2WO2A

Crystal structure of the epha4-ephrinb2 complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
178
structure length
178
Chain Sequence
TGEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKRTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPHRIN TYPE-A RECEPTOR
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
total genus 36
structure length 178
sequence length 178
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wo2A00
2Y6LA 4LKSA 1K42A 2E26A 3BGAA 1UMHA 1GOHA 5JXGA 1PMHX 3I2IA 1W99A 4CUAA 1JYNA 2W95A 1NUKA 3VDBA 2YC2A 4JKKA 5B4XA 2DDUA 3GDBA 4BJ0A 1OH4A 1TG7A 3AC0A 3T0DA 4DEVA 3DYOA 3HNYM 2J1VA 3WF1A 4A44A 1W8OA 3WF0A 2VZUA 1ULPA 5IFPA 4W4ZA 2QQOA 3CKHA 1H6XA 2YC4A 2CDOA 2VO5A 3T0BA 2RVAA 4OZOA 5IYYA 2J7MA 3MV11 1UY2A 4KI5M 4W8JA 2YFUA 3CIHA 2B4KA 4PF1A 2VZTA 3P1IA 5LA2A 1W9WA 2YG0A 1F4HA 3MUZ1 1GOFA 5EIYB 3HNMA 4BK5A 2OKXA 3THCA 1JYWA 2QQMA 4XUPA 1R64A 3VD3A 3CZUA 2JD9A 4GWJA 2WO3A 4TTGA 4QB2A 2BGPA 3WNLA 2W1QA 1W0NA 3CDZB 5IHRA 2C26A 4OUEA 4AAXA 2J1EA 4CUCA 2YFZA 2BGOA 4PT6A 5LA1A 4DUVA 3OB8A 5JUVA 2WO2A 2J1SA 5G04L 2VCAA 1JZ7A 4MGQA 2ORZA 3E1F1 3T08A 1UY0A 2QBXA 2VZPA 2VZSA 2WUHA 4P00B 1JZ2A 4GZ9A 2ZEYA 3WQBA 1CZSA 5IFTA 3OG2A 3PUHA 2JDAA 1LNSA 2RJ2A 3K75B 3MUY1 3OGRA 1JU3A 2V5DA 1JYVA 4CU7A 4D0QA 2XONA 2VZ1A 3I2GA 3UESA 3A7QA 1K45A 3W5NA 2VMFA 5IJRA 1JZ8A 3GGLA 3WNPA 2QQJA 4QX3A 2DCJA 3FHQA 4A4AA 3GM8A 4UOJA 4XUOA 1CZTA 1EUTA 3FN9A 2WBKA 2WDBA 5LA0A 1UYYA 3WF2A 4CU9A 1NAEA 4RN5A 2Y6JA 4XURA 5B4NA 3VD4A 2VZRA 4XZUG 3WSOA 3T0AA 4E8DA 1L7QA 4P02B 4D8MA 4DXTA 4MOAA 3I3EA 1MPXA 3C7GA 1W8NA 4M4PA 2JE8A 5DPNA 3A22A 4M4RA 4MGSA 1CIYA 4LHSA 3VDCA 3OEAA 2VQTA 3K77A 2W5FA 2VZOA 1JZ4A 5LCWL 3I2FA 2W91A 2VZ3A 2W94A 2WO1A 5CZKA 1JZ6A 1L7RA 3EYPA 1EUUA 3HEIA 5DQ0A 1XPWA 2V72A 2Y6HA 2WN2A 4MO3M 2BBAA 4L0PA 5CYYA 3FL7A 4OYUA 3HOBA 2EIEA 3P6BA 4GWIA 2ZEZA 4QPWA 2RV9A 3T2OA 1K3IA 4IUGA 3CZJA 3I2KA 2XHNA 1WKYA 2WYSA 4JHZA 3VD5A 1SDDB 1W9TA 1UY4A 2BERA 5JXIA 4YPJA 3K4AA 4DEQA 3IB3A 4DXSA 2XOMA 2QQKA 4XUQA 4XUNA 2EIBA 1T2XA 4LQRA 3SKVA 2ORXA 1UYZA 3WNOA 1XC6A 1P8JA 4LPLA 4KWUA 1H6YA 4QDQA 3C7OA 3HPNA 3MV01 4A41A 3A21A 5C71A 1US3A 2WQ8A 3K46A 1OF3A 3A23A 1NX9A 3LEGA 2Z4FA 2QQIA 4MADA 1UY3A 1JHJA 2JKXA 5HXMA 1SHWB 4DUWA 3HNBM 1CX1A 2VMDA 2B9VA 3SEPA 3OBAA 4TXWA 1JYXA 2KD7A 2WAAA 2VM9A 3K4DA 2W92A 5FUIA 3I2JA 3IDAA 2VZVA 4QB1A 3HJRA 2ZEWA 4BDVB 2YB7A 4DUXA 1XNAA 3C8XA 2HYXA 4JKMA 4UAPA 1D7PM 4ET7A 5EJZB 3U37A 1UY1A 2WABA 2EIDA 3MO4A 4XVHA 1IQDC 3SKJE 3I97A 4DXRA 4QX2A 2E32A 3ACIA 4AG4A 2ZEXA 2VTFA 4CVUA 2QQNA 2ZXQA 5C7GA 3WF4A 1ULOA 3WEZA 1O8SA 2R7EB 2J1RA 4UI9L 2BZDA 3VDAA 2LW8A 1UZ0A 4KMQA 4FI9A 1W9SA 2VR4A 4ZZ5A 5A1AA 3J7HA 2L9LA 3T2PA 4ARYA 4W50A 1DYOA 3MBWA 3F2ZA 4XUTA 4A3ZA 2E33A 3ABZA 4BK4A 3I2HA 2X09A 5HPOA 4A42A 3C7FA 3ACFA 1JU4A 5DN2A 2VC9A 2W46A 1KEXA 3C7EA 3IAPA 4CU6A 2CDPA 4BXSV 3WNKA 1DP0A 4ZY9A 4QB6A 4QDRA 2QQLA 3SEEA 3LEIA 5JXHA 4JKLA 4E8CA 1O8PA 3C7HA 3ETPA 1PMJX 1KGYA 2V4VA 1GMMA 3DYPA 4QAWA 2X05A 3WNMA 1J84A 5I0DA 3I3BA 4P08A 2VZQA 3UNPA 1PX3A 3NNGA 5J1XA 3CQOA 1F4AA 1UXZA 3BN6A 4A6OA 2C9KA 2W1UA 1UWWA 1TVGA 1DLCA 1SG3A 3NJXA 3NRUA 2W3JA 3DYMA 1BHGA 1UX7A 2VMCA 4ZZ8A 3THDA 1JI6A 5JR2A 2VOTA 2J22A 4OMDA 1WCQA 2VCCA 3K4ZA 2W1SA 2VCBA 5JXJA 1RYYA 3PUIA 3HN3A 5JMOA 4QX1A 4RYDA 4ZXEA 2J1UA 2C4XA 3EB7A 1O59A 1YQ2A 1OT5A 1OD3A 2Y64A 1I5PA 1US2A 1NKGA 2EICA 2J1AA 1GQPA 1JZ5A 2PQSA 1OF4A 4PQQA 3ZM8A 1UYXA 3D3AA 2W87A 3NQHA 1J83A 2WZ8A 3WNNA 3VD9A 1JZ3A 2VJXA 2XQXA 3WF3A 3T09A 2J1TA 3LQCA 3OEBA 3GXUA 3NJVA 5C70A 2ID4A 2VL4A 3DECA 1XNTA 4HG6B 3OGVA 4QDSA 3ECQA 3LE0A 4ARXA 4P5YA 2W1WA 2W9XA 2Y6KA 3IAQA 5DMYA 2WAOA 5G05L 2WZEA 1K12A 1UMIA 4QX0A 2Y8KA 3T2QA 4JX0A 3OGSA 1GUIA 1GOGA 3ACHA 3ACGA 3W5MA 1GU3A 3I3DA 2HLEA 1PX4A 3IIIA 2VQUA 3LPGA 2LS6A 3LPFA 4A45A 2X10A 5F7UA 3FHAA 3UETA 2DCKA 2E31A 3JXSA 5EJ1B 2W47A 1CZVA 4OMCA 1GNYA 1UXXX 2VMEA 3VD7A 2WN3A 4Z2AA 3CMGA 4CU8A 1HN1A 3LEKA 4CUBA 2Y6GA
chains in the Genus database with same CATH superfamily
2Y6LA 2ARCA 2WZR3 4G3YC 4NHMA 3GBGA 3VKLA 5AFBA 2JDZA 1RMU3 3VDDB 5K0UC 4YSFA 5CKNA 5IVFA 4B7EA 3DGTA 1EAH1 1MS4A 2VW1A 5LK5A 3I2IA 5FZ8A 3ZSKA 1ZA7A 1JYNA 2HWE1 2W95A 4IGPA 1LOCA 3UKNA 1NUKA 5SV8A 5A6QA 5FPUA 4Q0VA 1NZCA 3DPRA 3S5QA 5AVAA 5FWJA 3GDBA 1LGCA 1QJZA 1WGPA 1OH4A 1TG7A 1S0GA 1Q8OA 1Y9GA 4RFT0 4BJ0A 5LATA 3FZ3A 5FZBA 3DYOA 1M06G 3HNYM 4CCMA 3LFMA 5J98B 5J09A 1QJX1 4J25A 3T4HB 3J26N 2RS31 1QQP2 4BQWA 1VBA2 2BNNA 5BNNB 2D40A 4E2SA 5EXOA 3EMRA 2CGPA 2CDOA 4QXCA 5KWRA 4WM8C 2VG9A 4OZOA 4WVMB 5IYYA 4OHZA 5J96B 5JSPA 1KFUL 3O5SA 4FFHA 4FOWA 4O61A 3SXWA 3K51A 1UY2A 2F17A 4YM3A 3HQUA 2YFUA 2G9ZA 4PF1A 1AX0A 1RUG3 2GAUA 5FPZA 4BPZA 1DG6A 2HEVF 4HMZA 4X6QB 2RMU2 3P1IA 3VBUB 4HT1T 2JWPA 3ELNA 1W9WA 4RGKA 1OSGA 4LIVA 1F4HA 4A2UA 2JDHA 3POYA 1GOFA 1VMJA 5EIYB 4X8NA 2KR2A 1H0BA 1FOD3 5D8AB 5FO9B 4BK5A 5KC5A 3VZLA 1PGL2 4LKEA 1R1A3 1AYN1 3D0JA 2YU2A 2XUMA 3PMEA 2JD9A 3LIGA 5FYBA 5C8WA 2Y60A 3KV9A 3RQ0A 3AZZA 4JZRA 1VAVA 3WNLA 4R9AA 1V6MA 3ZOIA 1G7YA 1X9TA 2KM2A 2XL7A 1LODA 2ZTNA 4PLMA 4Y4YA 3AKSA 3CDZB 4H7LA 4QPIB 1MEC1 2C26A 2ARBA 2GC3A 2J1EA 4AGGA 3VKMA 3ZXKA 2YFZA 2EA7A 2BGOA 4IV1C 4META 1X50A 2VOVA 4NUBA 4GWMA 4FXGB 4JQRA 5LA1A 1ZM1A 1RUJ3 3N7KA 3CJIB 1FT9A 3T1LA 4DUVA 4Q0PA 3PUAA 4AOCA 1E5SA 3P5BA 3MIGA 5BYNA 3AKQA 1HRV2 1EPZA 1H1AA 1JZ7A 5FKCA 1XQNA 1QU0A 2EIGA 3E1F1 4I01A 4QHBA 2QBXA 3H3LA 4IV3B 1U5XA 5FLIA 2FDFA 4S2HA 1W6MB 3NSTA 4C1XA 1AL0G 4AEDC 1N1TA 2VH9A 2YDEA 2ZEYA 4ISRA 5FY9A 4D69A 1NE4A 2BEOA 3T2TA 3BU0A 2WS91 4QPYA 3PIJA 3K75B 2RG4A 4HK8A 4Y22A 1AL21 1DQ2A 3D82A 4CU7A 1LHOA 1EAH3 2XONA 2VUDA 4K8RB 1GWMA 2HWE3 3I54A 5A32B 1J59A 4IE6A 3N36A 5AC92 4EN8B 3J8F2 1W6OA 1HV1A 1OBNA 3I59B 3WHUA 5FYZA 1ZRIA 4EZ4A 5IJRA 4DS0A 2WNVA 5IUQA 3GGLA 4OI4A 3WNPA 2JDYA 2QQJA 1XOYA 1QJX3 3AYDA 2YROA 3MIDA 3ZPOA 4GJYA 1AYM3 5DUWA 3E5XA 5E6HA 2CAVA 2RS33 3E5UA 3FHQA 3OSDA 4N9HA 3TN91 4A4AA 1GZWA 5LBBA 4HVOA 2JB4A 1CZTA 1VBE3 4XXAA 3MLLA 1ALYA 1PVC3 1RL3A 4N90A 3VL9A 1BYHA 5ABJA 4A3XA 1OKQA 3WNXA 1Q8SA 4CU9A 1S2KA 2QNKA 4NPLA 4LNVA 3VZOA 2Y6JA 3QCWA 5B4NA 2XUEA 5A7WB 2PHTA 2Y6FA 5FZ0A 5LY1A 3L2HA 4MV2A 4QPGC 1Y9MA 1W2UA 2HWD2 3A0KA 3JBG1 3R6SA 4P02B 4URAA 2OIIA 4FOVA 4Y20B 3BOWA 1GZCA 1OLRA 3I3EA 1MPXA 3C7GA 1SPPB 1UZWA 5DAVA 1AYN3 3BTAA 4K20A 4XJ8A 5DPNA 2Z79A 3VBRB 2GNMA 2PHWA 3AMPA 1FPN2 5C5UA 5C9AB 3I4IA 3CJXA 4MGSA 4A7KA 2XWBB 1O3TA 4OI0A 3VDCA 4FPJA 4QKDA 2VZOA 2ZGRA 1CPMA 2MHFA 1HW5A 1MEC3 1WZXA 4KWLA 2ZMLA 2VU9A 3AXEA 1F5FA 4TN7A 5FMOL 3AZYA 5CZKA 3RMXA 3VBFB 2XJTA 3ZYRA 1RITA 1A8MA 1L7RA 3OJBA 4RL7A 3ES4A 4FFIA 3VHRA 4BXFA 4EWEA 1YRZA 3ILNA 2D3PA 1UAIA 1YJKA 1CESA 1N47A 1Y43B 3MIFA 5FYTA 2JG8A 2R062 2WN2A 2PQQA 2GU9A 3MFCA 4CCEA 2BBAA 4XC9A 3O12A 1UPIA 4L99A 4WZCA 3INAA 3RFRA 1UOFA 4MSVA 2XPJA 4OCTA 4SBVA 4CDQC 3B9IA 5FYIA 1QQP1 3P6BA 4I09A 1VBA1 4XF9A 2RV9A 4Q4Y2 3UKTA 2A6ZA 2B39A 4E2GA 2RR12 1WBLA 1PK6C 2CU5A 4H55A 4PLNA 5A33B 3WP6A 1KXGA 1OUXA 2VVDA 1BZWA 1QJFA 2WYSA 3IM0A 5A3UA 4JTNA 3SCFA 1UY4A 2BDRA 2BERA 5CBLA 4TLFA 3WHTA 4DB5A 4HLTA 5DZGA 2HWC2 3GBWA 4XIOA 1C57A 1FAYA 3K4AA 1HRI2 2RMU1 2XOMA 3WX5A 1W6QB 3POSA 1VAMA 3GZUC 5C4WA 4XUNA 4PI0A 2ZMKA 2FDKA 2HBTA 1T2XA 3LA7A 4GB32 1UYZA 2XXZA 1H1IA 1YFUA 1Q43A 3TEZA 2G19A 5FPLA 1PGL1 1QY4A 2ZGNA 3C7OA 4UW3A 4BHPA 1V9U2 1DZTA 4UXAA 4DY3A 4Q2FA 2DVAA 2OPWA 3MV01 1RB8G 4YW3A 2G1MA 3TN93 4XF1A 1VIWB 4ZPIA 3KM5A 5FBJA 1OF3A 2IFRA 3ZMOA 3ZN6B 1R091 5A7OA 5L36A 5LZ6A 4FO9A 4GXLA 2UY8A 4QQLA 1W6OB 3VUOA 2NLRA 5HXMA 2JKXA 5FUPA 5FR3A 3K3OA 4AFMA 3LZZA 5L7OA 5FZFA 2VOKA 3U4SA 1LOAA 2FBEA 1DFQA 1NCQB 2ZGQA 3AZWA 1DCSA 4WBBA 5FYUA 1MS8A 3SQOA 2R073 3VKOA 5JOZA 1CX1A 2P6HA 4NR1A 5LBFA 4BZ4A 3ZFFC 2Z42A 1X8EA 1URXA 1C8M1 4LO4B 4UT5A 1W39A 4XZPA 3JBG3 4EWAA 1VRH2 2WSVA 1BEV2 4FPGA 4KU8A 5KHGA 1POV0 2E63A 1HRV1 1W6NB 4CPBA 3BTYA 3I2JA 4MXWA 2UY9A 2YY1A 2VZVA 4F7ZA 1VBC2 2ZEWA 3PDQA 2YB7A 4DUXA 1LULA 5C8CA 2WLQA 2GZWA 1JXNA 3C8XA 3K3NA 4IEYA 2CNAA 3MGUA 4ET7A 3ILRA 4H14A 3NAPA 2QZ3A 5EJZB 3LIHA 2GH8A 3HQXA 4N53B 3VBOA 3BKZA 3HBKA 1LHUA 4G9SB 3SKJE 1PIV2 3AMMA 4HN0A 3ZDSA 1WBFA 3JQXA 4AEJA 3LKJA 3A4UA 4XJUA 5AC91 2ZGUA 3J8F1 3R4DB 1OFNA 2PLV1 2ZXQA 1DYKA 3WF4A 1ULOA 2D7FA 4QD2A 4UFMA 1CR7A 2CGNA 2WWUA 5ACA1 2B7YA 4FOQA 3NWKA 3ZKYA 1PGW2 1UZYA 1QQP3 4UI9L 5D1IA 1VBA3 4GULA 5F5QA 1NA1B 4ATEA 3OGJA 4LBQA 2ZGOA 4RHV2 2NP0A 1MS5A 3WDUA 1PZ8A 2EVXA 1GZTA 1QHDA 2ZHKA 4FT8A 3WP3A 1W9SA 1ZRDA 4J6GA 3B01A 2RHPA 2RS12 2PXJA 1OOPA 2YBPA 5HCHA 2PYTA 3NV4A 4ARYA 3ATGA 2RMU3 2WNUC 4HSLA 4LK7A 2P6CA 2PHLA 4I0WB 3HVDA 4A3ZA 1PO12 4FCAA 2E33A 4XJ9A 3ZYIB 3V0BA 5GLUA 5CKQA 3BPZA 4YM1A 3ALQA 5FMCA 1UD1A 4A42A 5DN2A 3ACFA 5HV0A 1DQ0A 1FPN1 1PNGA 3FE5A 5CEHA 2ADEA 2W46A 5JOWA 1NT0A 1QWRA 2C24A 2WFF2 3ENRA 5A6YA 3B00A 4XAEA 2EF6A 5F1RA 3IAPA 1LHWA 5DG2A 3THPA 1DP0A 5HCFA 1WCDJ 3LWCA 1AR61 2DBNA 3LSEA 1HIXA 4A7ZA 1G86A 1OA4A 3OBZA 3UJOA 2PHXA 5JXHA 4XMAA 2WA4A 1JYTA 2OPKA 3VBSB 1O8PA 4M3CE 1ND3A 4Z2WA 1KGYA 3ZSEA 3H1WA 4IXLA 4Y33A 1GMMA 1HRV3 4HKLA 4RGAA 2H0BA 5EZWA 1GP6A 4QQPA 1NY72 1D4M2 2GALA 1TME2 3I3BA 1LOEA 3LF7A 4QU2A 2DVGA 2AC1A 2JECA 2VZQA 4PIXA 4F83A 4Q4Y1 1YNAA 2RR11 4NRQA 5T54A 4YZ3A 5J1XA 2JDKA 2VXJA 1YI9A 3GZEA 5FZ1A 5KXEA 4A6OA 3WXPA 1DIWA 2C9KA 2R0HA 1W2AX 3VL8A 1HXS2 2CY6A 2XB6C 2XVKA 4FVVA 5IVVA 4KWKA 4I3PA 1TVGA 3AXDA 4GD4A 4FFGA 3NRUA 3NJZA 4CP1A 3SH3A 1HRI1 1W2OA 1UX7A 3PHMA 1AUYA 1W06A 1IS6A 5EYXA 3MW4A 2NQYA 1LJ7A 1ULFA 2VOTA 4DQAA 4F3JA 4DRVA 4GB31 5AC93 3WUCA 1CAWB 3J8F3 1VP6A 5DAXA 1FNZA 5J3UA 3M8LA 4OMDA 2ZGKA 5A6ZA 1RUNA 3NV1A 1GP4A 1XE8A 2D44A 5A7PA 2AH2A 2BVVA 1WMFA 1A8DA 1LENA 2VCCA 3UL2A 5ACA3 1WW4A 2YU1A 4UFJA 2WSUA 3OBTA 4QGMA 4XFFA 3PUIA 2DU0A 1RGSA 1UU4A 2XG3A 2LALA 3J7NA 3OF1A 4G4FA 4OHWA 1N3OA 4WVWA 3OD0A 2EXJA 2J1UA 4Y5SA 2D93A 2YGMA 3MFAA 2RS52 5FO8B 4CP9B 4W6WA 5KHKA 1US2A 3WW4A 1KITA 4JC1A 5FK8A 1RJ7A 4GA9A 4HZFA 1ASJ2 5LWBA 3VZKA 4IEQA 4PQQA 5FUNA 3ZFGC 4NHXA 4RQPA 1LU2A 1Q5OA 2HWD3 3ZM8A 5I0SA 1FXZA 5FPVA 2I74A 1VRH1 1YQ5A 1BEV1 4PDWC 3O1PA 4O7XA 2B45X 1AJOA 5ANNA 2EAKA 1JZ3A 5FPBA 1OHFA 1AR81 5E8AA 2C1FA 2FMDA 5FY7A 1XNCA 1LOFA 2VNOA 1WCKA 3HIFA 3FFZA 2BW8A 4AQ6A 1MZFA 1FPN3 5L7OC 4QKFA 4NRPA 2VL4A 3ZSLA 2NMNA 4EYUA 3OGVA 5IW0A 5ACA2 3T4VA 1QEXA 1IKQA 1NCRC 3LCPA 3V0BB 2VQAA 4CDUB 5D2AA 3A0NA 1MQTB 1PIV1 1U5IA 2QFEA 3KT1A 3LDBA 1AXYA 2ZX4A 2Q30A 4PIYA 3U75A 2WZEA 1NQJA 2WT1A 4QX8A 2VVEA 4MYEA 4QX0A 4PDWA 4JGYB 4RS5A 3MIBA 2R063 