5F7UA 5D2AA 3VBSA 1H9WA 2RS33 4W6XA 4Y5SA 4NIGA 3T30A 1QF3A 4FAGA 1UXXX 4Z1VA 2HWF2 5FDBA 1C1FA 1W04A 2QQVA 4BOWA 3HNMA 4NE9A 4D6SA 1PK6C 2HEWF 2VQAA 4PIYA 4XETA 2RS53 2WZPP 5KR7A 2VO5A 1QMJA 4ZY9A 2D6NA 5A1AA 4LKSA 1MVQA 1GWMA 3ACFA 1RUF1 1GP5A 3DXUA 3KT4A 1QHDA 2VU9A 2WINB 1UY4A 3BKZA 3N7MA 4AFMA 4DB5A 3KV5A 3Q8CA 4RN5A 4WVMA 3H7JA 5FXVA 3LFIA 2OUJA 1GQHA 1JW6A 5C9AC 5K4LA 4D94A 5A1LA 2XHKA 4MUVA 3W58A 2ZABA 3E1F1 2JIJA 2A6YA 1OQDA 3IIIA 1RUI2 3OBZA 1JBCA 3ZIXA 5FPUA 4HANA 4XUNA 3WCRA 1I5ZA 1GANA 1VBA1 2VZ3A 2RS11 2QDNA 2AEYA 4F3JA 1UX6A 3PVBB 3ZLIA 4LEJA
chains in the Genus database with same CATH topology
4AQ2A 1FPN3 4J6GA 2Q1MA 3B5LB 4B7EA 2GC1A 4ZU7A 3DGTA 1Z78A 4BQ1A 2QJVA 2WLPA 2B9UA 5I0TA 3ZO0B 3CEWA 3RRDA 4CDWC 1X36A 4JTOA 4ZKTB 1E57A 4IEOA 5J3UA 2D97A 4JC1A 2FZ1A 3WDTA 4I3PA 1LR5A 1IGOA 3MLLA 4FTEA 3SMHA 4JQRA 3NWKA 1YIPA 2JXAA 2CV6A 4IEYA 3JBG1 4LO7A 3ZXGA 4CTEA 1C8M3 4YW1A 2BVVA 3VN4A 4NHMA 3VKOA 2ZTNA 5CADA 1U5YA 2VOKA 1VP6A 1NLRA 1DDLA 4M0NA 4QM8A 4HSLA 1CAUB 1SCSA 2D44A 4LNVA 5C8CB 4QHBA 1U5IA 2YGMA 4QPIC 4UW5A 4XJ9A 2GNTA 2PHTA 3AFGA 2XL7A 1D2QA 3DL3A 1S2KA 3QCWA 1Q8PA 4K7JA 4LBQA 4XF4A 2PLV2 3B01A 1RTVA 3INAA 5C8WA 3ZDSA 1RUNA 2HWC1 4DY5A 2LUWA 2D5FA 3MPPG 5KXDA 1YFXA 2HWD3 4I0AA 5D8AA 1HDKA 2JG9A 2ZX3A 1RUF2 3AYAA 1Q8VA 2GC0A 1CPNA 2VPVA 5AFBA 5CFCB 1ND2C 2XVGA 2X5IC 3KGZA 1W6OA 1EPWA 1UF2C 3HR9A 3VGIA 2QNKA 4Y20A 5BNNA 3FC0A 4XBQA 5I8SA 5I0SA 1C1LA 5DZFA 2XJSA 1NG0A 4AG4A 5JCTA 4CEYC 2A3WA 2MPFA 4D7SA 5KHIA 1NQDA 4B4QA 5BPXA 1AX2A 1I1EA 3POWA 2W08A 3N7LA 2ZX2A 3VBFA 1NQJA 4CDWB 2CWMA 1PZ7A 4EN9B 3FZ3A 2VMGA 4ATEA 1H4HA 1Z7S2 1AVBA 4X8NA 4I0WB 3WXPA 4XPVA 5GZDA 3TAYA 3N4MA 