2WO2A

Crystal structure of the epha4-ephrinb2 complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
178
structure length
178
Chain Sequence
b'TGEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKRTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPHRIN TYPE-A RECEPTOR
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
total genus 36
structure length 178
sequence length 178
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wo2A00
4IUGA 3OGVA 2Y64A 4QDSA 4Z2AA 2J7MA 5HXMA 4ZZ5A 1OH4A 3K77A 4BDVB 3A7QA 3I2GA 2Y6LA 2W1WA 3ACGA 1JZ3A 4MOAA 1XNTA 2Y8KA 1O8PA 3LPFA 3I3EA 4ET7A 4JKKA 2X05A 2DCJA 3THCA 2W95A 3PUIA 1JYXA 1TVGA 2WABA 3T2PA 1DYOA 1OF3A 1OD3A 4M4RA 1GOGA 2E31A 1JZ6A 1JU4A 4QAWA 3T0BA 2J1RA 3IIIA 5J1XA 2QQNA 2WO1A 2VCAA 1UMIA 1HN1A 5HPOA 1KEXA 3WNPA 1J84A 3NRUA 4ZZ8A 2J1SA 4DUWA 2LW8A 2ZEYA 1XC6A 3I2KA 2RV9A 2ORZA 5DPNA 4A3ZA 1UY4A 3EB7A 2VZTA 1UY3A 3NJXA 5JXJA 2WYSA 5LA0A 5LA2A 1UY0A 4PF1A 4FI9A 4P08A 3BN6A 3K75B 5C71A 3HNYM 2XQXA 4AG4A 2J1TA 3JXSA 2ZEXA 5EIYB 4GZ9A 2WN2A 2WBKA 4GWIA 1UXXX 5IJRA 4CU6A 4MADA 2R7EB 2JDAA 1BHGA 1GQPA 2EICA 4XUPA 3IAQA 4AAXA 3GGLA 2WO2A 2VQTA 4RYDA 5JXHA 1PMHX 3WF1A 1JZ5A 3VD4A 2C9KA 3I2FA 3F2ZA 2VZ1A 4UOJA 3U37A 4ARYA 2W91A 1F4HA 4QB1A 3P1IA 5LA1A 3CKHA 5JXIA 3IB3A 5DQ0A 3HN3A 1L7QA 4A6OA 5IFPA 3HNBM 2WUHA 4ZY9A 1CZSA 1UYYA 2ZEWA 3IDAA 2RJ2A 3VDCA 4D8MA 3MO4A 2VMEA 3WEZA 4ARXA 2J1VA 1K3IA 2BZDA 2J1AA 2QQOA 3I2JA 3LE0A 3T08A 3ZM8A 2VZOA 3MBWA 5IHRA 1UMHA 4QX0A 1T2XA 2B4KA 2HLEA 2WDBA 3P6BA 1EUTA 3SEPA 1NAEA 2E32A 5EJ1B 1W99A 4UAPA 4XUTA 1UY2A 2L9LA 2C4XA 4JHZA 3I97A 3HNMA 3BGAA 4ZXEA 2Z4FA 3VDAA 3E1F1 4HG6B 4P02B 2QQLA 4DXRA 3LPGA 