3WW3A 5L9BA 3UK9A 3OGSA 1GUIA 5A6XA 5BV6A 5K0UA 1LECA 4IQPA 3FBMA 5F5AA 1JN2P 1HDKA 2B9UA 1X33A 1MS9A 3ACGA 2FD8A 1FV2A 4Q4Y3 4GWNA 2RR13 4RHV1 3VBHC 5FFOC 1PX4A 3AJZA 3E97A 3FHIB 3TEYA 2TEPA 3AP9A 1QH7A 3CNAA 5BNPC 3RJ2X 4ATFA 1ND2B 3N9LA 3DXTA 1H9WA 1ZRRA 2RS11 5DZEA 2WNEA 3ZXDA 2HWC3 1DGRA 2WKKA 1HRI3 3JXSA 5KR7A 2F6BA 1CAVB 2RE9A 3IPVA 1UXXX 3ZFEB 4GB33 4LHLA 1QOSA 5IVYA 1WWYA 4COYA 4HSJA 2IXJA 4JQTA 4CEYB 2VNVA 4IL7A 2Y6GA 5F5IA 3JQWA 3WDVA 5CFDC 4ZU4A 1K42A 3ZYGA 4Y1UA 3UJQA 3M3OA 4MGKE 1YFYA 3VZNA 2VD7A 2JG9B 4YGDA 5JXGA 3U0ZA 4V2WA 2WFF1 5GLWA 1PMHX 4FTSA 2PHDA 4Y1ZA 4MHRA 1GFF2 4Q26A 2YC2A 3KZ4C 2RS32 4IEZA 4CCKA 5C6CA 1JTZX 3AC0A 3POEA 1IG0A 2OYZA 4LKFA 3KLSA 4HBNA 3VKNA 5CG8A 2BOIA 1V6JA 5LBEA 4PBOA 3WF1A 4LJHA 2GNTA 3M3CA 3WF0A 2D6KA 1OLME 4YNIA 3KMHA 1OA3A 5IFPA 2VPVA 4W4ZA 2QQOA 1VRH3 3CKHA 1BEV3 5EQUA 1H6XA 2W39A 3O0WA 5FIXA 3T0BA 4B3NA 3O1OA 1NY71 1VBC3 1TME1 5HI0A 1NLSA 1WLWA 2PHFA 1QDCA 4KI5M 3JUUA 4JDOA 2VULA 4QQHA 4RSUA 3UGFA 2ZKLA 1K5MA 1LOBA 1QJY2 4CXYA 2D6LX 3N9OA 3DKQA 5DUXA 4YWAA 3V0AB 3ZSMA 3H8XA 5FYMA 1RXFA 1GWLA 2IXHA 1GICA 3B7MA 2OA2A 4K7JA 4AVVA 1V6LA 4E27A 3ZN5A 1SLCA 2Q1ZB 3KVBA 5H9RA 1PIV3 4AE2A 2OKXA 5JZGC 2E7QA 4LHKA 4QXBA 1JYWA 1FNYA 4AEDA 1VBB2 1I1EA 4AHYA 4M3CB 3CZUA 1SBEA 3J9SA 2CYFA 5EWSA 2GP5A 1E5IA 3RDIA 3RGBA 3SH5A 4MGTA 1W05A 2BUKA 2GN7A 3HAGA 5IHRA 2BGCA 2ZGLA 2PAKA 2EAAA 4IEPA 4AAXA 4CUCA 3ZX7A 2XR4A 3AL5A 2W2IA 2OUJA 4OHVA 4RHV3 2VW2A 3ZXFA 1XNBA 3I3QA 2ZZQA 5DAQA 2ES3A 3NJYA 4XBLA 1AXKA 4XOGA 2WT2A 3OB8A 4OI1A 4C0BA 2J1SA 2RS13 2VOWA 4F8AA 2QZ2A 4ORFA 1MZ6A 1MZEA 3T08A 2WS92 1EY2A 4CDXB 1HQWA 1J3RA 1UY0A 2VZSA 1U12A 2WUHA 3KV6A 3MPBA 3RPQA 4CP2A 2V5YA 1ZZ9A 3HWJA 3Q9OA 4XQWA 1AL22 4IGQA 3O14A 1CZSA 2IFWA 1PO13 3OG2A 5FZAA 2XL9A 3AVRA 1ENRA 4FP3A 2JDAA 1KD7A 1LR5A 2ZX3A 1OVPA 4DZGA 2V5DA 1Y4WA 1E5RA 4JGZC 2WFF3 2VZ1A 4QHZA 4XQDA 4DY5A 2DVFA 3MIEA 4WM8B 2Q1MA 1LHVA 2CWMA 4N43B 2JEMA 2A71A 1IHMA 2W68A 3GHNA 4HOOA 5CFCB 1C28A 5KBFA 3W5NA 3OY8B 4P9JA 3DV8A 4TYSA 3NW4A 2TUNA 1RJ8A 3K2OA 1LESA 2HWF2 1ENSA 3V65A 2ADDA 4AYUA 2PHUA 3BUCA 4L11A 1EUTA 2IUWA 2XDVA 1TNRA 3FN9A 2H6BA 5D21A 2Y0OA 1D4M3 2WBKA 1TME3 3MF6A 3BIWE 1H4HA 1UOGA 4XHBA 4COZA 5FZMA 2XWJB 2XVGA 1XNDA 2VCMA 2OVUA 4RN5A 4XURA 1QOOA 2WWJA 2VZRA 4UFHA 5JI9A 2OX0A 3QACA 1HXS3 3T0AA 2DFBA 2A5ZA 5DDJ1 5TSWA 3WDYA 4DXTA 4MOAA 2QQUA 1SMVA 3ZVXA 3AKTA 4ITCA 5FZ4A 4CDQA 3X29B 4OI2A 1YQCA 4IV1B 2AEZA 2DTYA 2JE8A 1XU1A 4LIUA 2ZMNA 1HKDA 1TEIA 1XU2A 2BTVC 1PK6A 3IIAA 5F3EA 5FZOA 3IBMA 4K6BA 4M4RA 3S5AA 5I0RA 1HB3A 4GIQA 3OEAA 4CYDA 3WDXA 3KF5A 1RXGA 2FZ1A 2PELA 4HETA 1H8TA 2W91A 4CE8A 1GZ9A 1CVNA 1Q3EA 2VZ3A 4FFFA 4O65A 2YUEA 4Y4RA 3S30A 4CDWB 4AHZA 3BPSA 1LTEA 4AQ2A 5GALA 4Y1VA 2RS53 4CZSA 1RUI2 3HEIA 5E89A 3VKFC 2XGXA 2Q1FA 1DGWA 1ZRCA 4NIHA 2D5FA 4Z82A 2V72A 2HEYF 2WQ4A 4ES9A 1ASJ3 1Z0HA 2UU8A 1KS5A 4K21A 4TLGA 5CYYA 3VHNA 4LBLA 5GZFA 4OYUA 4QX5A 2BPA2 3PMSA 5A3TA 2ZEZA 1GQHA 2Z5WA 3T2OA 1K3IA 4IUGA 4ZXKA 3CZJA 5JR7B 3POBA 2XHNA 2IVIB 1WKYA 1WW6A 2WRAA 5FJHA 4NOTA 4MG2A 4WM7C 3VD5A 4CEWC 4YVSC 5SV5A 4XBQA 1QJY1 5DZFA 5C4WC 2YXSA 4MUVA 3HMYA 4YYOA 2VGDA 3ZFFA 5JOYA 1C1FA 4YPJA 4DEQA 1LHNA 2QQKA 1CAXB 4YG0A 4AVBA 1O91A 4FOYA 4XUQA 2EIBA 4COVA 1T6GC 2ORXA 1LU1A 2LUWA 3WNOA 2OS2A 4MGIE 3RZMA 4CRQA 1R092 1S2BA 1H6YA 3H8OA 3RZKA 5FXWA 3AYAA 1VBB1 1A6CA 2PN5A 3HPNA 3WUDA 3A21A 1B35A 1Q8QA 4QPGB 4KGGA 3H7JA 5EJ3A 4L9BA 1K5MC 2QTWB 2ZZJA 1NX9A 1OQDA 5L19A 4LITA 2VXRA 3OD4A 3OPWA 3AZVA 1JHJA 1C8M2 3AP6A 2G9GA 3UV9A 1NXD1 3AYEA 3S7EA 3ZR6A 2O0OA 2ZGSA 5JVVA 4U36A 4MX3A 4R4ZA 4E4HA 4XFIA 3SEPA 4EJRA 4OZXA 3RS6A 1O3QA 4I2OA 3WDWA 2VM9A 1IPSA 3NV3A 4X6RB 1JOBA 4H2AA 4JDMA 3SITA 2ZX1A 3PTRB 2QVSB 1XB9A 4Z1VA 4SLIA 5K4LA 3WV6A 2DYCA 5F5CA 3Q8AA 1ZX5A 3BTZA 2CV6A 1G9BA 2GC2A 4NIAA 5EYYA 3D0SA 4ZS3A 4AFBA 2FDIA 1VALA 1GKBA 4IERA 3FWEA 3WINE 2PLV2 4P9IA 4EE2A 2WNUA 3I97A 1KQRA 4N9IA 4ONUA 4DXRA 4DIQA 2YGLA 1G8WA 5FYHA 4QX2A 4AI9A 4I0AA 3ACIA 4D3WA 5APAA 4AHXA 2FQPA 4E2QA 3DPRB 4LUMA 4P9XA 2DVBA 2HWF1 1R082 2XJSA 1POV1 3J7MA 3K48A 2J1RA 2QJVA 4NPMA 3W20A 4QT6A 4GKXA 4AVTA 1W90A 1CONA 4BB3A 2FMYA 4DRRA 5FAXA 1ZZBA 3TAYA 1W6PA 4C91A 2D3RA 3N9MA 4MHUA 3PVNA 3I2OA 1FMD2 4XCBA 1QJY3 4QGNA 2VR4A 4K40A 4O9GA 1I6XA 1UW8A 3RZZA 3WCRA 3J7HA 2HEWF 3POWA 5M0TA 1SCSA 4FBFA 3BOPA 4Y26A 2I2SA 3F2ZA 2RDNA 2Y26A 5BNOA 5J36A 1OQ1A 3EO6A 1BVVA 4Q0QA 1H4GA 5A70A 4XUTA 2QDNA 5FYYA 4YW4A 2J42A 2X09A 1SDWA 4QQOA 4K1YA 5BY5A 1VBB3 5HPOA 1AR62 1SFPA 2OZJA 3C7FA 1S1AA 3V56A 1DQ4A 1EP0A 2VNRA 3O0VA 4IEUA 2D6PA 4PLOA 5FZ9A 4YRDA 5F37A 5LW9A 3AMHA 1WD3A 3C7EA 2GNDA 4YVWA 3OTFA 4ZY9A 1IS5A 3HD8B 3ZLIA 4YZ5A 1LB2A 4BLIA 4HVRA 2IXIA 3UGGA 4NAMA 4QDRA 3WLUA 3KSCA 3VZMA 2VMGA 4D7YA 1W8ZA 5LEJA 1RUI1 4IV3C 4JKLA 4LEJA 2FZ2A 1PMJX 1DZRA 1VPHA 1SQ4A 1VBD2 1ZBA2 3S57A 5I8YA 2V4VA 4XYXA 2X05A 2XLAA 3W58A 5C3QA 2WS93 3ZO0B 1VB4A 5F8PA 2E7AA 1AL23 4W6XA 3UNPA 1KS4A 1H8TC 2GMEA 4BQ1A 3NNGA 5E88A 3CQOA 1KJLA 4RA0A 1AF9A 3BN6A 4RR3A 3AK0A 3IT8A 3ZDVA 2D6MA 2DBIA 2EXIA 2QQWA 3ZYFA 1UU6A 2W1UA 2K2SA 3NJXA 5F3GA 1OQEA 4XAAA 2W3JA 3DYMA 4QX7A 3ZFGA 3E6DA 4Y22B 1BHGA 3TBDA 3KV5A 1FATA 3GALA 1IG3A 3V64A 3TB0A 5FQ0A 1WA6X 5K7PA 1O3RA 1GYKA 3LDRA 1OVSA 1AZDA 3DKWA 1PMIA 2D6OX 1N1YA 1WCQA 1XNKA 5DXDA 4URTA 4UYBA 3LB9A 3K4ZA 4D6QA 3H8UA 4XMIA 2HWF3 3WOGA 1Q8VA 2WNVB 3H42B 2VW0A 1ODNA 4Q1PA 4XFAA 4QX1A 4BIFA 3CF6E 4LK6A 1Z7S1 4CCJA 4YW5A 2C4XA 5C33A 1GZWB 1NCRA 3GCXA 1OT5A 1OD3A 1POQA 2ATFA 2Y64A 4YGEA 4AL9A 1I5PA 4C0HA 3MICA 1NKGA 5A80A 2J1AA 2A73B 3KCXA 1UPSA 5ABJB 1GNZA 1Y9QA 4UFLA 4HONA 1ONAA 1AR82 2PQSA 5FO7B 2IVJA 1TMF1 5FP9A 1J3PA 3SNMA 4B29A 4E4ZA 2A6WA 2E7TA 1JHNA 2AEYA 3B94A 3D3AA 4HFSA 1B35C 1J83A 2WZ8A 1N3QA 3NQHA 4LE3A 3WNNA 1XSQA 1V6KA 4BQ5A 3KGZA 2XQXA 3QH7A 1SACA 3T09A 3VBHA 2LRPA 2Y34A 4DO0A 3IMNA 5FZIA 2B42B 2RM22 3NJVA 1J3QA 5FZEA 5FYCA 1JOPA 5BNPA 3DECA 4CCLA 5FZHA 1MZ5A 4XJZA 5C3PA 3PJQA 4P5YA 5KHJA 2W9XA 4CUGA 4LOTA 2Y6KA 4HPKA 1QIQA 2GDFA 5AFEA 2A75A 1YUDA 4AHWA 1RUI3 4KNCA 4OFGA 5G05L 1IPJA 4N8MA 1O7FA 4XACA 1UMIA 3VB9A 3WDTA 1S0JA 3D5OA 1APNA 3T2QA 4FAHA 4AAPA 3SISA 5CFDA 4FPLA 5IVBA 2C6SA 2ZA9A 1R081 4W65A 2JG8B 1QF3A 3LOIA 4BH9A 3BODA 1ZBE2 3ACHA 3W5MA 1H8VA 3POIA 3AX4A 5CIRA 3FLRA 4AK3A 1BVP1 2VQUA 1O4YA 2D43A 2ARXA 1OI6A 4N7UA 2WZPP 1D2QA 5FOBB 1QGLA 2QDRA 5LK7B 2JENA 4TSVA 3WQ0A 1FMD1 1I3HA 1WLTA 3B3QE 1UQXA 2VUCA 2OW4A 1XJAA 2E31A 1QJU1 1YC61 3B9CA 4I0BA 2A70A 2CAUA 5CKMA 4O9EA 4LO8A 3NL1A 4FTEA 2BJSA 3M4FA 3VD7A 4OQ9A 2UURA 2WN3A 5C4WB 1V6OA 1GLHA 2XMLA 1R093 3LEKA 4ZKTB 2KXLA 3LA2A 1SFYA 1D0HA 4BQXA 2NZ9A 4LKSA 4CCOA 2E26A 1STMA 2YMZA 3USSA 5JI7A 3S7IA 1NCQC 1UMHA 4DPNA 2ET7A 2ZX0A 4ZS2A 5A3PA 4TWTA 1W99A 3BB6A 5H9PA 5LA9A 3UYJA 4CUAA 1XXNA 3M3QA 1C8M3 4FPFA 4YARA 3RI9A 2ZHNA 1O6UA 5B4XA 1BK0A 2NM1A 4R52A 4X8PA 5JZGA 5H9SA 5BNOC 1A78A 3T0DA 4DEVA 1JBCA 4W6YA 5FWEA 5L7OB 2FDHA 4QXHA 3J7LA 2J1VA 4A44A 2PHRA 2B5HA 1X36A 5EV7A 5JIUA 4LO5B 1VBD1 1ZBA1 2RDQA 3WCSA 2UWBA 4JVAA 2MPFA 1RUH1 2YC4A 4P5HA 1DQ6A 2RVAA 2AR6A 2VVFA 2J7MA 4C1WA 3MV11 1CPNA 1N3PA 4N53C 1IPKA 4MXWB 4YVWC 4XHXA 2B4KA 4EN9B 2JE9A 2I45A 1JUIA 2X5IA 3HR9A 4KBZA 5C8CB 2PTMA 2VZTA 4L8QA 3KCYA 1J1LA 3OBRA 4CXXA 2GSYA 3H7YA 1TE1B 5LA2A 1RHI2 2AREA 3KQ4B 3NAPB 2XH6A 2PLV3 4XJWA 1DU3D 3HNMA 3I2DA 3L2YA 3OPTA 1WW5A 4PJYA 4OLLA 3VBOB 4Q8KA 4QM9A 1UF2C 3M7AA 1XBFA 2HKXA 2QQMA 4PBPA 4XUPA 1R64A 1HB4A 1NA1C 4TTGA 2WO3A 1YQ6A 4QB2A 3IDCB 4KU7A 2VMIA 3RVHA 1K5JA 3UT0A 4WZFA 1W0NA 4HKWA 1OURA 1L3JA 1MVEA 1R083 2XKPA 2Z2SB 3PIGA 1NLQA 4FPYA 1S0EA 4XF0A 3CL1A 1OD5A 5DABA 4UBGA 4Q0SA 4JGZA 5T3NA 4BM8A 4RR3C 3MZHA 3LSDA 4OUMA 1O4ZA 2K46A 1PO22 1SLTA 3H1YA 3USUA 2OUHA 3PUSA 1KJRA 4LHNA 2C0ZA 1V70A 4LBQB 2PAEA 4CCCA 1VMFA 4OQ8A 1VRBA 4L2NA 3FC0A 5CFDB 1FMD3 4AR2A 1U5ZA 4XF3A 5T52A 4AGRA 1W8UA 3KHCA 2VCAA 5JIAA 4IETA 4HKOA 1OOPB 1SBDA 1F2NA 3O1UA 5F2SA 1YXWA 2XQRA 4P00B 4LORA 5FTTC 1W2NA 3AVSA 3NKGA 5CA6A 3D4KA 5IFTA 1PVXA 4BYYA 3UKVA 1H2LA 3LFIA 3PUHA 4Y3OA 2UYBA 2LTNA 1LNSA 1AR63 2YZ4A 4Q4W1 4GKYA 2RM21 3MUY1 5AVPA 2VAUA 4AW7A 5KXBA 1JU3A 5FZCA 5I0UA 3B69A 2WC2A 1JYVA 4D0QA 2XJUA 5L73A 1LOGA 1XE0A 1IKPA 1COV2 1DGRN 3IN9A 3UESA 3URFA 3BTXA 3VHOA 1D0GA 1K45A 5IK4A 3VHPA 2BVBA 3SCHA 1UIKA 1HB2A 4XXPA 1C1LA 2YBSA 1LGNA 3ZKUA 3MF9A 3WG2A 4NIGA 2DCJA 3T1MA 1XYNA 1VBD3 1ZBA3 2H0VA 4GQ7A 4LBOA 3OGGA 4FQZA 3GM8A 2ET1A 4NIDA 4UOJA 1ND3B 1MVQA 2PA7A 4LULA 5JZGB 1R1ZA 1ZBE1 2WDBA 1ZZ6A 4YG3A 4AVCA 1CX4A 3VLBB 4IE5A 3O1SA 5LA0A 5DDJ2 3U1XA 1NYWA 3RWKX 3WF2A 4UW4A 3ACLA 2Q8EA 2JX9A 2HWB2 4LT5A 3VD4A 4Q4V1 3ZYHA 1L7LA 4JTOA 4XZUG 1RUE1 4E8DA 1L7QA 1BBT1 5J7MA 2BWAA 3AMNA 5GZGA 4YFZA 4LOSA 3RI8A 2E53A 2RDSA 4UF0A 4BMBA 1W8NA 2N7GA 4M4PA 1XSRA 3RWNA 1ZVFA 3OPZA 4NMIA 4RFRB 3ZIXA 5FDBA 3E6CC 3A22A 4NPRA 2V4AA 4UFKA 1DQ1A 5DAWA 2VECA 2ARAA 4LHSA 4WM7A 1ZREA 2ZS6B 3K77A 4CEWA 4YVSA 2DCTA 2EALA 4NHLA 4KQ7A 4QHOA 1JZ4A 5T5PA 4UFIA 4XQ4A 2D5HA 1W0PA 2CL2A 3D8CA 1GANA 5K8SA 4JAAA 1IGOA 2WO1A 1W8WA 1JZ6A 1RUC1 1AR72 2CTVA 2PFWA 4XW3A 5A3NA 5FPXA 3O1VA 4E4DX 1GV9A 4GH4A 5DQ0A 1XPWA 4R9DA 3W9AA 4YW2A 3BALA 5I0TA 3NKTA 1CAUA 3AJYA 3OYWA 2JIGA 3PLQA 1AR83 2ZABA 2Q8OA 3FL7A 3I8TA 3GYDA 1UU5A 2EIEA 2XJRA 4GWIA 5IVEA 2VE1A 4QGLA 3P3PA 1AHSA 5GLZA 4RQPB 4WVVA 4TZDA 1UCXA 4Z92B 5FP8A 3ZYJB 4FTBA 3O1TA 1JS9A 3HBZA 2ZKNA 5JSOA 1SDDB 4H3WA 1W9TA 4JV4A 4DOUA 5IAXA 2RM23 3QBQA 2ZCWA 1C8NA 4FPKA 3D6EA 1GQGA 3POJA 3RMYA 2GMMA 2YC0A 1CD3G 1RHI1 2OQ6A 4J1XA 3GZTB 5F3IA 3NNMA 3PVEA 4LQRA 4FPCA 3LA3A 3N3HA 1XC6A 1P8JA 4LPLA 3RYKA 2F4LA 5FREA 5FYVA 4QDQA 3VDDA 4AXOA 2QQPA 2VUJA 1ZRFA 1QJEA 2GN3A 1X82A 1UKGA 5FK7A 3RZHA 1SBFA 2R49A 1US3A 3T3YA 2ZAAA 4QMAA 3A23A 3RRDA 4KGQA 2HH9A 4GMP0 5GZDA 3UGHA 2X5IC 3LEGA 4FPHA 4PDWB 2Z4FA 4RS5B 2QQIA 1UOJA 3AFKA 4B1LA 4MADA 1UY3A 4KBBA 1ZBE3 2A1XA 3CHXA 4GAZA 2VBDA 1HJGA 4E9KA 4DUWA 4ZHNA 5K0UB 1RVF2 4FPEA 1PO21 4ES8A 2VMDA 2YPJA 1UOBA 2P3KA 3ZIWA 1OPOA 1OPMA 1ZA4A 5BNNA 1QH6A 1OH3A 3K4DA 5C3OA 2KA3A 2OT7A 3ZFEC 3ITQA 1O4TA 4BIOA 4DMIA 4WVMA 3T30A 1C5HA 1MS1A 2OXBA 2WLPA 5FUIA 1TZOA 4YLZA 4XILA 4Q29A 4S2GA 5FLJA 4QB1A 2IZWA 3HJRA 5KC6A 3I7DA 4PQ9A 1XNAA 4CTEA 2WIIB 3N7MA 2HYXA 1UL9A 2JG9C 4YM2A 4HVQA 4UAPA 3VBUA 1D7PM 1QOTA 3DF0A 3FJSA 3IPVB 5CU1A 5GLTA 1IQAA 3EXUA 3G6JB 5IATA 1UY1A 2WABA 3BU7A 5D8AA 2EIDA 4S2DA 2UWCA 2ZGMA 4XVHA 5FZKA 1YEWA 2DWRA 1RUG1 2WT0A 4PF5A 4BQ2A 4LA2A 1A3KA 2B8MA 1COV1 3KGLA 1XYPA 2WFPA 3JZVA 4YGCA 3KCCA 4Q27A 2HJIA 2R042 2ZEXA 