2DCKA 4HMZA 3MFCA 1TNRA 5GZEA 1LECA 5ACA2 4DQAA 2JDZA 1QU0A 3BOPA 3NL1A 2FMYA 2NMOA 1O3QA 4CRQA 4LO5B 3LZZA 2OW4A 5FREA 2JX9A 1H30A 1CQ9A 1V6IA 4OZXA 5L73A 4CDWA 4LUKA 1VJ2A 4AF9A 1O4YA 5JOWA 1XE7A 1YJKA 1PK6A 5CBLA 3S7EA 2OVUA 5H9SA 5BNPA 3I54A 3QLQA 1OPOA 5JAXA 4FSJA 2WT2A 5T5PA 1JTZX 2BPA2 2P2KA 4COYA 2Z2SB 5JPMB 1DQ2A 2RE9A 3AXEA 5B2GB 3FJSA 1OKQA 1KFUL 2YDEA 1ZZ9A 1J3RA 4K21A 4LBQD 1NE4A 2ZGNA 4CDXC 3DN7A 1FOD1 3HQXA 1UIJA 5DDJ1 3PTYA 5EZWA 1F31A 1QDCA 2VNGA 3MYXA 4OULA 4YW4A 1QJY3 4FTBA 1V9U1 2FQPA 4Q27A 3WG1A 1V70A 2F6BA 2ZHNA 2JICA 1LU2A 1S0JA 3AP5A 4YVWB 5KXCA 1S0DA 4NPRA 4GIQA 1UW8A 4HLTA 3ALQA 4RQPA 4A3XA 5JIAA 4XFCA 1DGRN 4NVPA 2DWRA 4WBBA 1CX4A 1AX0A 1JYCA 2ZHMA 4N90A 4WM7A 1S0FA 1X33A 2E9QA 1QNYA 2LALA 4TSVA 2QKDA 3ZYIB 4LBMA 4YZ1A 4F8AA 3VBRC 2ZKNA 5DUXA 2A71A 2PQQA 2ZGPA 2BTVC 4I01A 1H4GA 1URXA 2WS93 2ZZJA 1LGBA 1VBD1 4Q1RA 4M0HA 4IV1B 3LA3A 3D82A 2UU8A 1UU6A 4L11A 4BIFA 2XB6C 2RM22 4OUSA 3VKLA 3CJXA 4PIXA 3JQXA 4WVZA 1S0BA 1OSGA 4R4XA 5HXVA 1FAYA 4WZCA 3BPZA 3AYDA 4HVRA 2FZ2A 4DPNA 1RC6A 3M3OA 3TN92 3H8UA 5FQ0B 1LENA 1FPN1 3JZVA 3WW2A 1RUH1 3FUQA 1PGL1 4G9SB 1G86A 2WNUB 4YW2A 1ZNPA 3CU7A 2ZJCA 4Y20B 2WNVC 3WW1A 3ZSLA 5K0UC 3O7OA 4XQDA 4AWDA 1FXZA 2WSVA 3NKTA 5LRSA 4YZ5A 1DQ5A 2VVEA 3ILNA 4ZU4A 5DDJ3 4FXKB 3JB8A 4P9IA 4DINB 1M06G 1RMU1 4MLOA 1K5MA 1PMIA 4KGQA 3HAGA 3PVOA 3ZXAC 4AQ6A 4E4DX 2JG9C 2ZHLA 3JD71 2G9GA 3S7IA 3W9AA 3MFAA 1V6KA 3WX5A 4YYOA 2GSYA 3OF1A 4M01A 5KHJA 2WS91 4KH9A 3WZ1A 1AR92 1V6LA 2R062 3NV1A 2OZJA 3UKNA 4IESA 4GMP1 4KBBA 1Q56A 3VBRB 3RPQA 1CAWB 2D43A 3RZZA 5C8CC 1UKGA 1H8TB 2VOWA 3HD8B 3AP4A 1RUI3 5BNOB 2XWJB 2R49A 4S2DA 2BBVA 3W59A 2R16A 1SLTA 4F83A 4IV1A 1PGW1 