2WO2A

Crystal structure of the epha4-ephrinb2 complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
178
structure length
178
Chain Sequence
TGEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKRTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
molecule keywords EPHRIN TYPE-A RECEPTOR
total genus 36
structure length 178
sequence length 178
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wo2A00
3IB3A 1KGYA 1OT5A 3OBAA 2W3JA 1MPXA 2VZRA 1WKYA 2VL4A 2BGOA 4KMQA 2BZDA 2VZPA 3OG2A 2YB7A 2YG0A 4L0PA 2J1EA 4KI5M 4ZZ8A 1UYZA 2QQKA 1T2XA 4QDRA 3I2FA 5A1AA 3WNMA 3LPFA 3A22A 3JXSA 3CZJA 1UWWA 1OH4A 2WABA 2HLEA 2Y6LA 1JZ7A 3LEKA 4KWUA 4MADA 4JX0A 3HPNA 1UYXA 2WO2A 3K4DA 3ACIA 2LW8A 1EUTA 2ZEWA 3WF1A 4DXRA 2CDPA 5I0DA 1GUIA 2Y8KA 4CUAA 1L7QA 4QPWA 5C70A 1F4AA 1GNYA 2WAOA 3SEEA 3WQBA 5JXJA 2J22A 3LEIA 4MO3M 1UMIA 2EIDA 1OF3A 5B4XA 2VZUA 3IDAA 3THDA 4ZZ5A 2WZEA 3F2ZA 3T08A 1GU3A 4ET7A 3T0AA 2J1RA 4QDSA 2KD7A 2EIEA 3MUY1 2W1QA 3HNMA 2JD9A 4MGSA 1JZ4A 4UAPA 1UY0A 3AC0A 2VQTA 4A4AA 5HXMA 2W1WA 3MV01 2W1UA 1XNTA 1US2A 3I2IA 3DYPA 3P1IA 3VDBA 4ARXA 2ZXQA 2Y6JA 3W5NA 4GWJA 1BHGA 2EICA 3MV11 3C7EA 3WF4A 3UESA 3C7FA 4JKLA 2XONA 3I97A 3ABZA 4QB1A 4D0QA 2WZ8A 3WF0A 5IJRA 3EYPA 4CU9A 2QQIA 2YFUA 3DYMA 3MBWA 2BERA 2VMEA 1UY1A 2ZEXA 3P6BA 4LKSA 3ZM8A 1GOFA 1NAEA 3VD3A 4LHSA 4P5YA 2X10A 3WF3A 3GXUA 3CKHA 2QQJA 4DEQA 5G05L 2CDOA 4XUTA 2WBKA 2VZTA 1UY2A 4XVHA 4CVUA 2J1TA 4OZOA 2E26A 5LCWL 3IAPA 4D8MA 2HYXA 1XPWA 1US3A 1PX4A 1W0NA 1YQ2A 1JYWA 2W92A 4GZ9A 4PQQA 3ETPA 4TTGA 5C7GA 4JKKA 2VOTA 2E33A 4P08A 4XZUG 4DEVA 5IYYA 2YFZA 5B4NA 3T2PA 2VM9A 1SDDB 1EUUA 3ACHA 3I2KA 1JZ6A 2ID4A 4UI9L 4PF1A 4BJ0A 1SHWB 4XUNA 3A7QA 5LA1A 4QB6A 4E8DA 4P00B 1O8SA 4XURA 5J1XA 1JZ2A 2W95A 4QX2A 1R64A 1NX9A 5JXGA 3HEIA 5EIYB 1JHJA 4AG4A 2W9XA 3WNLA 2WQ8A 2RV9A 3HJRA 5CZKA 1DLCA 2C26A 4LPLA 2VZSA 1CX1A 1W8NA 3T09A 3FHAA 5JR2A 3J7HA 4BXSV 3I2HA 2Z4FA 4Z2AA 1OD3A 4CU6A 2DDUA 2VCBA 5EJZB 3SEPA 3EB7A 3WSOA 2W5FA 1J84A 3T2OA 3UNPA 5DN2A 1JZ3A 4OMCA 2E31A 2WO3A 3LEGA 4M4RA 2C9KA 3THCA 4RN5A 2X05A 4QB2A 4XUPA 3WEZA 2BGPA 3C7HA 3MUZ1 4ZY9A 4QX1A 5CYYA 1K3IA 5G04L 3I3EA 2WYSA 2Y64A 4XUOA 3K46A 2VZOA 3FN9A 3MO4A 2VZ3A 1UZ0A 2QQNA 2QQOA 3FHQA 1RYYA 2WN2A 4DUXA 3BGAA 2VCCA 3DYOA 3OGRA 1XC6A 2VJXA 3T0DA 1NKGA 2RVAA 4RYDA 4OYUA 5JXIA 4A45A 3CMGA 4BK5A 1UY4A 1JU3A 1OF4A 1W9WA 4JKMA 4QAWA 1CZSA 1GMMA 3K77A 2WUHA 3DECA 2VMFA 2YC2A 4PT6A 2JDAA 2XQXA 3GM8A 1UX7A 3OEAA 2B9VA 2VO5A 3K75B 4HG6B 3E1F1 2JKXA 4W8JA 3VD4A 4IUGA 5HPOA 5IFPA 1D7PM 2ORZA 2VMCA 3VD9A 2QBXA 3I3DA 1UMHA 1UY3A 1W9SA 2VZVA 2VTFA 2XOMA 4XUQA 4A42A 4LQRA 4M4PA 1O8PA 4BK4A 1HN1A 2VR4A 5LA2A 3IAQA 3FL7A 3PUIA 5EJ1B 5DPNA 4DUWA 1TG7A 2WN3A 3VD5A 1GQPA 1O59A 2BBAA 1TVGA 1ULPA 4DXTA 1JYNA 4UOJA 5JUVA 4ARYA 2PQSA 2W91A 2YC4A 3NJXA 2VZ1A 2EIBA 2E32A 3WNKA 3I2JA 3HNBM 4BDVB 4MGQA 3C7OA 1P8JA 2W94A 1JZ8A 1NUKA 1K12A 5FUIA 3ACFA 3CZUA 1F4HA 2Y6GA 4CUBA 2V72A 2WAAA 2VQUA 3OEBA 4W50A 2V4VA 5JXHA 1W99A 4P02B 1DYOA 4A3ZA 2DCJA 1K45A 2VMDA 1GOGA 4QX3A 4CU8A 3BN6A 1DP0A 1K42A 2J1SA 3CDZB 3OGVA 2ORXA 2W87A 2X09A 1JU4A 4MOAA 1SG3A 3UETA 3VD7A 1GOHA 5JMOA 4GWIA 3WNOA 1UXZA 2QQMA 2W46A 1CZTA 5F7UA 3WNPA 2J1UA 3ECQA 4ZXEA 4YPJA 2JE8A 1PMJX 1L7RA 3CIHA 3LE0A 2XHNA 4DUVA 3GGLA 1PX3A 2QQLA 3A23A 3GDBA 4A41A 1JI6A 3OB8A 3I3BA 2B4KA 3T0BA 2C4XA 2R7EB 3CQOA 4CU7A 2VZQA 3I2GA 2W47A 2J1AA 5DMYA 1LNSA 1CIYA 4E8CA 1W9TA 3HNYM 1H6YA 3W5MA 1CZVA 1UXXX 1WCQA 3T2QA 3IIIA 3NQHA 3C7GA 3WNNA 3WF2A 3HOBA 1W8OA 1J83A 4AAXA 4OMDA 1IQDC 3K4AA 4JHZA 1PMHX 3NRUA 5IHRA 4QDQA 3HN3A 3K4ZA 2VCAA 5DQ0A 1JYVA 2J7MA 3C8XA 1ULOA 2WO1A 1JYXA 2Y6KA 3OGSA 1JZ5A 2ZEZA 1UYYA 2W1SA 3PUHA 3SKVA 1I5PA 4A44A 2ZEYA 4CUCA 3NNGA 5LA0A 2V5DA 4W4ZA 2LS6A 2J1VA 3U37A 1XNAA 2L9LA 2VC9A 3VDAA 3D3AA 3LPGA 3VDCA 3SKJE 4QX0A 5C71A 2OKXA 3A21A 2Y6HA 2DCKA 4OUEA 1KEXA 4FI9A 3NJVA 3LQCA 1H6XA 4A6OA 5IFTA 2RJ2A 3ACGA 4DXSA 4TXWA 2WDBA
chains in the Genus database with same CATH superfamily
2JX9A 1UO9A 3HN1A 4HONA 5CIRA 1J3RA 1KGYA 1N3PA 3HBZA 4CZSA 1QDOA 1CAVA 3B01A 1OT5A 5FZ3A 4GMP1 2VUCA 4AFBA 4LLOA 3OUHA 2JJ6A 2BGOA 3RI8A 3I8TA 3ES4A 4P9JA 3ZFEA 4NHKA 2YB7A 4L0PA 3S6PA 2LTNA 4P14A 4KI5M 4JC1A 1ULGA 5K0UA 3ZR5A 2IXKA 3AXDA 4K40A 2IXJA 5A1AA 1BMV1 2JG9C 3LPFA 1OA2A 1V70A 1PZ7A 2WZPP 3H3ZA 5LEJA 3A22A 1UOFA 1UYPA 1RHI2 3CZJA 2VNVA 1W3VA 4MLOA 1H1IA 4XTPA 2HLEA 5L7OB 4KWUA 3ZYFA 2WKKA 5ABJA 1IS6A 3RGBA 4CEYB 1QEXA 5CFDB 1Q8VA 1IZ3A 1R091 3DV8A 2PA7A 3ACIA 1SPPA 1WLWA 2ZEWA 5A6YA 1G8WA 2EXIA 4GQ7A 4Y1XA 4DFSA 2A6XA 4CCCA 3OBZA 2BGCA 1OH3A 2H6BA 2ZGTA 1FATA 2UWAA 3N7MA 1IS3A 4Q5OA 5FYCA 1G9AA 3O1UA 2OPKA 1G9BA 1GP4A 1F4AA 3GZUC 3SEEA 5JXJA 5CKMA 3POEA 4ZS3A 2EIDA 4B4PA 4HN0A 2P5BA 4LOSA 5A7WA 3CF6E 4U36A 3THDA 1OI6A 4EQVA 5I8YA 4Q4Y1 4RSUA 3T08A 4CP0A 3VZKA 4XF0A 1UF2C 3MW2A 1N3OA 1S0DA 2KD7A 3NMBA 4QDSA 2EIEA 4WM8C 2RJKA 4NIGA 4YGDA 4XDQA 2D5FA 2D98A 1CAXB 2BTVC 4OI4A 4YG3A 5L7OA 1ZZBA 2VULA 3UK9A 2E53A 2Z42A 2BVVA 2YYOA 1JZ4A 1HQLA 3NAPB 4Q4Y3 4RFT0 2VVEA 4UAPA 4Q4W1 1A6CA 2IXIA 3AC0A 3TAYA 1W2OA 3AFKA 4JTOA 1UU4A 2GMPA 5FIXA 4A4AA 1UZVA 1AR93 2I74A 2QFEA 2W1WA 3MV01 3UYJA 4QKDA 4MXVA 3B9CA 3NW4A 2D40A 3P1IA 4NHYA 3VDBA 4ARXA 3VBOA 2ZXQA 1HRV3 2RS13 2ZTNA 3RJ2X 1PGL2 3U07A 3W5NA 3UGFA 1BHGA 2EICA 3UL2A 4YM2A 3O1SA 4N7UA 3C7EA 1QKQA 2YROA 4Q4V1 4JKLA 3I97A 1KXGA 2A70A 4Q4V2 5LRSA 2VY0A 2Z69A 2P3YA 5IJRA 5AVAA 5CBLA 2YBPA 2YFUA 5EYXA 1FXZA 5BNPB 4M3CE 4E2SA 2A3WA 1Y9QA 3ILRA 2LUWA 3ZO0B 1UMZA 1VAMA 5FFOC 4DIQA 1BVVA 2Q30A 5FRAA 3VDDC 1PVC1 2FCUA 1CAUA 1VB4A 1GOFA 5F37A 3RZJA 3OSDA 1SLCA 4LXLA 1VBD3 4Y1VA 4GB33 1C28A 3AP9A 4QHZA 5F9TA 5JCTA 2P3JA 3SHRA 5A7SA 5CADA 1KS5A 5K0UC 4KU8A 1XXNA 4R9AA 1SMVA 4DEQA 4BISA 1QNYA 1OVPA 2CDOA 3BOPA 4XUTA 5CU1A 3KSCA 1K5MB 4P9WA 4BPZA 1F2NA 3OPTA 3M4FA 3POFA 3LIGA 3KD4A 4QKBA 5EPAA 4XVHA 1MS0A 1NE4A 2VPVA 2VOWA 1DQ6A 2XBO2 5LCWL 1DF0A 4D8MA 3AMNA 1IGOA 1W0NA 1RUOA 3WQ0A 2XMLA 2FDIA 3UJOA 4AEDC 1REEA 4Q1PA 3H1WA 5I8SA 1GFF2 4LBOA 4B8EA 3DPRA 2HWD2 1YIFA 3KV4A 3OYWA 1YI9A 5FWJA 4XACA 1WA6X 1ONAA 1S0FA 4JKKA 4MGTA 4YGEA 3RZLA 2IZWA 1HXS3 5AC91 4LBQA 4W6XA 1YFYA 5GJ6A 4M0NA 3O1OA 4QQ2A 4Q0QA 4P9GA 2YFZA 1SBEA 1OLRA 3D6EA 3ACHA 1AVBA 2ZGOA 5GZGA 4CXYA 1BYHA 5FZFA 1JZ6A 4UI9L 2GNTA 4BJ0A 1SHWB 4Y5TA 2RS53 3LDKA 1DCSA 1CGPA 1IPSA 2BRTA 4QB6A 3QH7A 2A6VA 2A71A 4P00B 1O8SA 1FX5A 4XURA 3AM2A 3ZSKA 3QACA 5J1XA 1JZ2A 1UOJA 1N1SA 1X8EA 2NLRA 4QX2A 1R64A 4H7LA 3MICA 5C4WC 3WG4A 2RDRA 2V09A 5A80A 2FMYA 4R9DA 5GZEA 2WNVA 1OOPC 3IKWA 3J8F3 4YZ3A 3N3HA 3R6SA 3ZDSA 4JCKA 3W58A 2FD8A 1AXZA 1JHJA 3MIDA 4D6RA 5AC93 3B69A 3HJRA 1RUNA 3OYWB 4RQPC 3PURA 1UOBA 4NN0A 1W39A 4AQSA 4UW6A 1JUHA 5FBZA 5KHJA 3IIAA 3LIHA 5C8CA 2E51A 1NA1A 4MUVA 1EY2A 1E5SA 2DVGA 2HWB1 2DDUA 4Q4X3 1YQCA 1Q8SA 4TN7A 4ZXKA 5HBAA 4JZRA 1WW5A 5FY4A 5FZ7A 2Q8CA 5EJZB 3SEPA 3VB9A 2G9ZA 5FZOB 2BP6A 4UF0B 4COWA 3B7MA 5LBBA 4A7YA 1C8M3 4YW6A 1UU5A 2RS11 3T2OA 3GCWA 3V0BA 2YPJA 2GMEA 1U5IA 3O7OA 4OMCA 4GB31 1G9CA 5FYZA 1C57A 1HB4A 2ZBJA 2NMNA 4FQ4A 2XJRA 4YG0A 3THCA 1W06A 2X05A 4QB2A 1EP0A 1NCRA 3FBYA 5H9PA 2ARCA 4V1PA 1VE0A 1HB1A 3OD0A 1ODMA 4FP2A 1QJU3 3ASIA 4XCAA 5FY1A 5LBCA 5CFCC 3LEMA 1QXJA 2WYSA 4COUA 3A4UA 3WD5A 1AL0G 1JN2P 2Y64A 2CHHA 3NJZA 2JWPA 1VMHA 3VBOB 3VBUB 4COZA 5JOZA 3D0JA 1W6QB 3FN9A 4B4QA 1V6NA 2R30A 3SCFA 1HQWA 1FMD3 2D3SA 2QQOA 3PU3A 5FPBA 5FY7A 2ARXA 1RYYA 5JIAA 1HIXA 1QOTA 3VBOC 4X6RB 3NV4A 2VCCA 3RI9A 1RTVA 3T1MA 2YHJA 3OGRA 4IV3C 5EV7A 3HAGA 4AQTA 5IK4A 1YQ6A 3APBA 4AEJA 2XWJB 5JXIA 2RE9A 5LZ6A 3CMGA 5FUNA 1XE0A 1JU3A 1AYM2 1JW6A 1ZBE3 2WFPA 3VBFA 5DAQA 2WJSA 2N7GA 1PIV2 2CL2A 5C6CA 3N4MA 1AJKA 1WMXA 2P6CA 4QD2A 1N1TA 2VBPA 4HLTA 4Q8LA 3FHIB 2VMFA 2RS32 1GLHA 2H0VA 5GLVA 1QMJA 4Z07A 4AK3A 1NCQA 1WCDJ 4AFMA 5JZGB 5L9BA 1MS9A 3PLQA 2VO5A 3TEYA 4HG6B 5KR7A 1FMD1 3E1F1 2CGPA 1ZRIA 2RS31 1L3JA 2JDMA 3WW3A 4I09A 2ZHLA 1BBT1 2Q0AA 2ZZQA 4D69A 3I3DA 2WC2A 4B7EA 2VE1A 4XUQA 1W9SA 2VZVA 1RUI2 1ZBE2 1TZOA 2R6QA 1STMA 4LHKA 3WP3A 1EPZA 2VW1A 2B39A 1W9FA 5ERLA 4AI9A 1HXS2 3H1MA 4B1MA 3IT8A 4QPGB 2YBSA 2RS33 3JB8A 5C3PA 1DQ1A 2RM22 4LR4A 2DCZA 3PUIA 1QQP2 4NPLA 4N53C 1H8VA 2GC1A 5KBFA 5BV6A 1C8M1 2WA3A 5FZ8A 5DZGA 2ADDA 2RHPA 1EYBA 3H7YA 5A33B 1YXWA 1O3RA 4AVTA 1GQPA 2YZ4A 4LE4A 4E4ZA 3B93A 4GMP3 3MW3A 5FUPA 2BBAA 2A6ZA 2GDFA 4F3JA 4AFAA 4RHV1 1JYNA 1GBGA 1GWMA 4Y22A 1SACA 2VTXA 4H3WA 4ARYA 4E4HA 3ZMNA 2W91A 3ZR6A 2XBO1 3RMXA 3ZSEA 3RYPA 3OUIA 3I2JA 3HNBM 5C8CB 3H8OA 1P8JA 2XXZA 1Q8OA 3VKOA 4CDUB 4PF5A 2ET7A 2AZ5A 1RL3A 2BFUS 2CAVA 2V72A 2V5YA 4LK7A 4EN9B 2JD4A 1OLME 3O5SA 4QHOA 3S5QA 1X8MA 2WWJA 3MFAA 4Q4X2 5E88A 2ZPXA 3RG0A 2DUPA 3GBFA 4UFLA 4UFKA 1POQA 2DCJA 1J3QA 1HJFA 3BPZA 5EHDA 4Q8KA 1VBB3 2ZX0A 4QX3A 3H8UA 4UF0A 4PBPA 1Q43A 4XILA 1PK6C 2DCTA 2HJIA 3E5UA 2I07B 4OUSA 3CDZB 3OGVA 3RWKX 1PNFA 1XYOA 3AZYA 1LHNA 1VBA1 1HLCA 4HKOA 3CU7A 4H55A 1LOCA 3NAPA 4Z2WA 1UQXA 4PLOA 4AQ6A 4P5HA 1SG3A 2R1DA 3IZOA 1J3PA 3VD7A 3FFQA 4Z1VA 1XE7A 3AYEA 4PIXA 1M06G 1G6NA 4RR3B 4NJ4A 2XL7A 3SQOA 1JOJA 4AVCA 5F1RA 1S4CA 1AL21 1C8NA 3IWZA 4NHMA 1Y3TA 2FHRA 1AL22 2CY6A 3TYJA 4TLGA 1AR61 2C0ZA 2X29A 2XJVA 5HV4A 1ASJ1 1RVF1 3IBMA 4O9EA 3W21A 1OC1A 5JOXA 2UWBA 3DF0A 4F8AA 1VBC3 5HV0A 1KDKA 3GDBA 4P9YA 2PTMA 1LCLA 2B4KA 2PHFA 5FYIA 4N53A 4B1LA 4AI2A 1Y43B 5FYYA 2DV9A 1HV0A 1Z7S1 3CQOA 5FZMA 3I7DA 4BA6A 2IXLA 5C3QA 4I3GA 2J1AA 1XNCA 1LGCA 3MIHA 4IE6A 5DMYA 1I5ZA 3PJYA 4QQPA 3WR0A 4E8CA 1W9TA 2Y60A 3PUSA 3AMMA 3BCWA 3WG3A 2WR9A 4XFHA 1PM4A 1AYM3 2GN7A 5DDJ3 1KFXL 4IXLA 2HWF3 3JUUA 5FPVA 3TEWA 3NQHA 4PBOA 2QQVA 4HVRA 5KHKA 3WNNA 3O1MA 4LT5A 3E6BA 5GKAC 5IW0A 3OGJA 1W8OA 2NN8A 3WT3A 4AAXA 3DL3A 3E6DA 1A8DA 1Z0HA 4AGGA 4CCMA 4AFDA 2D6PA 1QJY3 1F5JA 5IHRA 4QDQA 1H2MA 3HN3A 4IE7A 5A70A 5FP8A 2J7MA 1W2UA 1O3SA 2WT2A 1LOFC 1UU6A 1ULOA 1DHKB 2Y6KA 3OPWA 3AX4A 2ZEZA 2VNRA 1AYN2 4MSVA 3O0XA 5T55A 3USSA 4K3UA 1UYYA 2W1SA 3PUHA 4CCEA 2XR4A 2PAMA 2WWSA 4GULA 2JG8C 1FV3A 1W3XA 1NLSA 1NE6A 3HR9A 3JU9A 4RGGA 4XQDA 4W4ZA 5HCBA 1U5YA 1GNZA 4YFWA 5HCHA 1RIRA 3U37A 3IDEA 2JE9A 1JHNA 1S0BA 1XNAA 2JENA 2R49A 2CAUA 1UZWA 2JDHA 3LFMA 3MDPA 4PIYA 4OI1A 4QX0A 3S5AA 3T4VA 2Y6HA 2TNFA 4IESA 5D8AA 3BTXA 5J48A 3JB4C 4X6QB 4F7ZA 4FI9A 4Y22B 3SH4A 3ZYIB 2A75A 4FSJA 1H6XA 4KGGA 3I3QA 4IV1C 4WVZA 4YGCA 5FK7A 3WP5A 1H1AA 3MEPA 5FDBA 1IPKA 2TUNA 3SH3A 2B8MA 2W68A 3FJSA 3VN4A 1VBC1 4NIHA 3M2MA 4C1WA 4MH0E 1GWLA 3OBAA 1KDMA 5IWFA 2VL4A 4KMQA 4R8HA 1W6NB 2FCVA 1CD3G 1RMU3 2BZDA 