3POGA 5JMCA 3U10A 2VTFA 4BE3A 2QQNA 4CVUA 5C7GA 1MACA 1S4CA 3ORJA 4QPIA 4UW6A 1SEFA 2QKDA 3PNAA 1O8SA 1R1A1 4YZ1A 1YI7A 2DTWA 5FKBA 4I3GA 2BZDA 5E1RA 2BU9A 2DFCA 1PHMA 3CEWA 4MLOA 1Z78A 4CPBD 3CJIA 5BUVA 3OCPA 3N9QA 4AFAA 5FZGA 2EXKA 4KMQA 4QKNA 2Y38A 3JB4C 4AEMA 3EHKA 3N35A 4WVZA 2A6XA 1MS3A 1FI2A 2HWB1 2HBUA 4IV3A 5A1AA 1K5MB 1W6MA 2Q0AA 3RYRA 2L9LA 1W03A 2FDJA 3T2PA 3ZXAC 5C9AA 4K3UA 1RHI3 4ZU7A 1WW7A 1DYOA 1W3XA 4UBHA 3MDPA 3MHZA 3SCGA 1CN1A 2PMWB 3ABZA 4BK4A 3I2HA 4KG8A 5I91A 1RIRA 1XYOA 3JU9A 4AGVA 3I3MA 4YG6A 5EP9A 4NE9A 2SLIA 5T5JA 4LKDA 4AEDB 3FLTA 2VC9A 5A32A 4JCKA 2JJ6A 3EBRA 1CWPA 1JYCA 5FXVA 2XBO2 1ODMA 3AKRA 1QXJA 4CU6A 5I93A 2BNMA 5ANQA 3I59A 4L92A 4Q8LA 3ROUA 4PHZA 5IK5A 3ST7A 1LKNA 4AFDA 2R16A 5FMDA 4J1WA 1PO23 1BXHA 1AR71 2H6CA 4LBQD 2QQLA 1WD4A 4AWDA 4CDXC 3LEIA 3J4UH 3KVAA 1BCXA 3C7HA 1YLLA 5FPAA 3KT4A 1S0BA 2QE3A 1ZYBA 3FUOA 2RDRA 3MLJA 1BMV2 2DUPA 1UIJA 2DCYA 4OHXA 4P9YA 1JH5A 2UYAA 4QAWA 4Z8BA 1KDKA 2JIJA 3JD72 1J84A 2MEV2 2IWGB 3GBFA 1AYM1 3I49A 2CGOA 5A7WA 4RGGA 4AFCA 2ZAHA 3BVCA 2F4PA 2WQZC 5CB7A 4FQ4A 1VBE1 4XF4A 1PVC1 1AVBA 1F4AA 4Q5OA 1KFXL 1UXZA 4JRLA 4N43C 4Y20A 1OC1A 5CFCC 3PUQA 5LRSA 5K9YA 3WR0A 4GH4C 1SPPA 4NVPA 3ZR5A 2Z69A 2BFUS 2O8OA 1SG3A 3FBYA 1E57A 3VBRA 4AZZA 4M00A 4ZZ8A 1COV3 3THDA 5T5LA 5JR2A 5JOXA 2J22A 3Q8BA 1QNWA 4B4PA 1PM4A 5L9VA 1AX1A 1H2MA 5FY8A 1Z7S2 2P17A 4AF9A 5T55A 3CU7A 2W1SA 1W9YA 2VCBA 3LD8A 1Y3TA 5LY2A 1RYYA 2VMHA 3VBFA 3H3UA 1OA2A 4EQVA 1XRUA 5JMOA 4HANA 4RYDA 2ZOEB 4XDPA 1GWKA 4MGYE 3ZMNA 1TMF2 4JRAA 1PZ9A 1RVF1 5DDJ3 4LBKA 5A3LA 1YFWA 2EICA 2ETEA 1F9KA 1GQPA 4GALA 1WCSA 4XFHA 2HWB3 4C8DA 1JZ5A 1OXCA 1S2EA 1ZZ8A 4A6SA 2O1QA 1RUD2 2LROA 2R1DA 3VDDC 1UYXA 3BCWA 4D7TA 5A33A 3O1MA 4LBNA 2W87A 2AENA 3POFA 3VD9A 3PURA 1S55A 3M70A 5IAVA 2VJXA 5FY5A 4YM0A 2A3YA 3WF3A 3KF3A 5FZ3A 1W8HA 2J1TA 4CDQB 3LQCA 4NWVA 5IT6A 1D4VB 1V00A 2ZGPA 1J58A 1REFA 3GXUA 4D6RA 5C70A 4R9CA 1JODA 1ACCA 1W6QA 4CDWC 2WNOA 1PK6B 2OZ6A 1XNTA 5FZOB 4QDSA 3ECQA 3LE0A 4QXKA 3B5LB 2E51A 1IS4A 5BNNC 1DDLA 3HT1A 4V1PA 4ARXA 4IGOA 5IVJA 4HK9A 2VQ0A 3PL0A 5F2WA 3WW2A 4B1MA 1AR73 1H8TB 1CIWA 4XTMA 3THTA 3IKWA 1AJKA 3JB8A 1DZQA 4P9LA 1YWKA 2WAOA 1YO8A 2DCZA 2R041 1K12A 2YYOA 3O7OA 3QH6A 3ZN6A 2Y8KA 2XJVA 4LBJA 3TNQA 4IEOA 3PVOA 1HQLA 3BYWA 2VY0A 1GOGA 4QM8A 3VBUC 1X7NA 3CLPA 1YIPA 5A3WA 1NCQA 3M2MA 3FX3A 3R4SA 1F31A 1F15A 1JUHA 4UW5A 3I3DA 5D8AC 2HLEA 2W0XA 4B4RA 1QJU2 1RINA 2IXLA 4MZUA 3WY6A 4I30A 3LPGA 2LS6A 5B2GB 4A45A 1KRIA 5HV4A 1VLNA 4XFGA 1W6NA 2E6VA 5EPAA 4ZONA 3UETA 1W9FA 3FUQA 1MR5A 2R071 2ERFA 1ZZCA 5CNAA 1O5UA 4AVSA 1SLIA 4QPIC 2W47A 5F6KA 2WO7A 4OMCA 1CQ9A 1DLLA 3ZFFB 3ME2A 4IESA 3HQRA 3MI8A 2NMOA 3DUIA 3LDKA 4LE4A 4Z2AA 3CMGA 4CU8A 4DXZA 4N53A 5DUUA 3AYCA 1DYPA 4CUBA 1Q8PA 4CXWA 3CJIC 1O5LA 3BGAA 3TOJA 5JAXA 4S2FA 4NWWA 1JYIA 4ISQA 1GOHA 1ENQA 1OFSA 4B4QA 4YW6A 2XBO1 1B35B 1EPWA 4BQ4A 2VBBA 4MXVA 4YW1A 5C9AC 5HCAA 3LEMA 3VDBA 3G7DA 4JKKA 4XJAA 1QXRA 1RVF3 2DDUA 4XTPA 3WG1A 5T5OA 1RUH2 4M0NA 2BV4A 3ZPYA 3VZJA 1N1VA 1YQ8A 1W8OA 1LRHA 1NA1A 2VZUA 4CA9A 1ULPA 1GBGA 3N7JA 2O8QA 1BMV1 1PM7A 2VO5A 1CJDA 1LCLA 5HBAA 1RUOA 3JD71 4IEXA 2ENRA 3NNJA 2MEV1 4Y1YA 4W8JA 1E5HA 3E5QA 5J48A 4XCAA 4FXKB 3CIHA 2DF7A 2FHRA 2P5BA 3GHMA 3O0XA 1G9CA 3M3EA 1SLLA 2P1BA 2GC1A 4BU2A 4DINB 4P14A 1RTVA 4KH9A 2YG0A 3MUZ1 1AX2A 2ZACA 1SLAA 1VAKA 1H2KA 3AP4A 1FX5A 3DPRC 3M1HA 3MPPG 5CVRA 1LAJA 4AVAA 3THCA 4LA3A 3U14A 2QQVA 1POV3 2R1BA 2WNUB 3U11A 2R043 5H9QA 3VD3A 4GWJA 2FCVA 4COUA 3DEMA 2O14A 1BLZA 2BGPA 2W1QA 1HB1A 5CG9A 1TNFA 3KS7A 3LOBA 1HLCA 1DF0A 1W04A 1H1MA 4OUEA 1EYBA 1HN0A 5BPXA 5KHHA 4NIIA 3ZXGA 1IS3A 3VBSA 4IW3A 4LO7A 2JDNA 1SFNA 1WLCA 4PCRA 5FMOS 2P4EA 2VUAA 4Q4X2 4INDA 4D6SA 3VBRC 4A7YA 4PT6A 5A1LA 2HYKA 3MW3A 1W6PB 5JUVA 2WO2A 5G04L 4LR4A 4XABA 3U07A 4XBNA 3FLPA 4EROA 2JDMA 2I07B 4MGQA 2ORZA 5FY0A 5FLHA 2GMPA 1RUD1 2VZPA 3Q8EA 3IDBB 1SZBA 4Q4W2 2A3WA 3WQ7A 4GZ9A 3WQBA 1JZ2A 1G9AA 3FMGA 3VBFC 4LBMA 5GLVA 4PI2A 1ZNPA 1PGSA 3MEPA 4Y1XA 5BNOB 3WD5A 1TQ5A 2FDGA 2RJ2A 1HV0A 3OGRA 3N4MA 1REEA 4BISA 4JHTA 3OUJA 2XBO3 4NHKA 4XDOA 2X29A 1CAWA 2D97A 4HXCA 1I9RA 5LRRA 3I2GA 3GCWA 5HCBA 3A7QA 4K1ZA 4YVWB 4M0HA 1M4WA 3C2UA 2VMFA 2C5DA 5FY1A 5CISA 1JZ8A 3AFGA 3NNFA 5F39A 4LO6B 4Q1RA 4CP0A 5C5TA 2ZHLA 1ZZ7A 2VBPA 4QX3A 3C3VA 3JCIA 5FZ6A 5LASA 5JSRA 1S0FA 4XUOA 4CP9A 5HXVA 1UZVA 1ULCA 4NO4A 2BWCA 3AB0A 3JD73 4Q4V2 1YYNA 3MIHA 4Y5TA 2MEV3 3RZLA 1RUE2 2JD4A 3MLKA 2VOXA 1BBT2 1UYYA 2BP6A 2XLGA 1NAEA 3SMHA 3NO8A 4ASLA 3TRSB 4GJZA 3WSOA 1EV12 4D8MA 4RR3B 2ZPXA 3ILFA 4XETA 5BNQA 3EJKA 1J1TA 3SC7X 1F35A 2WNVC 3TYJA 3ZFGB 2TNFA 4BOWA 5CADA 1O3SA 2HWD1 5GM0A 1G9FA 2B46X 3CBNA 2P3YA 1VE0A 1UKRA 5FQ0B 1ENXA 2RJLA 1RUC2 1CIYA 1Z7S3 5FXXA 2VQTA 4CDUA 1N1SA 2W5FA 2XVLA 5I8TA 1W28A 1JOJA 5LEKA 1MQTA 1RUF2 5LCWL 3I2FA 2BBVA 3EQEA 2DURA 2DU1A 1T6BX 2VTXA 2W94A 4P9WA 5ABJC 2G9FA 1UNBA 2WJSA 3H50A 5C3SA 5IK8A 1H2NA 4JGYA 5JDBA 1TMF3 3EYPA 4IE7A 4MH0E 1EUUA 1G9DA 4XEZA 2VNGA 1NCRB 1HQNA 4XDQA 2Y6HA 3GJAA 1BJQA 4MO3M 4BCUA 2YBKA 2JDPA 4IEWA 4L0PA 2BYVE 3S0MA 1UYPA 1W8FA 4Z07A 1B09A 1RUD3 3HOBA 5T50A 5A3OA 2JICA 3KT7A 1AR92 3R4UA 4QPWA 5JWPA 4NN0A 2R061 2IC1A 2YV8A 2Q8DA 5GKAC 1ND2A 3I2KA 2W08A 4M3CF 3IZOA 2DVDA 3OUIA 4JHZA 1UX6A 3CO2A 5A3MA 5FMBA 3NV2A 5JXIA 1CAVA 4LLOA 3GJBA 1BK1A 3H3ZA 3VBHB 2FCUA 3ZFEA 5LB6A 1GR3A 2Q4SA 3IB3A 5DG1A 4DXSA 4BWOA 2RJKA 2ZHMA 2R0FA 3GF6A 5FZLA 5BNPB 3SKVA 4CEYA 4FPOB 3WW1A 3U78A 1HX6A 2HWC1 4KWUA 5FOJB 3IDEA 2JG8C 4Y24A 5JCTA 3U4XA 3WP4A 2WZR2 2JG9A 4HPKB 1OMIA 5JPNB 2G4IA 4A41A 5C71A 1RMU2 5C3RA 2GNBA 2WQ8A 3K46A 1JMUB 4NHYA 3WG4A 2AUYA 1BKZA 1F5JA 2WL1A 1H9PA 1V9U1 1SHWB 2BRTA 3R0RA 2PAMA 2BQPA 1V0AA 4EZHA 5GZCA 4B8EA 1UZZA 2JDUA 3HNBM 1QJU3 1U0AA 2B9VA 4Q4X1 4AI2A 3OBAA 1BQPA 4TXWA 2P34A 1JYXA 2CHHA 2KD7A 2WAAA 1NE6A 3DL3A 2W92A 2W52A 2Y0IA 2X53S 1U5YA 3KV4A 1DBNA 2R32A 2Q8CA 1DGLA 1WMEA 4BMEA 3W21A 3IDAA 2K0GA 3WP5A 3ASIA 5A7QA 4BDVB 2D98A 2IXKA 1JW6A 1UMZA 2UWAA 2WA3A 2XHKA 3V0AA 1ULGA 4JKMA 4E4SA 2BOJA 1RUG2 5E16A 4Q0UA 3VBSC 3GZAA 4BQYA 2EXHA 2Q5TA 5FBZA 1VBC1 3U37A 4P9GA 1C4RA 1CGPA 4GMP1 3MYXA 5FP4A 1WMDA 3MO4A 1IQDC 1NXMA 2YHJA 1FOD2 1PNFA 3QD6A 4L97A 4M3CA 5FY4A 1QDOA 4EN7B 1H30A 1DGWX 1R1A2 2E32A 2AYHA 2D6NA 5FP3A 4AG4A 2ZX2A 3F95A 5A7SA 1RUH3 5FV3A 2A3XA 3WEZA 4AI1A 1XE7A 2R7EB 4C90A 1YHFA 2R30A 2V09A 4YW7A 5FP7A 4H7MA 4ZU5A 3TNPB 4NROA 3ZXEA 1OLQA 3AL6A 4YZ4A 5C8CC 3VDAA 3P3NA 4KL1A 1WCUA 2LW8A 2WINB 1C5IA 1LGBA 2LM3A 2P3JA 4DNYA 1UZ0A 3KWVA 3IMMA 1PGW1 2WWSA 3NAPC 4FI9A 1NQDA 1QNYA 1RUJ2 5JLVA 5KXDA 3B02A 4CDXA 1UN1A 1NZIA 4ZZ5A 3VBOC 5F3CA 1SCRA 1W2TA 2A6VA 1I5ZA 3N9NA 2X5IB 1WA4A 4W50A 1EV11 2SBAA 3H0OA 3DN7A 3MBWA 4OVEA 1C3HA 3TEWA 2A6YA 2WYFA 1S0CA 2V73A 4N7IA 1YCIA 3PU3A 3WG3A 3TWIA 3NMBA 4EV0A 3AKPA 3AMQA 1UO9A 3RG0A 4MVTA 2NYYA 3VV1A 4R9BA 3NNLA 3WT3A 1CJPA 4YGBA 3ZN4A 1JU4A 1Y7BA 4R4XA 4WM8A 2X8KA 3E6BA 4RD7A 4YFWA 1IOAA 1KDMA 1PO11 1KEXA 1EAH2 3Q8CA 4N43A 5CFCA 2HWE2 2CDPA 4MGZE 1V9U3 1RUF1 3WNKA 4HL0A 4BXSV 1SLBA 2BNOA 3OY8A 4QB6A 1QXPA 2GH2A 4D7SA 3RNSA 2Y33A 5FRAA 2AGSA 3IWZA 2JE7A 3PU8A 4HN1A 4XFBA 3KQRA 3ZXLA 4JGZB 5BXXA 4Q4X3 1HJFA 3SEEA 4FAGA 2WR9A 3DCQA 1OOPC 5FZDA 5GZEA 5FZ7A 1QJX2 3USUB 4E8CA 3AM2A 1W0OA 2JB8A 1AYM2 3ETPA 1W8TA 4IE0A 3H9AA 4JDNA 4D94A 4LXLA 5KHIA 1S0IA 1S0DA 4XE9A 1V6IA 1AXZA 3AZXA 3NVCA 2ZJCA 3DYPA 1VBE2 5F32A 1PVC2 2NPIA 4BA6A 4BQ3A 2ZBJA 3WNMA 5FJKA 1YJLA 5I0DA 1A34A 4P08A 4CDUC 4KWJA 4Q4W3 1AR91 1DQ5A 2VTXJ 1MQTC 3SH4A 1X9PA 3PTYA 1ULEA 1PX3A 1X8MA 2DUQA 2GP3A 4WV8A 5CAZA 1F8VA 1D4M1 4ASKA 3QLQA 4V2VA 1FYUA 4GMP3 4JGYC 2P3IA 4NAOA 4R8HA 2QCSB 3WZ1A 2R6QA 4IV1A 1UWWA 1DLCA 3SLIA 3ZXJA 3MW2A 2VMCA 1AYN2 1JI6A 2AZ5A 2D3SA 3B93A 4CCDA 1HXS1 4Y5Z0 5ERLA 1G6NA 5DAPA 3RZJA 5A7NA 4NRMA 2JXAA 1ND3C 3OOXA 1MS0A 5IWFA 4IDZA 1RC6A 2ILMA 3KB5A 4AI3A 3GNEA 1VB2A 3BI3A 2WZR1 1ND2C 3N9PA 3N7LA 2DUOA 5JXJA 2TBVA 5IK7A 1RMU1 2FCTA 2P2KA 1MEC2 3HN3A 4IE4A 4QU1A 4AI0A 4CDWA 2IXCA 3RJRA 4ZXEA 2XJQA 4OUSA 3VN4A 3AP5A 1VJ2A 4Q4V3 3M3IA 3EB7A 1WLDA 2CSGA 1O59A 1RUE3 1GNHA 1ST8A 1YQ2A 4BLJA 4EN0A 1BBT3 3VGIA 3WQ1A 1ULDA 4CEYC 4OULA 1NG0A 3WVJA 1GP5A 1REDA 5A1FA 1OF4A 2RS51 1EV13 3LAGA 4FP2A 5DUVA 3HT2A 2OQ7A 1LEDA 3ON7A 4QWNA 4AQSA 1IZ3A 1ASJ1 2C9AA 1YFXA 3DXUA 3Q8FA 2AACA 1OKOA 1V6NA 3ETQA 4NJ4A 3TEXA 3ZYPA 5JPMB 4UF0B 3OEBA 4LTAA 4XIKA 5L9RA 3L9JT 5KXCA 4YZ2A 1YIFA 5J37A 1CAXA 1RUC3 2ID4A 3SHRA 4EWDA 3APBA 5EFUA 4HG6B 2MNGA 3AP7A 3PJYA 3R05A 4AQTA 3FFQA 1RUF3 4WM7B 4AI8A 1FV3A 4U2AA 4CEWB 2W1WA 4YVSB 1Q56A 5ISLA 2E9QA 1FOD1 1OLMA 3IAQA 4I02A 3RSJA 3S6PA 3KHBA 4KG0A 5DMYA 1VMHA 4QPGA 4LUKA 2NN8A 3PVBB 4QKBA 2P37A 4FSJA 1LEMA 2GC0A 3TN92 4ASMB 4PIZA 4RQPC 5FYSA 2ZGTA 4GH4B 4JX0A 4COWA 4OHYA 4IEVA 4CSWA 5GJ6A 3OUHA 2XLFA 4K8FA 4DFSA 1WUVA 2DV9A 1CAUB 3ES1A 3OYWB 4B7KA 3H8RA 1QKQA 2K9ZA 4XFCA 1AR93 1GU3A 1LOFC 5F9TA 1GSLA 3QOPA 2A7AA 3BIEA 1OUSA 4K9SA 3IIIA 4LMFA 3H1MA 2R072 4EN6B 4XPVA 4UWDA 5EHDA 1D2SA 3LPFA 3KD4A 3RZGA 5FCCA 2XJPA 1RUJ1 2BFUL 2JKBA 2X10A 3JBG2 2YPDA 5F7UA 2XKOA 3FHAA 1WMXA 2CWSA 5I8SA 2DCKA 3ZSJA 4LLFA 4QQ2A 4AEKA 3O1RA 4M01A 1W3VA 5EJ1B 1NOVA 1QMJA 2QUOA 1CZVA 1DHKB 1GNYA 3W59A 5F6LB 2VMEA 1NLRA 1PZ7A 3HN1A 3RYPA 3ZYBA 5IVCA 1VR3A 4CCNA 5FXZA 1HN1A 3LGRA 4RS5C 5LBCA
chains in the Genus database with same CATH topology