4LULA 4Y4YA 3M3IA 4Y1UA 4AHXA 3ZN6B 4Q4Y2 1N1SA 4BE3A 4F7ZA 3ST7A 5L7OC 1ZRDA 4Q4W2 2ATFA 3VBRA 2QVSB 1UCXA 1GFF2 4XJUA 2RMU2 2YGLA 1ZRRA 2I45A 2ARXA 4DOUA 1QQP1 3KLSA 5JZGC 4HK9A 4M3CE 1W6NB 4QU2A 4J1XA 5BNPC 3T1LA 1BYHA 5E16A 2XVKA 2ZA9A 3OGJA 3ZFGC 4XFAA 2K2SA 1DQ1A 2JD4A 4Q4W3 5EYXA 3T1MA 4IEVA 4AK3A 3B93A 2D6OX 2WFF2 5FO8B 4PBPA 3MEPA 4OHZA 1CAXB 1ZM1A 3N36A 2WFF1 1UU5A 3ROUA 2YUEA 1VBA2 1W2UA 1QQP2 2XVLA 5C4WC 3U0ZA 2QE3A 2XBO2 4MGKE 4IEZA 4MYEA 2XH6A 5EJ3A 1U5XA 5T5OA 4TZDA 3BOWA 3WNXA 4JDMA 3VBUB 4AFDA 3FMGA 4XF1A 4DFSA 4C1XA 1LU1A 2A6ZA 1Q8OA 1I6XA 1VIWB 3WCSA 2ZX1A 1RUE3 1VBE3 1VBB2 1D4VB 1F2NA 2Q0AA 1I3HA 2WIIB 1ZZ6A 3TOJA 2DVDA 1UMZA 1VAMA 1HIXA 1HRV2 5DZGA 2ZHKA 4JRAA 3V0AB 1EPZA 3WT3A 4DRRA 1ZX5A 3KD4A 3VBHC 1DFQA 3V65A 3M3EA 1XRUA 1MQTB 2SBAA 5FLJA 4Q4V2 4AQSA 2VOVA 5GZCA 4KG0A 4I30A 2XBO3 1ZZBA 1XNDA 2GNBA 2A5ZA 1ZZCA 3CL1A 2ZPXA 4KGGA 2AZ5A 1VRH3 2VGDA 2RM21 5FOBB 3DF0A 2A6VA 4FOWA 4Y5Z0 4YZ4A 4CYDA 2QQPA 1COV3 5CG9A 2XWBB 5LEJA 3ZXFA 1LRHA 2XKPA 4NWWA 3WR0A 3MZHA 1G8WA 2B5HA 2EVXA 4Q4V3 2ZGRA 1MACA 4R52A 3VZKA 4Q1PA 4CDQC 1LOEA 3LWCA 5FRAA 1BMV1 1QWRA 4LHKA 2ENRA 1X82A 4CP0A 1WD4A 3H9AA 2DUQA 3IKWA 3IN9A 5JZGA 4M3CF 1QOSA 4GA9A 5F6LB 1POV3 2ZMNA 2YC0A 1ZA4A 1PNFA 4XYXA 1ND2B 1SMVA 1RUD3 4LBQB 1PO13 4P9XA 3VBUC 3ZFFB 4XBLA 1ND2A 1FNYA 4H14A 4CEWB 1KS4A 4EROA 5HBAA 2TBVA 1YLLA 5AVAA 4W65A 5C8CA 4Q0QA 2W0XA 1GZCA 1V9U3 1GR3A 4QQHA 3OPZA 5JLVA 2O1QA 4LBJA 2DCYA 2EXHA 2G9FA 5C4WA 3IDBB 5JR7B 2HWE2 2Y38A 2NM1A 4RGGA 1VBB1 1NY72 4LO4B 2VVFA 2PA7A 2KM2A 5FLHA 4Q2FA 4OI2A 3VBHB 2DYCA 2Y0OA 1F5FA 3AMMA 1MQTC 3OYWA 3RMXA 2X53S 1QJU1 2DF7A 3FBYA 2JKBA 5BNQA 1ZZ8A 1AYM1 5CVRA 4AGVA 5BNOC 