4A7ZA 4CXWA 2JECA 2Q1MA 5FPAA 3KQ4B 4YVSA 2J1EA 3ETQA 3JD71 3MPBA 4ZZ8A 4J25A 4QKNA 1UYZA 1FV2A 1AR71 1T2XA 5C9AA 1UKRA 3I2FA 3ZXEA 3ST7A 3BUCA 2R1BA 4JRAA 1AR72 4UFJA 1PGW1 4QT6A 1RUF1 5BNNB 2UU8A 1I3HA 3AKRA 1IG0A 3N7KA 4Q1RA 1ZYBA 1ZRCA 4RQPB 2FMDA 4FO9A 5IT6A 5FMOS 2E7AA 5DG1A 2VECA 1UAIA 3GJAA 3THTA 3X29B 1AJOA 1WUVA 2KR2A 4PIZA 1UYXA 2WO2A 3VDDB 1YEWA 3SXWA 3EJKA 4U2AA 4LIVA 3WF1A 2PN5A 1VR3A 4CEYC 1VBB1 3UJQA 4XJWA 1DQ0A 5DUWA 1DQ4A 1IS4A 4CUAA 4QPIC 1GR3A 4JDOA 1L7QA 1VBD2 4W65A 3HT2A 4BMBA 2GZWA 2Y0OA 5C70A 2YUEA 1IPJA 2OPWA 3ZXGA 3WG2A 3WQBA 1R092 1XSQA 4DMIA 2BWCA 3EMRA 5CFCB 1ULEA 2HBTA 3I2DA 3VGIA 2PHDA 4SBVA 4AHZA 1DLLA 1W03A 3UT0A 3KGZA 1YLLA 2AREA 1GU3A 1HQNA 2NYYA 1WBLA 2XBO3 1UIKA 4DO0A 3ROUA 1R1A3 2PHRA 3IMNA 4OQ8A 4YARA 2R32A 4LLFA 4MGSA 3KT7A 3SISA 3U14A 2WNOA 4FPGA 2HWD3 3WUCA 3NL1A 3CLPA 2JEMA 3KZ4C 5F8PA 2D43A 3U78A 2UY8A 2ZKNA 1COV2 4JAAA 4BYYA 3DCQA 4L99A 3ZXJA 4L9BA 5I0TA 3T3YA 5CB7A 4XCBA 4UYBA 2W1UA 3M3CA 4YWAA 4GH4B 4B3NA 2WSUA 3NAPC 4ZPIA 5DAXA 4L11A 4NO4A 2RS52 1H8TB 4LO8A 4YRDA 2KM2A 4WVMA 4XHBA 1J1LA 1ND2C 3DN7A 3U10A 3MV11 1E5IA 2YY1A 3WF4A 5L9VA 1VRBA 4UFHA 1YJLA 4MXWA 2XONA 4V2WA 4JGZB 2WZR3 3USUA 4D0QA 1TMF2 1UZZA 1QJY2 2NPIA 4JDMA 1OA3A 4CDWA 4CU9A 5HCFA 5C9AC 1RMU1 4FPLA 2B5HA 3CJIB 2BERA 2UYAA 2B45X 1AYN3 5HI0A 3ILFA 1HV1A 2ET1A 3AKSA 1OPMA 2QDRA 2HWD1 3I59A 3LOBA 3PTYA 4GA9A 2QQUA 4HFSA 4LKSA 2QJVA 5JWPA 2BU9A 1NLQA 4P5YA 5A3WA 4JHTA 3CKHA 4D7YA 1LGNA 5IVCA 1NA1B 1W6PB 1MACA 2BEOA 2NZ9A 3ATGA 5CVRA 3NO8A 4X8PA 2VZTA 5A33A 4R4XA 1PVXA 5T54A 1MZFA 5JZGA 5DABA 5DZEA 5K9YA 1KRIA 2LM3A 3QD6A 3VKNA 4CVUA 2A3XA 1T6GC 2E26A 2PQQA 2DCYA 3IAPA 4MGYE 5BXXA 4ASLA 3THPA 4CUGA 1US3A 2A5ZA 5FO9B 5DAPA 1JYWA 3ENRA 3KS7A 3OPZA 1VLNA 2HWF1 2CWSA 5HCAA 2EIGA 3WZ1A 1OD5A 3HT1A 3WV6A 1QJFA 5C7GA 5E89A 5A1FA 2VOTA 4DEVA 4KU7A 1R082 5CFDA 4C0BA 5L36A 2IXHA 2D97A 2R063 2VU9A 4NUBA 1OKOA 4Y20B 2ZGNA 4AGVA 5FYHA 1D4M3 1EUUA 1JS9A 4RGAA 4TLFA 1MR5A 3AFGA 1FMD2 5FP4A 1OLMA 4S2DA 4HPKB 2FDHA 1AX0A 4GMP0 4P9IA 2D93A 4E2QA 4CXXA 5C9AB 4BH9A 1AR73 2ILMA 4NIDA 2F17A 4DRVA 4XIOA 3BTYA 2W95A 4KH9A 2GC2A 3ZDVA 3SNMA 1WA4A 5ACA3 5FYUA 3BPSA 4XEZA 1TNFA 2VAUA 2XJQA 1RUC1 5F32A 1IG3A 2EXJA 2P2KA 3PVEA 3VDDA 4BOWA 2WNUC 3HEIA 1V6KA 1DDLA 3IM0A 1R083 4YM3A 3WQ7A 1X33A 2WLPA 2CSGA 2YDEA 1CPMA 4GALA 2VBDA 4RR3A 4IQPA 2EF6A 4AI3A 1DYPA 3M7AA 2A6WA 1FAYA 5F39A 4IE4A 4MX3A 1WMFA 1W8NA 5JR2A 2JDZA 4HVOA 2RS12 5FCCA 3ZFGB 3RZHA 3GZAA 4D6SA 1O4ZA 1XE8A 1HN0A 2A7AA 3B94A 1MQTA 3I2HA 1S0CA 2ZOEB 4CU6A 4CDXC 1V9U2 2TBVA 2DVAA 3HQXA 1J1TA 2D3RA 2Q1FA 4IE5A 4E4DX 4Q4V3 3EB7A 2CGNA 2WNUB 4JRLA 5JAXA 3WSOA 4JGYB 2W5FA 1AZDA 4CDWC 1JYCA 3SMHA 2BNOA 2P3IA 1DZTA 1ENSA 2VCMA 1ODNA 2WO3A 1GICA 3LSEA 4RN5A 3VBHA 4YW3A 1IS5A 3P3PA 4CA9A 1RUI1 1WMEA 2UYBA 1W05A 1X36A 4QX1A 2XJPA 1K3IA 5G04L 4XDPA 2ES3A 4CCNA 1AR83 4Y1ZA 1DQ5A 1SBFA 3Q9OA 4AQ2A 4BB3A 3OY8B 3IPVB 3K46A 1RUH1 2DU0A 3L2YA 4QXCA 1KD7A 2RM21 2CWMA 4RGKA 2DFCA 1YWKA 3SCGA 1Y4WA 4IEWA 2AYHA 1H4GA 4TZDA 5FJHA 1PVC2 1S2BA 1H8TA 1ND3B 5J09A 2ZJCA 4DUXA 3CHXA 2XVGA 3QCWA 3AKPA 3NV1A 2KA3A 4IGQA 4XBQA 2G4IA 4NVPA 1MZ5A 1AYM1 1ST8A 1A34A 3T0DA 3WDWA 4RYDA 3ORJA 4ZS2A 3FC0A 3CL1A 1AR82 4BE3A 4OYUA 4NRMA 3K2OA 5C8CC 3ZYBA 3JCIA 3A0NA 4LBQB 2Q5TA 5I0UA 1C5HA 1V6LA 5AVPA 5FQ0B 5FY8A 4N90A 4E9KA 4AVSA 4Y5Z0 1W8UA 5FKBA 4IW3A 5FZ6A 1BQPA 3WW1A 5L73A 1KS4A 2DUOA 2F4LA 4OHYA 4QAWA 4LHLA 2JKBA 4IERA 2WUHA 4MGKE 3KM5A 2O8QA 1VMFA 2VOKA 1VIWB 4LBQD 4QGLA 4AEDA 3ME2A 4A7KA 2YC2A 5T50A 1G9FA 3AMHA 5IVJA 5KC6A 3M3EA 5APAA 5GZDA 1ASJ3 1RVF3 4CPBD 3OEAA 1O3TA 4BIOA 2RR13 4B29A 2BWAA 2QDNA 3V0AA 3O1TA 3LGRA 3PIGA 5H9RA 2JKXA 1W6MA 1LOAA 3MIFA 4Y24A 4GKXA 3VD4A 1CJPA 4IUGA 4LBLA 3I2OA 4MZUA 5HPOA 5FMOL 1VRH1 2ORZA 1QWRA 1AXYA 4AHWA 2JB8A 2QBXA 3ES1A 4ISQA 5ACA1 2XDVA 1UMHA 3U4XA 1UY3A 2XOMA 2VXRA 1CAWA 2PHTA 1LENA 3JQWA 3JZVA 4FCAA 5EP9A 1BCXA 4LBJA 2Y38A 1OFSA 5IVYA 1O8PA 4CPBA 4HPKA 5A7QA 1O6UA 3ZYPA 1AL23 5FYSA 1ND3C 3IAQA 1G86A 5ANNA 1ASJ2 2IWGB 1RVF2 1V00A 1Z7S2 1C8M2 4GH4C 1C4RA 5DPNA 1UX6A 2EA7A 1WZXA 4FFFA 2YU2A 4E27A 2A6YA 4QU1A 3RSJA 2FCTA 1TG7A 4WZFA 3JBG2 5K0UB 5D8AB 3GALA 4CEYA 1V6OA 3ZPYA 1QXRA 5FXVA 4X8NA 5A3PA 2BOIA 3M8LA 1ALYA 1DYKA 3R4SA 1NCRB 5F5QA 2CV6A 3PTRB 3AP5A 1UCXA 4DXTA 1QJU2 1H2KA 4UOJA 5FJKA 2X5IA 2GNDA 2PQSA 1TE1B 4LKEA 4WM7B 4J6GA 5ABJB 2FBEA 1NY72 4ZKTB 2VZ1A 3TNQA 4KG8A 4XAEA 4XXAA 2E32A 5FZGA 3WNKA 2HEWF 4MGQA 5GZFA 3C7OA 3VBRC 1WGPA 1NUKA 1K12A 5FUIA 2HWF2 2HEVF 4EJRA 4CDQA 4CUBA 4IEZA 4GWNA 3VBSA 3VV1A 4I2OA 4FBFA 1WCSA 4FTSA 5I0RA 1V9U3 4IEYA 1W99A 3AVRA 5GLZA 1K45A 3Q8CA 1SEFA 1NLRA 1WMDA 5FZKA 5I91A 2WNUA 4CU8A 1XJAA 2J1SA 4LK6A 4NHLA 3PMEA 2JICA 2GH2A 4TWTA 1YHFA 2C6SA 3VBRB 1F5FA 1JU4A 1LEDA 1POV1 1GV9A 4Q26A 4MOAA 4AGRA 3NKGA 2Y0IA 5FZAA 4IGPA 1UN1A 1HB2A 2ZKLA 3MLKA 4LHNA 1JYIA 1PIV3 1ZNPA 3PU8A 2GN3A 4KG0A 4QHBA 5GALA 2FDGA 3VL8A 1UXZA 1Q56A 1PO12 4WZCA 5A3NA 3S57A 1RJ8A 2JB4A 5C5TA 2VD7A 4YYOA 1YUDA 1QDCA 4XBLA 4I01A 4XMIA 4QQLA 2R061 3AKTA 1WCUA 2FZ1A 2MPFA 4XE9A 3Q8EA 2R071 5GM0A 4AR2A 1L7RA 1RXFA 1VALA 2XHNA 4AHXA 3GGLA 1PMIA 1JBCA 2QQLA 3WDXA 4A41A 4B4RA 2ZCWA 4XQWA 1HW5A 1REFA 3OB8A 3DGTA 3HWJA 4PDWB 2D3PA 2C4XA 1H8TC 1W8ZA 1N3QA 4CP9B 1YNAA 1XU1A 3G7DA 1XYPA 4EN0A 4XJ9A 2F4PA 1LHWA 1QHDA 2W47A 4QQHA 1MZEA 1AX1A 1OOPB 4ISRA 1AF9A 4NE9A 2D6MA 2DTYA 3WUDA 3TEXA 5JMCA 1YIPA 3NWKA 3BIWE 4XJZA 1RUF2 4LKDA 4OFGA 5FO7B 3WDVA 4NPRA 2LRPA 5DZFA 2PFWA 4M0HA 3VBFC 2K9ZA 1WLDA 4MG2A 4XFIA 2JE7A 3N9LA 1UD1A 3HOBA 3LWCA 5F5CA 1PO22 1XB9A 2O1QA 2VMGA 2ZS6B 4BQWA 1ZVFA 1S0GA 2I2SA 3H8XA 2A73B 2AH2A 2Q4SA 2QZ3A 5DQ0A 4CP9A 3OTFA 1EAH3 1V6MA 3GHNA 2G1MA 5GLUA 5F2WA 3GF6A 1IOAA 2MEV2 3WY6A 1JZ5A 1B35B 2BUKA 3G6JB 5IUQA 4BZ4A 2DF7A 1U0AA 1CQ9A 4JDNA 4WM8B 5LWBA 1BKZA 4JTNA 5FXWA 1K5JA 3SKVA 3I59B 2AGSA 2R073 2Q1ZB 4OHXA 4PI2A 1GZ9A 1QJX1 4A44A 4RS5A 3MGUA 4YM1A 4URTA 4UFIA 3NNGA 3QOPA 2BW8A 5LA0A 1YQ5A 1PO23 2J1VA 2EXHA 4QX7A 5FZ1A 4EV0A 3IMMA 4NMIA 3BTZA 4C0HA 4CDUA 1BVP1 5FZLA 1QNWA 3SKJE 4DRRA 1LOGA 2XJTA 5K4LA 2OKXA 3A21A 4R9BA 3FX3A 5DG2A 2D6LX 4N43C 3AZXA 3JBG3 4XF1A 2O0OA 4Y4RA 3FUQA 2AEYA 2JXAA 3NJVA 1OMIA 1VRH3 2X5IB 5T52A 1VAKA 3WVJA 3ACLA 4O9GA 5KXBA 3N9QA 4R4ZA 4FPOB 4ES8A 5FOBB 5IFTA 1EPWA 2XLFA 3ACGA 3EHKA 4YNIA 4AWDA 4YW4A 3PVOA 5JSOA 2SBAA 2XGXA 2ZGRA 3N35A 4WM8A 4L92A 3CNAA 4CDXA 5CG9A 3LKJA 3WDUA 2WDBA 3AYAA 1RUD3 3IB3A 4WM7A 2JIGA 1UL9A 1O91A 1QF3A 3EXUA 3HD8B 2ZGLA 4XBNA 3W59A 5CG8A 1W0OA 1N1YA 1VPHA 2ZGSA 1XNDA 2K0GA 2QUOA 1UOGA 4KWKA 2GMMA 1XRUA 3EQEA 5L9RA 4XAAA 3PDQA 4K21A 3ZYHA 1LHUA 3JD72 1ZBE1 2XUMA 2YG0A 1QJY1 2WT1A 3LCPA 1S0EA 2GC3A 2VQ0A 5LY1A 3HQRA 1ACCA 3KGLA 3N9PA 4QDRA 1GANA 1Q5OA 1GQGA 2Q8DA 3M3IA 4MHUA 4XETA 4OHVA 1RITA 2ZGUA 4HETA 3T4HB 1OH4A 4O7XA 5FZOA 2WABA 2OQ6A 3P5BA 2HH9A 3CJIC 1H4HA 1JZ7A 3LEKA 4FPYA 4MADA 3E6CC 3GBWA 3NNFA 3ZSJA 1BMV2 3HPNA 1VBE3 5LASA 1RUD2 1JYTA 4Q29A 1AR91 3K4DA 1W28A 1XYNA 2LW8A 3TRSB 1RHI1 4DXRA 4IE0A 2WNEA 2DFBA 2QE3A 1ZRDA 3A0KA 1GUIA 3H8RA 4LKFA 1BXHA 3JD73 3PVNA 4YVWB 5FY9A 5LBEA 4QPWA 3RS6A 3O1VA 1UNBA 5FPZA 1QIQA 4MO3M 3LZZA 1UMIA 1OF3A 2PXJA 3WDYA 2OVUA 1WD4A 4YVSC 2Q8EA 5C3OA 3IDAA 4NROA 1MVEA 3VZNA 4ZZ5A 2CYFA 1NG0A 2WS92 4QXKA 4ET7A 2P34A 2ADEA 2G9GA 2J1RA 3B02A 2DBNA 3M3QA 5D2AA 1OPOA 3OD4A 2E7QA 5LA9A 3MUY1 2VUAA 2ZABA 1GSLA 4I30A 4YSFA 4LA2A 4QKFA 3RZZA 3HNMA 3VZLA 4PHZA 2Z79A 3ZPOA 5FZEA 2UY9A 4KWJA 3KCXA 2BYVE 3T2TA 4BHPA 4XFGA 1XOYA 3ZXKA 1LR5A 4HKWA 5JR7B 2JG8A 4Q0SA 2VQTA 3VLBB 2YPDA 1URXA 4AHYA 2ZHMA 1BBT3 1D4VB 4XW3A 1W8WA 1XNTA 1US2A 3I2IA 3MIGA 5JI7A 2ZACA 4YW5A 2OIIA 4YZ2A 2WS93 3ALQA 3RFRA 2VXJA 1HRI3 4AI0A 4QMAA 1Y9MA 5C4WB 4FXGB 3V0BB 1S0JA 5JLVA 4I0WB 3ZIXA 3ZFFA 4AI8A 3O1PA 5T5PA 2HYKA 3WHUA 3WF0A 4ONUA 1RINA 1SCRA 4DQAA 1B35A 4LO7A 3ZN6A 4MVTA 3BALA 3CBNA 3DPRC 3DYMA 1TQ5A 3WG1A 2DVBA 5CA6A 2MEV3 4A6SA 4O65A 1H30A 3UKVA 2VMEA 1UY1A 4Y26A 1JXNA 3LB9A 3D8CA 4FPJA 4OULA 3P6BA 3RWNA 3VZJA 3WXPA 2FDKA 1QQP1 1PZ9A 3LAGA 5IVFA 4UFMA 5JPNB 3HQUA 1CWPA 1MVQA 3H0OA 5FMBA 3H1YA 4LHSA 5GZCA 5IK8A 1YO8A 3ILNA 1XQNA 1HRI2 1A78A 2QQWA 3GXUA 4JGZC 3WLUA 5G05L 4Y1UA 4PLNA 5A7WB 5A6XA 2WBKA 5FZ9A 4CYDA 2VG9A 3W20A 5FOJB 5J7MA 1UY2A 4QXHA 1RUG1 4Q0UA 5FYBA 4CCLA 1SLAA 1MS4A 2J1TA 4OZOA 5LBFA 2VUDA 2HYXA 5FMCA 3W9AA 2W92A 3RZMA 2WWUA 1FNYA 2VW0A 4HKLA 2RDNA 4XC9A 1PIV1 2BNMA 4RQPA 4PQ9A 4TTGA 1DIWA 1TME1 3B00A 3K51A 4IV3B 2OA2A 1UZYA 4P08A 1PNGA 2E33A 4PJYA 4XZUG 5DAVA 1R093 1QH7A 1COV1 3TWIA 4EN8B 4FPHA 1LHOA 2XJSA 4L2NA 5BNPA 1LJ7A 3DKQA 1S2EA 3T2PA 5FLIA 1SDDB 1Y7BA 1O7FA 3AYCA 3I2KA 3O0WA 5CFCA 1PVC3 3BIEA 1W6OA 4FFIA 4K8RB 1POV0 4XUNA 2PLV1 3A7QA 4QX5A 5H9SA 4CP1A 5LA1A 2OUJA 2PLV3 2HBUA 1MS8A 3POBA 1V9U1 4YGBA 4NWWA 2DWRA 3RYRA 4EE2A 2YMZA 1R1A2 5JPMB 2BPA2 4L8QA 2IVJA 3BVCA 1W8FA 1SFYA 1H9WA 1NX9A 4XJAA 5A3UA 1OVSA 2PAEA 5EIYB 1COV3 1D2QA 2W9XA 4AG4A 2ZMNA 4HXCA 5JDBA 1VBE2 2WQ8A 5DUVA 2RV9A 4IV3A 4LNVA 1OUSA 2RMU1 1SQ4A 1DLCA 2JIJA 2RMU2 4LPLA 2FDFA 1CX1A 2OQ7A 3J7NA 3FHAA 4LOTA 5JZGC 3J7HA 2VW2A 1D0GA 2Z4FA 2PLV2 4W6YA 1HKDA 1JMUB 2QVSB 2GP5A 3POGA 2VCBA 2Y6FA 5FBJA 1G9DA 3RJRA 1X7NA 3TB0A 1TMF3 2XL9A 5F3CA 5T3NA 1XU2A 4IEOA 4QGMA 3M1HA 2RR12 3FUOA 5J96B 1J84A 3LDBA 2JDNA 4IEVA 3UNPA 5T5OA 1JZ3A 4AFCA 1IHMA 2E31A 1OQEA 3S7IA 2WA4A 4KGQA 2C9KA 1B09A 5LK5A 2R0FA 4E2GA 5BPXA 1H0BA 4XUPA 1N1VA 1W8TA 2WSVA 3C7HA 3MUZ1 2DUQA 3WEZA 4EWAA 2W0XA 4CDWB 1QJU1 2GP3A 3IPVA 3N7JA 2XG3A 1AR81 2X8KA 4YW7A 1WD3A 1YRZA 5LY2A 5FZBA 2ZGMA 3RYKA 3CJIA 4XUOA 5ANQA 1RB8G 5LEKA 4QM8A 1RUH2 2C9AA 4JGYC 5A3LA 5IVBA 4QPIB 1LAJA 1Z7S3 4QGNA 2VZ3A 4UW4A 5C4WA 1BK0A 2WFF2 4RA0A 3WW4A 2QQNA 3WP4A 1C3HA 4K8FA 3PUAA 4PLMA 1WBFA 4URAA 3O0VA 3H3UA 3KWVA 3BGAA 4UBHA 4XJUA 3DEMA 1QH6A 3DXTA 1F15A 1NYWA 1OSGA 4NOTA 4EZHA 1KFUL 1XC6A 1BEV2 1X9TA 2R041 2VTXJ 3U4SA 1AUYA 1NKGA 1JTZX 1OFNA 2RVAA 2W08A 3H3LA 4BIFA 1TNRA 3TEZA 2MHFA 2Y26A 1DZRA 1NCRC 4OZXA 2R062 4A45A 4CDUC 2W39A 1UKGA 4FT8A 5EFUA 4S2FA 1MZ6A 2GH8A 3FLTA 1D4M2 5C33A 3SCHA 4JKMA 4LO6B 5IVVA 1IKPA 1LU1A 2GNMA 1GMMA 1ULFA 1ND2A 2W52A 4L97A 1EAH1 1WLCA 2NQYA 3MFCA 1RUE3 4HT1T 4K7JA 5KHHA 3SH5A 5BUVA 3FFZA 4NPMA 3V0AB 3SLIA 4YVWC 1CONA 1Q8PA 1V6IA 2IFWA 2XQXA 4LA3A 5ACA2 1ZZ8A 1ZM1A 1DZQA 3B3QE 3OOXA 2B9VA 3KT1A 4W8JA 3LA7A 3INAA 1YFUA 2DURA 1VB2A 2O8OA 3H9AA 4HBNA 1WCKA 3BKZA 4P9XA 5IFPA 3S7EA 5FZCA 3RMYA 2VMCA 2WNVB 4XF3A 1O5LA 1QY4A 4C1XA 3BTAA 5D1IA 4BMEA 4Z92B 1H2LA 4XXPA 2YU1A 1LU2A 