2Y6LA 4LKSA 1K42A 2E26A 3BGAA 1UMHA 1GOHA 5JXGA 1PMHX 3I2IA 1W99A 4CUAA 1JYNA 2W95A 1NUKA 3VDBA 2YC2A 4JKKA 5B4XA 2DDUA 3GDBA 4BJ0A 1OH4A 1TG7A 3AC0A 3T0DA 4DEVA 3DYOA 3HNYM 2J1VA 3WF1A 4A44A 1W8OA 3WF0A 2VZUA 1ULPA 5IFPA 4W4ZA 2QQOA 3CKHA 1H6XA 2YC4A 2CDOA 2VO5A 3T0BA 2RVAA 4OZOA 5IYYA 2J7MA 3MV11 1UY2A 4KI5M 4W8JA 2YFUA 3CIHA 2B4KA 4PF1A 2VZTA 3P1IA 5LA2A 1W9WA 2YG0A 1F4HA 3MUZ1 1GOFA 5EIYB 3HNMA 4BK5A 2OKXA 3THCA 1JYWA 2QQMA 4XUPA 1R64A 3VD3A 3CZUA 2JD9A 4GWJA 2WO3A 4TTGA 4QB2A 2BGPA 3WNLA 2W1QA 1W0NA 3CDZB 5IHRA 2C26A 4OUEA 4AAXA 2J1EA 4CUCA 2YFZA 2BGOA 4PT6A 5LA1A 4DUVA 3OB8A 5JUVA 2WO2A 2J1SA 5G04L 2VCAA 1JZ7A 4MGQA 2ORZA 3E1F1 3T08A 1UY0A 2QBXA 2VZPA 2VZSA 2WUHA 4P00B 1JZ2A 4GZ9A 2ZEYA 3WQBA 1CZSA 5IFTA 3OG2A 3PUHA 2JDAA 1LNSA 2RJ2A 3K75B 3MUY1 3OGRA 1JU3A 2V5DA 1JYVA 4CU7A 4D0QA 2XONA 2VZ1A 3I2GA 3UESA 3A7QA 1K45A 3W5NA 2VMFA 5IJRA 1JZ8A 3GGLA 3WNPA 2QQJA 4QX3A 2DCJA 3FHQA 4A4AA 3GM8A 4UOJA 4XUOA 1CZTA 1EUTA 3FN9A 2WBKA 2WDBA 5LA0A 1UYYA 3WF2A 4CU9A 1NAEA 4RN5A 2Y6JA 4XURA 5B4NA 3VD4A 2VZRA 4XZUG 3WSOA 3T0AA 4E8DA 1L7QA 4P02B 4D8MA 4DXTA 4MOAA 3I3EA 1MPXA 3C7GA 1W8NA 4M4PA 2JE8A 5DPNA 3A22A 4M4RA 4MGSA 1CIYA 4LHSA 3VDCA 3OEAA 2VQTA 3K77A 2W5FA 2VZOA 1JZ4A 5LCWL 3I2FA 2W91A 2VZ3A 2W94A 2WO1A 5CZKA 1JZ6A 1L7RA 3EYPA 1EUUA 3HEIA 5DQ0A 1XPWA 2V72A 2Y6HA 2WN2A 4MO3M 2BBAA 4L0PA 5CYYA 3FL7A 4OYUA 3HOBA 2EIEA 3P6BA 4GWIA 2ZEZA 4QPWA 2RV9A 3T2OA 1K3IA 4IUGA 3CZJA 3I2KA 2XHNA 1WKYA 2WYSA 4JHZA 3VD5A 1SDDB 1W9TA 1UY4A 2BERA 5JXIA 4YPJA 3K4AA 4DEQA 3IB3A 4DXSA 2XOMA 2QQKA 4XUQA 4XUNA 2EIBA 1T2XA 4LQRA 3SKVA 2ORXA 1UYZA 3WNOA 1XC6A 1P8JA 4LPLA 4KWUA 1H6YA 4QDQA 3C7OA 3HPNA 3MV01 4A41A 3A21A 5C71A 1US3A 2WQ8A 3K46A 1OF3A 3A23A 1NX9A 3LEGA 2Z4FA 2QQIA 4MADA 1UY3A 1JHJA 2JKXA 5HXMA 1SHWB 4DUWA 3HNBM 1CX1A 2VMDA 2B9VA 3SEPA 3OBAA 4TXWA 1JYXA 2KD7A 2WAAA 2VM9A 3K4DA 2W92A 5FUIA 3I2JA 3IDAA 2VZVA 4QB1A 3HJRA 2ZEWA 4BDVB 2YB7A 4DUXA 1XNAA 3C8XA 2HYXA 4JKMA 4UAPA 1D7PM 4ET7A 5EJZB 3U37A 1UY1A 2WABA 2EIDA 3MO4A 4XVHA 1IQDC 3SKJE 3I97A 4DXRA 4QX2A 2E32A 3ACIA 4AG4A 2ZEXA 2VTFA 4CVUA 2QQNA 2ZXQA 5C7GA 3WF4A 1ULOA 3WEZA 1O8SA 2R7EB 2J1RA 4UI9L 2BZDA 3VDAA 2LW8A 1UZ0A 4KMQA 4FI9A 1W9SA 2VR4A 4ZZ5A 5A1AA 3J7HA 2L9LA 3T2PA 4ARYA 4W50A 1DYOA 3MBWA 3F2ZA 4XUTA 4A3ZA 2E33A 3ABZA 4BK4A 3I2HA 2X09A 5HPOA 4A42A 3C7FA 3ACFA 1JU4A 5DN2A 2VC9A 2W46A 1KEXA 3C7EA 3IAPA 4CU6A 2CDPA 4BXSV 3WNKA 1DP0A 4ZY9A 4QB6A 4QDRA 2QQLA 3SEEA 3LEIA 5JXHA 4JKLA 4E8CA 1O8PA 3C7HA 3ETPA 1PMJX 1KGYA 2V4VA 1GMMA 3DYPA 4QAWA 2X05A 3WNMA 1J84A 5I0DA 3I3BA 4P08A 2VZQA 3UNPA 1PX3A 3NNGA 5J1XA 3CQOA 1F4AA 1UXZA 3BN6A 4A6OA 2C9KA 2W1UA 1UWWA 1TVGA 1DLCA 1SG3A 3NJXA 3NRUA 2W3JA 3DYMA 1BHGA 1UX7A 2VMCA 4ZZ8A 3THDA 1JI6A 5JR2A 2VOTA 2J22A 4OMDA 1WCQA 2VCCA 3K4ZA 2W1SA 2VCBA 5JXJA 1RYYA 3PUIA 3HN3A 5JMOA 4QX1A 4RYDA 4ZXEA 2J1UA 2C4XA 3EB7A 1O59A 1YQ2A 1OT5A 1OD3A 2Y64A 1I5PA 1US2A 1NKGA 2EICA 2J1AA 1GQPA 1JZ5A 2PQSA 1OF4A 4PQQA 3ZM8A 1UYXA 3D3AA 2W87A 3NQHA 1J83A 2WZ8A 3WNNA 3VD9A 1JZ3A 2VJXA 2XQXA 3WF3A 3T09A 2J1TA 3LQCA 3OEBA 3GXUA 3NJVA 5C70A 2ID4A 2VL4A 3DECA 1XNTA 4HG6B 3OGVA 4QDSA 3ECQA 3LE0A 4ARXA 4P5YA 2W1WA 2W9XA 2Y6KA 3IAQA 5DMYA 2WAOA 5G05L 2WZEA 1K12A 1UMIA 4QX0A 2Y8KA 3T2QA 4JX0A 3OGSA 1GUIA 1GOGA 3ACHA 3ACGA 3W5MA 1GU3A 3I3DA 2HLEA 1PX4A 3IIIA 2VQUA 3LPGA 2LS6A 3LPFA 4A45A 2X10A 5F7UA 3FHAA 3UETA 2DCKA 2E31A 3JXSA 5EJ1B 2W47A 1CZVA 4OMCA 1GNYA 1UXXX 2VMEA 3VD7A 2WN3A 4Z2AA 3CMGA 4CU8A 1HN1A 3LEKA 4CUBA 2Y6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y6L A;  4LKS A;  1K42 A;  2E26 A;  3BGA A;  1UMH A;  1GOH A;  5JXG A;  1PMH X;  3I2I A;  1W99 A;  4CUA A;  1JYN A;  2W95 A;  1NUK A;  3VDB A;  2YC2 A;  4JKK A;  5B4X A;  2DDU A;  3GDB A;  4BJ0 A;  1OH4 A;  1TG7 A;  3AC0 A;  3T0D A;  4DEV A;  3DYO A;  3HNY M;  2J1V A;  3WF1 A;  4A44 A;  1W8O A;  3WF0 A;  2VZU A;  1ULP A;  5IFP A;  4W4Z A;  2QQO A;  3CKH A;  1H6X A;  2YC4 A;  2CDO A;  2VO5 A;  3T0B A;  2RVA A;  4OZO A;  5IYY A;  2J7M A;  3MV1 1;  1UY2 A;  4KI5 M;  4W8J A;  2YFU A;  3CIH A;  2B4K A;  4PF1 A;  2VZT A;  3P1I A;  5LA2 A;  1W9W A;  2YG0 A;  1F4H A;  3MUZ 1;  1GOF A;  5EIY B;  3HNM A;  4BK5 A;  2OKX A;  3THC A;  1JYW A;  2QQM A;  4XUP A;  1R64 A;  3VD3 A;  3CZU A;  2JD9 A;  4GWJ A;  2WO3 A;  4TTG A;  4QB2 A;  2BGP A;  3WNL A;  2W1Q A;  1W0N A;  3CDZ B;  5IHR A;  2C26 A;  4OUE A;  4AAX A;  2J1E A;  4CUC A;  2YFZ A;  2BGO A;  4PT6 A;  5LA1 A;  4DUV A;  3OB8 A;  5JUV A;  2WO2 A;  2J1S A;  5G04 L;  2VCA A;  1JZ7 A;  4MGQ A;  2ORZ A;  3E1F 1;  3T08 A;  1UY0 A;  2QBX A;  2VZP A;  2VZS A;  2WUH A;  4P00 B;  1JZ2 A;  4GZ9 A;  2ZEY A;  3WQB A;  1CZS A;  5IFT A;  3OG2 A;  3PUH A;  2JDA A;  1LNS A;  2RJ2 A;  3K75 B;  3MUY 1;  3OGR A;  1JU3 A;  2V5D A;  1JYV A;  4CU7 A;  4D0Q A;  2XON A;  2VZ1 A;  3I2G A;  3UES A;  3A7Q A;  1K45 A;  3W5N A;  2VMF A;  5IJR A;  1JZ8 A;  3GGL A;  3WNP A;  2QQJ A;  4QX3 A;  2DCJ A;  3FHQ A;  4A4A A;  3GM8 A;  4UOJ A;  4XUO A;  1CZT A;  1EUT A;  3FN9 A;  2WBK A;  2WDB A;  5LA0 A;  1UYY A;  3WF2 A;  4CU9 A;  1NAE A;  4RN5 A;  2Y6J A;  4XUR A;  5B4N A;  3VD4 A;  2VZR A;  4XZU G;  3WSO A;  3T0A A;  4E8D A;  1L7Q A;  4P02 B;  4D8M A;  4DXT A;  4MOA A;  3I3E A;  1MPX A;  3C7G A;  1W8N A;  4M4P A;  2JE8 A;  5DPN A;  3A22 A;  4M4R A;  4MGS A;  1CIY A;  4LHS A;  3VDC A;  3OEA A;  2VQT A;  3K77 A;  2W5F A;  2VZO A;  1JZ4 A;  5LCW L;  3I2F A;  2W91 A;  2VZ3 A;  2W94 A;  2WO1 A;  5CZK A;  1JZ6 A;  1L7R A;  3EYP A;  1EUU A;  3HEI A;  5DQ0 A;  1XPW A;  2V72 A;  2Y6H A;  2WN2 A;  4MO3 M;  2BBA A;  4L0P A;  5CYY A;  3FL7 A;  4OYU A;  3HOB A;  2EIE A;  3P6B A;  4GWI A;  2ZEZ A;  4QPW A;  2RV9 A;  3T2O A;  1K3I A;  4IUG A;  3CZJ A;  3I2K A;  2XHN A;  1WKY A;  2WYS A;  4JHZ A;  3VD5 A;  1SDD B;  1W9T A;  1UY4 A;  2BER A;  5JXI A;  4YPJ A;  3K4A A;  4DEQ A;  3IB3 A;  4DXS A;  2XOM A;  2QQK A;  4XUQ A;  4XUN A;  2EIB A;  1T2X A;  4LQR A;  3SKV A;  2ORX A;  1UYZ A;  3WNO A;  1XC6 A;  1P8J A;  4LPL A;  4KWU A;  1H6Y A;  4QDQ A;  3C7O A;  3HPN A;  3MV0 1;  4A41 A;  3A21 A;  5C71 A;  1US3 A;  2WQ8 A;  3K46 A;  1OF3 A;  3A23 A;  1NX9 A;  3LEG A;  2Z4F A;  2QQI A;  4MAD A;  1UY3 A;  1JHJ A;  2JKX A;  5HXM A;  1SHW B;  4DUW A;  3HNB M;  1CX1 A;  2VMD A;  2B9V A;  3SEP A;  3OBA A;  4TXW A;  1JYX A;  2KD7 A;  2WAA A;  2VM9 A;  3K4D A;  2W92 A;  5FUI A;  3I2J A;  3IDA A;  2VZV A;  4QB1 A;  3HJR A;  2ZEW A;  4BDV B;  2YB7 A;  4DUX A;  1XNA A;  3C8X A;  2HYX A;  4JKM A;  4UAP A;  1D7P M;  4ET7 A;  5EJZ B;  3U37 A;  1UY1 A;  2WAB A;  2EID A;  3MO4 A;  4XVH A;  1IQD C;  3SKJ E;  3I97 A;  4DXR A;  4QX2 A;  2E32 A;  3ACI A;  4AG4 A;  2ZEX A;  2VTF A;  4CVU A;  2QQN A;  2ZXQ A;  5C7G A;  3WF4 A;  1ULO A;  3WEZ A;  1O8S A;  2R7E B;  2J1R A;  4UI9 L;  2BZD A;  3VDA A;  2LW8 A;  1UZ0 A;  4KMQ A;  4FI9 A;  1W9S A;  2VR4 A;  4ZZ5 A;  5A1A A;  3J7H A;  2L9L A;  3T2P A;  4ARY A;  4W50 A;  1DYO A;  3MBW A;  3F2Z A;  4XUT A;  4A3Z A;  2E33 A;  3ABZ A;  4BK4 A;  3I2H A;  2X09 A;  5HPO A;  4A42 A;  3C7F A;  3ACF A;  1JU4 A;  5DN2 A;  2VC9 A;  2W46 A;  1KEX A;  3C7E A;  3IAP A;  4CU6 A;  2CDP A;  4BXS V;  3WNK A;  1DP0 A;  4ZY9 A;  4QB6 A;  4QDR A;  2QQL A;  3SEE A;  3LEI A;  5JXH A;  4JKL A;  4E8C A;  1O8P A;  3C7H A;  3ETP A;  1PMJ X;  1KGY A;  2V4V A;  1GMM A;  3DYP A;  4QAW A;  2X05 A;  3WNM A;  1J84 A;  5I0D A;  3I3B A;  4P08 A;  2VZQ A;  3UNP A;  1PX3 A;  3NNG A;  5J1X A;  3CQO A;  1F4A A;  1UXZ A;  3BN6 A;  4A6O A;  2C9K A;  2W1U A;  1UWW A;  1TVG A;  1DLC A;  1SG3 A;  3NJX A;  3NRU A;  2W3J A;  3DYM A;  1BHG A;  1UX7 A;  2VMC A;  4ZZ8 A;  3THD A;  1JI6 A;  5JR2 A;  2VOT A;  2J22 A;  4OMD A;  1WCQ A;  2VCC A;  3K4Z A;  2W1S A;  2VCB A;  5JXJ A;  1RYY A;  3PUI A;  3HN3 A;  5JMO A;  4QX1 A;  4RYD A;  4ZXE A;  2J1U A;  2C4X A;  3EB7 A;  1O59 A;  1YQ2 A;  1OT5 A;  1OD3 A;  2Y64 A;  1I5P A;  1US2 A;  1NKG A;  2EIC A;  2J1A A;  1GQP A;  1JZ5 A;  2PQS A;  1OF4 A;  4PQQ A;  3ZM8 A;  1UYX A;  3D3A A;  2W87 A;  3NQH A;  1J83 A;  2WZ8 A;  3WNN A;  3VD9 A;  1JZ3 A;  2VJX A;  2XQX A;  3WF3 A;  3T09 A;  2J1T A;  3LQC A;  3OEB A;  3GXU A;  3NJV A;  5C70 A;  2ID4 A;  2VL4 A;  3DEC A;  1XNT A;  4HG6 B;  3OGV A;  4QDS A;  3ECQ A;  3LE0 A;  4ARX A;  4P5Y A;  2W1W A;  2W9X A;  2Y6K A;  3IAQ A;  5DMY A;  2WAO A;  5G05 L;  2WZE A;  1K12 A;  1UMI A;  4QX0 A;  2Y8K A;  3T2Q A;  4JX0 A;  3OGS A;  1GUI A;  1GOG A;  3ACH A;  3ACG A;  3W5M A;  1GU3 A;  3I3D A;  2HLE A;  1PX4 A;  3III A;  2VQU A;  3LPG A;  2LS6 A;  3LPF A;  4A45 A;  2X10 A;  5F7U A;  3FHA A;  3UET A;  2DCK A;  2E31 A;  3JXS A;  5EJ1 B;  2W47 A;  1CZV A;  4OMC A;  1GNY A;  1UXX X;  2VME A;  3VD7 A;  2WN3 A;  4Z2A A;  3CMG A;  4CU8 A;  1HN1 A;  3LEK A;  4CUB A;  2Y6G A; 
#chains in the Genus database with same CATH topology
 2Y6L A;  2ARC A;  2WZR 3;  4G3Y C;  4NHM A;  3GBG A;  3VKL A;  5AFB A;  2JDZ A;  1RMU 3;  3VDD B;  5K0U C;  4YSF A;  5CKN A;  5IVF A;  4B7E A;  3DGT A;  1EAH 1;  1MS4 A;  2VW1 A;  5LK5 A;  3I2I A;  5FZ8 A;  3ZSK A;  1ZA7 A;  1JYN A;  2HWE 1;  2W95 A;  4IGP A;  1LOC A;  3UKN A;  1NUK A;  5SV8 A;  5A6Q A;  5FPU A;  4Q0V A;  1NZC A;  3DPR A;  3S5Q A;  5AVA A;  5FWJ A;  3GDB A;  1LGC A;  1QJZ A;  1WGP A;  1OH4 A;  1TG7 A;  1S0G A;  1Q8O A;  1Y9G A;  4RFT 0;  4BJ0 A;  5LAT A;  3FZ3 A;  5FZB A;  3DYO A;  1M06 G;  3HNY M;  4CCM A;  3LFM A;  5J98 B;  5J09 A;  1QJX 1;  4J25 A;  3T4H B;  3J26 N;  2RS3 1;  1QQP 2;  4BQW A;  1VBA 2;  2BNN A;  5BNN B;  2D40 A;  4E2S A;  5EXO A;  3EMR A;  2CGP A;  2CDO A;  4QXC A;  5KWR A;  4WM8 C;  2VG9 A;  4OZO A;  4WVM B;  5IYY A;  4OHZ A;  5J96 B;  5JSP A;  1KFU L;  3O5S A;  4FFH A;  4FOW A;  4O61 A;  3SXW A;  3K51 A;  1UY2 A;  2F17 A;  4YM3 A;  3HQU A;  2YFU A;  2G9Z A;  4PF1 A;  1AX0 A;  1RUG 3;  2GAU A;  5FPZ A;  4BPZ A;  1DG6 A;  2HEV F;  4HMZ A;  4X6Q B;  2RMU 2;  3P1I A;  3VBU B;  4HT1 T;  2JWP A;  3ELN A;  1W9W A;  4RGK A;  1OSG A;  4LIV A;  1F4H A;  4A2U A;  2JDH A;  3POY A;  1GOF A;  1VMJ A;  5EIY B;  4X8N A;  2KR2 A;  1H0B A;  1FOD 3;  5D8A B;  5FO9 B;  4BK5 A;  5KC5 A;  3VZL A;  1PGL 2;  4LKE A;  1R1A 3;  1AYN 1;  3D0J A;  2YU2 A;  2XUM A;  3PME A;  2JD9 A;  3LIG A;  5FYB A;  5C8W A;  2Y60 A;  3KV9 A;  3RQ0 A;  3AZZ A;  4JZR A;  1VAV A;  3WNL A;  4R9A A;  1V6M A;  3ZOI A;  1G7Y A;  1X9T A;  2KM2 A;  2XL7 A;  1LOD A;  2ZTN A;  4PLM A;  4Y4Y A;  3AKS A;  3CDZ B;  4H7L A;  4QPI B;  1MEC 1;  2C26 A;  2ARB A;  2GC3 A;  2J1E A;  4AGG A;  3VKM A;  3ZXK A;  2YFZ A;  2EA7 A;  2BGO A;  4IV1 C;  4MET A;  1X50 A;  2VOV A;  4NUB A;  4GWM A;  4FXG B;  4JQR A;  5LA1 A;  1ZM1 A;  1RUJ 3;  3N7K A;  3CJI B;  1FT9 A;  3T1L A;  4DUV A;  4Q0P A;  3PUA A;  4AOC A;  1E5S A;  3P5B A;  3MIG A;  5BYN A;  3AKQ A;  1HRV 2;  1EPZ A;  1H1A A;  1JZ7 A;  5FKC A;  1XQN A;  1QU0 A;  2EIG A;  3E1F 1;  4I01 A;  4QHB A;  2QBX A;  3H3L A;  4IV3 B;  1U5X A;  5FLI A;  2FDF A;  4S2H A;  1W6M B;  3NST A;  4C1X A;  1AL0 G;  4AED C;  1N1T A;  2VH9 A;  2YDE A;  2ZEY A;  4ISR A;  5FY9 A;  4D69 A;  1NE4 A;  2BEO A;  3T2T A;  3BU0 A;  2WS9 1;  4QPY A;  3PIJ A;  3K75 B;  2RG4 A;  4HK8 A;  4Y22 A;  1AL2 1;  1DQ2 A;  3D82 A;  4CU7 A;  1LHO A;  1EAH 3;  2XON A;  2VUD A;  4K8R B;  1GWM A;  2HWE 3;  3I54 A;  5A32 B;  1J59 A;  4IE6 A;  3N36 A;  5AC9 2;  4EN8 B;  3J8F 2;  1W6O A;  1HV1 A;  1OBN A;  3I59 B;  3WHU A;  5FYZ A;  1ZRI A;  4EZ4 A;  5IJR A;  4DS0 A;  2WNV A;  5IUQ A;  3GGL A;  4OI4 A;  3WNP A;  2JDY A;  2QQJ A;  1XOY A;  1QJX 3;  3AYD A;  2YRO A;  3MID A;  3ZPO A;  