3BODA 5T50A 5BYNA 1OQEA 1RHI3 5FMOL 3R0RA 2XJVA 1ZREA 1FYUA 2CGPA 2VH9A 4FPLA 1BEV2 1NYWA 4HKLA 2HWF1 4G4FA 2EAKA 4P9YA 3V0BB 4COZA 2HWB1 2WLQA 1RHI1 5BNNB 1RUC1 3N7JA 2VUAA 3M3CA 3TNQA 2HWC3 1RB8G 5JSRA 2H6CA 1DLLA 3IT8A 2DV9A 5I0UA 1W39A 1KD7A 3D0JA 4YVWC 1QH6A 3BCWA 3VBSB 4WVMB 1I9RA 3VDDA 1UZZA 2VUJA 1XYNA 3NW4A 1UPIA 4IEPA 2JENA 4CDXB 2HEYF 1RVF2 1AR91 1AYN1 3PMEA 3ZXJA 4RR3A 1YI7A 3VL9A 2AGSA 3E97A 1ZZ7A 3I8TA 3AP7A 2YMZA 2X8KA 1IZ3A 3U10A 2B7YA 3LOIA 5LK5A 1W6PA 3TRSB 1HRV3 3LB9A 4TYSA 3GBFA 4FPYA 3AZZA 2PFWA 4ONUA 3L2YA 1F5JA 2R32A 1ZBE1 1PO23 1YNAA 3PJQA 1LEMA 3KSCA 4IEXA 1Z7S3 3M2MA 4AVAA 3AJZA 1C8M2 1QJU3 5E1RA 1LOBA 3AKRA 3UKVA 2GNDA 1DHKB 1QDOA 2GH8A 3ZFEA 2D6KA 4K40A 1PZ9A 4JAAA 2X5IA 5AC91 1IKQA 1N3QA 4R4ZA 2ZAAA 1PGW2 5CA6A 5ABJC 1DYKA 1LOCA 2E6VA 4D3WA 5DG1A 2JE7A 5J37A 2NP0A 1SLIA 5GLVA 1WCKA 4WVVA 1D4M1 2LM3A 3MIHA 4Q4X2 1UD1A 2P17A 3KCYA 2XPJA 1H2KA 3JBG3 4AI3A 2Z5WA 2ZS6B 1DF0A 1H1AA 4N53C 3WP4A 2ZZQA 5JPNB 1LEDA 1XE8A 4H3WA 5CFCA 1N1VA 2D6LX 1HRI3 5LK7B 3LAGA 1BZWA 3BU7A 4FPJA 1GICA 4CDQA 1O3TA 1SLBA 3L9JT 4WM7C 4K6BA 4CEWA 2GALA 1DBNA 4AVVA 4OLLA 4L99A 4QT6A 3WG4A 1MZ6A 1ZBA3 1NA1A 5GZGA 1SFYA 4YFWA 4IV3A 4QGNA 4Y24A 3MW2A 3FE5A 1RUI1 1ULEA 1W6PB 3GBWA 4COUA 4KU7A 4MXWA 1X8EA 1V6JA 3U07A 1WA4A 3BTAA 1KJLA 4BPZA 4QGMA 2TNFA 3GZUC 3RI9A 1OLQA 1H8TC 3AMQA 2CAVA 1GZ9A 3AZXA 3PHMA 4QD2A 3CJIB 1KQRA 4XF9A 1EP0A 4HVOA 1LHWA 3S0MA 4EN6B 3CO2A 1PZ8A 4N9HA 3QH6A 2R1DA 3AKPA 2RS31 2IXJA 1R093 3VZLA 1OOPB 3KM5A 3THTA 3V0BA 2R042 2G4IA 1AR72 4K3UA 2ZGOA 4XFIA 3O0XA 3EO6A 5J7MA 3NAPC 5DXDA 1V9U2 2DCZA 1VALA 3LSDA 4DMIA 2B45X 1BBT2 4PLMA 4LO8A 2DFBA 1R092 1VRH1 2BVBA 5EYYA 4AFCA 1RVF3 