1U12A 1ULCA 3FLRA 4TSVA 4NIAA 5FY5A 3HBKA 4RL7A 2XJUA 2ZA9A 4A42A 1PO13 1LESA 5EQUA 3VBHC 4ZHNA 1FYUA 1GZCA 1AHSA 4ORFA 5J36A 4M4PA 4N8MA 2ZMLA 4BK4A 1DGRA 4KWLA 1HN1A 4C8DA 5LW9A 5LA2A 1UIJA 1DG6A 1K5MA 4QPGC 2HWC1 4AZZA 2OW4A 3TN92 4NHXA 3ZXLA 1LHVA 3MYXA 4DUWA 3WDTA 1HXS1 3ZKUA 2AUYA 3S30A 2MEV1 2VH9A 3UV9A 1LECA 4YZ5A 2PAKA 5LB6A 1PO21 5LATA 4UW3A 1W9YA 2D5HA 4G9SB 4B7KA 4NAMA 3AZVA 1E57A 1O59A 3FWEA 4MGZE 3T30A 3VBHB 1QU0A 4JQRA 2P1BA 5JUVA 2ZAAA 5E6HA 3M3OA 4I0AA 2YC4A 3NNMA 4HN1A 1GQHA 3OBRA 1APNA 3GHMA 5FK8A 1LOBA 2RDSA 5FZIA 3VBSB 3ZOIA 2W94A 5A3MA 2G9FA 4CEWB 4XFCA 5JSPA 5E8AA 3VHOA 4Y1YA 1OLQA 3BI3A 1F4HA 2Y6GA 2WRAA 4JV4A 2WL1A 1GKBA 4UBGA 1OURA 4GKYA 2P17A 3WX5A 4Z8BA 2XVLA 1OUXA 2WAAA 3LA3A 3RZGA 1ND3A 1SLBA 2UURA 4W50A 2V4VA 5JXHA 4DXZA 4P02B 1DYOA 4YW2A 1AX2A 2VMDA 3AL5A 3KQRA 5F3GA 3ZSLA 1GOGA 2YV8A 1FPN1 5BNQA 1HDKA 3BN6A 4IGOA 1EV12 2B9UA 1EAH2 2B46X 2ZX1A 4RHV2 1K42A 3ELNA 5FREA 2ORXA 2W87A 4GJZA 3MZHA 2XKPA 2WIIB 3ZMOA 3VKFC 4TYSA 3ZIWA 1C1LA 4D94A 1QGLA 3KLSA 4IEUA 3R4DB 5L7OC 2BOJA 1VJ2A 3UETA 2ZGKA 2R072 5JMOA 1NZCA 1ZRFA 3WNOA 2RS51 5FYVA 4CE8A 2QQMA 2W46A 5F7UA 5FXXA 5T5LA 2PHXA 3WNPA 2J1UA 4WVMB 4DNYA 2Q8OA 1DGLA 5C3RA 5KXEA 4HK8A 4LTAA 4QXBA 1RUH3 1JUIA 4YPJA 3DUIA 1FNZA 1PMJX 2ZGQA 1KITA 4BLIA 1FOD2 3U0ZA 2C1FA 2E9QA 3CIHA 3FMGA 4PDWA 3UKTA 1PX3A 2YXSA 4AEMA 3PMSA 5KHIA 5JOWA 1MEC1 2X5IC 1NOVA 4I3PA 4WBBA 3I3BA 2B42B 5IK7A 3D0SA 2C24A 5JI9A 3H42B 1VRH2 2R7EB 1W6MB 2VBBA 1WWYA 3AXEA 4QPYA 4SLIA 4N43B 2ZX3A 4CU7A 3PL0A 3AP6A 1OA4A 1BEV3 2CTVA 3QLQA 2XPJA 1NXMA 4YW1A 4Y4YA 4DZGA 3VHPA 1SPPB 1E5RA 1LNSA 4N9HA 1CIYA 2ATFA 3ZXDA 3KVBA 3QH6A 1AYN1 2EXKA 4YFZA 2XWBB 4YLZA 3ZXFA 1KJRA 4R9CA 3O14A 1ND2B 1ENRA 1LOEA 3W5MA 3BYWA 4IETA 4BQXA 1UXXX 1WCQA 3T2QA 4QPGA 1Z78A 1VBD1 1RGSA 2Y33A 3C7GA 1QOSA 5FZ4A 3TOJA 1RUE2 3E97A 1O3QA 3BOWA 3ZYGA 3KV9A 4AF9A 1JH5A 4BWOA 1PZ8A 2A1XA 1LB2A 3RQ0A 3FLPA 3NRUA 5IATA 3I49A 4H7MA 3KV5A 2WS91 3PIJA 3H50A 2VCAA 2WFF1 3K4ZA 3AJZA 1JYVA 1GP5A 4IV1A 1ZZ6A 4BQYA 1XSRA 1OXCA 1QXPA 2WO1A 3B5LB 4C91A 1REDA 2JDPA 2NM1A 4KL1A 5A32B 3GCXA 1OQ1A 2WZR1 3LF7A 4Y20A 1GWKA 4OHWA 4UT5A 1I5PA 4G3YC 4Q4Y2 1D0HA 1XBFA 2DBIA 2ZEYA 4CUCA 1LTEA 5ISLA 3AZZA 4IEXA 4K6BA 1NT0A 2V5DA 1ZX5A 1C1FA 2B7YA 3AP4A 1RUJ2 4HL0A 4COYA 4H14A 2L9LA 2VC9A 1RUG3 2YC0A 3LD8A 3D3AA 3LPGA 5FYMA 5KXCA 1HRV2 2DCKA 2IVIB 4OUEA 1KEXA 4C90A 1SFNA 3LDRA 4FTBA 4DB5A 5ABJC 3KCCA 3LQCA 5A3OA 2AACA 2R16A 2OXBA 2RJ2A 3NV2A 4TXWA 2WYFA 5FZDA 3ZN4A 4XABA 5T5JA 4NAOA 4LBMA 4AL9A 4GJYA 4KQ7A 3FZ3A 1MQTB 1RC6A 4RD7A 5FP9A 2W3JA 2ZGPA 1BBT2 1MPXA 2SLIA 4M3CF 3TBDA 1RUJ3 3VHNA 2VZRA 4GH4A 1WKYA 4NWVA 4COVA 4CSWA 1RUJ1 1VP6A 4HSJA 4LORA 4CEWA 2VZPA 1LODA 3OG2A 1BZWA 4YG6A 4EZ4A 1MS5A 2RJLA 4PDWC 1W2TA 4GB32 2QQKA 5BNPC 3V56A 3WNMA 4E4SA 3C2UA 5BNOA 2XH6A 4ITCA 4JQTA 3JXSA 1OBNA 1UWWA 4MXWB 3SC7X 2BVBA 5SV5A 1V0AA 2GAUA 5FLHA 1TME2 4XF9A 1IQAA 3ZXAC 2ZHKA 2Y6LA 4NR1A 2NP0A 5FR3A 2FDJA 1K5MC 1SLLA 4JX0A 4OHZA 3K3NA 4AVBA 4DOUA 3OJBA 4LUKA 2GSYA 5FLJA 1EUTA 3IN9A 3OUJA 3J7LA 2CDPA 2QKDA 3LOIA 3OBTA 4K9SA 1RUF3 5I0DA 2Y8KA 1NA1C 1UW8A 1X82A 4D7TA 1QOOA 3AYDA 4Q0PA 4W6WA 1WW7A 4JVAA 1OOPA 1R081 4GWMA 4YZ4A 4IEPA 1GNYA 2VQAA 2WAOA 2AEZA 2BDRA 2J22A 2WINB 3LEIA 1ZREA 2G19A 3O12A 3HMYA 5B4XA 3RNSA 4RR3C 2VZUA 4DY3A 1FT9A 1TME3 3BB6A 5EYYA 2WZEA 3F2ZA 2GALA 5JIUA 4NRQA 1CX4A 4G4FA 4FTEA 3T0AA 2ZHNA 2XKOA 3I54A 4QU2A 4AVAA 2KXLA 1CPNA 3K3OA 4CCKA 4AEKA 5EWSA 5KHGA 1J58A 4WM7C 3AK0A 5I8TA 4LO4B 2W1QA 4ZU7A 1D4M1 2PYTA 1S1AA 2JD9A 4LITA 3K48A 2VGDA 3AMQA 4N43A 4LBKA 2PMWB 4YM0A 5C8WA 2R0HA 4RFRB 5FP3A 1W2NA 4BLJA 1DBNA 3R4UA 4XJ8A 5AC92 1UY0A 2FZ2A 3NNJA 3OGGA 4Q4W3 4FOVA 4NIIA 2D7FA 1YJKA 2YBKA 3T1LA 4YVSB 4FAHA 5HXMA 3ZFEB 1D2SA 2HWC3 4PCRA 2TEPA 3V65A 2ZZJA 3DYPA 2ARBA 3J7MA 1GZWB 3POSA 2Y6JA 3GJBA 4RS5B 1DGRN 1PO11 3MIBA 4GWJA 4MGIE 5CAZA 1PGL1 1N47A 3NJYA 2HWE3 3UESA 1TMF1 3ZN6B 3C7FA 1RHI3 1R1ZA 3HVDA 2XUEA 3ABZA 2DU1A 4QB1A 4V2VA 1RUC2 2WZ8A 4D3WA 5A6ZA 3RZKA 1GYKA 3EYPA 2QQIA 4LEJA 4XYXA 5C5UA 4LMFA 2GC0A 3MBWA 5E1RA 4XPVA 2E63A 3ZLIA 2DVDA 4Q4W2 5J98B 2EAKA 2PELA 2PHWA 3KMHA 3OCPA 4HVQA 5J3UA 2ZEXA 2HWE1 5M0TA 3H7JA 2RMU3 2HWC2 3L9JT 1W6QA 4FXKB 4LJHA 1I9RA 5CNAA 4EWEA 3ZM8A 1NAEA 3L2HA 3MPPG 3VD3A 4CDXB 4EROA 2D44A 4XOGA 3EO6A 2BJSA 5FTTC 1YYNA 2X10A 2E7TA 4QX8A 3WF3A 2QQJA 3ON7A 3POIA 2HWE2 4QQOA 3URFA 4EN7B 3AB0A 3ZFGA 2P6HA 1RUG2 5A3TA 5GLTA 4UW5A 3KHBA 3F95A 2A3YA 1CAXA 2AC1A 3ZKYA 1NY71 3MF9A 4FFGA 4Z82A 2WNVC 3ZFFC 1XPWA 4MHRA 1PX4A 2OX0A 4NRPA 1YQ2A 4AVVA 4GZ9A 3R05A 3WCRA 1OHFA 3WNXA 3I3MA 5K7PA 4PQQA 1E5HA 3ETPA 5BY5A 1PK6B 2AENA 3VBUC 4BQ1A 2H0BA 3N9NA 1NCQC 2WO7A 4XHXA 2Y34A 1CVNA 2OZ6A 3MIEA 1CESA 2VMIA 1DGWX 2DVFA 4Q4X1 4QWNA 2VOXA 5EJ3A 1XNKA 2HWB3 1MS3A 2C5DA 1RJ7A 2O14A 1W6OB 4N7IA 5IYYA 1AR92 3NSTA 3GNEA 5A7PA 5GLWA 1GNHA 2IFRA 2VM9A 5B4NA 2WFF3 4CP2A 2ID4A 4PF1A 1WW6A 1LEMA 5FXZA 3BODA 2VOVA 2WQZC 4CEWC 4FFHA 2VNOA 4R52A 1CIWA 4DPNA 4E8DA 3NKTA 2NMOA 2IUWA 5F6LB 3U1XA 5AFBA 1C5IA 2PHLA 5CKNA 3SITA 2RDQA 1NCQB 3E5XA 1WW4A 4FPKA 1SLTA 2ENRA 2Z2SB 3KF5A 5F2SA 5EZWA 5JXGA 2ZMKA 2D6KA 4I02A 4M01A 2XHKA 4FOWA 4ZU4A 2I45A 3GBGA 4ATEA 3WINE 3WNLA 1ZA4A 4XFFA 4P9LA 1YC61 4META 2ERFA 5CZKA 1JOPA 1NXD1 5FPLA 2VNGA 2W2IA 1CAUB 3E5QA 2XLAA 3NNLA 4CTEA 4OUMA 1B35C 2DTWA 4Y33A 2OUHA 2C26A 5K8SA 2ZX4A 4HANA 1W6NA 2VZSA 3R0RA 4CCOA 5CFDC 3ZVXA 1CN1A 1W6PA 2V4AA 1O4YA 1CAVB 4HK9A 3BU7A 5FYTA 3T09A 4FQZA 4WV8A 1DU3D 4BXSV 1YI7A 5CEHA 4AW7A 5A6QA 2XB6C 4AYUA 5BNOC 4CCJA 4Z2AA 1ENQA 1OD3A 3PNAA 4LULA 3ITQA 5JSRA 3PUQA 4I0BA 4FAGA 2OYZA 4AAPA 3JQXA 4S2HA 2D6OX 2J42A 4MYEA 1TEIA 3O1RA 1BLZA 2QNKA 5H9QA 2MNGA 1HRI1 3ZSMA 4BXFA 1JODA 3AZWA 5DN2A 3LA2A 3GZTB 4WVVA 3P3NA 3LEGA 4M4RA 1F8VA 4GIQA 1XNBA 2CGOA 5LK7B 3N9MA 1HX6A 2BGPA 4M3CA 3U75A 4ZY9A 3WOGA 1SLIA 5CYYA 2UWCA 5D21A 5HXVA 3AVSA 2FQPA 4EYUA 4OI0A 3ZYRA 3I3EA 1QJZA 2EAAA 1RUE1 3VHRA 1YFXA 3WW2A 1LRHA 4CDQB 2P37A 2VZOA 2QCSB 5FY0A 3ZN5A 4EN6B 4YZ1A 5FV3A 5FWEA 3IDBB 1A8MA 4DY5A 3MO4A 3TN93 5BNNC 4Q2FA 2V73A 5FMDA 1UZ0A 1MQTC 1YCIA 1MS1A 3FHQA 1FPN3 2BV4A 3WP6A 2RR11 4MV2A 4XF4A 1YQ8A 2WN2A 4K1YA 4PI0A 5IK5A 3AKQA 2JDUA 3CJXA 1VBA3 4IV1B 3DYOA 3WCSA 1RXGA 3J4UH 1RUC3 3VUOA 4OLLA 5EXOA 5LRRA 2EVXA 3LSDA 1O4TA 4LIUA 1A3KA 2VJXA 3J8F2 2EALA 3FE5A 1BJQA 1VMJA 4BK5A 5A1LA 1ULDA 1W2AX 4BQ3A 4ZONA 1FOD1 1UY4A 2D6NA 1OF4A 1SDWA 2R042 3WQ1A 5B2GB 1W9WA 2BBVA 3AL6A 1H1MA 1CZSA 3GZEA 3K77A 1FPN2 4HSLA 3DECA 4Y5SA 1LULA 2VMHA 4JGYA 1U5XA 1MEC3 2YGLA 4IDZA 1ZZ7A 1G7YA 2HEYF 5C3SA 4PT6A 5DXDA 1VBA2 2JDAA 2XLGA 3GM8A 5I0SA 1UX7A 3PVBB 3Q8AA 2ARAA 3V64A 3UGGA 2ZX2A 4ES9A 1ZA7A 3K75B 1I1EA 2WLQA 4RHV3 4N53B 5CISA 2XQRA 1CJDA 4FPEA 1ZZ9A 2F6BA 1VBC2 4IL7A 3MLLA 3VKMA 4LE3A 3KVAA 1D7PM 5SV8A 4CRQA 3VD9A 1H2NA 3KB5A 1FI2A 3U11A 2VTFA 1F9KA 1M4WA 1PK6A 1DGWA 1HJGA 3VBRA 2E6VA 2OS2A 3EBRA 5JOYA 4LQRA 3MHZA 3VBUA 1BK1A 4FVVA 4XIKA 3ZYJB 1J59A 3POWA 2IXCA 2HWB2 1Y9GA 1MEC2 3POYA 3WHTA 4EWDA 2VR4A 3M70A 4AXOA 1S55A 3FL7A 4OQ9A 1FOD3 3VZMA 3RRDA 5DDJ2 5D8AC 5EJ1B 1O5UA 1ZBA1 2H6CA 1W0PA 2VUJA 3JBG1 3ZFEC 4D6QA 2Z5WA 3N7LA 1LKNA 2WN3A 4M00A 4RS5C 3KT4A 3VD5A 1L7LA 4K20A 2JG9A 3RVHA 1OKQA 1AR63 3Q8BA 2BFUL 3PJQA 4XDOA 1TVGA 1NZIA 1ULPA 5FQ0A 4INDA 4ASKA 2CU5A 2P4EA 3MW4A 1QJEA 4KBZA 5L19A 4Y3OA 2YGMA 4KBBA 4F83A 3NJXA 2WQ4A 2K46A 3DPRB 2EIBA 3VBFB 5DUUA 2QTWB 5A7NA 4BDVB 1I6XA 4XZPA 5KC5A 5FAXA 1JZ8A 4K1ZA 3ACFA 3J8F1 3CZUA 3D5OA 3OY8A 3UGHA 2QZ2A 2VQUA 4S2GA 1W8HA 1Q8QA 3OEBA 4FPFA 1KQRA 3KF3A 1T6BX 4A2UA 3VZOA 2VVDA 4BQ5A 4A3ZA 1LOFA 3USUB 3KHCA 1LGBA 3C3VA 1H9PA 3N36A 5DAWA 4FOQA 3NV3A 3DKWA 1S0IA 1BEV1 1DP0A 2JG9B 2OT7A 4DS0A 5IAVA 4UWDA 3AJYA 3CEWA 1AXKA 2OZJA 4Q0VA 2JG8B 3AP7A 5F6KA 2X09A 4XTMA 3VKLA 3J26N 3MI8A 3MLJA 2DYCA 1DQ2A 5FPUA 4AE2A 4HMZA 4FP3A 3PHMA 4M3CB 1GOHA 1IKQA 1F35A 1OQDA 4GWIA 1RUI3 3UKNA 3J9SA 5A32A 1SCSA 2WT0A 3D4KA 4HOOA 1GP6A 4J1XA 1CZTA 1W90A 4A3XA 3ECQA 5IAXA 4WVWA 4ZXEA 1JOBA 1GZWA 1YFWA 4J1WA 3ZX7A 2AR6A 4OCTA 4OI2A 2RM23 2HKXA 2JE8A 4CDQC 5FZHA 5I93A 3VBSC 1QQP3 4GD4A 3OF1A 2BQPA 5DUXA 1RMU2 3POJA 3LE0A 4KNCA 4BU2A 4DUVA 4AEDB 3GYDA 5F5IA 1CR7A 5BNNA 1RUD1 3A23A 4ZU5A 1JI6A 4N9IA 5FZ0A 3T0BA 5DDJ1 3TN91 4IEQA 2VZQA 2QQPA 4BM8A 3I2GA 4FPCA 2BNNA 3NVCA 4LO5B 3FBMA 5IVEA 1SBDA 3RDIA 3ZFGC 5J37A 3N9OA 4YVWA 2X53S 4BQ2A 1CAWB 3HNYM 1H6YA 1UPSA 2XVKA 1POV3 4GXLA 2R043 5TSWA 3BU0A 1CZVA 2JDYA 3VL9A 4AOCA 4O61A 1ZZCA 3IIIA 2ETEA 5F3EA 5FKCA 5F3IA 1ZBA2 5KWRA 5CKQA 1NQJA 1DFQA 1V6JA 2GNBA 2IC1A 3IDCB 4OVEA 2LALA 1KJLA 5FPXA 1ENXA 1QJX3 1NQDA 2RG4A 1ZRRA 3WF2A 2PHUA 4H2AA 3S0MA 1PGW2 4XFAA 1J83A 4OMDA 1IQDC 3K4AA 3KCYA 4JHZA 4LUMA 4BCUA 1PMHX 5BNOB 1VBB2 4BQ4A 2ZAHA 4AI1A 1GZTA 1S2KA 1WLTA 3C8XA 5F5AA 4DINB 3HIFA 5BYNA 3OGSA 1JYXA 1F31A 4XMAA 3KV6A 2CNAA 3QBQA 1VAVA 3TNPB 3CO2A 1ZBA3 3RPQA 5A7OA 4CCDA 1HRV1 4ASMB 1W04A 1QJX2 2LROA 1R1A1 3DXUA 5FP7A 1SFPA 2LS6A 3I4IA 1PM7A 1Q3EA 3MF6A 4QPIA 4Q27A 4QM9A 3VDAA 3VDCA 2K2SA 1UPIA 5C71A 1EV13 4LBNA 3D82A 4HZFA 3ZFFB 1EV11 1X9PA 3LFIA 4GAZA 1VBE1 4XFBA 5KXDA 2P3KA 4FOYA 5AFEA 3Q8FA 5JVVA 1PHMA 1SZBA 1HB3A 3AMPA 4JGZA 4ATFA 1AR62 5FO8B 4XQ4A 5E16A 2WZR2 4A6OA 4D7SA 2VVFA 1X50A 1U5ZA 4DXSA 2GU9A 3B9IA 1PGSA 4UXAA 2JDKA
chains in the Genus database with same CATH topology