4GJY A;  1AYM 3;  5DUW A;  3E5X A;  5E6H A;  2CAV A;  2RS3 3;  3E5U A;  3FHQ A;  3OSD A;  4N9H A;  3TN9 1;  4A4A A;  1GZW A;  5LBB A;  4HVO A;  2JB4 A;  1CZT A;  1VBE 3;  4XXA A;  3MLL A;  1ALY A;  1PVC 3;  1RL3 A;  4N90 A;  3VL9 A;  1BYH A;  5ABJ A;  4A3X A;  1OKQ A;  3WNX A;  1Q8S A;  4CU9 A;  1S2K A;  2QNK A;  4NPL A;  4LNV A;  3VZO A;  2Y6J A;  3QCW A;  5B4N A;  2XUE A;  5A7W B;  2PHT A;  2Y6F A;  5FZ0 A;  5LY1 A;  3L2H A;  4MV2 A;  4QPG C;  1Y9M A;  1W2U A;  2HWD 2;  3A0K A;  3JBG 1;  3R6S A;  4P02 B;  4URA A;  2OII A;  4FOV A;  4Y20 B;  3BOW A;  1GZC A;  1OLR A;  3I3E A;  1MPX A;  3C7G A;  1SPP B;  1UZW A;  5DAV A;  1AYN 3;  3BTA A;  4K20 A;  4XJ8 A;  5DPN A;  2Z79 A;  3VBR B;  2GNM A;  2PHW A;  3AMP A;  1FPN 2;  5C5U A;  5C9A B;  3I4I A;  3CJX A;  4MGS A;  4A7K A;  2XWB B;  1O3T A;  4OI0 A;  3VDC A;  4FPJ A;  4QKD A;  2VZO A;  2ZGR A;  1CPM A;  2MHF A;  1HW5 A;  1MEC 3;  1WZX A;  4KWL A;  2ZML A;  2VU9 A;  3AXE A;  1F5F A;  4TN7 A;  5FMO L;  3AZY A;  5CZK A;  3RMX A;  3VBF B;  2XJT A;  3ZYR A;  1RIT A;  1A8M A;  1L7R A;  3OJB A;  4RL7 A;  3ES4 A;  4FFI A;  3VHR A;  4BXF A;  4EWE A;  1YRZ A;  3ILN A;  2D3P A;  1UAI A;  1YJK A;  1CES A;  1N47 A;  1Y43 B;  3MIF A;  5FYT A;  2JG8 A;  2R06 2;  2WN2 A;  2PQQ A;  2GU9 A;  3MFC A;  4CCE A;  2BBA A;  4XC9 A;  3O12 A;  1UPI A;  4L99 A;  4WZC A;  3INA A;  3RFR A;  1UOF A;  4MSV A;  2XPJ A;  4OCT A;  4SBV A;  4CDQ C;  3B9I A;  5FYI A;  1QQP 1;  3P6B A;  4I09 A;  1VBA 1;  4XF9 A;  2RV9 A;  4Q4Y 2;  3UKT A;  2A6Z A;  2B39 A;  4E2G A;  2RR1 2;  1WBL A;  1PK6 C;  2CU5 A;  4H55 A;  4PLN A;  5A33 B;  3WP6 A;  1KXG A;  1OUX A;  2VVD A;  1BZW A;  1QJF A;  2WYS A;  3IM0 A;  5A3U A;  4JTN A;  3SCF A;  1UY4 A;  2BDR A;  2BER A;  5CBL A;  4TLF A;  3WHT A;  4DB5 A;  4HLT A;  5DZG A;  2HWC 2;  3GBW A;  4XIO A;  1C57 A;  1FAY A;  3K4A A;  1HRI 2;  2RMU 1;  2XOM A;  3WX5 A;  1W6Q B;  3POS A;  1VAM A;  3GZU C;  5C4W A;  4XUN A;  4PI0 A;  2ZMK A;  2FDK A;  2HBT A;  1T2X A;  3LA7 A;  4GB3 2;  1UYZ A;  2XXZ A;  1H1I A;  1YFU A;  1Q43 A;  3TEZ A;  2G19 A;  5FPL A;  1PGL 1;  1QY4 A;  2ZGN A;  3C7O A;  4UW3 A;  4BHP A;  1V9U 2;  1DZT A;  4UXA A;  4DY3 A;  4Q2F A;  2DVA A;  2OPW A;  3MV0 1;  1RB8 G;  4YW3 A;  2G1M A;  3TN9 3;  4XF1 A;  1VIW B;  4ZPI A;  3KM5 A;  5FBJ A;  1OF3 A;  2IFR A;  3ZMO A;  3ZN6 B;  1R09 1;  5A7O A;  5L36 A;  5LZ6 A;  4FO9 A;  4GXL A;  2UY8 A;  4QQL A;  1W6O B;  3VUO A;  2NLR A;  5HXM A;  2JKX A;  5FUP A;  5FR3 A;  3K3O A;  4AFM A;  3LZZ A;  5L7O A;  5FZF A;  2VOK A;  3U4S A;  1LOA A;  2FBE A;  1DFQ A;  1NCQ B;  2ZGQ A;  3AZW A;  1DCS A;  4WBB A;  5FYU A;  1MS8 A;  3SQO A;  2R07 3;  3VKO A;  5JOZ A;  1CX1 A;  2P6H A;  4NR1 A;  5LBF A;  4BZ4 A;  3ZFF C;  2Z42 A;  1X8E A;  1URX A;  1C8M 1;  4LO4 B;  4UT5 A;  1W39 A;  4XZP A;  3JBG 3;  4EWA A;  1VRH 2;  2WSV A;  1BEV 2;  4FPG A;  4KU8 A;  5KHG A;  1POV 0;  2E63 A;  1HRV 1;  1W6N B;  4CPB A;  3BTY A;  3I2J A;  4MXW A;  2UY9 A;  2YY1 A;  2VZV A;  4F7Z A;  1VBC 2;  2ZEW A;  3PDQ A;  2YB7 A;  4DUX A;  1LUL A;  5C8C A;  2WLQ A;  2GZW A;  1JXN A;  3C8X A;  3K3N A;  4IEY A;  2CNA A;  3MGU A;  4ET7 A;  3ILR A;  4H14 A;  3NAP A;  2QZ3 A;  5EJZ B;  3LIH A;  2GH8 A;  3HQX A;  4N53 B;  3VBO A;  3BKZ A;  3HBK A;  1LHU A;  4G9S B;  3SKJ E;  1PIV 2;  3AMM A;  4HN0 A;  3ZDS A;  1WBF A;  3JQX A;  4AEJ A;  3LKJ A;  3A4U A;  4XJU A;  5AC9 1;  2ZGU A;  3J8F 1;  3R4D B;  1OFN A;  2PLV 1;  2ZXQ A;  1DYK A;  3WF4 A;  1ULO A;  2D7F A;  4QD2 A;  4UFM A;  1CR7 A;  2CGN A;  2WWU A;  5ACA 1;  2B7Y A;  4FOQ A;  3NWK A;  3ZKY A;  1PGW 2;  1UZY A;  1QQP 3;  4UI9 L;  5D1I A;  1VBA 3;  4GUL A;  5F5Q A;  1NA1 B;  4ATE A;  3OGJ A;  4LBQ A;  2ZGO A;  4RHV 2;  2NP0 A;  1MS5 A;  3WDU A;  1PZ8 A;  2EVX A;  1GZT A;  1QHD A;  2ZHK A;  4FT8 A;  3WP3 A;  1W9S A;  1ZRD A;  4J6G A;  3B01 A;  2RHP A;  2RS1 2;  2PXJ A;  1OOP A;  2YBP A;  5HCH A;  2PYT A;  3NV4 A;  4ARY A;  3ATG A;  2RMU 3;  2WNU C;  4HSL A;  4LK7 A;  2P6C A;  2PHL A;  4I0W B;  3HVD A;  4A3Z A;  1PO1 2;  4FCA A;  2E33 A;  4XJ9 A;  3ZYI B;  3V0B A;  5GLU A;  5CKQ A;  3BPZ A;  4YM1 A;  3ALQ A;  5FMC A;  1UD1 A;  4A42 A;  5DN2 A;  3ACF A;  5HV0 A;  1DQ0 A;  1FPN 1;  1PNG A;  3FE5 A;  5CEH A;  2ADE A;  2W46 A;  5JOW A;  1NT0 A;  1QWR A;  2C24 A;  2WFF 2;  3ENR A;  5A6Y A;  3B00 A;  4XAE A;  2EF6 A;  5F1R A;  3IAP A;  1LHW A;  5DG2 A;  3THP A;  1DP0 A;  5HCF A;  1WCD J;  3LWC A;  1AR6 1;  2DBN A;  3LSE A;  1HIX A;  4A7Z A;  1G86 A;  1OA4 A;  3OBZ A;  3UJO A;  2PHX A;  5JXH A;  4XMA A;  2WA4 A;  1JYT A;  2OPK A;  3VBS B;  1O8P A;  4M3C E;  1ND3 A;  4Z2W A;  1KGY A;  3ZSE A;  3H1W A;  4IXL A;  4Y33 A;  1GMM A;  1HRV 3;  4HKL A;  4RGA A;  2H0B A;  5EZW A;  1GP6 A;  4QQP A;  1NY7 2;  1D4M 2;  2GAL A;  1TME 2;  3I3B A;  1LOE A;  3LF7 A;  4QU2 A;  2DVG A;  2AC1 A;  2JEC A;  2VZQ A;  4PIX A;  4F83 A;  4Q4Y 1;  1YNA A;  2RR1 1;  4NRQ A;  5T54 A;  4YZ3 A;  5J1X A;  2JDK A;  2VXJ A;  1YI9 A;  3GZE A;  5FZ1 A;  5KXE A;  4A6O A;  3WXP A;  1DIW A;  2C9K A;  2R0H A;  1W2A X;  3VL8 A;  1HXS 2;  2CY6 A;  2XB6 C;  2XVK A;  4FVV A;  5IVV A;  4KWK A;  4I3P A;  1TVG A;  3AXD A;  4GD4 A;  4FFG A;  3NRU A;  3NJZ A;  4CP1 A;  3SH3 A;  1HRI 1;  1W2O A;  1UX7 A;  3PHM A;  1AUY A;  1W06 A;  1IS6 A;  5EYX A;  3MW4 A;  2NQY A;  1LJ7 A;  1ULF A;  2VOT A;  4DQA A;  4F3J A;  4DRV A;  4GB3 1;  5AC9 3;  3WUC A;  1CAW B;  3J8F 3;  1VP6 A;  5DAX A;  1FNZ A;  5J3U A;  3M8L A;  4OMD A;  2ZGK A;  5A6Z A;  1RUN A;  3NV1 A;  1GP4 A;  1XE8 A;  2D44 A;  5A7P A;  2AH2 A;  2BVV A;  1WMF A;  1A8D A;  1LEN A;  2VCC A;  3UL2 A;  5ACA 3;  1WW4 A;  2YU1 A;  4UFJ A;  2WSU A;  3OBT A;  4QGM A;  4XFF A;  3PUI A;  2DU0 A;  1RGS A;  1UU4 A;  2XG3 A;  2LAL A;  3J7N A;  3OF1 A;  4G4F A;  4OHW A;  1N3O A;  4WVW A;  3OD0 A;  2EXJ A;  2J1U A;  4Y5S A;  2D93 A;  2YGM A;  3MFA A;  2RS5 2;  5FO8 B;  4CP9 B;  4W6W A;  5KHK A;  1US2 A;  3WW4 A;  1KIT A;  4JC1 A;  5FK8 A;  1RJ7 A;  4GA9 A;  4HZF A;  1ASJ 2;  5LWB A;  3VZK A;  4IEQ A;  4PQQ A;  5FUN A;  3ZFG C;  4NHX A;  4RQP A;  1LU2 A;  1Q5O A;  2HWD 3;  3ZM8 A;  5I0S A;  1FXZ A;  5FPV A;  2I74 A;  1VRH 1;  1YQ5 A;  1BEV 1;  4PDW C;  3O1P A;  4O7X A;  2B45 X;  1AJO A;  5ANN A;  2EAK A;  1JZ3 A;  5FPB A;  1OHF A;  1AR8 1;  5E8A A;  2C1F A;  2FMD A;  5FY7 A;  1XNC A;  1LOF A;  2VNO A;  1WCK A;  3HIF A;  3FFZ A;  2BW8 A;  4AQ6 A;  1MZF A;  1FPN 3;  5L7O C;  4QKF A;  4NRP A;  2VL4 A;  3ZSL A;  2NMN A;  4EYU A;  3OGV A;  5IW0 A;  5ACA 2;  3T4V A;  1QEX A;  1IKQ A;  1NCR C;  3LCP A;  3V0B B;  2VQA A;  4CDU B;  5D2A A;  3A0N A;  1MQT B;  1PIV 1;  1U5I A;  2QFE A;  3KT1 A;  3LDB A;  1AXY A;  2ZX4 A;  2Q30 A;  4PIY A;  3U75 A;  2WZE A;  1NQJ A;  2WT1 A;  4QX8 A;  2VVE A;  4MYE A;  4QX0 A;  4PDW A;  4JGY B;  4RS5 A;  3MIB A;  2R06 3;  3WW3 A;  5L9B A;  3UK9 A;  3OGS A;  1GUI A;  5A6X A;  5BV6 A;  5K0U A;  1LEC A;  4IQP A;  3FBM A;  5F5A A;  1JN2 P;  1HDK A;  2B9U A;  1X33 A;  1MS9 A;  3ACG A;  2FD8 A;  1FV2 A;  4Q4Y 3;  4GWN A;  2RR1 3;  4RHV 1;  3VBH C;  5FFO C;  1PX4 A;  3AJZ A;  3E97 A;  3FHI B;  3TEY A;  2TEP A;  3AP9 A;  1QH7 A;  3CNA A;  5BNP C;  3RJ2 X;  4ATF A;  1ND2 B;  3N9L A;  3DXT A;  1H9W A;  1ZRR A;  2RS1 1;  5DZE A;  2WNE A;  3ZXD A;  2HWC 3;  1DGR A;  2WKK A;  1HRI 3;  3JXS A;  5KR7 A;  2F6B A;  1CAV B;  2RE9 A;  3IPV A;  1UXX X;  3ZFE B;  4GB3 3;  4LHL A;  1QOS A;  5IVY A;  1WWY A;  4COY A;  4HSJ A;  2IXJ A;  4JQT A;  4CEY B;  2VNV A;  4IL7 A;  2Y6G A;  5F5I A;  3JQW A;  3WDV A;  5CFD C;  4ZU4 A;  1K42 A;  3ZYG A;  4Y1U A;  3UJQ A;  3M3O A;  4MGK E;  1YFY A;  3VZN A;  2VD7 A;  2JG9 B;  4YGD A;  5JXG A;  3U0Z A;  4V2W A;  2WFF 1;  5GLW A;  1PMH X;  4FTS A;  2PHD A;  4Y1Z A;  4MHR A;  1GFF 2;  4Q26 A;  2YC2 A;  3KZ4 C;  2RS3 2;  4IEZ A;  4CCK A;  5C6C A;  1JTZ X;  3AC0 A;  3POE A;  1IG0 A;  2OYZ A;  4LKF A;  3KLS A;  4HBN A;  3VKN A;  5CG8 A;  2BOI A;  1V6J A;  5LBE A;  4PBO A;  3WF1 A;  4LJH A;  2GNT A;  3M3C A;  3WF0 A;  2D6K A;  1OLM E;  4YNI A;  3KMH A;  1OA3 A;  5IFP A;  2VPV A;  4W4Z A;  2QQO A;  1VRH 3;  3CKH A;  1BEV 3;  5EQU A;  1H6X A;  2W39 A;  3O0W A;  5FIX A;  3T0B A;  4B3N A;  3O1O A;  1NY7 1;  1VBC 3;  1TME 1;  5HI0 A;  1NLS A;  1WLW A;  2PHF A;  1QDC A;  4KI5 M;  3JUU A;  4JDO A;  2VUL A;  4QQH A;  4RSU A;  3UGF A;  2ZKL A;  1K5M A;  1LOB A;  1QJY 2;  4CXY A;  2D6L X;  3N9O A;  3DKQ A;  5DUX A;  4YWA A;  3V0A B;  3ZSM A;  3H8X A;  5FYM A;  1RXF A;  1GWL A;  2IXH A;  1GIC A;  3B7M A;  2OA2 A;  4K7J A;  4AVV A;  1V6L A;  4E27 A;  3ZN5 A;  1SLC A;  2Q1Z B;  3KVB A;  5H9R A;  1PIV 3;  4AE2 A;  2OKX A;  5JZG C;  2E7Q A;  4LHK A;  4QXB A;  1JYW A;  1FNY A;  4AED A;  1VBB 2;  1I1E A;  4AHY A;  4M3C B;  3CZU A;  1SBE A;  3J9S A;  2CYF A;  5EWS A;  2GP5 A;  1E5I A;  3RDI A;  3RGB A;  3SH5 A;  4MGT A;  1W05 A;  2BUK A;  2GN7 A;  3HAG A;  5IHR A;  2BGC A;  2ZGL A;  2PAK A;  2EAA A;  4IEP A;  4AAX A;  4CUC A;  3ZX7 A;  2XR4 A;  3AL5 A;  2W2I A;  2OUJ A;  4OHV A;  4RHV 3;  2VW2 A;  3ZXF A;  1XNB A;  3I3Q A;  2ZZQ A;  5DAQ A;  2ES3 A;  3NJY A;  4XBL A;  1AXK A;  4XOG A;  2WT2 A;  3OB8 A;  4OI1 A;  4C0B A;  2J1S A;  2RS1 3;  2VOW A;  4F8A A;  2QZ2 A;  4ORF A;  1MZ6 A;  1MZE A;  3T08 A;  2WS9 2;  1EY2 A;  4CDX B;  1HQW A;  1J3R A;  1UY0 A;  2VZS A;  1U12 A;  2WUH A;  3KV6 A;  3MPB A;  3RPQ A;  4CP2 A;  2V5Y A;  1ZZ9 A;  3HWJ A;  3Q9O A;  4XQW A;  1AL2 2;  4IGQ A;  3O14 A;  1CZS A;  2IFW A;  1PO1 3;  3OG2 A;  5FZA A;  2XL9 A;  3AVR A;  1ENR A;  4FP3 A;  2JDA A;  1KD7 A;  1LR5 A;  2ZX3 A;  1OVP A;  4DZG A;  2V5D A;  1Y4W A;  1E5R A;  4JGZ C;  2WFF 3;  2VZ1 A;  4QHZ A;  4XQD A;  4DY5 A;  2DVF A;  3MIE A;  4WM8 B;  2Q1M A;  1LHV A;  2CWM A;  4N43 B;  2JEM A;  2A71 A;  1IHM A;  2W68 A;  3GHN A;  4HOO A;  5CFC B;  1C28 A;  5KBF A;  3W5N A;  3OY8 B;  4P9J A;  3DV8 A;  4TYS A;  3NW4 A;  2TUN A;  1RJ8 A;  3K2O A;  1LES A;  2HWF 2;  1ENS A;  3V65 A;  2ADD A;  4AYU A;  2PHU A;  3BUC A;  4L11 A;  1EUT A;  2IUW A;  2XDV A;  1TNR A;  3FN9 A;  2H6B A;  5D21 A;  2Y0O A;  1D4M 3;  2WBK A;  1TME 3;  3MF6 A;  3BIW E;  1H4H A;  1UOG A;  4XHB A;  4COZ A;  5FZM A;  2XWJ B;  2XVG A;  1XND A;  2VCM A;  2OVU A;  4RN5 A;  4XUR A;  1QOO A;  2WWJ A;  2VZR A;  4UFH A;  5JI9 A;  2OX0 A;  3QAC A;  1HXS 3;  3T0A A;  2DFB A;  2A5Z A;  5DDJ 1;  5TSW A;  3WDY A;  4DXT A;  