3ZFGB 1UPSA 5D8AB 3TN93 1ULGA 4L97A 1GNZA 4YGEA 5FMOS 2E63A 3D8CA 3I2DA 1GYKA 4WM7B 4X8PA 3JUUA 4JGYC 1OA3A 2AREA 3R05A 1VBC2 5DZEA 1RIRA 1IS3A 4PDWB 4JGZA 1R083 4Y1VA 4QPIB 5FAXA 2BQPA 4Q8KA 3CLPA 3ZXEA 5BUVA 1SEFA 4C1WA 1OFSA 3AB0A 5CNAA 1YYNA 4H55A 4XXPA 1W6OB 4AI0A 4AVBA 3IDEA 4AEJA 1UL9A 1KJRA 2WSUA 3RS6A 3ACLA 2HWE1 3E5QA 1NZCA 2XJRA 4ISRA 1RUE1 1VBE1 2E51A 5L36A 1S0IA 3OJBA 1G9BA 1A6CA 2V5YA 2BNMA 3B02A 4TWTA 2WNVA 4QQLA 2EIGA 4UW6A 4I3GA 1Q8QA 3RNSA 4AVTA 4QGLA 2VNOA 4PF5A 4IL7A 5JSOA 2R1BA 1XNKA 3GZTB 2A75A 1H1IA 3ZMNA 2GAUA 1AUYA 4XHBA 1GV9A 3AMNA 1VR3A 2WT0A 2C5DA 3AMHA 2RMU3 1ALYA 1O7FA 1JUIA 1MEC3 1JXNA 1VAVA 2PHDA 5JDBA 4XJZA 2QZ3A 1J3PA 3OYWB 4MH0E 1NCRB 2WJSA 3NSTA 1RUC2 2O8OA 1W6NA 1YIFA 3WOGA 3ZIWA 1UU4A 3WHTA 4OI4A 4KWJA 2D3SA 5GM0A 3MF6A 4FPOB 1BXHA 3WVJA 2JG8C 4GQ7A 1VB4A 4YVSA 1ASJ3 2VULA 1RUD2 3M7AA 1RGSA 2GNMA 1WMEA 1RUD1 1H9PA 1AL0G 1OA4A 1YFWA 2IFWA 3EJKA 4YG0A 4CEWC 1MS4A 1FX5A 3H1YA 2P34A 4BLJA 1AYN2 4KWKA 5CG8A 2JEMA 4MZUA 2Z42A 2PLV1 3KZ4C 3WW4A 4Z2WA 4LR4A 4XOGA 3B9CA 5IK4A 2W39A 4KU8A 4JVAA 2ARBA 2VOXA 3K48A 1LHVA 4HPKA 3M1HA 1EAH1 4SLIA 5EV7A 1K5MB 4OHVA 2NZ9A 3GHMA 1U0AA 3RDIA 1FV2A 2A3YA 2PHRA 1Q3EA 4AI8A 4LO6B 1NA1B 4XF3A 1VAKA 4Q0PA 1AYN3 4XXAA 4RS5B 2RR12 1D4M3 2VNRA 4KL1A 4Q0SA 1GNHA 4YM1A 2E7QA 1C8M1 5GJ6A 3UJQA 1ZRCA 3JU9A 5CFDC 2CAUA 5C9AA 2PAKA 1FV3A 4X6RB 3SLIA 3WDWA 3B00A 4XW3A 4LE4A 2XG3A 3JBG2 2ZX4A 5BNPB 1AXKA 3QBQA 3WW3A 1DQ6A 1GLHA 1QY4A 3ZYJB 4Q4W1 4C90A 4LLOA 5ACA3 3SITA 1QXRA 2RS52 2WQ4A 3B94A 1CVNA 1TME1 3FFQA 4Z92B 5EWSA 1W6MA 1WLTA 5A3LA 4LUMA 2GN7A 1PHMA 1CN1A 3QOPA 3VBSC 4A2UA 2WQZC 4W6WA 1DYPA 2JECA 5K7PA 2YROA 1KS5A 5T5JA 4N7UA 1NCQB 