3IB3A 1KGYA 1OT5A 3OBAA 2W3JA 1MPXA 2VZRA 1WKYA 2VL4A 2BGOA 4KMQA 2BZDA 2VZPA 3OG2A 2YB7A 2YG0A 4L0PA 2J1EA 4KI5M 4ZZ8A 1UYZA 2QQKA 1T2XA 4QDRA 3I2FA 5A1AA 3WNMA 3LPFA 3A22A 3JXSA 3CZJA 1UWWA 1OH4A 2WABA 2HLEA 2Y6LA 1JZ7A 3LEKA 4KWUA 4MADA 4JX0A 3HPNA 1UYXA 2WO2A 3K4DA 3ACIA 2LW8A 1EUTA 2ZEWA 3WF1A 4DXRA 2CDPA 5I0DA 1GUIA 2Y8KA 4CUAA 1L7QA 4QPWA 5C70A 1F4AA 1GNYA 2WAOA 3SEEA 3WQBA 5JXJA 2J22A 3LEIA 4MO3M 1UMIA 2EIDA 1OF3A 5B4XA 2VZUA 3IDAA 3THDA 4ZZ5A 2WZEA 3F2ZA 3T08A 1GU3A 4ET7A 3T0AA 2J1RA 4QDSA 2KD7A 2EIEA 3MUY1 2W1QA 3HNMA 2JD9A 4MGSA 1JZ4A 4UAPA 1UY0A 3AC0A 2VQTA 4A4AA 5HXMA 2W1WA 3MV01 2W1UA 1XNTA 1US2A 3I2IA 3DYPA 3P1IA 3VDBA 4ARXA 2ZXQA 2Y6JA 3W5NA 4GWJA 1BHGA 2EICA 3MV11 3C7EA 3WF4A 3UESA 3C7FA 4JKLA 2XONA 3I97A 3ABZA 4QB1A 4D0QA 2WZ8A 3WF0A 5IJRA 3EYPA 4CU9A 2QQIA 2YFUA 3DYMA 3MBWA 2BERA 2VMEA 1UY1A 2ZEXA 3P6BA 4LKSA 3ZM8A 1GOFA 1NAEA 3VD3A 4LHSA 4P5YA 2X10A 3WF3A 3GXUA 3CKHA 2QQJA 4DEQA 5G05L 2CDOA 4XUTA 2WBKA 2VZTA 1UY2A 4XVHA 4CVUA 2J1TA 4OZOA 2E26A 5LCWL 3IAPA 4D8MA 2HYXA 1XPWA 1US3A 1PX4A 1W0NA 1YQ2A 1JYWA 2W92A 4GZ9A 4PQQA 3ETPA 4TTGA 5C7GA 4JKKA 2VOTA 2E33A 4P08A 4XZUG 4DEVA 5IYYA 2YFZA 5B4NA 3T2PA 2VM9A 1SDDB 1EUUA 3ACHA 3I2KA 1JZ6A 2ID4A 4UI9L 4PF1A 4BJ0A 1SHWB 4XUNA 3A7QA 5LA1A 4QB6A 4E8DA 4P00B 1O8SA 4XURA 5J1XA 1JZ2A 2W95A 4QX2A 1R64A 1NX9A 5JXGA 3HEIA 5EIYB 1JHJA 4AG4A 2W9XA 3WNLA 2WQ8A 2RV9A 3HJRA 5CZKA 1DLCA 2C26A 4LPLA 2VZSA 1CX1A 1W8NA 3T09A 3FHAA 5JR2A 3J7HA 4BXSV 3I2HA 2Z4FA 4Z2AA 1OD3A 4CU6A 2DDUA 2VCBA 5EJZB 3SEPA 3EB7A 3WSOA 2W5FA 1J84A 3T2OA 3UNPA 5DN2A 1JZ3A 4OMCA 2E31A 2WO3A 3LEGA 4M4RA 2C9KA 3THCA 4RN5A 2X05A 4QB2A 4XUPA 3WEZA 2BGPA 3C7HA 3MUZ1 4ZY9A 4QX1A 5CYYA 1K3IA 5G04L 3I3EA 2WYSA 2Y64A 4XUOA 3K46A 2VZOA 3FN9A 3MO4A 2VZ3A 1UZ0A 2QQNA 2QQOA 3FHQA 1RYYA 2WN2A 4DUXA 3BGAA 2VCCA 3DYOA 3OGRA 1XC6A 2VJXA 3T0DA 1NKGA 2RVAA 4RYDA 4OYUA 5JXIA 4A45A 3CMGA 4BK5A 1UY4A 1JU3A 1OF4A 1W9WA 4JKMA 4QAWA 1CZSA 1GMMA 3K77A 2WUHA 3DECA 2VMFA 2YC2A 4PT6A 2JDAA 2XQXA 3GM8A 1UX7A 3OEAA 2B9VA 2VO5A 3K75B 4HG6B 3E1F1 2JKXA 4W8JA 3VD4A 4IUGA 5HPOA 5IFPA 1D7PM 2ORZA 2VMCA 3VD9A 2QBXA 3I3DA 1UMHA 1UY3A 1W9SA 2VZVA 2VTFA 2XOMA 4XUQA 4A42A 4LQRA 4M4PA 1O8PA 4BK4A 1HN1A 2VR4A 5LA2A 3IAQA 3FL7A 3PUIA 5EJ1B 5DPNA 4DUWA 1TG7A 2WN3A 3VD5A 1GQPA 1O59A 2BBAA 1TVGA 1ULPA 4DXTA 1JYNA 4UOJA 5JUVA 4ARYA 2PQSA 2W91A 2YC4A 3NJXA 2VZ1A 2EIBA 2E32A 3WNKA 3I2JA 3HNBM 4BDVB 4MGQA 3C7OA 1P8JA 2W94A 1JZ8A 1NUKA 1K12A 5FUIA 3ACFA 3CZUA 1F4HA 2Y6GA 4CUBA 2V72A 2WAAA 2VQUA 3OEBA 4W50A 2V4VA 5JXHA 1W99A 4P02B 1DYOA 4A3ZA 2DCJA 1K45A 2VMDA 1GOGA 4QX3A 4CU8A 3BN6A 1DP0A 1K42A 2J1SA 3CDZB 3OGVA 2ORXA 2W87A 2X09A 1JU4A 4MOAA 1SG3A 3UETA 3VD7A 1GOHA 5JMOA 4GWIA 3WNOA 1UXZA 2QQMA 2W46A 1CZTA 5F7UA 3WNPA 2J1UA 3ECQA 4ZXEA 4YPJA 2JE8A 1PMJX 1L7RA 3CIHA 3LE0A 2XHNA 4DUVA 3GGLA 1PX3A 2QQLA 3A23A 3GDBA 4A41A 1JI6A 3OB8A 3I3BA 2B4KA 3T0BA 2C4XA 2R7EB 3CQOA 4CU7A 2VZQA 3I2GA 2W47A 2J1AA 5DMYA 1LNSA 1CIYA 4E8CA 1W9TA 3HNYM 1H6YA 3W5MA 1CZVA 1UXXX 1WCQA 3T2QA 3IIIA 3NQHA 3C7GA 3WNNA 3WF2A 3HOBA 1W8OA 1J83A 4AAXA 4OMDA 1IQDC 3K4AA 4JHZA 1PMHX 3NRUA 5IHRA 4QDQA 3HN3A 3K4ZA 2VCAA 5DQ0A 1JYVA 2J7MA 3C8XA 1ULOA 2WO1A 1JYXA 2Y6KA 3OGSA 1JZ5A 2ZEZA 1UYYA 2W1SA 3PUHA 3SKVA 1I5PA 4A44A 2ZEYA 4CUCA 3NNGA 5LA0A 2V5DA 4W4ZA 2LS6A 2J1VA 3U37A 1XNAA 2L9LA 2VC9A 3VDAA 3D3AA 3LPGA 3VDCA 3SKJE 4QX0A 5C71A 2OKXA 3A21A 2Y6HA 2DCKA 4OUEA 1KEXA 4FI9A 3NJVA 3LQCA 1H6XA 4A6OA 5IFTA 2RJ2A 3ACGA 4DXSA 4TXWA 2WDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IB3 A;  1KGY A;  1OT5 A;  3OBA A;  2W3J A;  1MPX A;  2VZR A;  1WKY A;  2VL4 A;  2BGO A;  4KMQ A;  2BZD A;  2VZP A;  3OG2 A;  2YB7 A;  2YG0 A;  4L0P A;  2J1E A;  4KI5 M;  4ZZ8 A;  1UYZ A;  2QQK A;  1T2X A;  4QDR A;  3I2F A;  5A1A A;  3WNM A;  3LPF A;  3A22 A;  3JXS A;  3CZJ A;  1UWW A;  1OH4 A;  2WAB A;  2HLE A;  2Y6L A;  1JZ7 A;  3LEK A;  4KWU A;  4MAD A;  4JX0 A;  3HPN A;  1UYX A;  2WO2 A;  3K4D A;  3ACI A;  2LW8 A;  1EUT A;  2ZEW A;  3WF1 A;  4DXR A;  2CDP A;  5I0D A;  1GUI A;  2Y8K A;  4CUA A;  1L7Q A;  4QPW A;  5C70 A;  1F4A A;  1GNY A;  2WAO A;  3SEE A;  3WQB A;  5JXJ A;  2J22 A;  3LEI A;  4MO3 M;  1UMI A;  2EID A;  1OF3 A;  5B4X A;  2VZU A;  3IDA A;  3THD A;  4ZZ5 A;  2WZE A;  3F2Z A;  3T08 A;  1GU3 A;  4ET7 A;  3T0A A;  2J1R A;  4QDS A;  2KD7 A;  2EIE A;  3MUY 1;  2W1Q A;  3HNM A;  2JD9 A;  4MGS A;  1JZ4 A;  4UAP A;  1UY0 A;  3AC0 A;  2VQT A;  4A4A A;  5HXM A;  2W1W A;  3MV0 1;  2W1U A;  1XNT A;  1US2 A;  3I2I A;  3DYP A;  3P1I A;  3VDB A;  4ARX A;  2ZXQ A;  2Y6J A;  3W5N A;  4GWJ A;  1BHG A;  2EIC A;  3MV1 1;  3C7E A;  3WF4 A;  3UES A;  3C7F A;  4JKL A;  2XON A;  3I97 A;  3ABZ A;  4QB1 A;  4D0Q A;  2WZ8 A;  3WF0 A;  5IJR A;  3EYP A;  4CU9 A;  2QQI A;  2YFU A;  3DYM A;  3MBW A;  2BER A;  2VME A;  1UY1 A;  2ZEX A;  3P6B A;  4LKS A;  3ZM8 A;  1GOF A;  1NAE A;  3VD3 A;  4LHS A;  4P5Y A;  2X10 A;  3WF3 A;  3GXU A;  3CKH A;  2QQJ A;  4DEQ A;  5G05 L;  2CDO A;  4XUT A;  2WBK A;  2VZT A;  1UY2 A;  4XVH A;  4CVU A;  2J1T A;  4OZO A;  2E26 A;  5LCW L;  3IAP A;  4D8M A;  2HYX A;  1XPW A;  1US3 A;  1PX4 A;  1W0N A;  1YQ2 A;  1JYW A;  2W92 A;  4GZ9 A;  4PQQ A;  3ETP A;  4TTG A;  5C7G A;  4JKK A;  2VOT A;  2E33 A;  4P08 A;  4XZU G;  4DEV A;  5IYY A;  2YFZ A;  5B4N A;  3T2P A;  2VM9 A;  1SDD B;  1EUU A;  3ACH A;  3I2K A;  1JZ6 A;  2ID4 A;  4UI9 L;  4PF1 A;  4BJ0 A;  1SHW B;  4XUN A;  3A7Q A;  5LA1 A;  4QB6 A;  4E8D A;  4P00 B;  1O8S A;  4XUR A;  5J1X A;  1JZ2 A;  2W95 A;  4QX2 A;  1R64 A;  1NX9 A;  5JXG A;  3HEI A;  5EIY B;  1JHJ A;  4AG4 A;  2W9X A;  3WNL A;  2WQ8 A;  2RV9 A;  3HJR A;  5CZK A;  1DLC A;  2C26 A;  4LPL A;  2VZS A;  1CX1 A;  1W8N A;  3T09 A;  3FHA A;  5JR2 A;  3J7H A;  4BXS V;  3I2H A;  2Z4F A;  4Z2A A;  1OD3 A;  4CU6 A;  2DDU A;  2VCB A;  5EJZ B;  3SEP A;  3EB7 A;  3WSO A;  2W5F A;  1J84 A;  3T2O A;  3UNP A;  5DN2 A;  1JZ3 A;  4OMC A;  2E31 A;  2WO3 A;  3LEG A;  4M4R A;  2C9K A;  3THC A;  4RN5 A;  2X05 A;  4QB2 A;  4XUP A;  3WEZ A;  2BGP A;  3C7H A;  3MUZ 1;  4ZY9 A;  4QX1 A;  5CYY A;  1K3I A;  5G04 L;  3I3E A;  2WYS A;  2Y64 A;  4XUO A;  3K46 A;  2VZO A;  3FN9 A;  3MO4 A;  2VZ3 A;  1UZ0 A;  2QQN A;  2QQO A;  3FHQ A;  1RYY A;  2WN2 A;  4DUX A;  3BGA A;  2VCC A;  3DYO A;  3OGR A;  1XC6 A;  2VJX A;  3T0D A;  1NKG A;  2RVA A;  4RYD A;  4OYU A;  5JXI A;  4A45 A;  3CMG A;  4BK5 A;  1UY4 A;  1JU3 A;  1OF4 A;  1W9W A;  4JKM A;  4QAW A;  1CZS A;  1GMM A;  3K77 A;  2WUH A;  3DEC A;  2VMF A;  2YC2 A;  4PT6 A;  2JDA A;  2XQX A;  3GM8 A;  1UX7 A;  3OEA A;  2B9V A;  2VO5 A;  3K75 B;  4HG6 B;  3E1F 1;  2JKX A;  4W8J A;  3VD4 A;  4IUG A;  5HPO A;  5IFP A;  1D7P M;  2ORZ A;  2VMC A;  3VD9 A;  2QBX A;  3I3D A;  1UMH A;  1UY3 A;  1W9S A;  2VZV A;  2VTF A;  2XOM A;  4XUQ A;  4A42 A;  4LQR A;  4M4P A;  1O8P A;  4BK4 A;  1HN1 A;  2VR4 A;  5LA2 A;  3IAQ A;  3FL7 A;  3PUI A;  5EJ1 B;  5DPN A;  4DUW A;  1TG7 A;  2WN3 A;  3VD5 A;  1GQP A;  1O59 A;  2BBA A;  1TVG A;  1ULP A;  4DXT A;  1JYN A;  4UOJ A;  5JUV A;  4ARY A;  2PQS A;  2W91 A;  2YC4 A;  3NJX A;  2VZ1 A;  2EIB A;  2E32 A;  3WNK A;  3I2J A;  3HNB M;  4BDV B;  4MGQ A;  3C7O A;  1P8J A;  2W94 A;  1JZ8 A;  1NUK A;  1K12 A;  5FUI A;  3ACF A;  3CZU A;  1F4H A;  2Y6G A;  4CUB A;  2V72 A;  2WAA A;  2VQU A;  3OEB A;  4W50 A;  2V4V A;  5JXH A;  1W99 A;  4P02 B;  1DYO A;  4A3Z A;  2DCJ A;  1K45 A;  2VMD A;  1GOG A;  4QX3 A;  4CU8 A;  3BN6 A;  1DP0 A;  1K42 A;  2J1S A;  3CDZ B;  3OGV A;  2ORX A;  2W87 A;  2X09 A;  1JU4 A;  4MOA A;  1SG3 A;  3UET A;  3VD7 A;  1GOH A;  5JMO A;  4GWI A;  3WNO A;  1UXZ A;  2QQM A;  2W46 A;  1CZT A;  5F7U A;  3WNP A;  2J1U A;  3ECQ A;  4ZXE A;  4YPJ A;  2JE8 A;  1PMJ X;  1L7R A;  3CIH A;  3LE0 A;  2XHN A;  4DUV A;  3GGL A;  1PX3 A;  2QQL A;  3A23 A;  3GDB A;  4A41 A;  1JI6 A;  3OB8 A;  3I3B A;  2B4K A;  3T0B A;  2C4X A;  2R7E B;  3CQO A;  4CU7 A;  2VZQ A;  3I2G A;  2W47 A;  2J1A A;  5DMY A;  1LNS A;  1CIY A;  4E8C A;  1W9T A;  3HNY M;  1H6Y A;  3W5M A;  1CZV A;  1UXX X;  1WCQ A;  3T2Q A;  3III A;  3NQH A;  3C7G A;  3WNN A;  3WF2 A;  3HOB A;  1W8O A;  1J83 A;  4AAX A;  4OMD A;  1IQD C;  3K4A A;  4JHZ A;  1PMH X;  3NRU A;  5IHR A;  4QDQ A;  3HN3 A;  3K4Z A;  2VCA A;  5DQ0 A;  1JYV A;  2J7M A;  3C8X A;  1ULO A;  2WO1 A;  1JYX A;  2Y6K A;  3OGS A;  1JZ5 A;  2ZEZ A;  1UYY A;  2W1S A;  3PUH A;  3SKV A;  1I5P A;  4A44 A;  2ZEY A;  4CUC A;  3NNG A;  5LA0 A;  2V5D A;  4W4Z A;  2LS6 A;  2J1V A;  3U37 A;  1XNA A;  2L9L A;  2VC9 A;  3VDA A;  3D3A A;  3LPG A;  3VDC A;  3SKJ E;  4QX0 A;  5C71 A;  2OKX A;  3A21 A;  2Y6H A;  2DCK A;  4OUE A;  1KEX A;  4FI9 A;  3NJV A;  3LQC A;  1H6X A;  4A6O A;  5IFT A;  2RJ2 A;  3ACG A;  4DXS A;  4TXW A;  2WDB A; 
#chains in the Genus database with same CATH topology
 2JX9 A;  1UO9 A;  3HN1 A;  4HON A;  5CIR A;  1J3R A;  1KGY A;  1N3P A;  3HBZ A;  4CZS A;  1QDO A;  1CAV A;  3B01 A;  1OT5 A;  5FZ3 A;  4GMP 1;  2VUC A;  4AFB A;  4LLO A;  3OUH A;  2JJ6 A;  2BGO A;  3RI8 A;  3I8T A;  3ES4 A;  4P9J A;  3ZFE A;  4NHK A;  2YB7 A;  4L0P A;  3S6P A;  2LTN A;  4P14 A;  4KI5 M;  4JC1 A;  1ULG A;  5K0U A;  3ZR5 A;  2IXK A;  3AXD A;  4K40 A;  2IXJ A;  5A1A A;  1BMV 1;  2JG9 C;  3LPF A;  1OA2 A;  1V70 A;  1PZ7 A;  2WZP P;  3H3Z A;  5LEJ A;  3A22 A;  1UOF A;  1UYP A;  1RHI 2;  3CZJ A;  2VNV A;  1W3V A;  4MLO A;  1H1I A;  4XTP A;  2HLE A;  5L7O B;  4KWU A;  3ZYF A;  2WKK A;  5ABJ A;  1IS6 A;  3RGB A;  4CEY B;  1QEX A;  5CFD B;  1Q8V A;  1IZ3 A;  1R09 1;  3DV8 A;  2PA7 A;  3ACI A;  1SPP A;  1WLW A;  2ZEW A;  5A6Y A;  1G8W A;  2EXI A;  4GQ7 A;  4Y1X A;  4DFS A;  2A6X A;  4CCC A;  3OBZ A;  2BGC A;  1OH3 A;  2H6B A;  2ZGT A;  1FAT A;  2UWA A;  3N7M A;  1IS3 A;  4Q5O A;  5FYC A;  1G9A A;  3O1U A;  2OPK A;  1G9B A;  1GP4 A;  1F4A A;  3GZU C;  3SEE A;  5JXJ A;  5CKM A;  3POE A;  4ZS3 A;  2EID A;  4B4P A;  4HN0 A;  2P5B A;  4LOS A;  5A7W A;  3CF6 E;  4U36 A;  3THD A;  1OI6 A;  4EQV A;  5I8Y A;  4Q4Y 1;  4RSU A;  3T08 A;  4CP0 A;  3VZK A;  4XF0 A;  1UF2 C;  3MW2 A;  1N3O A;  1S0D A;  2KD7 A;  3NMB A;  4QDS A;  2EIE A;  4WM8 C;  2RJK A;  4NIG A;  4YGD A;  4XDQ A;  2D5F A;  2D98 A;  1CAX B;  2BTV C;  4OI4 A;  4YG3 A;  5L7O A;  1ZZB A;  2VUL A;  3UK9 A;  2E53 A;  2Z42 A;  2BVV A;  2YYO A;  1JZ4 A;  1HQL A;  3NAP B;  4Q4Y 3;  4RFT 0;  2VVE A;  4UAP A;  4Q4W 1;  1A6C A;  2IXI A;  3AC0 A;  3TAY A;  1W2O A;  3AFK A;  4JTO A;  1UU4 A;  2GMP A;  5FIX A;  4A4A A;  1UZV A;  1AR9 3;  2I74 A;  2QFE A;  2W1W A;  3MV0 1;  3UYJ A;  4QKD A;  4MXV A;  3B9C A;  3NW4 A;  2D40 A;  3P1I A;  4NHY A;  3VDB A;  4ARX A;  3VBO A;  2ZXQ A;  1HRV 3;  2RS1 3;  2ZTN A;  3RJ2 X;  1PGL 2;  3U07 A;  3W5N A;  3UGF A;  1BHG A;  2EIC A;  3UL2 A;  4YM2 A;  3O1S A;  4N7U A;  3C7E A;  1QKQ A;  2YRO A;  4Q4V 1;  4JKL A;  3I97 A;  1KXG A;  2A70 A;  4Q4V 2;  5LRS A;  2VY0 A;  2Z69 A;  2P3Y A;  5IJR A;  5AVA A;  5CBL A;  2YBP A;  2YFU A;  5EYX A;  1FXZ A;  5BNP B;  4M3C E;  4E2S A;  2A3W A;  1Y9Q A;  3ILR A;  2LUW A;  3ZO0 B;  1UMZ A;  1VAM A;  5FFO C;  4DIQ A;  1BVV A;  2Q30 A;  5FRA A;  3VDD C;  1PVC 1;  2FCU A;  1CAU A;  1VB4 A;  1GOF A;  5F37 A;  3RZJ A;  3OSD A;  1SLC A;  4LXL A;  1VBD 3;  4Y1V A;  4GB3 3;  1C28 A;  3AP9 A;  4QHZ A;  5F9T A;  5JCT A;  2P3J A;  3SHR A;  5A7S A;  5CAD A;  1KS5 A;  5K0U C;  4KU8 A;  1XXN A;  4R9A A;  1SMV A;  4DEQ A;  4BIS A;  1QNY A;  1OVP A;  2CDO A;  3BOP A;  4XUT A;  5CU1 A;  3KSC A;  1K5M B;  4P9W A;  4BPZ A;  1F2N A;  3OPT A;  3M4F A;  3POF A;  3LIG A;  3KD4 