3OEBA 1JYNA 1TG7A 1NX9A 3VD3A 1W9WA 3D3AA 1JZ8A 5G04L 2VZPA 5A1AA 4JKLA 4CU8A 2W9XA 4W4ZA 4P5YA 2BGPA 3HEIA 3THDA 4GWJA 1JI6A 2Y6JA 2W5FA 3A23A 3I2HA 1O59A 3PUHA 2QQIA 3CDZB 1K12A 2ID4A 2QBXA 2W87A 1W8OA 1US3A 1NKGA 2V4VA 3FHAA 4BJ0A 1GUIA 3NNGA 2XHNA 5C7GA 2W1UA 5IFTA 4DEVA 5CYYA 1JYVA 3NQHA 3FL7A 4MGQA 3WNLA 4E8DA 2VO5A 5F7UA 1MPXA 3K4DA 3MV01 3ECQA 3CQOA 2JD9A 4KI5M 4OUEA 4TXWA 3LEGA 2LS6A 1WCQA 3GDBA 3VD7A 1SG3A 3WNKA 3W5NA 5JR2A 4JX0A 4CVUA 4TTGA 1PX3A 4MGSA 1JZ2A 4QB6A 2CDPA 2VZQA 3T2OA 1GU3A 4XUOA 2DCKA 5I0DA 4LPLA 1P8JA 3OGRA 2VJXA 3LEIA 4QDRA 1GNYA 3I3DA 2WAOA 3C7HA 3SEEA 3DYOA 4BXSV 1SDDB 3OGSA 4DUXA 3WF3A 3T0DA 3K4AA 4CUCA 2WN3A 3W5MA 2W1SA 3MUZ1 2WAAA 2VMFA 1CIYA 2X10A 4YPJA 2VL4A 4UI9L 2Y6HA 3EYPA 3GM8A 3LQCA 4PQQA 4KWUA 4QX2A 3A21A 1DLCA 3WF0A 5JUVA 3C7FA 4LHSA 2BGOA 1UZ0A 3HOBA 3HPNA 3ABZA 4XUNA 2V72A 5JMOA 3ACHA 4A45A 4A41A 1WKYA 2VTFA 1KGYA 3OBAA 1XPWA 5IYYA 1CZVA 3VDBA 2PQSA 2E26A 3CIHA 4A4AA 1JU3A 3ACIA 2Y6GA 3MV11 2C26A 2EIEA 1W9SA 5C70A 2X09A 4W50A 1LNSA 3ETPA 2OKXA 2VC9A 2WQ8A 4XVHA 2JE8A 2W47A 3J7HA 1UYXA 1CX1A 2CDOA 2QQMA 5DN2A 2VZUA 1K42A 3C7OA 3SKJE 5DMYA 3CZJA 2W3JA 5CZKA 1OF4A 3OG2A 5B4NA 3I3BA 1L7RA 2WO3A 2VM9A 3WF4A 3A22A 1GMMA 3FN9A 1W0NA 4BK4A 3UNPA 4OMCA 4KMQA 1PX4A 1IQDC 2YC4A 1W8NA 1D7PM 2VMDA 5FUIA 4CU7A 1JZ7A 2VCCA 2VOTA 4CU9A 5B4XA 3MUY1 2VMCA 2V5DA 4D0QA 3WNMA 1YQ2A 1K45A 3C7GA 2VZSA 4RN5A 1JHJA 2BBAA 2VZRA 1RYYA 4OZOA 2XONA 3OEAA 4PT6A 2JKXA 1JYWA 3LEKA 2HYXA 4QPWA 4DEQA 3VD9A 2J1UA 2VCBA 3T2QA 1F4AA 3WSOA 3T0AA 4XURA 2YFZA 4E8CA 4CUAA 2B9VA 4LQRA 1UXZA 1US2A 2QQJA 2VQUA 2E33A 1GOHA 1UYZA 3ACFA 3I2IA 1OT5A 4QDQA 3C7EA 1ULPA 3UESA 2YFUA 2VR4A 3T09A 