4AEDA 4MXVA 1D4M2 2GDFA 1L3JA 2TUNA 3ZFEC 2EALA 4R9BA 3IBMA 4RHV2 4JGYA 1EV11 1R1A2 1BBT1 2AR6A 3LGRA 4MGYE 2YPJA 3RJ2X 4NO4A 2UY8A 1WW4A 2LTNA 1RINA 4XTPA 5DUVA 1YI9A 2D40A 2WZR3 4FPGA 2KXLA 3VHPA 5H9RA 3R4UA 4CDXA 4NR1A 2CNAA 4H7LA 2ZBJA 4YGCA 1YO8A 3GHNA 1V6OA 4BYYA 1QOTA 2AUYA 1CAXA 1R082 5JWPA 2IC1A 4SBVA 2XL9A 2NMNA 2V73A 2CGNA 3UV9A 4FPCA 3E5XA 3RMYA 4DRVA 2HKXA 4EJRA 4XEZA 1FMD1 3V64A 2RR11 4YM0A 3BB6A 1OQ1A 4RS5A 1KFXL 4Y22A 1AJOA 3ZSMA 1AYM3 1R081 1V6NA 2XKOA 2YYOA 2PAMA 4Q4V1 3D4KA 3E5UA 4HT1T 1IS5A 1AL22 2VECA 1WUVA 2WL1A 1ENXA 1CD3G 2A6WA 2CYFA 4H7MA 3DV8A 3ZMOA 4FOYA 4XFGA 4OI0A 1SQ4A 1OHFA 3H1WA 4FOVA 1VBA3 3SH4A 3TNPB 1RUOA 1OPMA 3I7DA 3ZN6A 4CZSA 1SDWA 5CFDA 1BMV2 1C5IA 2ZCWA 1LCLA 1TEIA 5ABJB 2VMHA 4OHXA 2ET7A 2XLGA 2DTYA 4P9LA 1JH5A 4PLNA 3ASIA 4WZFA 5T52A 3VDDC 2IZWA 3MPBA 1HXS1 1XU2A 4BLIA 2R30A 4FP3A 1WBFA 1O4TA 2ZACA 2MNGA 5JSPA 2DVFA 4HKOA 3LA2A 4GMP0 4C91A 2N7GA 2OZ6A 2IXHA 1JOJA 2NLRA 3Q9OA 2C9AA 5GLTA 5J36A 3HBZA 2KA3A 3N3HA 3A0NA 5EFUA 4AFAA 2PYTA 3H0OA 4MVTA 1HQLA 1H2NA 2BFUL 4ASMB 1YCIA 1LOAA 3MW4A 1AF9A 1RL3A 5JZGB 5DUUA 4DS0A 1ULDA 4J1WA 3AYEA 1ZBA2 1FOD2 2ES3A 2WKKA 3NV4A 3VKNA 5L7OA 3GF6A 4Q4X3 1DGWA 2XBO1 4JDOA 3PLQA 1REDA 4K9SA 2B42B 3ZFFA 4Z8BA 2RJLA 4B8EA 2QZ2A 5HCFA 3I59B 2I2SA 3M4FA 3NO8A 1PVC3 4BCUA 1WW6A 2B39A 1CR7A 1VBD2 4P9JA 4D7YA 3FWEA 3AFKA 1CONA 1XQNA 2B8MA 2HWB3 1ZYBA 3KB5A 3NV3A 3POYA 3R4SA 1Y9QA 3D6EA 4QM9A 5IK7A 2B46X 3NAPB 1BVP1 4HBNA 4LTAA 3WP5A 3C2UA 5E89A 3VZJA 1U12A 4RHV3 3AX4A 4JGZB 5FFOC 3IIAA 3AXDA 5SV8A 1YHFA 2VMIA 2ZGMA 3G7DA 3ZYRA 5D8AC 3PVNA 3VHOA 3HMYA 1IS6A 3NV2A 4YG6A 3V56A 1WD3A 4E27A 1H1MA 2CWSA 4HETA 1CAUA 3A4UA 3KCCA 5AVPA 