A;  4QKB A;  5EPA A;  4XVH A;  1MS0 A;  1NE4 A;  2VPV A;  2VOW A;  1DQ6 A;  2XBO 2;  5LCW L;  1DF0 A;  4D8M A;  3AMN A;  1IGO A;  1W0N A;  1RUO A;  3WQ0 A;  2XML A;  2FDI A;  3UJO A;  4AED C;  1REE A;  4Q1P A;  3H1W A;  5I8S A;  1GFF 2;  4LBO A;  4B8E A;  3DPR A;  2HWD 2;  1YIF A;  3KV4 A;  3OYW A;  1YI9 A;  5FWJ A;  4XAC A;  1WA6 X;  1ONA A;  1S0F A;  4JKK A;  4MGT A;  4YGE A;  3RZL A;  2IZW A;  1HXS 3;  5AC9 1;  4LBQ A;  4W6X A;  1YFY A;  5GJ6 A;  4M0N A;  3O1O A;  4QQ2 A;  4Q0Q A;  4P9G A;  2YFZ A;  1SBE A;  1OLR A;  3D6E A;  3ACH A;  1AVB A;  2ZGO A;  5GZG A;  4CXY A;  1BYH A;  5FZF A;  1JZ6 A;  4UI9 L;  2GNT A;  4BJ0 A;  1SHW B;  4Y5T A;  2RS5 3;  3LDK A;  1DCS A;  1CGP A;  1IPS A;  2BRT A;  4QB6 A;  3QH7 A;  2A6V A;  2A71 A;  4P00 B;  1O8S A;  1FX5 A;  4XUR A;  3AM2 A;  3ZSK A;  3QAC A;  5J1X A;  1JZ2 A;  1UOJ A;  1N1S A;  1X8E A;  2NLR A;  4QX2 A;  1R64 A;  4H7L A;  3MIC A;  5C4W C;  3WG4 A;  2RDR A;  2V09 A;  5A80 A;  2FMY A;  4R9D A;  5GZE A;  2WNV A;  1OOP C;  3IKW A;  3J8F 3;  4YZ3 A;  3N3H A;  3R6S A;  3ZDS A;  4JCK A;  3W58 A;  2FD8 A;  1AXZ A;  1JHJ A;  3MID A;  4D6R A;  5AC9 3;  3B69 A;  3HJR A;  1RUN A;  3OYW B;  4RQP C;  3PUR A;  1UOB A;  4NN0 A;  1W39 A;  4AQS A;  4UW6 A;  1JUH A;  5FBZ A;  5KHJ A;  3IIA A;  3LIH A;  5C8C A;  2E51 A;  1NA1 A;  4MUV A;  1EY2 A;  1E5S A;  2DVG A;  2HWB 1;  2DDU A;  4Q4X 3;  1YQC A;  1Q8S A;  4TN7 A;  4ZXK A;  5HBA A;  4JZR A;  1WW5 A;  5FY4 A;  5FZ7 A;  2Q8C A;  5EJZ B;  3SEP A;  3VB9 A;  2G9Z A;  5FZO B;  2BP6 A;  4UF0 B;  4COW A;  3B7M A;  5LBB A;  4A7Y A;  1C8M 3;  4YW6 A;  1UU5 A;  2RS1 1;  3T2O A;  3GCW A;  3V0B A;  2YPJ A;  2GME A;  1U5I A;  3O7O A;  4OMC A;  4GB3 1;  1G9C A;  5FYZ A;  1C57 A;  1HB4 A;  2ZBJ A;  2NMN A;  4FQ4 A;  2XJR A;  4YG0 A;  3THC A;  1W06 A;  2X05 A;  4QB2 A;  1EP0 A;  1NCR A;  3FBY A;  5H9P A;  2ARC A;  4V1P A;  1VE0 A;  1HB1 A;  3OD0 A;  1ODM A;  4FP2 A;  1QJU 3;  3ASI A;  4XCA A;  5FY1 A;  5LBC A;  5CFC C;  3LEM A;  1QXJ A;  2WYS A;  4COU A;  3A4U A;  3WD5 A;  1AL0 G;  1JN2 P;  2Y64 A;  2CHH A;  3NJZ A;  2JWP A;  1VMH A;  3VBO B;  3VBU B;  4COZ A;  5JOZ A;  3D0J A;  1W6Q B;  3FN9 A;  4B4Q A;  1V6N A;  2R30 A;  3SCF A;  1HQW A;  1FMD 3;  2D3S A;  2QQO A;  3PU3 A;  5FPB A;  5FY7 A;  2ARX A;  1RYY A;  5JIA A;  1HIX A;  1QOT A;  3VBO C;  4X6R B;  3NV4 A;  2VCC A;  3RI9 A;  1RTV A;  3T1M A;  2YHJ A;  3OGR A;  4IV3 C;  5EV7 A;  3HAG A;  4AQT A;  5IK4 A;  1YQ6 A;  3APB A;  4AEJ A;  2XWJ B;  5JXI A;  2RE9 A;  5LZ6 A;  3CMG A;  5FUN A;  1XE0 A;  1JU3 A;  1AYM 2;  1JW6 A;  1ZBE 3;  2WFP A;  3VBF A;  5DAQ A;  2WJS A;  2N7G A;  1PIV 2;  2CL2 A;  5C6C A;  3N4M A;  1AJK A;  1WMX A;  2P6C A;  4QD2 A;  1N1T A;  2VBP A;  4HLT A;  4Q8L A;  3FHI B;  2VMF A;  2RS3 2;  1GLH A;  2H0V A;  5GLV A;  1QMJ A;  4Z07 A;  4AK3 A;  1NCQ A;  1WCD J;  4AFM A;  5JZG B;  5L9B A;  1MS9 A;  3PLQ A;  2VO5 A;  3TEY A;  4HG6 B;  5KR7 A;  1FMD 1;  3E1F 1;  2CGP A;  1ZRI A;  2RS3 1;  1L3J A;  2JDM A;  3WW3 A;  4I09 A;  2ZHL A;  1BBT 1;  2Q0A A;  2ZZQ A;  4D69 A;  3I3D A;  2WC2 A;  4B7E A;  2VE1 A;  4XUQ A;  1W9S A;  2VZV A;  1RUI 2;  1ZBE 2;  1TZO A;  2R6Q A;  1STM A;  4LHK A;  3WP3 A;  1EPZ A;  2VW1 A;  2B39 A;  1W9F A;  5ERL A;  4AI9 A;  1HXS 2;  3H1M A;  4B1M A;  3IT8 A;  4QPG B;  2YBS A;  2RS3 3;  3JB8 A;  5C3P A;  1DQ1 A;  2RM2 2;  4LR4 A;  2DCZ A;  3PUI A;  1QQP 2;  4NPL A;  4N53 C;  1H8V A;  2GC1 A;  5KBF A;  5BV6 A;  1C8M 1;  2WA3 A;  5FZ8 A;  5DZG A;  2ADD A;  2RHP A;  1EYB A;  3H7Y A;  5A33 B;  1YXW A;  1O3R A;  4AVT A;  1GQP A;  2YZ4 A;  4LE4 A;  4E4Z A;  3B93 A;  4GMP 3;  3MW3 A;  5FUP A;  2BBA A;  2A6Z A;  2GDF A;  4F3J A;  4AFA A;  4RHV 1;  1JYN A;  1GBG A;  1GWM A;  4Y22 A;  1SAC A;  2VTX A;  4H3W A;  4ARY A;  4E4H A;  3ZMN A;  2W91 A;  3ZR6 A;  2XBO 1;  3RMX A;  3ZSE A;  3RYP A;  3OUI A;  3I2J A;  3HNB M;  5C8C B;  3H8O A;  1P8J A;  2XXZ A;  1Q8O A;  3VKO A;  4CDU B;  4PF5 A;  2ET7 A;  2AZ5 A;  1RL3 A;  2BFU S;  2CAV A;  2V72 A;  2V5Y A;  4LK7 A;  4EN9 B;  2JD4 A;  1OLM E;  3O5S A;  4QHO A;  3S5Q A;  1X8M A;  2WWJ A;  3MFA A;  4Q4X 2;  5E88 A;  2ZPX A;  3RG0 A;  2DUP A;  3GBF A;  4UFL A;  4UFK A;  1POQ A;  2DCJ A;  1J3Q A;  1HJF A;  3BPZ A;  5EHD A;  4Q8K A;  1VBB 3;  2ZX0 A;  4QX3 A;  3H8U A;  4UF0 A;  4PBP A;  1Q43 A;  4XIL A;  1PK6 C;  2DCT A;  2HJI A;  3E5U A;  2I07 B;  4OUS A;  3CDZ B;  3OGV A;  3RWK X;  1PNF A;  1XYO A;  3AZY A;  1LHN A;  1VBA 1;  1HLC A;  4HKO A;  3CU7 A;  4H55 A;  1LOC A;  3NAP A;  4Z2W A;  1UQX A;  4PLO A;  4AQ6 A;  4P5H A;  1SG3 A;  2R1D A;  3IZO A;  1J3P A;  3VD7 A;  3FFQ A;  4Z1V A;  1XE7 A;  3AYE A;  4PIX A;  1M06 G;  1G6N A;  4RR3 B;  4NJ4 A;  2XL7 A;  3SQO A;  1JOJ A;  4AVC A;  5F1R A;  1S4C A;  1AL2 1;  1C8N A;  3IWZ A;  4NHM A;  1Y3T A;  2FHR A;  1AL2 2;  2CY6 A;  3TYJ A;  4TLG A;  1AR6 1;  2C0Z A;  2X29 A;  2XJV A;  5HV4 A;  1ASJ 1;  1RVF 1;  3IBM A;  4O9E A;  3W21 A;  1OC1 A;  5JOX A;  2UWB A;  3DF0 A;  4F8A A;  1VBC 3;  5HV0 A;  1KDK A;  3GDB A;  4P9Y A;  2PTM A;  1LCL A;  2B4K A;  2PHF A;  5FYI A;  4N53 A;  4B1L A;  4AI2 A;  1Y43 B;  5FYY A;  2DV9 A;  1HV0 A;  1Z7S 1;  3CQO A;  5FZM A;  3I7D A;  4BA6 A;  2IXL A;  5C3Q A;  4I3G A;  2J1A A;  1XNC A;  1LGC A;  3MIH A;  4IE6 A;  5DMY A;  1I5Z A;  3PJY A;  4QQP A;  3WR0 A;  4E8C A;  1W9T A;  2Y60 A;  3PUS A;  3AMM A;  3BCW A;  3WG3 A;  2WR9 A;  4XFH A;  1PM4 A;  1AYM 3;  2GN7 A;  5DDJ 3;  1KFX L;  4IXL A;  2HWF 3;  3JUU A;  5FPV A;  3TEW A;  3NQH A;  4PBO A;  2QQV A;  4HVR A;  5KHK A;  3WNN A;  3O1M A;  4LT5 A;  3E6B A;  5GKA C;  5IW0 A;  3OGJ A;  1W8O A;  2NN8 A;  3WT3 A;  4AAX A;  3DL3 A;  3E6D A;  1A8D A;  1Z0H A;  4AGG A;  4CCM A;  4AFD A;  2D6P A;  1QJY 3;  1F5J A;  5IHR A;  4QDQ A;  1H2M A;  3HN3 A;  4IE7 A;  5A70 A;  5FP8 A;  2J7M A;  1W2U A;  1O3S A;  2WT2 A;  1LOF C;  1UU6 A;  1ULO A;  1DHK B;  2Y6K A;  3OPW A;  3AX4 A;  2ZEZ A;  2VNR A;  1AYN 2;  4MSV A;  3O0X A;  5T55 A;  3USS A;  4K3U A;  1UYY A;  2W1S A;  3PUH A;  4CCE A;  2XR4 A;  2PAM A;  2WWS A;  4GUL A;  2JG8 C;  1FV3 A;  1W3X A;  1NLS A;  1NE6 A;  3HR9 A;  3JU9 A;  4RGG A;  4XQD A;  4W4Z A;  5HCB A;  1U5Y A;  1GNZ A;  4YFW A;  5HCH A;  1RIR A;  3U37 A;  3IDE A;  2JE9 A;  1JHN A;  1S0B A;  1XNA A;  2JEN A;  2R49 A;  2CAU A;  1UZW A;  2JDH A;  3LFM A;  3MDP A;  4PIY A;  4OI1 A;  4QX0 A;  3S5A A;  3T4V A;  2Y6H A;  2TNF A;  4IES A;  5D8A A;  3BTX A;  5J48 A;  3JB4 C;  4X6Q B;  4F7Z A;  4FI9 A;  4Y22 B;  3SH4 A;  3ZYI B;  2A75 A;  4FSJ A;  1H6X A;  4KGG A;  3I3Q A;  4IV1 C;  4WVZ A;  4YGC A;  5FK7 A;  3WP5 A;  1H1A A;  3MEP A;  5FDB A;  1IPK A;  2TUN A;  3SH3 A;  2B8M A;  2W68 A;  3FJS A;  3VN4 A;  1VBC 1;  4NIH A;  3M2M A;  4C1W A;  4MH0 E;  1GWL A;  3OBA A;  1KDM A;  5IWF A;  2VL4 A;  4KMQ A;  4R8H A;  1W6N B;  2FCV A;  1CD3 G;  1RMU 3;  2BZD A;  4A7Z A;  4CXW A;  2JEC A;  2Q1M A;  5FPA A;  3KQ4 B;  4YVS A;  2J1E A;  3ETQ A;  3JD7 1;  3MPB A;  4ZZ8 A;  4J25 A;  4QKN A;  1UYZ A;  1FV2 A;  1AR7 1;  1T2X A;  5C9A A;  1UKR A;  3I2F A;  3ZXE A;  3ST7 A;  3BUC A;  2R1B A;  4JRA A;  1AR7 2;  4UFJ A;  1PGW 1;  4QT6 A;  1RUF 1;  5BNN B;  2UU8 A;  1I3H A;  3AKR A;  1IG0 A;  3N7K A;  4Q1R A;  1ZYB A;  1ZRC A;  4RQP B;  2FMD A;  4FO9 A;  5IT6 A;  5FMO S;  2E7A A;  5DG1 A;  2VEC A;  1UAI A;  3GJA A;  3THT A;  3X29 B;  1AJO A;  1WUV A;  2KR2 A;  4PIZ A;  1UYX A;  2WO2 A;  3VDD B;  1YEW A;  3SXW A;  3EJK A;  4U2A A;  4LIV A;  3WF1 A;  2PN5 A;  1VR3 A;  4CEY C;  1VBB 1;  3UJQ A;  4XJW A;  1DQ0 A;  5DUW A;  1DQ4 A;  1IS4 A;  4CUA A;  4QPI C;  1GR3 A;  4JDO A;  1L7Q A;  1VBD 2;  4W65 A;  3HT2 A;  4BMB A;  2GZW A;  2Y0O A;  5C70 A;  2YUE A;  1IPJ A;  2OPW A;  3ZXG A;  3WG2 A;  3WQB A;  1R09 2;  1XSQ A;  4DMI A;  2BWC A;  3EMR A;  5CFC B;  1ULE A;  2HBT A;  3I2D A;  3VGI A;  2PHD A;  4SBV A;  4AHZ A;  1DLL A;  1W03 A;  3UT0 A;  3KGZ A;  1YLL A;  2ARE A;  1GU3 A;  1HQN A;  2NYY A;  1WBL A;  2XBO 3;  1UIK A;  4DO0 A;  3ROU A;  1R1A 3;  2PHR A;  3IMN A;  4OQ8 A;  4YAR A;  2R32 A;  4LLF A;  4MGS A;  3KT7 A;  3SIS A;  3U14 A;  2WNO A;  4FPG A;  2HWD 3;  3WUC A;  3NL1 A;  3CLP A;  2JEM A;  3KZ4 C;  5F8P A;  2D43 A;  3U78 A;  2UY8 A;  2ZKN A;  1COV 2;  4JAA A;  4BYY A;  3DCQ A;  4L99 A;  3ZXJ A;  4L9B A;  5I0T A;  3T3Y A;  5CB7 A;  4XCB A;  4UYB A;  2W1U A;  3M3C A;  4YWA A;  4GH4 B;  4B3N A;  2WSU A;  3NAP C;  4ZPI A;  5DAX A;  4L11 A;  4NO4 A;  2RS5 2;  1H8T B;  4LO8 A;  4YRD A;  2KM2 A;  4WVM A;  4XHB A;  1J1L A;  1ND2 C;  3DN7 A;  3U10 A;  3MV1 1;  1E5I A;  2YY1 A;  3WF4 A;  5L9V A;  1VRB A;  4UFH A;  1YJL A;  4MXW A;  2XON A;  4V2W A;  4JGZ B;  2WZR 3;  3USU A;  4D0Q A;  1TMF 2;  1UZZ A;  1QJY 2;  2NPI A;  4JDM A;  1OA3 A;  4CDW A;  4CU9 A;  5HCF A;  5C9A C;  1RMU 1;  4FPL A;  2B5H A;  3CJI B;  2BER A;  2UYA A;  2B45 X;  1AYN 3;  5HI0 A;  3ILF A;  1HV1 A;  2ET1 A;  3AKS A;  1OPM A;  2QDR A;  2HWD 1;  3I59 A;  3LOB A;  3PTY A;  4GA9 A;  2QQU A;  4HFS A;  4LKS A;  2QJV A;  5JWP A;  2BU9 A;  1NLQ A;  4P5Y A;  5A3W A;  4JHT A;  3CKH A;  4D7Y A;  1LGN A;  5IVC A;  1NA1 B;  1W6P B;  1MAC A;  2BEO A;  2NZ9 A;  3ATG A;  5CVR A;  3NO8 A;  4X8P A;  2VZT A;  5A33 A;  4R4X A;  1PVX A;  5T54 A;  1MZF A;  5JZG A;  5DAB A;  5DZE A;  5K9Y A;  1KRI A;  2LM3 A;  3QD6 A;  3VKN A;  4CVU A;  2A3X A;  1T6G C;  2E26 A;  2PQQ A;  2DCY A;  3IAP A;  4MGY E;  5BXX A;  4ASL A;  3THP A;  4CUG A;  1US3 A;  2A5Z A;  5FO9 B;  5DAP A;  1JYW A;  3ENR A;  3KS7 A;  3OPZ A;  1VLN A;  2HWF 1;  2CWS A;  5HCA A;  2EIG A;  3WZ1 A;  1OD5 A;  3HT1 A;  3WV6 A;  1QJF A;  5C7G A;  5E89 A;  5A1F A;  2VOT A;  4DEV A;  4KU7 A;  1R08 2;  5CFD A;  4C0B A;  5L36 A;  2IXH A;  2D97 A;  2R06 3;  2VU9 A;  4NUB A;  1OKO A;  4Y20 B;  2ZGN A;  4AGV A;  5FYH A;  1D4M 3;  1EUU A;  1JS9 A;  4RGA A;  4TLF A;  1MR5 A;  3AFG A;  1FMD 2;  5FP4 A;  1OLM A;  4S2D A;  4HPK B;  2FDH A;  1AX0 A;  4GMP 0;  4P9I A;  2D93 A;  4E2Q A;  4CXX A;  5C9A B;  4BH9 A;  1AR7 3;  2ILM A;  4NID A;  2F17 A;  4DRV A;  4XIO A;  3BTY A;  2W95 A;  4KH9 A;  2GC2 A;  3ZDV A;  3SNM A;  1WA4 A;  5ACA 3;  5FYU A;  3BPS A;  4XEZ A;  1TNF A;  2VAU A;  2XJQ A;  1RUC 1;  5F32 A;  1IG3 A;  2EXJ A;  2P2K A;  3PVE A;  3VDD A;  4BOW A;  2WNU C;  3HEI A;  1V6K A;  1DDL A;  3IM0 A;  1R08 3;  4YM3 A;  3WQ7 A;  1X33 A;  2WLP A;  2CSG A;  2YDE A;  1CPM A;  