2ORXA 2XOMA 3NJVA 1CZTA 2W92A 1JZ4A 4DUVA 4W8JA 3DYPA 2BERA 4MO3M 2Y6KA 1W9TA 4L0PA 2EIDA 5LCWL 2VZ3A 2EIBA 3C8XA 3DYMA 1R64A 4CUBA 3VD5A 1UX7A 4DXTA 1ULOA 3WNOA 3CZUA 2W94A 4BK5A 2ZEZA 3FHQA 3HJRA 4LKSA 2YB7A 2ZXQA 3AC0A 4A44A 1EUUA 3GXUA 2KD7A 4QB2A 1O8SA 5JXGA 4OYUA 3CMGA 2DDUA 3OB8A 1I5PA 3WNNA 3DECA 3K46A 5EJZB 1GOFA 2J22A 4A42A 3WF2A 1H6YA 4M4PA 3UETA 2W46A 1H6XA 1NUKA 3WQBA 4XZUG 2J1EA 3SKVA 1XNAA 1DP0A 2WZ8A 3K4ZA 4XUQA 2YC2A 4QX1A 4OMDA 4JKMA 1PMJX 4DXSA 1J83A 2YG0A 2VZVA 3IAPA 5G05L 1SHWB 1UY1A 2WZEA 4P00B 2RVAA 2W1QA 2QQKA 4QX3A 1UWWA
chains in the Genus database with same CATH superfamily
4CCEA 3OGVA 3GHNA 5J3UA 3BKZA 2J7MA 5HXMA 3NV1A 1WD3A 2PHXA 3RPQA 3WUCA 5CEHA 1R082 1PZ7A 3AMQA 1ZRFA 1GZWB 3A7QA 4COWA 4MV2A 1LHVA 4JRAA 3WDUA 4F7ZA 5KXDA 1NA1B 4CPBD 1QJZA 2DVFA 4XHBA 5C5UA 2Y0IA 5IK4A 1K5JA 5JR7B 1W2UA 2ZA9A 4Y20B 2BV4A 1JMUB 5FZ7A 5FREA 3SLIA 1FOD1 4MUVA 1NA1C 5CKQA 1TVGA 1ZYBA 5JPNB 1TMF3 1DYOA 5FUNA 2XVLA 5T5OA 1A6CA 2E31A 4HPKB 4NPMA 5LBCA 1JZ6A 1H1AA 3O1MA 3RZLA 2R063 5AVAA 2C5DA 2VTXJ 2XGXA 1ZBA3 2AZ5A 5J1XA 2VCAA 2OW4A 2YDEA 3ZLIA 3ETQA 1RGSA 1UMIA 1JOJA 2P6HA 3EJKA 1CAVA 1NQDA 3K3OA 4LHKA 4YW3A 4AEMA 5HPOA 5J37A 3GNEA 2RJLA 2Y26A 1N1SA 2PYTA 1RUI2 3B9CA 4N53B 2VAUA 4QQHA 1RVF2 3VBSB 4CP9A 5BY5A 3GZUC 3UGHA 1CWPA 4Z1VA 4IEPA 5FZMA 4O7XA 1C8M1 2G1MA 1Q8VA 3D8CA 3N3HA 4W6XA 3VBSC 3ZSLA 4QM9A 2ORZA 2ZX4A 1SFNA 3HWJA 3ZMOA 5JOZA 3C3VA 3EB7A 1H9PA 3D6EA 1RB8G 1UY3A 1W03A 1W2TA 2WYSA 3AP7A 5LA2A 1UY0A 3ZYIB 1Y9GA 4NE9A 5FWEA 4JGYB 3BN6A 1W3XA 2O1QA 4URAA 5C71A 1QMJA 2XQXA 1BBT2 3EHKA 3NNJA 2J1TA 3JXSA 4LBJA 5JOWA 4BLJA 4AVCA 3ZYJB 3OY8B 4Z8BA 5EPAA 4JGYC 4AHXA 1AYM3 5FPVA 