1ZVFA 5LEKA 4WVWA 1EY2A 4B4PA 4E2GA 4LHNA 2R6QA 3OBTA 1AR83 2UURA 2WFPA 1WLWA 5GLWA 1MEC1 4HL0A 1OI6A 2A3XA 3AYCA 3WQ7A 3E6CC 3RYPA 3WDVA 5JOXA 1PIV3 1DGWX 4FPKA 5CB7A 3T2TA 3AZVA 4JTNA 3WINE 1PGL2 3VHRA 3ETQA 5CFDB 1W6MB 3SH5A 4AEKA 1B35B 4RSUA 4JRLA 2IFRA 4AVSA 2FHRA 3H3UA 2MEV3 1SACA 1PNGA 1O5LA 5JMCA 1Y3TA 2PLV3 4QQPA 3VHNA 2DCTA 5BY5A 1TME3 1TMF2 2MEV2 1RJ8A 4GWMA 2HWD1 1OD5A 4LE3A 4FP2A 5AC92 3I59A 1G9AA 1HXS3 2MEV1 1UKRA 5TSWA 2EXJA 5FQ0A 1XU1A 3N7KA 1HV0A 2CY6A 1RUH3 4N43A 3VZNA 3D0SA 3I4IA 3MGUA 4ATFA 4A7YA 3BALA 4G3YC 3ZFFC 2ZGUA 2D5HA 3USSA 5KXBA 4YM2A 3VBOC 5C6CA 2JG8B 3WHUA 1ULCA 2C0ZA 2RMU1 1DZTA 4GXLA 4OVEA 4XZPA 3OD4A 2PHWA 4HN1A 5J48A 1XXNA 1MR5A 1NLSA 2AYHA 1PGSA 1AYM2 5GLUA 3N35A 2PELA 1FMD3 1G9FA 1BQPA 5A32A 3WLUA 4Z07A 1RUG1 4QPGC 1B35A 1LKNA 2WWSA 3X29B 1VRH2 4QQOA 1WW7A 2YXSA 2ZGQA 1N3PA 2R0FA 2WA4A 1MEC2 4AXOA 1WW5A 3J26N 2QDRA 5DDJ2 4ZXKA 1K5MC 2BWAA 4AI2A 4R9CA 2ETEA 4XJAA 2BW8A 1COV1 4BIOA 5GALA 1CESA 3EXUA 4UW3A 3DPRC 1UZYA 2ERFA 1LHOA 5A33A 2CGOA 1HW5A 1WLDA 4RD7A 1UIKA 3M70A 5KHGA 5H9QA 2X5IB 1HQWA 4FQZA 2IXIA 4DY3A 1JN2P 4I02A 1HV1A 4RR3B 4YRDA 1LGNA 4KNCA 1FOD3 4Y1ZA 4FPFA 4AYUA 3R6SA 2WNUC 3RI8A 3ME2A 4XDQA 3VUOA 2WNVB 1D2SA 1FI2A 4FO9A 1WGPA 2HJIA 1SCRA 2H0VA 1DZQA 1BJQA 1XYPA 1WLCA 1C8NA 4Q8LA 3VDDB 1LESA 2AENA 4YARA 2BNOA 4N43B 4B4RA 3GZAA 5KBFA 4YW5A 3ZYGA 1FNZA 2R041 4N9IA 1WCSA 4GKYA 5LRRA 2JG9B 3EHKA 1ZBE3 4QPYA 1YWKA 1A78A 2R073 2D3PA 4XILA 1RHI2 2XJQA 3O14A 1C57A 4PCRA 4XFFA 3H7YA 2D7FA 1HKDA 4FOQA 5GZFA 3USUA 4FVVA 2PN5A 3WUCA 3AKTA 4EV0A 1SBEA 1MS8A 4DXZA 1AHSA 4CDQB 4JGYB 2VW0A 4P5HA 2RM23 1EV13 3RQ0A 3J8F1 2IXCA 4QPGB 3MI8A 4LA2A 2GMEA 1REFA 4DNYA 2K0GA 