4GAL A;  2VBD A;  4RR3 A;  4IQP A;  2EF6 A;  4AI3 A;  1DYP A;  3M7A A;  2A6W A;  1FAY A;  5F39 A;  4IE4 A;  4MX3 A;  1WMF A;  1W8N A;  5JR2 A;  2JDZ A;  4HVO A;  2RS1 2;  5FCC A;  3ZFG B;  3RZH A;  3GZA A;  4D6S A;  1O4Z A;  1XE8 A;  1HN0 A;  2A7A A;  3B94 A;  1MQT A;  3I2H A;  1S0C A;  2ZOE B;  4CU6 A;  4CDX C;  1V9U 2;  2TBV A;  2DVA A;  3HQX A;  1J1T A;  2D3R A;  2Q1F A;  4IE5 A;  4E4D X;  4Q4V 3;  3EB7 A;  2CGN A;  2WNU B;  4JRL A;  5JAX A;  3WSO A;  4JGY B;  2W5F A;  1AZD A;  4CDW C;  1JYC A;  3SMH A;  2BNO A;  2P3I A;  1DZT A;  1ENS A;  2VCM A;  1ODN A;  2WO3 A;  1GIC A;  3LSE A;  4RN5 A;  3VBH A;  4YW3 A;  1IS5 A;  3P3P A;  4CA9 A;  1RUI 1;  1WME A;  2UYB A;  1W05 A;  1X36 A;  4QX1 A;  2XJP A;  1K3I A;  5G04 L;  4XDP A;  2ES3 A;  4CCN A;  1AR8 3;  4Y1Z A;  1DQ5 A;  1SBF A;  3Q9O A;  4AQ2 A;  4BB3 A;  3OY8 B;  3IPV B;  3K46 A;  1RUH 1;  2DU0 A;  3L2Y A;  4QXC A;  1KD7 A;  2RM2 1;  2CWM A;  4RGK A;  2DFC A;  1YWK A;  3SCG A;  1Y4W A;  4IEW A;  2AYH A;  1H4G A;  4TZD A;  5FJH A;  1PVC 2;  1S2B A;  1H8T A;  1ND3 B;  5J09 A;  2ZJC A;  4DUX A;  3CHX A;  2XVG A;  3QCW A;  3AKP A;  3NV1 A;  2KA3 A;  4IGQ A;  4XBQ A;  2G4I A;  4NVP A;  1MZ5 A;  1AYM 1;  1ST8 A;  1A34 A;  3T0D A;  3WDW A;  4RYD A;  3ORJ A;  4ZS2 A;  3FC0 A;  3CL1 A;  1AR8 2;  4BE3 A;  4OYU A;  4NRM A;  3K2O A;  5C8C C;  3ZYB A;  3JCI A;  3A0N A;  4LBQ B;  2Q5T A;  5I0U A;  1C5H A;  1V6L A;  5AVP A;  5FQ0 B;  5FY8 A;  4N90 A;  4E9K A;  4AVS A;  4Y5Z 0;  1W8U A;  5FKB A;  4IW3 A;  5FZ6 A;  1BQP A;  3WW1 A;  5L73 A;  1KS4 A;  2DUO A;  2F4L A;  4OHY A;  4QAW A;  4LHL A;  2JKB A;  4IER A;  2WUH A;  4MGK E;  3KM5 A;  2O8Q A;  1VMF A;  2VOK A;  1VIW B;  4LBQ D;  4QGL A;  4AED A;  3ME2 A;  4A7K A;  2YC2 A;  5T50 A;  1G9F A;  3AMH A;  5IVJ A;  5KC6 A;  3M3E A;  5APA A;  5GZD A;  1ASJ 3;  1RVF 3;  4CPB D;  3OEA A;  1O3T A;  4BIO A;  2RR1 3;  4B29 A;  2BWA A;  2QDN A;  3V0A A;  3O1T A;  3LGR A;  3PIG A;  5H9R A;  2JKX A;  1W6M A;  1LOA A;  3MIF A;  4Y24 A;  4GKX A;  3VD4 A;  1CJP A;  4IUG A;  4LBL A;  3I2O A;  4MZU A;  5HPO A;  5FMO L;  1VRH 1;  2ORZ A;  1QWR A;  1AXY A;  4AHW A;  2JB8 A;  2QBX A;  3ES1 A;  4ISQ A;  5ACA 1;  2XDV A;  1UMH A;  3U4X A;  1UY3 A;  2XOM A;  2VXR A;  1CAW A;  2PHT A;  1LEN A;  3JQW A;  3JZV A;  4FCA A;  5EP9 A;  1BCX A;  4LBJ A;  2Y38 A;  1OFS A;  5IVY A;  1O8P A;  4CPB A;  4HPK A;  5A7Q A;  1O6U A;  3ZYP A;  1AL2 3;  5FYS A;  1ND3 C;  3IAQ A;  1G86 A;  5ANN A;  1ASJ 2;  2IWG B;  1RVF 2;  1V00 A;  1Z7S 2;  1C8M 2;  4GH4 C;  1C4R A;  5DPN A;  1UX6 A;  2EA7 A;  1WZX A;  4FFF A;  2YU2 A;  4E27 A;  2A6Y A;  4QU1 A;  3RSJ A;  2FCT A;  1TG7 A;  4WZF A;  3JBG 2;  5K0U B;  5D8A B;  3GAL A;  4CEY A;  1V6O A;  3ZPY A;  1QXR A;  5FXV A;  4X8N A;  5A3P A;  2BOI A;  3M8L A;  1ALY A;  1DYK A;  3R4S A;  1NCR B;  5F5Q A;  2CV6 A;  3PTR B;  3AP5 A;  1UCX A;  4DXT A;  1QJU 2;  1H2K A;  4UOJ A;  5FJK A;  2X5I A;  2GND A;  2PQS A;  1TE1 B;  4LKE A;  4WM7 B;  4J6G A;  5ABJ B;  2FBE A;  1NY7 2;  4ZKT B;  2VZ1 A;  3TNQ A;  4KG8 A;  4XAE A;  4XXA A;  2E32 A;  5FZG A;  3WNK A;  2HEW F;  4MGQ A;  5GZF A;  3C7O A;  3VBR C;  1WGP A;  1NUK A;  1K12 A;  5FUI A;  2HWF 2;  2HEV F;  4EJR A;  4CDQ A;  4CUB A;  4IEZ A;  4GWN A;  3VBS A;  3VV1 A;  4I2O A;  4FBF A;  1WCS A;  4FTS A;  5I0R A;  1V9U 3;  4IEY A;  1W99 A;  3AVR A;  5GLZ A;  1K45 A;  3Q8C A;  1SEF A;  1NLR A;  1WMD A;  5FZK A;  5I91 A;  2WNU A;  4CU8 A;  1XJA A;  2J1S A;  4LK6 A;  4NHL A;  3PME A;  2JIC A;  2GH2 A;  4TWT A;  1YHF A;  2C6S A;  3VBR B;  1F5F A;  1JU4 A;  1LED A;  1POV 1;  1GV9 A;  4Q26 A;  4MOA A;  4AGR A;  3NKG A;  2Y0I A;  5FZA A;  4IGP A;  1UN1 A;  1HB2 A;  2ZKL A;  3MLK A;  4LHN A;  1JYI A;  1PIV 3;  1ZNP A;  3PU8 A;  2GN3 A;  4KG0 A;  4QHB A;  5GAL A;  2FDG A;  3VL8 A;  1UXZ A;  1Q56 A;  1PO1 2;  4WZC A;  5A3N A;  3S57 A;  1RJ8 A;  2JB4 A;  5C5T A;  2VD7 A;  4YYO A;  1YUD A;  1QDC A;  4XBL A;  4I01 A;  4XMI A;  4QQL A;  2R06 1;  3AKT A;  1WCU A;  2FZ1 A;  2MPF A;  4XE9 A;  3Q8E A;  2R07 1;  5GM0 A;  4AR2 A;  1L7R A;  1RXF A;  1VAL A;  2XHN A;  4AHX A;  3GGL A;  1PMI A;  1JBC A;  2QQL A;  3WDX A;  4A41 A;  4B4R A;  2ZCW A;  4XQW A;  1HW5 A;  1REF A;  3OB8 A;  3DGT A;  3HWJ A;  4PDW B;  2D3P A;  2C4X A;  1H8T C;  1W8Z A;  1N3Q A;  4CP9 B;  1YNA A;  1XU1 A;  3G7D A;  1XYP A;  4EN0 A;  4XJ9 A;  2F4P A;  1LHW A;  1QHD A;  2W47 A;  4QQH A;  1MZE A;  1AX1 A;  1OOP B;  4ISR A;  1AF9 A;  4NE9 A;  2D6M A;  2DTY A;  3WUD A;  3TEX A;  5JMC A;  1YIP A;  3NWK A;  3BIW E;  4XJZ A;  1RUF 2;  4LKD A;  4OFG A;  5FO7 B;  3WDV A;  4NPR A;  2LRP A;  5DZF A;  2PFW A;  4M0H A;  3VBF C;  2K9Z A;  1WLD A;  4MG2 A;  4XFI A;  2JE7 A;  3N9L A;  1UD1 A;  3HOB A;  3LWC A;  5F5C A;  1PO2 2;  1XB9 A;  2O1Q A;  2VMG A;  2ZS6 B;  4BQW A;  1ZVF A;  1S0G A;  2I2S A;  3H8X A;  2A73 B;  2AH2 A;  2Q4S A;  2QZ3 A;  5DQ0 A;  4CP9 A;  3OTF A;  1EAH 3;  1V6M A;  3GHN A;  2G1M A;  5GLU A;  5F2W A;  3GF6 A;  1IOA A;  2MEV 2;  3WY6 A;  1JZ5 A;  1B35 B;  2BUK A;  3G6J B;  5IUQ A;  4BZ4 A;  2DF7 A;  1U0A A;  1CQ9 A;  4JDN A;  4WM8 B;  5LWB A;  1BKZ A;  4JTN A;  5FXW A;  1K5J A;  3SKV A;  3I59 B;  2AGS A;  2R07 3;  2Q1Z B;  4OHX A;  4PI2 A;  1GZ9 A;  1QJX 1;  4A44 A;  4RS5 A;  3MGU A;  4YM1 A;  4URT A;  4UFI A;  3NNG A;  3QOP A;  2BW8 A;  5LA0 A;  1YQ5 A;  1PO2 3;  2J1V A;  2EXH A;  4QX7 A;  5FZ1 A;  4EV0 A;  3IMM A;  4NMI A;  3BTZ A;  4C0H A;  4CDU A;  1BVP 1;  5FZL A;  1QNW A;  3SKJ E;  4DRR A;  1LOG A;  2XJT A;  5K4L A;  2OKX A;  3A21 A;  4R9B A;  3FX3 A;  5DG2 A;  2D6L X;  4N43 C;  3AZX A;  3JBG 3;  4XF1 A;  2O0O A;  4Y4R A;  3FUQ A;  2AEY A;  2JXA A;  3NJV A;  1OMI A;  1VRH 3;  2X5I B;  5T52 A;  1VAK A;  3WVJ A;  3ACL A;  4O9G A;  5KXB A;  3N9Q A;  4R4Z A;  4FPO B;  4ES8 A;  5FOB B;  5IFT A;  1EPW A;  2XLF A;  3ACG A;  3EHK A;  4YNI A;  4AWD A;  4YW4 A;  3PVO A;  5JSO A;  2SBA A;  2XGX A;  2ZGR A;  3N35 A;  4WM8 A;  4L92 A;  3CNA A;  4CDX A;  5CG9 A;  3LKJ A;  3WDU A;  2WDB A;  3AYA A;  1RUD 3;  3IB3 A;  4WM7 A;  2JIG A;  1UL9 A;  1O91 A;  1QF3 A;  3EXU A;  3HD8 B;  2ZGL A;  4XBN A;  3W59 A;  5CG8 A;  1W0O A;  1N1Y A;  1VPH A;  2ZGS A;  1XND A;  2K0G A;  2QUO A;  1UOG A;  4KWK A;  2GMM A;  1XRU A;  3EQE A;  5L9R A;  4XAA A;  3PDQ A;  4K21 A;  3ZYH A;  1LHU A;  3JD7 2;  1ZBE 1;  2XUM A;  2YG0 A;  1QJY 1;  2WT1 A;  3LCP A;  1S0E A;  2GC3 A;  2VQ0 A;  5LY1 A;  3HQR A;  1ACC A;  3KGL A;  3N9P A;  4QDR A;  1GAN A;  1Q5O A;  1GQG A;  2Q8D A;  3M3I A;  4MHU A;  4XET A;  4OHV A;  1RIT A;  2ZGU A;  4HET A;  3T4H B;  1OH4 A;  4O7X A;  5FZO A;  2WAB A;  2OQ6 A;  3P5B A;  2HH9 A;  3CJI C;  1H4H A;  1JZ7 A;  3LEK A;  4FPY A;  4MAD A;  3E6C C;  3GBW A;  3NNF A;  3ZSJ A;  1BMV 2;  3HPN A;  1VBE 3;  5LAS A;  1RUD 2;  1JYT A;  4Q29 A;  1AR9 1;  3K4D A;  1W28 A;  1XYN A;  2LW8 A;  3TRS B;  1RHI 1;  4DXR A;  4IE0 A;  2WNE A;  2DFB A;  2QE3 A;  1ZRD A;  3A0K A;  1GUI A;  3H8R A;  4LKF A;  1BXH A;  3JD7 3;  3PVN A;  4YVW B;  5FY9 A;  5LBE A;  4QPW A;  3RS6 A;  3O1V A;  1UNB A;  5FPZ A;  1QIQ A;  4MO3 M;  3LZZ A;  1UMI A;  1OF3 A;  2PXJ A;  3WDY A;  2OVU A;  1WD4 A;  4YVS C;  2Q8E A;  5C3O A;  3IDA A;  4NRO A;  1MVE A;  3VZN A;  4ZZ5 A;  2CYF A;  1NG0 A;  2WS9 2;  4QXK A;  4ET7 A;  2P34 A;  2ADE A;  2G9G A;  2J1R A;  3B02 A;  2DBN A;  3M3Q A;  5D2A A;  1OPO A;  3OD4 A;  2E7Q A;  5LA9 A;  3MUY 1;  2VUA A;  2ZAB A;  1GSL A;  4I30 A;  4YSF A;  4LA2 A;  4QKF A;  3RZZ A;  3HNM A;  3VZL A;  4PHZ A;  2Z79 A;  3ZPO A;  5FZE A;  2UY9 A;  4KWJ A;  3KCX A;  2BYV E;  3T2T A;  4BHP A;  4XFG A;  1XOY A;  3ZXK A;  1LR5 A;  4HKW A;  5JR7 B;  2JG8 A;  4Q0S A;  2VQT A;  3VLB B;  2YPD A;  1URX A;  4AHY A;  2ZHM A;  1BBT 3;  1D4V B;  4XW3 A;  1W8W A;  1XNT A;  1US2 A;  3I2I A;  3MIG A;  5JI7 A;  2ZAC A;  4YW5 A;  2OII A;  4YZ2 A;  2WS9 3;  3ALQ A;  3RFR A;  2VXJ A;  1HRI 3;  4AI0 A;  4QMA A;  1Y9M A;  5C4W B;  4FXG B;  3V0B B;  1S0J A;  5JLV A;  4I0W B;  3ZIX A;  3ZFF A;  4AI8 A;  3O1P A;  5T5P A;  2HYK A;  3WHU A;  3WF0 A;  4ONU A;  1RIN A;  1SCR A;  4DQA A;  1B35 A;  4LO7 A;  3ZN6 A;  4MVT A;  3BAL A;  3CBN A;  3DPR C;  3DYM A;  1TQ5 A;  3WG1 A;  2DVB A;  5CA6 A;  2MEV 3;  4A6S A;  4O65 A;  1H30 A;  3UKV A;  2VME A;  1UY1 A;  4Y26 A;  1JXN A;  3LB9 A;  3D8C A;  4FPJ A;  4OUL A;  3P6B A;  3RWN A;  3VZJ A;  3WXP A;  2FDK A;  1QQP 1;  1PZ9 A;  3LAG A;  5IVF A;  4UFM A;  5JPN B;  3HQU A;  1CWP A;  1MVQ A;  3H0O A;  5FMB A;  3H1Y A;  4LHS A;  5GZC A;  5IK8 A;  1YO8 A;  3ILN A;  1XQN A;  1HRI 2;  1A78 A;  2QQW A;  3GXU A;  4JGZ C;  3WLU A;  5G05 L;  4Y1U A;  4PLN A;  5A7W B;  5A6X A;  2WBK A;  5FZ9 A;  4CYD A;  2VG9 A;  3W20 A;  5FOJ B;  5J7M A;  1UY2 A;  4QXH A;  1RUG 1;  4Q0U A;  5FYB A;  4CCL A;  1SLA A;  1MS4 A;  2J1T A;  4OZO A;  5LBF A;  2VUD A;  2HYX A;  5FMC A;  3W9A A;  2W92 A;  3RZM A;  2WWU A;  1FNY A;  2VW0 A;  4HKL A;  2RDN A;  4XC9 A;  1PIV 1;  2BNM A;  4RQP A;  4PQ9 A;  4TTG A;  1DIW A;  1TME 1;  3B00 A;  3K51 A;  4IV3 B;  2OA2 A;  1UZY A;  4P08 A;  1PNG A;  2E33 A;  4PJY A;  4XZU G;  5DAV A;  1R09 3;  1QH7 A;  1COV 1;  3TWI A;  4EN8 B;  4FPH A;  1LHO A;  2XJS A;  4L2N A;  5BNP A;  1LJ7 A;  3DKQ A;  1S2E A;  3T2P A;  5FLI A;  1SDD B;  1Y7B A;  1O7F A;  3AYC A;  3I2K A;  3O0W A;  5CFC A;  1PVC 3;  3BIE A;  1W6O A;  4FFI A;  4K8R B;  1POV 0;  4XUN A;  2PLV 1;  3A7Q A;  4QX5 A;  5H9S A;  4CP1 A;  5LA1 A;  2OUJ A;  2PLV 3;  2HBU A;  1MS8 A;  3POB A;  1V9U 1;  4YGB A;  4NWW A;  2DWR A;  3RYR A;  4EE2 A;  2YMZ A;  1R1A 2;  5JPM B;  2BPA 2;  4L8Q A;  2IVJ A;  3BVC A;  1W8F A;  1SFY A;  1H9W A;  1NX9 A;  4XJA A;  5A3U A;  1OVS A;  2PAE A;  5EIY B;  1COV 3;  1D2Q A;  2W9X A;  4AG4 A;  2ZMN A;  4HXC A;  5JDB A;  1VBE 2;  2WQ8 A;  5DUV A;  2RV9 A;  4IV3 A;  4LNV A;  1OUS A;  2RMU 1;  1SQ4 A;  1DLC A;  2JIJ A;  2RMU 2;  4LPL A;  2FDF A;  1CX1 A;  2OQ7 A;  3J7N A;  3FHA A;  4LOT A;  5JZG C;  3J7H A;  2VW2 A;  1D0G A;  2Z4F A;  2PLV 2;  4W6Y A;  1HKD A;  1JMU B;  2QVS B;  2GP5 A;  3POG A;  2VCB A;  2Y6F A;  5FBJ A;  1G9D A;  3RJR A;  1X7N A;  3TB0 A;  1TMF 3;  2XL9 A;  5F3C A;  5T3N A;  1XU2 A;  4IEO A;  4QGM A;  3M1H A;  2RR1 2;  3FUO A;  5J96 B;  1J84 A;  3LDB A;  2JDN A;  4IEV A;  3UNP A;  5T5O A;  1JZ3 A;  4AFC A;  1IHM A;  2E31 A;  1OQE A;  3S7I A;  2WA4 A;  4KGQ A;  2C9K A;  1B09 A;  5LK5 