4MOA A;  2QQU A;  1SMV A;  3ZVX A;  3AKT A;  4ITC A;  5FZ4 A;  4CDQ A;  3X29 B;  4OI2 A;  1YQC A;  4IV1 B;  2AEZ A;  2DTY A;  2JE8 A;  1XU1 A;  4LIU A;  2ZMN A;  1HKD A;  1TEI A;  1XU2 A;  2BTV C;  1PK6 A;  3IIA A;  5F3E A;  5FZO A;  3IBM A;  4K6B A;  4M4R A;  3S5A A;  5I0R A;  1HB3 A;  4GIQ A;  3OEA A;  4CYD A;  3WDX A;  3KF5 A;  1RXG A;  2FZ1 A;  2PEL A;  4HET A;  1H8T A;  2W91 A;  4CE8 A;  1GZ9 A;  1CVN A;  1Q3E A;  2VZ3 A;  4FFF A;  4O65 A;  2YUE A;  4Y4R A;  3S30 A;  4CDW B;  4AHZ A;  3BPS A;  1LTE A;  4AQ2 A;  5GAL A;  4Y1V A;  2RS5 3;  4CZS A;  1RUI 2;  3HEI A;  5E89 A;  3VKF C;  2XGX A;  2Q1F A;  1DGW A;  1ZRC A;  4NIH A;  2D5F A;  4Z82 A;  2V72 A;  2HEY F;  2WQ4 A;  4ES9 A;  1ASJ 3;  1Z0H A;  2UU8 A;  1KS5 A;  4K21 A;  4TLG A;  5CYY A;  3VHN A;  4LBL A;  5GZF A;  4OYU A;  4QX5 A;  2BPA 2;  3PMS A;  5A3T A;  2ZEZ A;  1GQH A;  2Z5W A;  3T2O A;  1K3I A;  4IUG A;  4ZXK A;  3CZJ A;  5JR7 B;  3POB A;  2XHN A;  2IVI B;  1WKY A;  1WW6 A;  2WRA A;  5FJH A;  4NOT A;  4MG2 A;  4WM7 C;  3VD5 A;  4CEW C;  4YVS C;  5SV5 A;  4XBQ A;  1QJY 1;  5DZF A;  5C4W C;  2YXS A;  4MUV A;  3HMY A;  4YYO A;  2VGD A;  3ZFF A;  5JOY A;  1C1F A;  4YPJ A;  4DEQ A;  1LHN A;  2QQK A;  1CAX B;  4YG0 A;  4AVB A;  1O91 A;  4FOY A;  4XUQ A;  2EIB A;  4COV A;  1T6G C;  2ORX A;  1LU1 A;  2LUW A;  3WNO A;  2OS2 A;  4MGI E;  3RZM A;  4CRQ A;  1R09 2;  1S2B A;  1H6Y A;  3H8O A;  3RZK A;  5FXW A;  3AYA A;  1VBB 1;  1A6C A;  2PN5 A;  3HPN A;  3WUD A;  3A21 A;  1B35 A;  1Q8Q A;  4QPG B;  4KGG A;  3H7J A;  5EJ3 A;  4L9B A;  1K5M C;  2QTW B;  2ZZJ A;  1NX9 A;  1OQD A;  5L19 A;  4LIT A;  2VXR A;  3OD4 A;  3OPW A;  3AZV A;  1JHJ A;  1C8M 2;  3AP6 A;  2G9G A;  3UV9 A;  1NXD 1;  3AYE A;  3S7E A;  3ZR6 A;  2O0O A;  2ZGS A;  5JVV A;  4U36 A;  4MX3 A;  4R4Z A;  4E4H A;  4XFI A;  3SEP A;  4EJR A;  4OZX A;  3RS6 A;  1O3Q A;  4I2O A;  3WDW A;  2VM9 A;  1IPS A;  3NV3 A;  4X6R B;  1JOB A;  4H2A A;  4JDM A;  3SIT A;  2ZX1 A;  3PTR B;  2QVS B;  1XB9 A;  4Z1V A;  4SLI A;  5K4L A;  3WV6 A;  2DYC A;  5F5C A;  3Q8A A;  1ZX5 A;  3BTZ A;  2CV6 A;  1G9B A;  2GC2 A;  4NIA A;  5EYY A;  3D0S A;  4ZS3 A;  4AFB A;  2FDI A;  1VAL A;  1GKB A;  4IER A;  3FWE A;  3WIN E;  2PLV 2;  4P9I A;  4EE2 A;  2WNU A;  3I97 A;  1KQR A;  4N9I A;  4ONU A;  4DXR A;  4DIQ A;  2YGL A;  1G8W A;  5FYH A;  4QX2 A;  4AI9 A;  4I0A A;  3ACI A;  4D3W A;  5APA A;  4AHX A;  2FQP A;  4E2Q A;  3DPR B;  4LUM A;  4P9X A;  2DVB A;  2HWF 1;  1R08 2;  2XJS A;  1POV 1;  3J7M A;  3K48 A;  2J1R A;  2QJV A;  4NPM A;  3W20 A;  4QT6 A;  4GKX A;  4AVT A;  1W90 A;  1CON A;  4BB3 A;  2FMY A;  4DRR A;  5FAX A;  1ZZB A;  3TAY A;  1W6P A;  4C91 A;  2D3R A;  3N9M A;  4MHU A;  3PVN A;  3I2O A;  1FMD 2;  4XCB A;  1QJY 3;  4QGN A;  2VR4 A;  4K40 A;  4O9G A;  1I6X A;  1UW8 A;  3RZZ A;  3WCR A;  3J7H A;  2HEW F;  3POW A;  5M0T A;  1SCS A;  4FBF A;  3BOP A;  4Y26 A;  2I2S A;  3F2Z A;  2RDN A;  2Y26 A;  5BNO A;  5J36 A;  1OQ1 A;  3EO6 A;  1BVV A;  4Q0Q A;  1H4G A;  5A70 A;  4XUT A;  2QDN A;  5FYY A;  4YW4 A;  2J42 A;  2X09 A;  1SDW A;  4QQO A;  4K1Y A;  5BY5 A;  1VBB 3;  5HPO A;  1AR6 2;  1SFP A;  2OZJ A;  3C7F A;  1S1A A;  3V56 A;  1DQ4 A;  1EP0 A;  2VNR A;  3O0V A;  4IEU A;  2D6P A;  4PLO A;  5FZ9 A;  4YRD A;  5F37 A;  5LW9 A;  3AMH A;  1WD3 A;  3C7E A;  2GND A;  4YVW A;  3OTF A;  4ZY9 A;  1IS5 A;  3HD8 B;  3ZLI A;  4YZ5 A;  1LB2 A;  4BLI A;  4HVR A;  2IXI A;  3UGG A;  4NAM A;  4QDR A;  3WLU A;  3KSC A;  3VZM A;  2VMG A;  4D7Y A;  1W8Z A;  5LEJ A;  1RUI 1;  4IV3 C;  4JKL A;  4LEJ A;  2FZ2 A;  1PMJ X;  1DZR A;  1VPH A;  1SQ4 A;  1VBD 2;  1ZBA 2;  3S57 A;  5I8Y A;  2V4V A;  4XYX A;  2X05 A;  2XLA A;  3W58 A;  5C3Q A;  2WS9 3;  3ZO0 B;  1VB4 A;  5F8P A;  2E7A A;  1AL2 3;  4W6X A;  3UNP A;  1KS4 A;  1H8T C;  2GME A;  4BQ1 A;  3NNG A;  5E88 A;  3CQO A;  1KJL A;  4RA0 A;  1AF9 A;  3BN6 A;  4RR3 A;  3AK0 A;  3IT8 A;  3ZDV A;  2D6M A;  2DBI A;  2EXI A;  2QQW A;  3ZYF A;  1UU6 A;  2W1U A;  2K2S A;  3NJX A;  5F3G A;  1OQE A;  4XAA A;  2W3J A;  3DYM A;  4QX7 A;  3ZFG A;  3E6D A;  4Y22 B;  1BHG A;  3TBD A;  3KV5 A;  1FAT A;  3GAL A;  1IG3 A;  3V64 A;  3TB0 A;  5FQ0 A;  1WA6 X;  5K7P A;  1O3R A;  1GYK A;  3LDR A;  1OVS A;  1AZD A;  3DKW A;  1PMI A;  2D6O X;  1N1Y A;  1WCQ A;  1XNK A;  5DXD A;  4URT A;  4UYB A;  3LB9 A;  3K4Z A;  4D6Q A;  3H8U A;  4XMI A;  2HWF 3;  3WOG A;  1Q8V A;  2WNV B;  3H42 B;  2VW0 A;  1ODN A;  4Q1P A;  4XFA A;  4QX1 A;  4BIF A;  3CF6 E;  4LK6 A;  1Z7S 1;  4CCJ A;  4YW5 A;  2C4X A;  5C33 A;  1GZW B;  1NCR A;  3GCX A;  1OT5 A;  1OD3 A;  1POQ A;  2ATF A;  2Y64 A;  4YGE A;  4AL9 A;  1I5P A;  4C0H A;  3MIC A;  1NKG A;  5A80 A;  2J1A A;  2A73 B;  3KCX A;  1UPS A;  5ABJ B;  1GNZ A;  1Y9Q A;  4UFL A;  4HON A;  1ONA A;  1AR8 2;  2PQS A;  5FO7 B;  2IVJ A;  1TMF 1;  5FP9 A;  1J3P A;  3SNM A;  4B29 A;  4E4Z A;  2A6W A;  2E7T A;  1JHN A;  2AEY A;  3B94 A;  3D3A A;  4HFS A;  1B35 C;  1J83 A;  2WZ8 A;  1N3Q A;  3NQH A;  4LE3 A;  3WNN A;  1XSQ A;  1V6K A;  4BQ5 A;  3KGZ A;  2XQX A;  3QH7 A;  1SAC A;  3T09 A;  3VBH A;  2LRP A;  2Y34 A;  4DO0 A;  3IMN A;  5FZI A;  2B42 B;  2RM2 2;  3NJV A;  1J3Q A;  5FZE A;  5FYC A;  1JOP A;  5BNP A;  3DEC A;  4CCL A;  5FZH A;  1MZ5 A;  4XJZ A;  5C3P A;  3PJQ A;  4P5Y A;  5KHJ A;  2W9X A;  4CUG A;  4LOT A;  2Y6K A;  4HPK A;  1QIQ A;  2GDF A;  5AFE A;  2A75 A;  1YUD A;  4AHW A;  1RUI 3;  4KNC A;  4OFG A;  5G05 L;  1IPJ A;  4N8M A;  1O7F A;  4XAC A;  1UMI A;  3VB9 A;  3WDT A;  1S0J A;  3D5O A;  1APN A;  3T2Q A;  4FAH A;  4AAP A;  3SIS A;  5CFD A;  4FPL A;  5IVB A;  2C6S A;  2ZA9 A;  1R08 1;  4W65 A;  2JG8 B;  1QF3 A;  3LOI A;  4BH9 A;  3BOD A;  1ZBE 2;  3ACH A;  3W5M A;  1H8V A;  3POI A;  3AX4 A;  5CIR A;  3FLR A;  4AK3 A;  1BVP 1;  2VQU A;  1O4Y A;  2D43 A;  2ARX A;  1OI6 A;  4N7U A;  2WZP P;  1D2Q A;  5FOB B;  1QGL A;  2QDR A;  5LK7 B;  2JEN A;  4TSV A;  3WQ0 A;  1FMD 1;  1I3H A;  1WLT A;  3B3Q E;  1UQX A;  2VUC A;  2OW4 A;  1XJA A;  2E31 A;  1QJU 1;  1YC6 1;  3B9C A;  4I0B A;  2A70 A;  2CAU A;  5CKM A;  4O9E A;  4LO8 A;  3NL1 A;  4FTE A;  2BJS A;  3M4F A;  3VD7 A;  4OQ9 A;  2UUR A;  2WN3 A;  5C4W B;  1V6O A;  1GLH A;  2XML A;  1R09 3;  3LEK A;  4ZKT B;  2KXL A;  3LA2 A;  1SFY A;  1D0H A;  4BQX A;  2NZ9 A;  4LKS A;  4CCO A;  2E26 A;  1STM A;  2YMZ A;  3USS A;  5JI7 A;  3S7I A;  1NCQ C;  1UMH A;  4DPN A;  2ET7 A;  2ZX0 A;  4ZS2 A;  5A3P A;  4TWT A;  1W99 A;  3BB6 A;  5H9P A;  5LA9 A;  3UYJ A;  4CUA A;  1XXN A;  3M3Q A;  1C8M 3;  4FPF A;  4YAR A;  3RI9 A;  2ZHN A;  1O6U A;  5B4X A;  1BK0 A;  2NM1 A;  4R52 A;  4X8P A;  5JZG A;  5H9S A;  5BNO C;  1A78 A;  3T0D A;  4DEV A;  1JBC A;  4W6Y A;  5FWE A;  5L7O B;  2FDH A;  4QXH A;  3J7L A;  2J1V A;  4A44 A;  2PHR A;  2B5H A;  1X36 A;  5EV7 A;  5JIU A;  4LO5 B;  1VBD 1;  1ZBA 1;  2RDQ A;  3WCS A;  2UWB A;  4JVA A;  2MPF A;  1RUH 1;  2YC4 A;  4P5H A;  1DQ6 A;  2RVA A;  2AR6 A;  2VVF A;  2J7M A;  4C1W A;  3MV1 1;  1CPN A;  1N3P A;  4N53 C;  1IPK A;  4MXW B;  4YVW C;  4XHX A;  2B4K A;  4EN9 B;  2JE9 A;  2I45 A;  1JUI A;  2X5I A;  3HR9 A;  4KBZ A;  5C8C B;  2PTM A;  2VZT A;  4L8Q A;  3KCY A;  1J1L A;  3OBR A;  4CXX A;  2GSY A;  3H7Y A;  1TE1 B;  5LA2 A;  1RHI 2;  2ARE A;  3KQ4 B;  3NAP B;  2XH6 A;  2PLV 3;  4XJW A;  1DU3 D;  3HNM A;  3I2D A;  3L2Y A;  3OPT A;  1WW5 A;  4PJY A;  4OLL A;  3VBO B;  4Q8K A;  4QM9 A;  1UF2 C;  3M7A A;  1XBF A;  2HKX A;  2QQM A;  4PBP A;  4XUP A;  1R64 A;  1HB4 A;  1NA1 C;  4TTG A;  2WO3 A;  1YQ6 A;  4QB2 A;  3IDC B;  4KU7 A;  2VMI A;  3RVH A;  1K5J A;  3UT0 A;  4WZF A;  1W0N A;  4HKW A;  1OUR A;  1L3J A;  1MVE A;  1R08 3;  2XKP A;  2Z2S B;  3PIG A;  1NLQ A;  4FPY A;  1S0E A;  4XF0 A;  3CL1 A;  1OD5 A;  5DAB A;  4UBG A;  4Q0S A;  4JGZ A;  5T3N A;  4BM8 A;  4RR3 C;  3MZH A;  3LSD A;  4OUM A;  1O4Z A;  2K46 A;  1PO2 2;  1SLT A;  3H1Y A;  3USU A;  2OUH A;  3PUS A;  1KJR A;  4LHN A;  2C0Z A;  1V70 A;  4LBQ B;  2PAE A;  4CCC A;  1VMF A;  4OQ8 A;  1VRB A;  4L2N A;  3FC0 A;  5CFD B;  1FMD 3;  4AR2 A;  1U5Z A;  4XF3 A;  5T52 A;  4AGR A;  1W8U A;  3KHC A;  2VCA A;  5JIA A;  4IET A;  4HKO A;  1OOP B;  1SBD A;  1F2N A;  3O1U A;  5F2S A;  1YXW A;  2XQR A;  4P00 B;  4LOR A;  5FTT C;  1W2N A;  3AVS A;  3NKG A;  5CA6 A;  3D4K A;  5IFT A;  1PVX A;  4BYY A;  3UKV A;  1H2L A;  3LFI A;  3PUH A;  4Y3O A;  2UYB A;  2LTN A;  1LNS A;  1AR6 3;  2YZ4 A;  4Q4W 1;  4GKY A;  2RM2 1;  3MUY 1;  5AVP A;  2VAU A;  4AW7 A;  5KXB A;  1JU3 A;  5FZC A;  5I0U A;  3B69 A;  2WC2 A;  1JYV A;  4D0Q A;  2XJU A;  5L73 A;  1LOG A;  1XE0 A;  1IKP A;  1COV 2;  1DGR N;  3IN9 A;  3UES A;  3URF A;  3BTX A;  3VHO A;  1D0G A;  1K45 A;  5IK4 A;  3VHP A;  2BVB A;  3SCH A;  1UIK A;  1HB2 A;  4XXP A;  1C1L A;  2YBS A;  1LGN A;  3ZKU A;  3MF9 A;  3WG2 A;  4NIG A;  2DCJ A;  3T1M A;  1XYN A;  1VBD 3;  1ZBA 3;  2H0V A;  4GQ7 A;  4LBO A;  3OGG A;  4FQZ A;  3GM8 A;  2ET1 A;  4NID A;  4UOJ A;  1ND3 B;  1MVQ A;  2PA7 A;  4LUL A;  5JZG B;  1R1Z A;  1ZBE 1;  2WDB A;  1ZZ6 A;  4YG3 A;  4AVC A;  1CX4 A;  3VLB B;  4IE5 A;  3O1S A;  5LA0 A;  5DDJ 2;  3U1X A;  1NYW A;  3RWK X;  3WF2 A;  4UW4 A;  3ACL A;  2Q8E A;  2JX9 A;  2HWB 2;  4LT5 A;  3VD4 A;  4Q4V 1;  3ZYH A;  1L7L A;  4JTO A;  4XZU G;  1RUE 1;  4E8D A;  1L7Q A;  1BBT 1;  5J7M A;  2BWA A;  3AMN A;  5GZG A;  4YFZ A;  4LOS A;  3RI8 A;  2E53 A;  2RDS A;  4UF0 A;  4BMB A;  1W8N A;  2N7G A;  4M4P A;  1XSR A;  3RWN A;  1ZVF A;  3OPZ A;  4NMI A;  4RFR B;  3ZIX A;  5FDB A;  3E6C C;  3A22 A;  4NPR A;  2V4A A;  4UFK A;  1DQ1 A;  5DAW A;  2VEC A;  2ARA A;  4LHS A;  4WM7 A;  1ZRE A;  2ZS6 B;  3K77 A;  4CEW A;  4YVS A;  2DCT A;  2EAL A;  4NHL A;  4KQ7 A;  4QHO A;  1JZ4 A;  5T5P A;  4UFI A;  4XQ4 A;  2D5H A;  1W0P A;  2CL2 A;  3D8C A;  1GAN A;  5K8S A;  4JAA A;  1IGO A;  2WO1 A;  1W8W A;  1JZ6 A;  1RUC 1;  1AR7 2;  2CTV A;  2PFW A;  4XW3 A;  5A3N A;  5FPX A;  3O1V A;  4E4D X;  1GV9 A;  4GH4 A;  5DQ0 A;  1XPW A;  4R9D A;  3W9A A;  4YW2 A;  3BAL A;  5I0T A;  3NKT A;  1CAU A;  3AJY A;  3OYW A;  2JIG A;  3PLQ A;  1AR8 3;  2ZAB A;  2Q8O A;  3FL7 A;  3I8T A;  3GYD A;  1UU5 A;  2EIE A;  2XJR A;  4GWI A;  5IVE A;  2VE1 A;  4QGL A;  3P3P A;  1AHS A;  5GLZ A;  4RQP B;  4WVV A;  4TZD A;  1UCX A;  4Z92 B;  5FP8 A;  3ZYJ B;  4FTB A;  3O1T A;  1JS9 A;  3HBZ A;  2ZKN A;  5JSO A;  1SDD B;  4H3W A;  1W9T