3HWJA 5FLIA 3NVCA 2Q8OA 2VY0A 5F1RA 4GALA 3HN1A 5A32B 1AL23 2FBEA 4YVSB 3ZN5A 1DG6A 2ILMA 3VBHA 5FBZA 1NCQC 2O8QA 4GH4A 4R9AA 2CTVA 4R9DA 2ZGKA 5E8AA 3WP3A 3LOBA 4N7IA 5ABJA 3GYDA 5KC5A 2DUPA 2P3IA 1B09A 3SCFA 1R1ZA 1XYOA 1HX6A 5D1IA 4I2OA 2HWC2 1Q5OA 4QPGA 1NXMA 1BKZA 2O0OA 5FPZA 4AW7A 3U4XA 1IPJA 1WMFA 4D69A 2GMPA 1TNFA 4FXGB 4IEQA 4CDUA 3CJIA 5J09A 4O9GA 3RYRA 3ES4A 4AQTA 3KMHA 4OI1A 4IETA 4BWOA 1AX1A 1MS3A 1PO21 2GH2A 1O91A 3OY8B 1AR93 2DUOA 1N3OA 2VVDA 1IKPA 1MS1A 3M8LA 3HT1A 3O0WA 3ZX7A 5KC6A 3GNEA 4URTA 5SV5A 4OHYA 4U2AA 2XLFA 3CNAA 3MLJA 4N53A 4PQ9A 4XIOA 1CGPA 4XTMA 3VL8A 5C33A 3IM0A 4Y1YA 4Y22B 2UY9A 1ZBE2 3IPVB 4L2NA 3J8F3 2ZGTA 5AC93 5KXEA 3TN91 2RHPA 1MVEA 3WG3A 1W6QA 2WNUA 2Z79A 3ECQA 4I0BA 1SBFA 1ENQA 3R4DB 4AHWA 4LLFA 3WDUA 2GMMA 1HRI2 4E2QA 3DUIA 2EF6A 1EYBA 1YRZA 4O9EA 1UAIA 3JB4C 1PVC2 3VBFC 2JJ6A 3AJYA 1YJLA 1QJU2 1N1YA 2WNEA 4HZFA 1GZWB 4YNIA 1GBGA 3ELNA 3AKQA 3MIBA 3ZFGA 4XHXA 3MIGA 3G6JB 1RUC3 1OLRA 4EN7B 1PIV2 4EWDA 5AFEA 1LJ7A 1YUDA 4RHV1 5KHKA 1EAH2 1QH7A 5KHHA 1DGRA 1HRI1 1W0PA 1RUG2 2HWB2 2QFEA 2DVBA 5FTTC 1IOAA 1FT9A 3RWNA 1H8TA 3E6DA 4EN8B 2R043 3WD5A 3WQ1A 1V00A 1CAWA 1OFNA 1ASJ1 1LGCA 2E7AA 1ZRFA 1LHNA 2NQYA 3AKSA 4GWNA 4E2SA 1G6NA 1Q8SA 3H1MA 4QQ2A 5A3MA 1PIV1 1O5UA 4GB33 2R061 4RQPB 3VBOB 2XLAA 4M00A 1OOPA 2H6BA 3L2HA 3PNAA 3UJOA 5C9AB 4NOTA 4X6QB 2WFF3 4YVWA 4ZU5A 3MLKA 4IEWA 4AHZA 3BIWE 1X7NA 5T5LA 2RS12 1RUF3 2P37A 4Z82A 4JDNA 4AEDC 1S0GA 4GMP3 2DVGA 4AI1A 1G9CA 3OBRA 1VBD3 1D0GA 4LBNA 4MXWB 2HWE3 3VKMA 4RL7A 5I93A 4MV2A 4A7ZA 4PBOA 3ZN4A 2XJUA 1H2LA 1VBC3 4LBLA 2VW2A 2EA7A 1JHNA 1TE1B 4HKWA 4M3CA 4K1ZA 3SNMA 2A6XA 1POV1 4UBHA 4BA6A 2NN8A 2P3JA 4QXKA 3KT1A