3RZZA 1O4TA 1X33A 4GWIA 3DV8A 3CHXA 3S0MA 2PHDA 4KL1A 5BNOC 5BNNB 4AEKA 2ADEA 4A7KA 1OPMA 3MI8A 4LMFA 1OQEA 2JDAA 4UBGA 2P4EA 4E2SA 2UY8A 4EZ4A 3MYXA 3AL6A 4XUPA 3IAQA 1WLCA 2WO2A 4QQPA 3WQ1A 2W0XA 3JCIA 4CTEA 5A1FA 5BXXA 1PMHX 5GZEA 3WF1A 3VD4A 3FBYA 1GFF2 3AJYA 4AZZA 5IVEA 4UOJA 4MXWA 1GQGA 1YQ8A 4BQXA 1CPNA 1IKPA 4UFKA 3ZXAC 4CEWA 1VE0A 5CFDA 4ITCA 2B7YA 2EXHA 2RHPA 2RMU1 4QB1A 3WG3A 5IVFA 3P1IA 4FFIA 4CSWA 1HDKA 3UKTA 3CKHA 3ZXDA 4CCKA 1CVNA 2DWRA 1H8VA 5JXIA 4NJ4A 2XR4A 1PK6A 4NIGA 5DAWA 4XW3A 4FPCA 1FPN1 3HNBM 4YM2A 1VMHA 1I9RA 1O7FA 2JENA 1UYYA 3LD8A 2ARAA 5L9BA 4YYOA 1XB9A 1HB1A 4GMP0 2CNAA 4X6QB 4BQ1A 3IDAA 2A3XA 1EYBA 3VZLA 2RJ2A 2BRTA 1QH6A 2CY6A 3T3YA 2RS31 4ARXA 2BZDA 3I2JA 3VBOA 1HXS1 2VZOA 1Z7S2 3OSDA 5IHRA 1UMHA 5TSWA 4TZDA 1NQJA 4LE3A 4U36A 2HLEA 3AP5A 2ZABA 1XE8A 2GAUA 3NAPC 1X9TA 3SEPA 3U14A 5LEKA 3AYCA 1N3PA 3PUQA 5FPLA 1EAH3 1FMD3 4D6RA 3K3NA 4XUTA 3FC0A 1UY2A 4J1WA 4XQ4A 4GB33 3FFZA 4LO6B 4XF1A 1Q8SA 1ULGA 2RS11 2OQ7A 1C5IA 4ZKTB 3J7NA 5A33A 4N7UA 4ZXEA 3U78A 4FFGA 2JECA 2Z4FA 1C1LA 2YMZA 1V9U2 3CJIA 4P02B 4BOWA 1ND3C 3TN92 4CP1A 2BW8A 2OA2A 2P1BA 4JDMA 2YGLA 4COZA 4XJWA 4ZHNA 3CLPA 4Q8KA 4HVQA 3NWKA 1OKQA 1RJ8A 1VB2A 3Q8FA 3DPRB 1NX9A 2X53S 4LHLA 4OHZA 4IV1A 3VHRA 5C3QA 4EZHA 2VZPA 3SXWA 4IETA 1F15A 1AZDA 2GU9A 1WMDA 2W9XA 3OBRA 4P5YA 4W4ZA 1HJGA 2BGPA 3HEIA 3O1UA 1AXKA 4GWJA 2JE9A 2VH9A 5LEJA 3H8RA 3A23A 2W5FA 3I2HA 1O59A 3U4SA 2FCTA 4Y4YA 1M06G 1JBCA 3JBG2 2C0ZA 1UZZA 3BCWA 2VMGA 3HR9A 5ANQA 4PHZA 5H9PA 3ZPYA 4CDXC 1NA1A 4XFIA 1VBC3 4L92A 4YG6A 1K12A 3TNPB 2XPJA 1W8OA 1US3A 4XTMA 1D2QA 5C8CB 3M7AA 1QDOA 4LORA 2V4VA 3PVNA 2FHRA 2XHNA 2I2SA 5IFTA 3RZKA 2DTYA 