A;  4JV4 A;  4DOU A;  5IAX A;  2RM2 3;  3QBQ A;  2ZCW A;  1C8N A;  4FPK A;  3D6E A;  1GQG A;  3POJ A;  3RMY A;  2GMM A;  2YC0 A;  1CD3 G;  1RHI 1;  2OQ6 A;  4J1X A;  3GZT B;  5F3I A;  3NNM A;  3PVE A;  4LQR A;  4FPC A;  3LA3 A;  3N3H A;  1XC6 A;  1P8J A;  4LPL A;  3RYK A;  2F4L A;  5FRE A;  5FYV A;  4QDQ A;  3VDD A;  4AXO A;  2QQP A;  2VUJ A;  1ZRF A;  1QJE A;  2GN3 A;  1X82 A;  1UKG A;  5FK7 A;  3RZH A;  1SBF A;  2R49 A;  1US3 A;  3T3Y A;  2ZAA A;  4QMA A;  3A23 A;  3RRD A;  4KGQ A;  2HH9 A;  4GMP 0;  5GZD A;  3UGH A;  2X5I C;  3LEG A;  4FPH A;  4PDW B;  2Z4F A;  4RS5 B;  2QQI A;  1UOJ A;  3AFK A;  4B1L A;  4MAD A;  1UY3 A;  4KBB A;  1ZBE 3;  2A1X A;  3CHX A;  4GAZ A;  2VBD A;  1HJG A;  4E9K A;  4DUW A;  4ZHN A;  5K0U B;  1RVF 2;  4FPE A;  1PO2 1;  4ES8 A;  2VMD A;  2YPJ A;  1UOB A;  2P3K A;  3ZIW A;  1OPO A;  1OPM A;  1ZA4 A;  5BNN A;  1QH6 A;  1OH3 A;  3K4D A;  5C3O A;  2KA3 A;  2OT7 A;  3ZFE C;  3ITQ A;  1O4T A;  4BIO A;  4DMI A;  4WVM A;  3T30 A;  1C5H A;  1MS1 A;  2OXB A;  2WLP A;  5FUI A;  1TZO A;  4YLZ A;  4XIL A;  4Q29 A;  4S2G A;  5FLJ A;  4QB1 A;  2IZW A;  3HJR A;  5KC6 A;  3I7D A;  4PQ9 A;  1XNA A;  4CTE A;  2WII B;  3N7M A;  2HYX A;  1UL9 A;  2JG9 C;  4YM2 A;  4HVQ A;  4UAP A;  3VBU A;  1D7P M;  1QOT A;  3DF0 A;  3FJS A;  3IPV B;  5CU1 A;  5GLT A;  1IQA A;  3EXU A;  3G6J B;  5IAT A;  1UY1 A;  2WAB A;  3BU7 A;  5D8A A;  2EID A;  4S2D A;  2UWC A;  2ZGM A;  4XVH A;  5FZK A;  1YEW A;  2DWR A;  1RUG 1;  2WT0 A;  4PF5 A;  4BQ2 A;  4LA2 A;  1A3K A;  2B8M A;  1COV 1;  3KGL A;  1XYP A;  2WFP A;  3JZV A;  4YGC A;  3KCC A;  4Q27 A;  2HJI A;  2R04 2;  2ZEX A;  3POG A;  5JMC A;  3U10 A;  2VTF A;  4BE3 A;  2QQN A;  4CVU A;  5C7G A;  1MAC A;  1S4C A;  3ORJ A;  4QPI A;  4UW6 A;  1SEF A;  2QKD A;  3PNA A;  1O8S A;  1R1A 1;  4YZ1 A;  1YI7 A;  2DTW A;  5FKB A;  4I3G A;  2BZD A;  5E1R A;  2BU9 A;  2DFC A;  1PHM A;  3CEW A;  4MLO A;  1Z78 A;  4CPB D;  3CJI A;  5BUV A;  3OCP A;  3N9Q A;  4AFA A;  5FZG A;  2EXK A;  4KMQ A;  4QKN A;  2Y38 A;  3JB4 C;  4AEM A;  3EHK A;  3N35 A;  4WVZ A;  2A6X A;  1MS3 A;  1FI2 A;  2HWB 1;  2HBU A;  4IV3 A;  5A1A A;  1K5M B;  1W6M A;  2Q0A A;  3RYR A;  2L9L A;  1W03 A;  2FDJ A;  3T2P A;  3ZXA C;  5C9A A;  4K3U A;  1RHI 3;  4ZU7 A;  1WW7 A;  1DYO A;  1W3X A;  4UBH A;  3MDP A;  3MHZ A;  3SCG A;  1CN1 A;  2PMW B;  3ABZ A;  4BK4 A;  3I2H A;  4KG8 A;  5I91 A;  1RIR A;  1XYO A;  3JU9 A;  4AGV A;  3I3M A;  4YG6 A;  5EP9 A;  4NE9 A;  2SLI A;  5T5J A;  4LKD A;  4AED B;  3FLT A;  2VC9 A;  5A32 A;  4JCK A;  2JJ6 A;  3EBR A;  1CWP A;  1JYC A;  5FXV A;  2XBO 2;  1ODM A;  3AKR A;  1QXJ A;  4CU6 A;  5I93 A;  2BNM A;  5ANQ A;  3I59 A;  4L92 A;  4Q8L A;  3ROU A;  4PHZ A;  5IK5 A;  3ST7 A;  1LKN A;  4AFD A;  2R16 A;  5FMD A;  4J1W A;  1PO2 3;  1BXH A;  1AR7 1;  2H6C A;  4LBQ D;  2QQL A;  1WD4 A;  4AWD A;  4CDX C;  3LEI A;  3J4U H;  3KVA A;  1BCX A;  3C7H A;  1YLL A;  5FPA A;  3KT4 A;  1S0B A;  2QE3 A;  1ZYB A;  3FUO A;  2RDR A;  3MLJ A;  1BMV 2;  2DUP A;  1UIJ A;  2DCY A;  4OHX A;  4P9Y A;  1JH5 A;  2UYA A;  4QAW A;  4Z8B A;  1KDK A;  2JIJ A;  3JD7 2;  1J84 A;  2MEV 2;  2IWG B;  3GBF A;  1AYM 1;  3I49 A;  2CGO A;  5A7W A;  4RGG A;  4AFC A;  2ZAH A;  3BVC A;  2F4P A;  2WQZ C;  5CB7 A;  4FQ4 A;  1VBE 1;  4XF4 A;  1PVC 1;  1AVB A;  1F4A A;  4Q5O A;  1KFX L;  1UXZ A;  4JRL A;  4N43 C;  4Y20 A;  1OC1 A;  5CFC C;  3PUQ A;  5LRS A;  5K9Y A;  3WR0 A;  4GH4 C;  1SPP A;  4NVP A;  3ZR5 A;  2Z69 A;  2BFU S;  2O8O A;  1SG3 A;  3FBY A;  1E57 A;  3VBR A;  4AZZ A;  4M00 A;  4ZZ8 A;  1COV 3;  3THD A;  5T5L A;  5JR2 A;  5JOX A;  2J22 A;  3Q8B A;  1QNW A;  4B4P A;  1PM4 A;  5L9V A;  1AX1 A;  1H2M A;  5FY8 A;  1Z7S 2;  2P17 A;  4AF9 A;  5T55 A;  3CU7 A;  2W1S A;  1W9Y A;  2VCB A;  3LD8 A;  1Y3T A;  5LY2 A;  1RYY A;  2VMH A;  3VBF A;  3H3U A;  1OA2 A;  4EQV A;  1XRU A;  5JMO A;  4HAN A;  4RYD A;  2ZOE B;  4XDP A;  1GWK A;  4MGY E;  3ZMN A;  1TMF 2;  4JRA A;  1PZ9 A;  1RVF 1;  5DDJ 3;  4LBK A;  5A3L A;  1YFW A;  2EIC A;  2ETE A;  1F9K A;  1GQP A;  4GAL A;  1WCS A;  4XFH A;  2HWB 3;  4C8D A;  1JZ5 A;  1OXC A;  1S2E A;  1ZZ8 A;  4A6S A;  2O1Q A;  1RUD 2;  2LRO A;  2R1D A;  3VDD C;  1UYX A;  3BCW A;  4D7T A;  5A33 A;  3O1M A;  4LBN A;  2W87 A;  2AEN A;  3POF A;  3VD9 A;  3PUR A;  1S55 A;  3M70 A;  5IAV A;  2VJX A;  5FY5 A;  4YM0 A;  2A3Y A;  3WF3 A;  3KF3 A;  5FZ3 A;  1W8H A;  2J1T A;  4CDQ B;  3LQC A;  4NWV A;  5IT6 A;  1D4V B;  1V00 A;  2ZGP A;  1J58 A;  1REF A;  3GXU A;  4D6R A;  5C70 A;  4R9C A;  1JOD A;  1ACC A;  1W6Q A;  4CDW C;  2WNO A;  1PK6 B;  2OZ6 A;  1XNT A;  5FZO B;  4QDS A;  3ECQ A;  3LE0 A;  4QXK A;  3B5L B;  2E51 A;  1IS4 A;  5BNN C;  1DDL A;  3HT1 A;  4V1P A;  4ARX A;  4IGO A;  5IVJ A;  4HK9 A;  2VQ0 A;  3PL0 A;  5F2W A;  3WW2 A;  4B1M A;  1AR7 3;  1H8T B;  1CIW A;  4XTM A;  3THT A;  3IKW A;  1AJK A;  3JB8 A;  1DZQ A;  4P9L A;  1YWK A;  2WAO A;  1YO8 A;  2DCZ A;  2R04 1;  1K12 A;  2YYO A;  3O7O A;  3QH6 A;  3ZN6 A;  2Y8K A;  2XJV A;  4LBJ A;  3TNQ A;  4IEO A;  3PVO A;  1HQL A;  3BYW A;  2VY0 A;  1GOG A;  4QM8 A;  3VBU C;  1X7N A;  3CLP A;  1YIP A;  5A3W A;  1NCQ A;  3M2M A;  3FX3 A;  3R4S A;  1F31 A;  1F15 A;  1JUH A;  4UW5 A;  3I3D A;  5D8A C;  2HLE A;  2W0X A;  4B4R A;  1QJU 2;  1RIN A;  2IXL A;  4MZU A;  3WY6 A;  4I30 A;  3LPG A;  2LS6 A;  5B2G B;  4A45 A;  1KRI A;  5HV4 A;  1VLN A;  4XFG A;  1W6N A;  2E6V A;  5EPA A;  4ZON A;  3UET A;  1W9F A;  3FUQ A;  1MR5 A;  2R07 1;  2ERF A;  1ZZC A;  5CNA A;  1O5U A;  4AVS A;  1SLI A;  4QPI C;  2W47 A;  5F6K A;  2WO7 A;  4OMC A;  1CQ9 A;  1DLL A;  3ZFF B;  3ME2 A;  4IES A;  3HQR A;  3MI8 A;  2NMO A;  3DUI A;  3LDK A;  4LE4 A;  4Z2A A;  3CMG A;  4CU8 A;  4DXZ A;  4N53 A;  5DUU A;  3AYC A;  1DYP A;  4CUB A;  1Q8P A;  4CXW A;  3CJI C;  1O5L A;  3BGA A;  3TOJ A;  5JAX A;  4S2F A;  4NWW A;  1JYI A;  4ISQ A;  1GOH A;  1ENQ A;  1OFS A;  4B4Q A;  4YW6 A;  2XBO 1;  1B35 B;  1EPW A;  4BQ4 A;  2VBB A;  4MXV A;  4YW1 A;  5C9A C;  5HCA A;  3LEM A;  3VDB A;  3G7D A;  4JKK A;  4XJA A;  1QXR A;  1RVF 3;  2DDU A;  4XTP A;  3WG1 A;  5T5O A;  1RUH 2;  4M0N A;  2BV4 A;  3ZPY A;  3VZJ A;  1N1V A;  1YQ8 A;  1W8O A;  1LRH A;  1NA1 A;  2VZU A;  4CA9 A;  1ULP A;  1GBG A;  3N7J A;  2O8Q A;  1BMV 1;  1PM7 A;  2VO5 A;  1CJD A;  1LCL A;  5HBA A;  1RUO A;  3JD7 1;  4IEX A;  2ENR A;  3NNJ A;  2MEV 1;  4Y1Y A;  4W8J A;  1E5H A;  3E5Q A;  5J48 A;  4XCA A;  4FXK B;  3CIH A;  2DF7 A;  2FHR A;  2P5B A;  3GHM A;  3O0X A;  1G9C A;  3M3E A;  1SLL A;  2P1B A;  2GC1 A;  4BU2 A;  4DIN B;  4P14 A;  1RTV A;  4KH9 A;  2YG0 A;  3MUZ 1;  1AX2 A;  2ZAC A;  1SLA A;  1VAK A;  1H2K A;  3AP4 A;  1FX5 A;  3DPR C;  3M1H A;  3MPP G;  5CVR A;  1LAJ A;  4AVA A;  3THC A;  4LA3 A;  3U14 A;  2QQV A;  1POV 3;  2R1B A;  2WNU B;  3U11 A;  2R04 3;  5H9Q A;  3VD3 A;  4GWJ A;  2FCV A;  4COU A;  3DEM A;  2O14 A;  1BLZ A;  2BGP A;  2W1Q A;  1HB1 A;  5CG9 A;  1TNF A;  3KS7 A;  3LOB A;  1HLC A;  1DF0 A;  1W04 A;  1H1M A;  4OUE A;  1EYB A;  1HN0 A;  5BPX A;  5KHH A;  4NII A;  3ZXG A;  1IS3 A;  3VBS A;  4IW3 A;  4LO7 A;  2JDN A;  1SFN A;  1WLC A;  4PCR A;  5FMO S;  2P4E A;  2VUA A;  4Q4X 2;  4IND A;  4D6S A;  3VBR C;  4A7Y A;  4PT6 A;  5A1L A;  2HYK A;  3MW3 A;  1W6P B;  5JUV A;  2WO2 A;  5G04 L;  4LR4 A;  4XAB A;  3U07 A;  4XBN A;  3FLP A;  4ERO A;  2JDM A;  2I07 B;  4MGQ A;  2ORZ A;  5FY0 A;  5FLH A;  2GMP A;  1RUD 1;  2VZP A;  3Q8E A;  3IDB B;  1SZB A;  4Q4W 2;  2A3W A;  3WQ7 A;  4GZ9 A;  3WQB A;  1JZ2 A;  1G9A A;  3FMG A;  3VBF C;  4LBM A;  5GLV A;  4PI2 A;  1ZNP A;  1PGS A;  3MEP A;  4Y1X A;  5BNO B;  3WD5 A;  1TQ5 A;  2FDG A;  2RJ2 A;  1HV0 A;  3OGR A;  3N4M A;  1REE A;  4BIS A;  4JHT A;  3OUJ A;  2XBO 3;  4NHK A;  4XDO A;  2X29 A;  1CAW A;  2D97 A;  4HXC A;  1I9R A;  5LRR A;  3I2G A;  3GCW A;  5HCB A;  3A7Q A;  4K1Z A;  4YVW B;  4M0H A;  1M4W A;  3C2U A;  2VMF A;  2C5D A;  5FY1 A;  5CIS A;  1JZ8 A;  3AFG A;  3NNF A;  5F39 A;  4LO6 B;  4Q1R A;  4CP0 A;  5C5T A;  2ZHL A;  1ZZ7 A;  2VBP A;  4QX3 A;  3C3V A;  3JCI A;  5FZ6 A;  5LAS A;  5JSR A;  1S0F A;  4XUO A;  4CP9 A;  5HXV A;  1UZV A;  1ULC A;  4NO4 A;  2BWC A;  3AB0 A;  3JD7 3;  4Q4V 2;  1YYN A;  3MIH A;  4Y5T A;  2MEV 3;  3RZL A;  1RUE 2;  2JD4 A;  3MLK A;  2VOX A;  1BBT 2;  1UYY A;  2BP6 A;  2XLG A;  1NAE A;  3SMH A;  3NO8 A;  4ASL A;  3TRS B;  4GJZ A;  3WSO A;  1EV1 2;  4D8M A;  4RR3 B;  2ZPX A;  3ILF A;  4XET A;  5BNQ A;  3EJK A;  1J1T A;  3SC7 X;  1F35 A;  2WNV C;  3TYJ A;  3ZFG B;  2TNF A;  4BOW A;  5CAD A;  1O3S A;  2HWD 1;  5GM0 A;  1G9F A;  2B46 X;  3CBN A;  2P3Y A;  1VE0 A;  1UKR A;  5FQ0 B;  1ENX A;  2RJL A;  1RUC 2;  1CIY A;  1Z7S 3;  5FXX A;  2VQT A;  4CDU A;  1N1S A;  2W5F A;  2XVL A;  5I8T A;  1W28 A;  1JOJ A;  5LEK A;  1MQT A;  1RUF 2;  5LCW L;  3I2F A;  2BBV A;  3EQE A;  2DUR A;  2DU1 A;  1T6B X;  2VTX A;  2W94 A;  4P9W A;  5ABJ C;  2G9F A;  1UNB A;  2WJS A;  3H50 A;  5C3S A;  5IK8 A;  1H2N A;  4JGY A;  5JDB A;  1TMF 3;  3EYP A;  4IE7 A;  4MH0 E;  1EUU A;  1G9D A;  4XEZ A;  2VNG A;  1NCR B;  1HQN A;  4XDQ A;  2Y6H A;  3GJA A;  1BJQ A;  4MO3 M;  4BCU A;  2YBK A;  2JDP A;  4IEW A;  4L0P A;  2BYV E;  3S0M A;  1UYP A;  1W8F A;  4Z07 A;  1B09 A;  1RUD 3;  3HOB A;  5T50 A;  5A3O A;  2JIC A;  3KT7 A;  1AR9 2;  3R4U A;  4QPW A;  5JWP A;  4NN0 A;  2R06 1;  2IC1 A;  2YV8 A;  2Q8D A;  5GKA C;  1ND2 A;  3I2K A;  2W08 A;  4M3C F;  3IZO A;  2DVD A;  3OUI A;  4JHZ A;  1UX6 A;  3CO2 A;  5A3M A;  5FMB A;  3NV2 A;  5JXI A;  1CAV A;  4LLO A;  3GJB A;  1BK1 A;  3H3Z A;  3VBH B;  2FCU A;  3ZFE A;  5LB6 A;  1GR3 A;  2Q4S A;  3IB3 A;  5DG1 A;  4DXS A;  4BWO A;  2RJK A;  2ZHM A;  2R0F A;  3GF6 A;  5FZL A;  5BNP B;  3SKV A;  4CEY A;  4FPO B;  3WW1 A;  3U78 A;  1HX6 A;  2HWC 1;  4KWU A;  5FOJ B;  3IDE A;  2JG8 C;  4Y24 A;  5JCT A;  3U4X A;  3WP4 A;  2WZR 2;  2JG9 A;  4HPK B;  1OMI A;  5JPN B;  2G4I A;  4A41 A;  5C71 A;  1RMU 2;  5C3R A;  2GNB A;  2WQ8 A;  3K46 A;  1JMU B;  4NHY A;  3WG4 A;  2AUY A;  1BKZ A;  1F5J A;  2WL1 A;  1H9P A;  1V9U 1;  1SHW B;  2BRT A;  3R0R A;  2PAM A;  2BQP A;  1V0A A;  4EZH A;  5GZC A;  4B8E A;  1UZZ A;  2JDU A;  3HNB M;  1QJU 3;  1U0A A;  2B9V A;  4Q4X 1;  4AI2 A;  3OBA A;  1BQP A;  4TXW A;  2P34 A;  1JYX A;  2CHH A;  2KD7 A;  2WAA A;  1NE6 A;  3DL3 A;  2W92 A;  2W52 A;  2Y0I A;  2X53 S;  1U5Y