A;  2R0F A;  4E2G A;  5BPX A;  1H0B A;  4XUP A;  1N1V A;  1W8T A;  2WSV A;  3C7H A;  3MUZ 1;  2DUQ A;  3WEZ A;  4EWA A;  2W0X A;  4CDW B;  1QJU 1;  2GP3 A;  3IPV A;  3N7J A;  2XG3 A;  1AR8 1;  2X8K A;  4YW7 A;  1WD3 A;  1YRZ A;  5LY2 A;  5FZB A;  2ZGM A;  3RYK A;  3CJI A;  4XUO A;  5ANQ A;  1RB8 G;  5LEK A;  4QM8 A;  1RUH 2;  2C9A A;  4JGY C;  5A3L A;  5IVB A;  4QPI B;  1LAJ A;  1Z7S 3;  4QGN A;  2VZ3 A;  4UW4 A;  5C4W A;  1BK0 A;  2WFF 2;  4RA0 A;  3WW4 A;  2QQN A;  3WP4 A;  1C3H A;  4K8F A;  3PUA A;  4PLM A;  1WBF A;  4URA A;  3O0V A;  3H3U A;  3KWV A;  3BGA A;  4UBH A;  4XJU A;  3DEM A;  1QH6 A;  3DXT A;  1F15 A;  1NYW A;  1OSG A;  4NOT A;  4EZH A;  1KFU L;  1XC6 A;  1BEV 2;  1X9T A;  2R04 1;  2VTX J;  3U4S A;  1AUY A;  1NKG A;  1JTZ X;  1OFN A;  2RVA A;  2W08 A;  3H3L A;  4BIF A;  1TNR A;  3TEZ A;  2MHF A;  2Y26 A;  1DZR A;  1NCR C;  4OZX A;  2R06 2;  4A45 A;  4CDU C;  2W39 A;  1UKG A;  4FT8 A;  5EFU A;  4S2F A;  1MZ6 A;  2GH8 A;  3FLT A;  1D4M 2;  5C33 A;  3SCH A;  4JKM A;  4LO6 B;  5IVV A;  1IKP A;  1LU1 A;  2GNM A;  1GMM A;  1ULF A;  1ND2 A;  2W52 A;  4L97 A;  1EAH 1;  1WLC A;  2NQY A;  3MFC A;  1RUE 3;  4HT1 T;  4K7J A;  5KHH A;  3SH5 A;  5BUV A;  3FFZ A;  4NPM A;  3V0A B;  3SLI A;  4YVW C;  1CON A;  1Q8P A;  1V6I A;  2IFW A;  2XQX A;  4LA3 A;  5ACA 2;  1ZZ8 A;  1ZM1 A;  1DZQ A;  3B3Q E;  3OOX A;  2B9V A;  3KT1 A;  4W8J A;  3LA7 A;  3INA A;  1YFU A;  2DUR A;  1VB2 A;  2O8O A;  3H9A A;  4HBN A;  1WCK A;  3BKZ A;  4P9X A;  5IFP A;  3S7E A;  5FZC A;  3RMY A;  2VMC A;  2WNV B;  4XF3 A;  1O5L A;  1QY4 A;  4C1X A;  3BTA A;  5D1I A;  4BME A;  4Z92 B;  1H2L A;  4XXP A;  2YU1 A;  1LU2 A;  1U12 A;  1ULC A;  3FLR A;  4TSV A;  4NIA A;  5FY5 A;  3HBK A;  4RL7 A;  2XJU A;  2ZA9 A;  4A42 A;  1PO1 3;  1LES A;  5EQU A;  3VBH C;  4ZHN A;  1FYU A;  1GZC A;  1AHS A;  4ORF A;  5J36 A;  4M4P A;  4N8M A;  2ZML A;  4BK4 A;  1DGR A;  4KWL A;  1HN1 A;  4C8D A;  5LW9 A;  5LA2 A;  1UIJ A;  1DG6 A;  1K5M A;  4QPG C;  2HWC 1;  4AZZ A;  2OW4 A;  3TN9 2;  4NHX A;  3ZXL A;  1LHV A;  3MYX A;  4DUW A;  3WDT A;  1HXS 1;  3ZKU A;  2AUY A;  3S30 A;  2MEV 1;  2VH9 A;  3UV9 A;  1LEC A;  4YZ5 A;  2PAK A;  5LB6 A;  1PO2 1;  5LAT A;  4UW3 A;  1W9Y A;  2D5H A;  4G9S B;  4B7K A;  4NAM A;  3AZV A;  1E57 A;  1O59 A;  3FWE A;  4MGZ E;  3T30 A;  3VBH B;  1QU0 A;  4JQR A;  2P1B A;  5JUV A;  2ZAA A;  5E6H A;  3M3O A;  4I0A A;  2YC4 A;  3NNM A;  4HN1 A;  1GQH A;  3OBR A;  1APN A;  3GHM A;  5FK8 A;  1LOB A;  2RDS A;  5FZI A;  3VBS B;  3ZOI A;  2W94 A;  5A3M A;  2G9F A;  4CEW B;  4XFC A;  5JSP A;  5E8A A;  3VHO A;  4Y1Y A;  1OLQ A;  3BI3 A;  1F4H A;  2Y6G A;  2WRA A;  4JV4 A;  2WL1 A;  1GKB A;  4UBG A;  1OUR A;  4GKY A;  2P17 A;  3WX5 A;  4Z8B A;  2XVL A;  1OUX A;  2WAA A;  3LA3 A;  3RZG A;  1ND3 A;  1SLB A;  2UUR A;  4W50 A;  2V4V A;  5JXH A;  4DXZ A;  4P02 B;  1DYO A;  4YW2 A;  1AX2 A;  2VMD A;  3AL5 A;  3KQR A;  5F3G A;  3ZSL A;  1GOG A;  2YV8 A;  1FPN 1;  5BNQ A;  1HDK A;  3BN6 A;  4IGO A;  1EV1 2;  2B9U A;  1EAH 2;  2B46 X;  2ZX1 A;  4RHV 2;  1K42 A;  3ELN A;  5FRE A;  2ORX A;  2W87 A;  4GJZ A;  3MZH A;  2XKP A;  2WII B;  3ZMO A;  3VKF C;  4TYS A;  3ZIW A;  1C1L A;  4D94 A;  1QGL A;  3KLS A;  4IEU A;  3R4D B;  5L7O C;  2BOJ A;  1VJ2 A;  3UET A;  2ZGK A;  2R07 2;  5JMO A;  1NZC A;  1ZRF A;  3WNO A;  2RS5 1;  5FYV A;  4CE8 A;  2QQM A;  2W46 A;  5F7U A;  5FXX A;  5T5L A;  2PHX A;  3WNP A;  2J1U A;  4WVM B;  4DNY A;  2Q8O A;  1DGL A;  5C3R A;  5KXE A;  4HK8 A;  4LTA A;  4QXB A;  1RUH 3;  1JUI A;  4YPJ A;  3DUI A;  1FNZ A;  1PMJ X;  2ZGQ A;  1KIT A;  4BLI A;  1FOD 2;  3U0Z A;  2C1F A;  2E9Q A;  3CIH A;  3FMG A;  4PDW A;  3UKT A;  1PX3 A;  2YXS A;  4AEM A;  3PMS A;  5KHI A;  5JOW A;  1MEC 1;  2X5I C;  1NOV A;  4I3P A;  4WBB A;  3I3B A;  2B42 B;  5IK7 A;  3D0S A;  2C24 A;  5JI9 A;  3H42 B;  1VRH 2;  2R7E B;  1W6M B;  2VBB A;  1WWY A;  3AXE A;  4QPY A;  4SLI A;  4N43 B;  2ZX3 A;  4CU7 A;  3PL0 A;  3AP6 A;  1OA4 A;  1BEV 3;  2CTV A;  3QLQ A;  2XPJ A;  1NXM A;  4YW1 A;  4Y4Y A;  4DZG A;  3VHP A;  1SPP B;  1E5R A;  1LNS A;  4N9H A;  1CIY A;  2ATF A;  3ZXD A;  3KVB A;  3QH6 A;  1AYN 1;  2EXK A;  4YFZ A;  2XWB B;  4YLZ A;  3ZXF A;  1KJR A;  4R9C A;  3O14 A;  1ND2 B;  1ENR A;  1LOE A;  3W5M A;  3BYW A;  4IET A;  4BQX A;  1UXX X;  1WCQ A;  3T2Q A;  4QPG A;  1Z78 A;  1VBD 1;  1RGS A;  2Y33 A;  3C7G A;  1QOS A;  5FZ4 A;  3TOJ A;  1RUE 2;  3E97 A;  1O3Q A;  3BOW A;  3ZYG A;  3KV9 A;  4AF9 A;  1JH5 A;  4BWO A;  1PZ8 A;  2A1X A;  1LB2 A;  3RQ0 A;  3FLP A;  3NRU A;  5IAT A;  3I49 A;  4H7M A;  3KV5 A;  2WS9 1;  3PIJ A;  3H50 A;  2VCA A;  2WFF 1;  3K4Z A;  3AJZ A;  1JYV A;  1GP5 A;  4IV1 A;  1ZZ6 A;  4BQY A;  1XSR A;  1OXC A;  1QXP A;  2WO1 A;  3B5L B;  4C91 A;  1RED A;  2JDP A;  2NM1 A;  4KL1 A;  5A32 B;  3GCX A;  1OQ1 A;  2WZR 1;  3LF7 A;  4Y20 A;  1GWK A;  4OHW A;  4UT5 A;  1I5P A;  4G3Y C;  4Q4Y 2;  1D0H A;  1XBF A;  2DBI A;  2ZEY A;  4CUC A;  1LTE A;  5ISL A;  3AZZ A;  4IEX A;  4K6B A;  1NT0 A;  2V5D A;  1ZX5 A;  1C1F A;  2B7Y A;  3AP4 A;  1RUJ 2;  4HL0 A;  4COY A;  4H14 A;  2L9L A;  2VC9 A;  1RUG 3;  2YC0 A;  3LD8 A;  3D3A A;  3LPG A;  5FYM A;  5KXC A;  1HRV 2;  2DCK A;  2IVI B;  4OUE A;  1KEX A;  4C90 A;  1SFN A;  3LDR A;  4FTB A;  4DB5 A;  5ABJ C;  3KCC A;  3LQC A;  5A3O A;  2AAC A;  2R16 A;  2OXB A;  2RJ2 A;  3NV2 A;  4TXW A;  2WYF A;  5FZD A;  3ZN4 A;  4XAB A;  5T5J A;  4NAO A;  4LBM A;  4AL9 A;  4GJY A;  4KQ7 A;  3FZ3 A;  1MQT B;  1RC6 A;  4RD7 A;  5FP9 A;  2W3J A;  2ZGP A;  1BBT 2;  1MPX A;  2SLI A;  4M3C F;  3TBD A;  1RUJ 3;  3VHN A;  2VZR A;  4GH4 A;  1WKY A;  4NWV A;  4COV A;  4CSW A;  1RUJ 1;  1VP6 A;  4HSJ A;  4LOR A;  4CEW A;  2VZP A;  1LOD A;  3OG2 A;  1BZW A;  4YG6 A;  4EZ4 A;  1MS5 A;  2RJL A;  4PDW C;  1W2T A;  4GB3 2;  2QQK A;  5BNP C;  3V56 A;  3WNM A;  4E4S A;  3C2U A;  5BNO A;  2XH6 A;  4ITC A;  4JQT A;  3JXS A;  1OBN A;  1UWW A;  4MXW B;  3SC7 X;  2BVB A;  5SV5 A;  1V0A A;  2GAU A;  5FLH A;  1TME 2;  4XF9 A;  1IQA A;  3ZXA C;  2ZHK A;  2Y6L A;  4NR1 A;  2NP0 A;  5FR3 A;  2FDJ A;  1K5M C;  1SLL A;  4JX0 A;  4OHZ A;  3K3N A;  4AVB A;  4DOU A;  3OJB A;  4LUK A;  2GSY A;  5FLJ A;  1EUT A;  3IN9 A;  3OUJ A;  3J7L A;  2CDP A;  2QKD A;  3LOI A;  3OBT A;  4K9S A;  1RUF 3;  5I0D A;  2Y8K A;  1NA1 C;  1UW8 A;  1X82 A;  4D7T A;  1QOO A;  3AYD A;  4Q0P A;  4W6W A;  1WW7 A;  4JVA A;  1OOP A;  1R08 1;  4GWM A;  4YZ4 A;  4IEP A;  1GNY A;  2VQA A;  2WAO A;  2AEZ A;  2BDR A;  2J22 A;  2WIN B;  3LEI A;  1ZRE A;  2G19 A;  3O12 A;  3HMY A;  5B4X A;  3RNS A;  4RR3 C;  2VZU A;  4DY3 A;  1FT9 A;  1TME 3;  3BB6 A;  5EYY A;  2WZE A;  3F2Z A;  2GAL A;  5JIU A;  4NRQ A;  1CX4 A;  4G4F A;  4FTE A;  3T0A A;  2ZHN A;  2XKO A;  3I54 A;  4QU2 A;  4AVA A;  2KXL A;  1CPN A;  3K3O A;  4CCK A;  4AEK A;  5EWS A;  5KHG A;  1J58 A;  4WM7 C;  3AK0 A;  5I8T A;  4LO4 B;  2W1Q A;  4ZU7 A;  1D4M 1;  2PYT A;  1S1A A;  2JD9 A;  4LIT A;  3K48 A;  2VGD A;  3AMQ A;  4N43 A;  4LBK A;  2PMW B;  4YM0 A;  5C8W A;  2R0H A;  4RFR B;  5FP3 A;  1W2N A;  4BLJ A;  1DBN A;  3R4U A;  4XJ8 A;  5AC9 2;  1UY0 A;  2FZ2 A;  3NNJ A;  3OGG A;  4Q4W 3;  4FOV A;  4NII A;  2D7F A;  1YJK A;  2YBK A;  3T1L A;  4YVS B;  4FAH A;  5HXM A;  3ZFE B;  1D2S A;  2HWC 3;  4PCR A;  2TEP A;  3V65 A;  2ZZJ A;  3DYP A;  2ARB A;  3J7M A;  1GZW B;  3POS A;  2Y6J A;  3GJB A;  4RS5 B;  1DGR N;  1PO1 1;  3MIB A;  4GWJ A;  4MGI E;  5CAZ A;  1PGL 1;  1N47 A;  3NJY A;  2HWE 3;  3UES A;  1TMF 1;  3ZN6 B;  3C7F A;  1RHI 3;  1R1Z A;  3HVD A;  2XUE A;  3ABZ A;  2DU1 A;  4QB1 A;  4V2V A;  1RUC 2;  2WZ8 A;  4D3W A;  5A6Z A;  3RZK A;  1GYK A;  3EYP A;  2QQI A;  4LEJ A;  4XYX A;  5C5U A;  4LMF A;  2GC0 A;  3MBW A;  5E1R A;  4XPV A;  2E63 A;  3ZLI A;  2DVD A;  4Q4W 2;  5J98 B;  2EAK A;  2PEL A;  2PHW A;  3KMH A;  3OCP A;  4HVQ A;  5J3U A;  2ZEX A;  2HWE 1;  5M0T A;  3H7J A;  2RMU 3;  2HWC 2;  3L9J T;  1W6Q A;  4FXK B;  4LJH A;  1I9R A;  5CNA A;  4EWE A;  3ZM8 A;  1NAE A;  3L2H A;  3MPP G;  3VD3 A;  4CDX B;  4ERO A;  2D44 A;  4XOG A;  3EO6 A;  2BJS A;  5FTT C;  1YYN A;  2X10 A;  2E7T A;  4QX8 A;  3WF3 A;  2QQJ A;  3ON7 A;  3POI A;  2HWE 2;  4QQO A;  3URF A;  4EN7 B;  3AB0 A;  3ZFG A;  2P6H A;  1RUG 2;  5A3T A;  5GLT A;  4UW5 A;  3KHB A;  3F95 A;  2A3Y A;  1CAX A;  2AC1 A;  3ZKY A;  1NY7 1;  3MF9 A;  4FFG A;  4Z82 A;  2WNV C;  3ZFF C;  1XPW A;  4MHR A;  1PX4 A;  2OX0 A;  4NRP A;  1YQ2 A;  4AVV A;  4GZ9 A;  3R05 A;  3WCR A;  1OHF A;  3WNX A;  3I3M A;  5K7P A;  4PQQ A;  1E5H A;  3ETP A;  5BY5 A;  1PK6 B;  2AEN A;  3VBU C;  4BQ1 A;  2H0B A;  3N9N A;  1NCQ C;  2WO7 A;  4XHX A;  2Y34 A;  1CVN A;  2OZ6 A;  3MIE A;  1CES A;  2VMI A;  1DGW X;  2DVF A;  4Q4X 1;  4QWN A;  2VOX A;  5EJ3 A;  1XNK A;  2HWB 3;  1MS3 A;  2C5D A;  1RJ7 A;  2O14 A;  1W6O B;  4N7I A;  5IYY A;  1AR9 2;  3NST A;  3GNE A;  5A7P A;  5GLW A;  1GNH A;  2IFR A;  2VM9 A;  5B4N A;  2WFF 3;  4CP2 A;  2ID4 A;  4PF1 A;  1WW6 A;  1LEM A;  5FXZ A;  3BOD A;  2VOV A;  2WQZ C;  4CEW C;  4FFH A;  2VNO A;  4R52 A;  1CIW A;  4DPN A;  4E8D A;  3NKT A;  2NMO A;  2IUW A;  5F6L B;  3U1X A;  5AFB A;  1C5I A;  2PHL A;  5CKN A;  3SIT A;  2RDQ A;  1NCQ B;  3E5X A;  1WW4 A;  4FPK A;  1SLT A;  2ENR A;  2Z2S B;  3KF5 A;  5F2S A;  5EZW A;  5JXG A;  2ZMK A;  2D6K A;  4I02 A;  4M01 A;  2XHK A;  4FOW A;  4ZU4 A;  2I45 A;  3GBG A;  4ATE A;  3WIN E;  3WNL A;  1ZA4 A;  4XFF A;  4P9L A;  1YC6 1;  4MET A;  2ERF A;  5CZK A;  1JOP A;  1NXD 1;  5FPL A;  2VNG A;  2W2I A;  1CAU B;  3E5Q A;  2XLA A;  3NNL A;  4CTE A;  4OUM A;  1B35 C;  2DTW A;  4Y33 A;  2OUH A;  2C26 A;  5K8S A;  2ZX4 A;  4HAN A;  1W6N A;  2VZS A;  3R0R A;  4CCO A;  5CFD C;  3ZVX A;  1CN1 A;  1W6P A;  2V4A A;  1O4Y A;  1CAV B;  4HK9 A;  3BU7 A;  5FYT A;  3T09 A;  4FQZ A;  4WV8 A;  1DU3 D;  4BXS V;  1YI7 A;  5CEH A;  4AW7 A;  5A6Q A;  2XB6 C;  4AYU A;  5BNO C;  4CCJ A;  4Z2A A;  1ENQ A;  1OD3 A;  3PNA A;  4LUL A;  3ITQ A;  5JSR A;  3PUQ A;  4I0B A;  4FAG A;  2OYZ A;  4AAP A;  3JQX A;  4S2H A;  2D6O X;  2J42 A;  4MYE A;  1TEI A;  3O1R A;  1BLZ A;  2QNK A;  5H9Q A;  2MNG A;  1HRI 1;  3ZSM A;  4BXF A;  1JOD A;  3AZW A;  5DN2 A;  3LA2 A;  3GZT B;  4WVV A;  3P3N A;  3LEG A;  4M4R A;  1F8V A;  4GIQ A;  1XNB A;  2CGO A;  5LK7 B;  3N9M A;  1HX6 A;  2BGP A;  4M3C A;  3U75 A;  4ZY9 A;  3WOG A;  