3JB8A 4DEVA 3NMBA 5C8CC 5KXEA 4OULA 5CYYA 2RM22 3VZKA 1R091 3FL7A 3RI8A 1NCRC 4XBQA 4MGQA 4NHKA 1H1MA 4HPKA 3NNLA 4LXLA 3O0WA 1PO23 2VO5A 3TOJA 3M3CA 3RZHA 5F7UA 4NHYA 3K4DA 4HOOA 3ZFFC 3KM5A 2Y0OA 2VOWA 2WA4A 4AHYA 4PIZA 2GZWA 4TXWA 5M0TA 4IE4A 4GWNA 3O12A 1AL23 1QEXA 3VBSA 1SG3A 2YXSA 1NXD1 3FLRA 3ZN5A 5FYTA 4PDWC 5KHGA 1YO8A 5F8PA 2ZPXA 4AVTA 4Q2FA 5D8AB 1ASJ2 4B4QA 2VZQA 1VR3A 1GU3A 1RUC2 1V6LA 5FZDA 1O3SA 3A4UA 1C28A 4FOVA 4JDNA 2D6PA 4NVPA 2PLV2 3KVBA 4R9AA 5FRAA 2YU1A 3OGRA 1ULCA 1RUG3 3D5OA 5D8AC 4JGYA 2Z79A 4Q4X3 2VJXA 3AYAA 5FOBB 1AYN3 5CAZA 1Y7BA 1O4ZA 1I3HA 1AR72 3RJRA 3SISA 1RUNA 4Q4W2 3OY8A 4WVMB 1YHFA 1QJU2 1OOPC 2ZX2A 4BZ4A 1SDDB 2K46A 1CN1A 2P5BA 3OGGA 4Q8LA 3OGSA 2H6CA 5GALA 1PO13 4DUXA 5CADA 3K4AA 1LTEA 4CUCA 5BNNA 5KXCA 1WLTA 3NV2A 4J6GA 5EQUA 2VNGA 4CXXA 5J09A 5E6HA 4LE4A 3VLBB 1F31A 2X10A 5BPXA 3RNSA 3ZDSA 2VL4A 2X29A 5LZ6A 3PJYA 5A3WA 2Y6HA 3K51A 4XIOA 3BPSA 3FLTA 5JSRA 3QOPA 1B35B 4WM7C 3B00A 4BQYA 1AVBA 2IXKA 3D4KA 1Q8PA 3BOWA 2ZZQA 3OJBA 5FP3A 3WF0A 1VBB3 1OD5A 3C7FA 4LKDA 1FATA 5IK8A 3FHIB 5CKNA 3WDTA 3N7LA 1QNYA 5JMOA 5K9YA 1HW5A 1MQTB 1OSGA 3WCSA 3RZJA 4F8AA 3H7JA 1IS3A 4JTOA 1KGYA 1X9PA 2DVDA 3OBAA 1UW8A 2AEZA 2BDRA 5FYSA 1MZEA 3MIHA 3RYKA 5LRRA 4Q29A 2QQPA 1YRZA 5LA9A 3ACIA 2ZX0A 3OOXA 3UJQA 3HT2A 3IDBB 4RHV1 1DGRN 2C26A 1NOVA 2DCTA 5T50A 5A6QA 3OUHA 4GKYA 1LENA 1YNAA 4CYDA 2X09A 2HWE3 4YM3A 1ENXA 3H3LA 3U10A 3IN9A 2D44A 5E1RA 5HCHA 2VC9A 2WQ8A 4LK6A 1AR63 1SBDA 2Q8DA 4H7MA 2E51A 2JX9A 2K9ZA 2QDNA 2W52A 3POJA 1ZRDA 2QQMA 1CX1A 4GKXA 1I6XA 3OF1A 4INDA 3CZJA 1QXRA 4XTPA 4YFZA 3U4XA 1RHI1 1W6PB 2QQVA 5FK7A 1QJY3 3NKGA 1G9DA 2XBO3 2ZGUA 2ZKLA 4KG8A 1L7RA 4QX5A 