A;  3KV4 A;  1DBN A;  2R32 A;  2Q8C A;  1DGL A;  1WME A;  4BME A;  3W21 A;  3IDA A;  2K0G A;  3WP5 A;  3ASI A;  5A7Q A;  4BDV B;  2D98 A;  2IXK A;  1JW6 A;  1UMZ A;  2UWA A;  2WA3 A;  2XHK A;  3V0A A;  1ULG A;  4JKM A;  4E4S A;  2BOJ A;  1RUG 2;  5E16 A;  4Q0U A;  3VBS C;  3GZA A;  4BQY A;  2EXH A;  2Q5T A;  5FBZ A;  1VBC 1;  3U37 A;  4P9G A;  1C4R A;  1CGP A;  4GMP 1;  3MYX A;  5FP4 A;  1WMD A;  3MO4 A;  1IQD C;  1NXM A;  2YHJ A;  1FOD 2;  1PNF A;  3QD6 A;  4L97 A;  4M3C A;  5FY4 A;  1QDO A;  4EN7 B;  1H30 A;  1DGW X;  1R1A 2;  2E32 A;  2AYH A;  2D6N A;  5FP3 A;  4AG4 A;  2ZX2 A;  3F95 A;  5A7S A;  1RUH 3;  5FV3 A;  2A3X A;  3WEZ A;  4AI1 A;  1XE7 A;  2R7E B;  4C90 A;  1YHF A;  2R30 A;  2V09 A;  4YW7 A;  5FP7 A;  4H7M A;  4ZU5 A;  3TNP B;  4NRO A;  3ZXE A;  1OLQ A;  3AL6 A;  4YZ4 A;  5C8C C;  3VDA A;  3P3N A;  4KL1 A;  1WCU A;  2LW8 A;  2WIN B;  1C5I A;  1LGB A;  2LM3 A;  2P3J A;  4DNY A;  1UZ0 A;  3KWV A;  3IMM A;  1PGW 1;  2WWS A;  3NAP C;  4FI9 A;  1NQD A;  1QNY A;  1RUJ 2;  5JLV A;  5KXD A;  3B02 A;  4CDX A;  1UN1 A;  1NZI A;  4ZZ5 A;  3VBO C;  5F3C A;  1SCR A;  1W2T A;  2A6V A;  1I5Z A;  3N9N A;  2X5I B;  1WA4 A;  4W50 A;  1EV1 1;  2SBA A;  3H0O A;  3DN7 A;  3MBW A;  4OVE A;  1C3H A;  3TEW A;  2A6Y A;  2WYF A;  1S0C A;  2V73 A;  4N7I A;  1YCI A;  3PU3 A;  3WG3 A;  3TWI A;  3NMB A;  4EV0 A;  3AKP A;  3AMQ A;  1UO9 A;  3RG0 A;  4MVT A;  2NYY A;  3VV1 A;  4R9B A;  3NNL A;  3WT3 A;  1CJP A;  4YGB A;  3ZN4 A;  1JU4 A;  1Y7B A;  4R4X A;  4WM8 A;  2X8K A;  3E6B A;  4RD7 A;  4YFW A;  1IOA A;  1KDM A;  1PO1 1;  1KEX A;  1EAH 2;  3Q8C A;  4N43 A;  5CFC A;  2HWE 2;  2CDP A;  4MGZ E;  1V9U 3;  1RUF 1;  3WNK A;  4HL0 A;  4BXS V;  1SLB A;  2BNO A;  3OY8 A;  4QB6 A;  1QXP A;  2GH2 A;  4D7S A;  3RNS A;  2Y33 A;  5FRA A;  2AGS A;  3IWZ A;  2JE7 A;  3PU8 A;  4HN1 A;  4XFB A;  3KQR A;  3ZXL A;  4JGZ B;  5BXX A;  4Q4X 3;  1HJF A;  3SEE A;  4FAG A;  2WR9 A;  3DCQ A;  1OOP C;  5FZD A;  5GZE A;  5FZ7 A;  1QJX 2;  3USU B;  4E8C A;  3AM2 A;  1W0O A;  2JB8 A;  1AYM 2;  3ETP A;  1W8T A;  4IE0 A;  3H9A A;  4JDN A;  4D94 A;  4LXL A;  5KHI A;  1S0I A;  1S0D A;  4XE9 A;  1V6I A;  1AXZ A;  3AZX A;  3NVC A;  2ZJC A;  3DYP A;  1VBE 2;  5F32 A;  1PVC 2;  2NPI A;  4BA6 A;  4BQ3 A;  2ZBJ A;  3WNM A;  5FJK A;  1YJL A;  5I0D A;  1A34 A;  4P08 A;  4CDU C;  4KWJ A;  4Q4W 3;  1AR9 1;  1DQ5 A;  2VTX J;  1MQT C;  3SH4 A;  1X9P A;  3PTY A;  1ULE A;  1PX3 A;  1X8M A;  2DUQ A;  2GP3 A;  4WV8 A;  5CAZ A;  1F8V A;  1D4M 1;  4ASK A;  3QLQ A;  4V2V A;  1FYU A;  4GMP 3;  4JGY C;  2P3I A;  4NAO A;  4R8H A;  2QCS B;  3WZ1 A;  2R6Q A;  4IV1 A;  1UWW A;  1DLC A;  3SLI A;  3ZXJ A;  3MW2 A;  2VMC A;  1AYN 2;  1JI6 A;  2AZ5 A;  2D3S A;  3B93 A;  4CCD A;  1HXS 1;  4Y5Z 0;  5ERL A;  1G6N A;  5DAP A;  3RZJ A;  5A7N A;  4NRM A;  2JXA A;  1ND3 C;  3OOX A;  1MS0 A;  5IWF A;  4IDZ A;  1RC6 A;  2ILM A;  3KB5 A;  4AI3 A;  3GNE A;  1VB2 A;  3BI3 A;  2WZR 1;  1ND2 C;  3N9P A;  3N7L A;  2DUO A;  5JXJ A;  2TBV A;  5IK7 A;  1RMU 1;  2FCT A;  2P2K A;  1MEC 2;  3HN3 A;  4IE4 A;  4QU1 A;  4AI0 A;  4CDW A;  2IXC A;  3RJR A;  4ZXE A;  2XJQ A;  4OUS A;  3VN4 A;  3AP5 A;  1VJ2 A;  4Q4V 3;  3M3I A;  3EB7 A;  1WLD A;  2CSG A;  1O59 A;  1RUE 3;  1GNH A;  1ST8 A;  1YQ2 A;  4BLJ A;  4EN0 A;  1BBT 3;  3VGI A;  3WQ1 A;  1ULD A;  4CEY C;  4OUL A;  1NG0 A;  3WVJ A;  1GP5 A;  1RED A;  5A1F A;  1OF4 A;  2RS5 1;  1EV1 3;  3LAG A;  4FP2 A;  5DUV A;  3HT2 A;  2OQ7 A;  1LED A;  3ON7 A;  4QWN A;  4AQS A;  1IZ3 A;  1ASJ 1;  2C9A A;  1YFX A;  3DXU A;  3Q8F A;  2AAC A;  1OKO A;  1V6N A;  3ETQ A;  4NJ4 A;  3TEX A;  3ZYP A;  5JPM B;  4UF0 B;  3OEB A;  4LTA A;  4XIK A;  5L9R A;  3L9J T;  5KXC A;  4YZ2 A;  1YIF A;  5J37 A;  1CAX A;  1RUC 3;  2ID4 A;  3SHR A;  4EWD A;  3APB A;  5EFU A;  4HG6 B;  2MNG A;  3AP7 A;  3PJY A;  3R05 A;  4AQT A;  3FFQ A;  1RUF 3;  4WM7 B;  4AI8 A;  1FV3 A;  4U2A A;  4CEW B;  2W1W A;  4YVS B;  1Q56 A;  5ISL A;  2E9Q A;  1FOD 1;  1OLM A;  3IAQ A;  4I02 A;  3RSJ A;  3S6P A;  3KHB A;  4KG0 A;  5DMY A;  1VMH A;  4QPG A;  4LUK A;  2NN8 A;  3PVB B;  4QKB A;  2P37 A;  4FSJ A;  1LEM A;  2GC0 A;  3TN9 2;  4ASM B;  4PIZ A;  4RQP C;  5FYS A;  2ZGT A;  4GH4 B;  4JX0 A;  4COW A;  4OHY A;  4IEV A;  4CSW A;  5GJ6 A;  3OUH A;  2XLF A;  4K8F A;  4DFS A;  1WUV A;  2DV9 A;  1CAU B;  3ES1 A;  3OYW B;  4B7K A;  3H8R A;  1QKQ A;  2K9Z A;  4XFC A;  1AR9 3;  1GU3 A;  1LOF C;  5F9T A;  1GSL A;  3QOP A;  2A7A A;  3BIE A;  1OUS A;  4K9S A;  3III A;  4LMF A;  3H1M A;  2R07 2;  4EN6 B;  4XPV A;  4UWD A;  5EHD A;  1D2S A;  3LPF A;  3KD4 A;  3RZG A;  5FCC A;  2XJP A;  1RUJ 1;  2BFU L;  2JKB A;  2X10 A;  3JBG 2;  2YPD A;  5F7U A;  2XKO A;  3FHA A;  1WMX A;  2CWS A;  5I8S A;  2DCK A;  3ZSJ A;  4LLF A;  4QQ2 A;  4AEK A;  3O1R A;  4M01 A;  1W3V A;  5EJ1 B;  1NOV A;  1QMJ A;  2QUO A;  1CZV A;  1DHK B;  1GNY A;  3W59 A;  5F6L B;  2VME A;  1NLR A;  1PZ7 A;  3HN1 A;  3RYP A;  3ZYB A;  5IVC A;  1VR3 A;  4CCN A;  5FXZ A;  1HN1 A;  3LGR A;  4RS5 C;  5LBC A; 
#chains in the Genus database with same CATH homology
 2Y6L A;  4LKS A;  1K42 A;  2E26 A;  3BGA A;  1UMH A;  1GOH A;  5JXG A;  1PMH X;  3I2I A;  1W99 A;  4CUA A;  1JYN A;  2W95 A;  1NUK A;  3VDB A;  2YC2 A;  4JKK A;  5B4X A;  2DDU A;  3GDB A;  4BJ0 A;  1OH4 A;  1TG7 A;  3AC0 A;  3T0D A;  4DEV A;  3DYO A;  3HNY M;  2J1V A;  3WF1 A;  4A44 A;  1W8O A;  3WF0 A;  2VZU A;  1ULP A;  5IFP A;  4W4Z A;  2QQO A;  3CKH A;  1H6X A;  2YC4 A;  2CDO A;  2VO5 A;  3T0B A;  2RVA A;  4OZO A;  5IYY A;  2J7M A;  3MV1 1;  1UY2 A;  4KI5 M;  4W8J A;  2YFU A;  3CIH A;  2B4K A;  4PF1 A;  2VZT A;  3P1I A;  5LA2 A;  1W9W A;  2YG0 A;  1F4H A;  3MUZ 1;  1GOF A;  5EIY B;  3HNM A;  4BK5 A;  2OKX A;  3THC A;  1JYW A;  2QQM A;  4XUP A;  1R64 A;  3VD3 A;  3CZU A;  2JD9 A;  4GWJ A;  2WO3 A;  4TTG A;  4QB2 A;  2BGP A;  3WNL A;  2W1Q A;  1W0N A;  3CDZ B;  5IHR A;  2C26 A;  4OUE A;  4AAX A;  2J1E A;  4CUC A;  2YFZ A;  2BGO A;  4PT6 A;  5LA1 A;  4DUV A;  3OB8 A;  5JUV A;  2WO2 A;  2J1S A;  5G04 L;  2VCA A;  1JZ7 A;  4MGQ A;  2ORZ A;  3E1F 1;  3T08 A;  1UY0 A;  2QBX A;  2VZP A;  2VZS A;  2WUH A;  4P00 B;  1JZ2 A;  4GZ9 A;  2ZEY A;  3WQB A;  1CZS A;  5IFT A;  3OG2 A;  3PUH A;  2JDA A;  1LNS A;  2RJ2 A;  3K75 B;  3MUY 1;  3OGR A;  1JU3 A;  2V5D A;  1JYV A;  4CU7 A;  4D0Q A;  2XON A;  2VZ1 A;  3I2G A;  3UES A;  3A7Q A;  1K45 A;  3W5N A;  2VMF A;  5IJR A;  1JZ8 A;  3GGL A;  3WNP A;  2QQJ A;  4QX3 A;  2DCJ A;  3FHQ A;  4A4A A;  3GM8 A;  4UOJ A;  4XUO A;  1CZT A;  1EUT A;  3FN9 A;  2WBK A;  2WDB A;  5LA0 A;  1UYY A;  3WF2 A;  4CU9 A;  1NAE A;  4RN5 A;  2Y6J A;  4XUR A;  5B4N A;  3VD4 A;  2VZR A;  4XZU G;  3WSO A;  3T0A A;  4E8D A;  1L7Q A;  4P02 B;  4D8M A;  4DXT A;  4MOA A;  3I3E A;  1MPX A;  3C7G A;  1W8N A;  4M4P A;  2JE8 A;  5DPN A;  3A22 A;  4M4R A;  4MGS A;  1CIY A;  4LHS A;  3VDC A;  3OEA A;  2VQT A;  3K77 A;  2W5F A;  2VZO A;  1JZ4 A;  5LCW L;  3I2F A;  2W91 A;  2VZ3 A;  2W94 A;  2WO1 A;  5CZK A;  1JZ6 A;  1L7R A;  3EYP A;  1EUU A;  3HEI A;  5DQ0 A;  1XPW A;  2V72 A;  2Y6H A;  2WN2 A;  4MO3 M;  2BBA A;  4L0P A;  5CYY A;  3FL7 A;  4OYU A;  3HOB A;  2EIE A;  3P6B A;  4GWI A;  2ZEZ A;  4QPW A;  2RV9 A;  3T2O A;  1K3I A;  4IUG A;  3CZJ A;  3I2K A;  2XHN A;  1WKY A;  2WYS A;  4JHZ A;  3VD5 A;  1SDD B;  1W9T A;  1UY4 A;  2BER A;  5JXI A;  4YPJ A;  3K4A A;  4DEQ A;  3IB3 A;  4DXS A;  2XOM A;  2QQK A;  4XUQ A;  4XUN A;  2EIB A;  1T2X A;  4LQR A;  3SKV A;  2ORX A;  1UYZ A;  3WNO A;  1XC6 A;  1P8J A;  4LPL A;  4KWU A;  1H6Y A;  4QDQ A;  3C7O A;  3HPN A;  3MV0 1;  4A41 A;  3A21 A;  5C71 A;  1US3 A;  2WQ8 A;  3K46 A;  1OF3 A;  3A23 A;  1NX9 A;  3LEG A;  2Z4F A;  2QQI A;  4MAD A;  1UY3 A;  1JHJ A;  2JKX A;  5HXM A;  1SHW B;  4DUW A;  3HNB M;  1CX1 A;  2VMD A;  2B9V A;  3SEP A;  3OBA A;  4TXW A;  1JYX A;  2KD7 A;  2WAA A;  2VM9 A;  3K4D A;  2W92 A;  5FUI A;  3I2J A;  3IDA A;  2VZV A;  4QB1 A;  3HJR A;  2ZEW A;  4BDV B;  2YB7 A;  4DUX A;  1XNA A;  3C8X A;  2HYX A;  4JKM A;  4UAP A;  1D7P M;  4ET7 A;  5EJZ B;  3U37 A;  1UY1 A;  2WAB A;  2EID A;  3MO4 A;  4XVH A;  1IQD C;  3SKJ E;  3I97 A;  4DXR A;  4QX2 A;  2E32 A;  3ACI A;  4AG4 A;  2ZEX A;  2VTF A;  4CVU A;  2QQN A;  2ZXQ A;  5C7G A;  3WF4 A;  1ULO A;  3WEZ A;  1O8S A;  2R7E B;  2J1R A;  4UI9 L;  2BZD A;  3VDA A;  2LW8 A;  1UZ0 A;  4KMQ A;  4FI9 A;  1W9S A;  2VR4 A;  4ZZ5 A;  5A1A A;  3J7H A;  2L9L A;  3T2P A;  4ARY A;  4W50 A;  1DYO A;  3MBW A;  3F2Z A;  4XUT A;  4A3Z A;  2E33 A;  3ABZ A;  4BK4 A;  3I2H A;  2X09 A;  5HPO A;  4A42 A;  3C7F A;  3ACF A;  1JU4 A;  5DN2 A;  2VC9 A;  2W46 A;  1KEX A;  3C7E A;  3IAP A;  4CU6 A;  2CDP A;  4BXS V;  3WNK A;  1DP0 A;  4ZY9 A;  4QB6 A;  4QDR A;  2QQL A;  3SEE A;  3LEI A;  5JXH A;  4JKL A;  4E8C A;  1O8P A;  3C7H A;  3ETP A;  1PMJ X;  1KGY A;  2V4V A;  1GMM A;  3DYP A;  4QAW A;  2X05 A;  3WNM A;  1J84 A;  5I0D A;  3I3B A;  4P08 A;  2VZQ A;  3UNP A;  1PX3 A;  3NNG A;  5J1X A;  3CQO A;  1F4A A;  1UXZ A;  3BN6 A;  4A6O A;  2C9K A;  2W1U A;  1UWW A;  1TVG A;  1DLC A;  1SG3 A;  3NJX A;  3NRU A;  2W3J A;  3DYM A;  1BHG A;  1UX7 A;  2VMC A;  4ZZ8 A;  3THD A;  1JI6 A;  5JR2 A;  2VOT A;  2J22 A;  4OMD A;  1WCQ A;  2VCC A;  3K4Z A;  2W1S A;  2VCB A;  5JXJ A;  1RYY A;  3PUI A;  3HN3 A;  5JMO A;  4QX1 A;  4RYD A;  4ZXE A;  2J1U A;  2C4X A;  3EB7 A;  1O59 A;  1YQ2 A;  1OT5 A;  1OD3 A;  2Y64 A;  1I5P A;  1US2 A;  1NKG A;  2EIC A;  2J1A A;  1GQP A;  1JZ5 A;  2PQS A;  1OF4 A;  4PQQ A;  3ZM8 A;  1UYX A;  3D3A A;  2W87 A;  3NQH A;  1J83 A;  2WZ8 A;  3WNN A;  3VD9 A;  1JZ3 A;  2VJX A;  2XQX A;  3WF3 A;  3T09 A;  2J1T A;  3LQC A;  3OEB A;  3GXU A;  3NJV A;  5C70 A;  2ID4 A;  2VL4 A;  3DEC A;  1XNT A;  4HG6 B;  3OGV A;  4QDS A;  3ECQ A;  3LE0 A;  4ARX A;  4P5Y A;  2W1W A;  2W9X A;  2Y6K A;  3IAQ A;  5DMY A;  2WAO A;  5G05 L;  2WZE A;  1K12 A;  1UMI A;  4QX0 A;  2Y8K A;  3T2Q A;  4JX0 A;  3OGS A;  1GUI A;  1GOG A;  3ACH A;  3ACG A;  3W5M A;  1GU3 A;  3I3D A;  2HLE A;  1PX4 A;  3III A;  2VQU A;  3LPG A;  2LS6 A;  3LPF A;  4A45 A;  2X10 A;  5F7U A;  3FHA A;  3UET A;  2DCK A;  2E31 A;  3JXS A;  5EJ1 B;  2W47 A;  1CZV A;  4OMC A;  1GNY A;  1UXX X;  2VME A;  3VD7 A;  2WN3 A;  4Z2A A;  3CMG A;  4CU8 A;  1HN1 A;  3LEK A;  4CUB A;  2Y6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...