1SLI A;  5CYY A;  2UWC A;  5D21 A;  5HXV A;  3AVS A;  2FQP A;  4EYU A;  4OI0 A;  3ZYR A;  3I3E A;  1QJZ A;  2EAA A;  1RUE 1;  3VHR A;  1YFX A;  3WW2 A;  1LRH A;  4CDQ B;  2P37 A;  2VZO A;  2QCS B;  5FY0 A;  3ZN5 A;  4EN6 B;  4YZ1 A;  5FV3 A;  5FWE A;  3IDB B;  1A8M A;  4DY5 A;  3MO4 A;  3TN9 3;  5BNN C;  4Q2F A;  2V73 A;  5FMD A;  1UZ0 A;  1MQT C;  1YCI A;  1MS1 A;  3FHQ A;  1FPN 3;  2BV4 A;  3WP6 A;  2RR1 1;  4MV2 A;  4XF4 A;  1YQ8 A;  2WN2 A;  4K1Y A;  4PI0 A;  5IK5 A;  3AKQ A;  2JDU A;  3CJX A;  1VBA 3;  4IV1 B;  3DYO A;  3WCS A;  1RXG A;  3J4U H;  1RUC 3;  3VUO A;  4OLL A;  5EXO A;  5LRR A;  2EVX A;  3LSD A;  1O4T A;  4LIU A;  1A3K A;  2VJX A;  3J8F 2;  2EAL A;  3FE5 A;  1BJQ A;  1VMJ A;  4BK5 A;  5A1L A;  1ULD A;  1W2A X;  4BQ3 A;  4ZON A;  1FOD 1;  1UY4 A;  2D6N A;  1OF4 A;  1SDW A;  2R04 2;  3WQ1 A;  5B2G B;  1W9W A;  2BBV A;  3AL6 A;  1H1M A;  1CZS A;  3GZE A;  3K77 A;  1FPN 2;  4HSL A;  3DEC A;  4Y5S A;  1LUL A;  2VMH A;  4JGY A;  1U5X A;  1MEC 3;  2YGL A;  4IDZ A;  1ZZ7 A;  1G7Y A;  2HEY F;  5C3S A;  4PT6 A;  5DXD A;  1VBA 2;  2JDA A;  2XLG A;  3GM8 A;  5I0S A;  1UX7 A;  3PVB B;  3Q8A A;  2ARA A;  3V64 A;  3UGG A;  2ZX2 A;  4ES9 A;  1ZA7 A;  3K75 B;  1I1E A;  2WLQ A;  4RHV 3;  4N53 B;  5CIS A;  2XQR A;  1CJD A;  4FPE A;  1ZZ9 A;  2F6B A;  1VBC 2;  4IL7 A;  3MLL A;  3VKM A;  4LE3 A;  3KVA A;  1D7P M;  5SV8 A;  4CRQ A;  3VD9 A;  1H2N A;  3KB5 A;  1FI2 A;  3U11 A;  2VTF A;  1F9K A;  1M4W A;  1PK6 A;  1DGW A;  1HJG A;  3VBR A;  2E6V A;  2OS2 A;  3EBR A;  5JOY A;  4LQR A;  3MHZ A;  3VBU A;  1BK1 A;  4FVV A;  4XIK A;  3ZYJ B;  1J59 A;  3POW A;  2IXC A;  2HWB 2;  1Y9G A;  1MEC 2;  3POY A;  3WHT A;  4EWD A;  2VR4 A;  3M70 A;  4AXO A;  1S55 A;  3FL7 A;  4OQ9 A;  1FOD 3;  3VZM A;  3RRD A;  5DDJ 2;  5D8A C;  5EJ1 B;  1O5U A;  1ZBA 1;  2H6C A;  1W0P A;  2VUJ A;  3JBG 1;  3ZFE C;  4D6Q A;  2Z5W A;  3N7L A;  1LKN A;  2WN3 A;  4M00 A;  4RS5 C;  3KT4 A;  3VD5 A;  1L7L A;  4K20 A;  2JG9 A;  3RVH A;  1OKQ A;  1AR6 3;  3Q8B A;  2BFU L;  3PJQ A;  4XDO A;  1TVG A;  1NZI A;  1ULP A;  5FQ0 A;  4IND A;  4ASK A;  2CU5 A;  2P4E A;  3MW4 A;  1QJE A;  4KBZ A;  5L19 A;  4Y3O A;  2YGM A;  4KBB A;  4F83 A;  3NJX A;  2WQ4 A;  2K46 A;  3DPR B;  2EIB A;  3VBF B;  5DUU A;  2QTW B;  5A7N A;  4BDV B;  1I6X A;  4XZP A;  5KC5 A;  5FAX A;  1JZ8 A;  4K1Z A;  3ACF A;  3J8F 1;  3CZU A;  3D5O A;  3OY8 A;  3UGH A;  2QZ2 A;  2VQU A;  4S2G A;  1W8H A;  1Q8Q A;  3OEB A;  4FPF A;  1KQR A;  3KF3 A;  1T6B X;  4A2U A;  3VZO A;  2VVD A;  4BQ5 A;  4A3Z A;  1LOF A;  3USU B;  3KHC A;  1LGB A;  3C3V A;  1H9P A;  3N36 A;  5DAW A;  4FOQ A;  3NV3 A;  3DKW A;  1S0I A;  1BEV 1;  1DP0 A;  2JG9 B;  2OT7 A;  4DS0 A;  5IAV A;  4UWD A;  3AJY A;  3CEW A;  1AXK A;  2OZJ A;  4Q0V A;  2JG8 B;  3AP7 A;  5F6K A;  2X09 A;  4XTM A;  3VKL A;  3J26 N;  3MI8 A;  3MLJ A;  2DYC A;  1DQ2 A;  5FPU A;  4AE2 A;  4HMZ A;  4FP3 A;  3PHM A;  4M3C B;  1GOH A;  1IKQ A;  1F35 A;  1OQD A;  4GWI A;  1RUI 3;  3UKN A;  3J9S A;  5A32 A;  1SCS A;  2WT0 A;  3D4K A;  4HOO A;  1GP6 A;  4J1X A;  1CZT A;  1W90 A;  4A3X A;  3ECQ A;  5IAX A;  4WVW A;  4ZXE A;  1JOB A;  1GZW A;  1YFW A;  4J1W A;  3ZX7 A;  2AR6 A;  4OCT A;  4OI2 A;  2RM2 3;  2HKX A;  2JE8 A;  4CDQ C;  5FZH A;  5I93 A;  3VBS C;  1QQP 3;  4GD4 A;  3OF1 A;  2BQP A;  5DUX A;  1RMU 2;  3POJ A;  3LE0 A;  4KNC A;  4BU2 A;  4DUV A;  4AED B;  3GYD A;  5F5I A;  1CR7 A;  5BNN A;  1RUD 1;  3A23 A;  4ZU5 A;  1JI6 A;  4N9I A;  5FZ0 A;  3T0B A;  5DDJ 1;  3TN9 1;  4IEQ A;  2VZQ A;  2QQP A;  4BM8 A;  3I2G A;  4FPC A;  2BNN A;  3NVC A;  4LO5 B;  3FBM A;  5IVE A;  1SBD A;  3RDI A;  3ZFG C;  5J37 A;  3N9O A;  4YVW A;  2X53 S;  4BQ2 A;  1CAW B;  3HNY M;  1H6Y A;  1UPS A;  2XVK A;  1POV 3;  4GXL A;  2R04 3;  5TSW A;  3BU0 A;  1CZV A;  2JDY A;  3VL9 A;  4AOC A;  4O61 A;  1ZZC A;  3III A;  2ETE A;  5F3E A;  5FKC A;  5F3I A;  1ZBA 2;  5KWR A;  5CKQ A;  1NQJ A;  1DFQ A;  1V6J A;  2GNB A;  2IC1 A;  3IDC B;  4OVE A;  2LAL A;  1KJL A;  5FPX A;  1ENX A;  1QJX 3;  1NQD A;  2RG4 A;  1ZRR A;  3WF2 A;  2PHU A;  4H2A A;  3S0M A;  1PGW 2;  4XFA A;  1J83 A;  4OMD A;  1IQD C;  3K4A A;  3KCY A;  4JHZ A;  4LUM A;  4BCU A;  1PMH X;  5BNO B;  1VBB 2;  4BQ4 A;  2ZAH A;  4AI1 A;  1GZT A;  1S2K A;  1WLT A;  3C8X A;  5F5A A;  4DIN B;  3HIF A;  5BYN A;  3OGS A;  1JYX A;  1F31 A;  4XMA A;  3KV6 A;  2CNA A;  3QBQ A;  1VAV A;  3TNP B;  3CO2 A;  1ZBA 3;  3RPQ A;  5A7O A;  4CCD A;  1HRV 1;  4ASM B;  1W04 A;  1QJX 2;  2LRO A;  1R1A 1;  3DXU A;  5FP7 A;  1SFP A;  2LS6 A;  3I4I A;  1PM7 A;  1Q3E A;  3MF6 A;  4QPI A;  4Q27 A;  4QM9 A;  3VDA A;  3VDC A;  2K2S A;  1UPI A;  5C71 A;  1EV1 3;  4LBN A;  3D82 A;  4HZF A;  3ZFF B;  1EV1 1;  1X9P A;  3LFI A;  4GAZ A;  1VBE 1;  4XFB A;  5KXD A;  2P3K A;  4FOY A;  5AFE A;  3Q8F A;  5JVV A;  1PHM A;  1SZB A;  1HB3 A;  3AMP A;  4JGZ A;  4ATF A;  1AR6 2;  5FO8 B;  4XQ4 A;  5E16 A;  2WZR 2;  4A6O A;  4D7S A;  2VVF A;  1X50 A;  1U5Z A;  4DXS A;  2GU9 A;  3B9I A;  1PGS A;  4UXA A;  2JDK A; 
#chains in the Genus database with same CATH homology
 3IB3 A;  1KGY A;  1OT5 A;  3OBA A;  2W3J A;  1MPX A;  2VZR A;  1WKY A;  2VL4 A;  2BGO A;  4KMQ A;  2BZD A;  2VZP A;  3OG2 A;  2YB7 A;  2YG0 A;  4L0P A;  2J1E A;  4KI5 M;  4ZZ8 A;  1UYZ A;  2QQK A;  1T2X A;  4QDR A;  3I2F A;  5A1A A;  3WNM A;  3LPF A;  3A22 A;  3JXS A;  3CZJ A;  1UWW A;  1OH4 A;  2WAB A;  2HLE A;  2Y6L A;  1JZ7 A;  3LEK A;  4KWU A;  4MAD A;  4JX0 A;  3HPN A;  1UYX A;  2WO2 A;  3K4D A;  3ACI A;  2LW8 A;  1EUT A;  2ZEW A;  3WF1 A;  4DXR A;  2CDP A;  5I0D A;  1GUI A;  2Y8K A;  4CUA A;  1L7Q A;  4QPW A;  5C70 A;  1F4A A;  1GNY A;  2WAO A;  3SEE A;  3WQB A;  5JXJ A;  2J22 A;  3LEI A;  4MO3 M;  1UMI A;  2EID A;  1OF3 A;  5B4X A;  2VZU A;  3IDA A;  3THD A;  4ZZ5 A;  2WZE A;  3F2Z A;  3T08 A;  1GU3 A;  4ET7 A;  3T0A A;  2J1R A;  4QDS A;  2KD7 A;  2EIE A;  3MUY 1;  2W1Q A;  3HNM A;  2JD9 A;  4MGS A;  1JZ4 A;  4UAP A;  1UY0 A;  3AC0 A;  2VQT A;  4A4A A;  5HXM A;  2W1W A;  3MV0 1;  2W1U A;  1XNT A;  1US2 A;  3I2I A;  3DYP A;  3P1I A;  3VDB A;  4ARX A;  2ZXQ A;  2Y6J A;  3W5N A;  4GWJ A;  1BHG A;  2EIC A;  3MV1 1;  3C7E A;  3WF4 A;  3UES A;  3C7F A;  4JKL A;  2XON A;  3I97 A;  3ABZ A;  4QB1 A;  4D0Q A;  2WZ8 A;  3WF0 A;  5IJR A;  3EYP A;  4CU9 A;  2QQI A;  2YFU A;  3DYM A;  3MBW A;  2BER A;  2VME A;  1UY1 A;  2ZEX A;  3P6B A;  4LKS A;  3ZM8 A;  1GOF A;  1NAE A;  3VD3 A;  4LHS A;  4P5Y A;  2X10 A;  3WF3 A;  3GXU A;  3CKH A;  2QQJ A;  4DEQ A;  5G05 L;  2CDO A;  4XUT A;  2WBK A;  2VZT A;  1UY2 A;  4XVH A;  4CVU A;  2J1T A;  4OZO A;  2E26 A;  5LCW L;  3IAP A;  4D8M A;  2HYX A;  1XPW A;  1US3 A;  1PX4 A;  1W0N A;  1YQ2 A;  1JYW A;  2W92 A;  4GZ9 A;  4PQQ A;  3ETP A;  4TTG A;  5C7G A;  4JKK A;  2VOT A;  2E33 A;  4P08 A;  4XZU G;  4DEV A;  5IYY A;  2YFZ A;  5B4N A;  3T2P A;  2VM9 A;  1SDD B;  1EUU A;  3ACH A;  3I2K A;  1JZ6 A;  2ID4 A;  4UI9 L;  4PF1 A;  4BJ0 A;  1SHW B;  4XUN A;  3A7Q A;  5LA1 A;  4QB6 A;  4E8D A;  4P00 B;  1O8S A;  4XUR A;  5J1X A;  1JZ2 A;  2W95 A;  4QX2 A;  1R64 A;  1NX9 A;  5JXG A;  3HEI A;  5EIY B;  1JHJ A;  4AG4 A;  2W9X A;  3WNL A;  2WQ8 A;  2RV9 A;  3HJR A;  5CZK A;  1DLC A;  2C26 A;  4LPL A;  2VZS A;  1CX1 A;  1W8N A;  3T09 A;  3FHA A;  5JR2 A;  3J7H A;  4BXS V;  3I2H A;  2Z4F A;  4Z2A A;  1OD3 A;  4CU6 A;  2DDU A;  2VCB A;  5EJZ B;  3SEP A;  3EB7 A;  3WSO A;  2W5F A;  1J84 A;  3T2O A;  3UNP A;  5DN2 A;  1JZ3 A;  4OMC A;  2E31 A;  2WO3 A;  3LEG A;  4M4R A;  2C9K A;  3THC A;  4RN5 A;  2X05 A;  4QB2 A;  4XUP A;  3WEZ A;  2BGP A;  3C7H A;  3MUZ 1;  4ZY9 A;  4QX1 A;  5CYY A;  1K3I A;  5G04 L;  3I3E A;  2WYS A;  2Y64 A;  4XUO A;  3K46 A;  2VZO A;  3FN9 A;  3MO4 A;  2VZ3 A;  1UZ0 A;  2QQN A;  2QQO A;  3FHQ A;  1RYY A;  2WN2 A;  4DUX A;  3BGA A;  2VCC A;  3DYO A;  3OGR A;  1XC6 A;  2VJX A;  3T0D A;  1NKG A;  2RVA A;  4RYD A;  4OYU A;  5JXI A;  4A45 A;  3CMG A;  4BK5 A;  1UY4 A;  1JU3 A;  1OF4 A;  1W9W A;  4JKM A;  4QAW A;  1CZS A;  1GMM A;  3K77 A;  2WUH A;  3DEC A;  2VMF A;  2YC2 A;  4PT6 A;  2JDA A;  2XQX A;  3GM8 A;  1UX7 A;  3OEA A;  2B9V A;  2VO5 A;  3K75 B;  4HG6 B;  3E1F 1;  2JKX A;  4W8J A;  3VD4 A;  4IUG A;  5HPO A;  5IFP A;  1D7P M;  2ORZ A;  2VMC A;  3VD9 A;  2QBX A;  3I3D A;  1UMH A;  1UY3 A;  1W9S A;  2VZV A;  2VTF A;  2XOM A;  4XUQ A;  4A42 A;  4LQR A;  4M4P A;  1O8P A;  4BK4 A;  1HN1 A;  2VR4 A;  5LA2 A;  3IAQ A;  3FL7 A;  3PUI A;  5EJ1 B;  5DPN A;  4DUW A;  1TG7 A;  2WN3 A;  3VD5 A;  1GQP A;  1O59 A;  2BBA A;  1TVG A;  1ULP A;  4DXT A;  1JYN A;  4UOJ A;  5JUV A;  4ARY A;  2PQS A;  2W91 A;  2YC4 A;  3NJX A;  2VZ1 A;  2EIB A;  2E32 A;  3WNK A;  3I2J A;  3HNB M;  4BDV B;  4MGQ A;  3C7O A;  1P8J A;  2W94 A;  1JZ8 A;  1NUK A;  1K12 A;  5FUI A;  3ACF A;  3CZU A;  1F4H A;  2Y6G A;  4CUB A;  2V72 A;  2WAA A;  2VQU A;  3OEB A;  4W50 A;  2V4V A;  5JXH A;  1W99 A;  4P02 B;  1DYO A;  4A3Z A;  2DCJ A;  1K45 A;  2VMD A;  1GOG A;  4QX3 A;  4CU8 A;  3BN6 A;  1DP0 A;  1K42 A;  2J1S A;  3CDZ B;  3OGV A;  2ORX A;  2W87 A;  2X09 A;  1JU4 A;  4MOA A;  1SG3 A;  3UET A;  3VD7 A;  1GOH A;  5JMO A;  4GWI A;  3WNO A;  1UXZ A;  2QQM A;  2W46 A;  1CZT A;  5F7U A;  3WNP A;  2J1U A;  3ECQ A;  4ZXE A;  4YPJ A;  2JE8 A;  1PMJ X;  1L7R A;  3CIH A;  3LE0 A;  2XHN A;  4DUV A;  3GGL A;  1PX3 A;  2QQL A;  3A23 A;  3GDB A;  4A41 A;  1JI6 A;  3OB8 A;  3I3B A;  2B4K A;  3T0B A;  2C4X A;  2R7E B;  3CQO A;  4CU7 A;  2VZQ A;  3I2G A;  2W47 A;  2J1A A;  5DMY A;  1LNS A;  1CIY A;  4E8C A;  1W9T A;  3HNY M;  1H6Y A;  3W5M A;  1CZV A;  1UXX X;  1WCQ A;  3T2Q A;  3III A;  3NQH A;  3C7G A;  3WNN A;  3WF2 A;  3HOB A;  1W8O A;  1J83 A;  4AAX A;  4OMD A;  1IQD C;  3K4A A;  4JHZ A;  1PMH X;  3NRU A;  5IHR A;  4QDQ A;  3HN3 A;  3K4Z A;  2VCA A;  5DQ0 A;  1JYV A;  2J7M A;  3C8X A;  1ULO A;  2WO1 A;  1JYX A;  2Y6K A;  3OGS A;  1JZ5 A;  2ZEZ A;  1UYY A;  2W1S A;  3PUH A;  3SKV A;  1I5P A;  4A44 A;  2ZEY A;  4CUC A;  3NNG A;  5LA0 A;  2V5D A;  4W4Z A;  2LS6 A;  2J1V A;  3U37 A;  1XNA A;  2L9L A;  2VC9 A;  3VDA A;  3D3A A;  3LPG A;  3VDC A;  3SKJ E;  4QX0 A;  5C71 A;  2OKX A;  3A21 A;  2Y6H A;  2DCK A;  4OUE A;  1KEX A;  4FI9 A;  3NJV A;  3LQC A;  1H6X A;  4A6O A;  5IFT A;  2RJ2 A;  3ACG A;  4DXS A;  4TXW A;  2WDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...