3N9OA 2VM9A 1WMFA 4BIOA 2UY9A 2Z5WA 3PJQA 4GAZA 5FZIA 4DFSA 4AL9A 1SLTA 4BQ2A 1QH7A 3S57A 3DPRA 3ZXFA 3H1YA 1LKNA 5FPBA 3ZKYA 2IC1A 2CGOA 1W2OA 1C57A 4BE3A 2EF6A 1UZYA 1NXMA 3MDPA 1IPSA 2VBBA 3CL1A 3MLJA 2ZOEB 1PX4A 1G6NA 1RUF3 2R1BA 1XQNA 3HMYA 3LA7A 1U5IA 4G3YC 3AMMA 4QXHA 5GM0A 2YC4A 1W8NA 1D7PM 4FTSA 2IVJA 2OPWA 1T6BX 2VMDA 5FCCA 3VHPA 2XWBB 4XE9A 3ZYFA 5IUQA 1QJFA 1W0PA 2A5ZA 4DRVA 2PHWA 3ZXEA 2WINB 4LK7A 4EJRA 4AFBA 3MUY1 1S2EA 4I01A 4B4PA 3WNMA 3C7GA 2HWD2 2WFF2 4RN5A 5C8CA 1QXPA 2BBAA 2VOKA 3QACA 4M0HA 1TEIA 3LGRA 3H0OA 5DAPA 5H9SA 5JWPA 3NKTA 5SV8A 4XJUA 4K7JA 4DMIA 4PT6A 4CDWB 2V73A 1PIV2 1JYWA 2D3SA 2UYBA 1HIXA 4QPWA 4Y24A 3E5QA 4DEQA 1WCUA 2J1UA 5FLIA 1HV1A 4K8RB 4Z82A 2VQ0A 2NM1A 3RZMA 1Q5OA 4XURA 3U07A 2B9VA 1HKDA 1QF3A 2XJUA 3WG2A 2GMPA 1UXZA 2A73B 2QQJA 2YUEA 4FOQA 5E8AA 3TEXA 4CDQB 3ZXLA 4LA2A 1GOHA 4DB5A 2X5IB 1VBE3 1PVC3 1ZBE3 1PGW1 5A6YA 1XYPA 3C7EA 2VNRA 4WVZA 2WT0A 4HETA 2X5IC 3PTYA 2VGDA 2O8QA 3JQWA 5D8AA 3UESA 3VKNA 3AX4A 4YZ4A 4BPZA 3T09A 1ZRCA 2PA7A 5FY1A 5FY5A 1LGCA 2RR11 4PI0A 3DF0A 5DABA 3DYPA 1YWKA 5A7OA 1FV2A 1W6NB 5AFEA 3B7MA 5LASA 3ILNA 4C1WA 3AP9A 1W6MB 4QQ2A 4WVMA 4CCOA 1POV0 4ASKA 4HONA 1R083 3AVSA 5JI7A 4HZFA 4DO0A 3D0JA 1DQ4A 2HWB1 1LB2A 1ZA4A 1WA6X 1FNZA 1R64A 1RUH3 3DYMA 3LKJA 3P5BA 4WM7A 4DIQA 1GP5A 2HWF2 3PNAA 1UX7A 2NQYA 2XWJB 2GMMA 3RWNA 4P9WA 3KQ4B 4CCLA 1B35A 3D0SA 4UF0B 1OI6A 3FHQA 1W39A 4E4HA 4LKSA 1J1LA 3M1HA 2HYKA 5FY4A 4FAGA 4MH0E 5FY8A 1ZREA 1HRI1 4ONUA 4A44A 4UBHA 1WW6A 4ATFA 3OTFA 3PURA 5FDBA 2P3IA 3DCQA 3LIGA 5IK5A 1OUSA 2HWC1 4YGEA 2B46X 4AI1A 1MQTA 1O8SA 4OYUA 3CMGA 4LNVA 2YZ4A 2XKPA 1SCSA 4OQ8A 3DL3A 1YQ5A 2HKXA 1RUI3 5EV7A 2BBVA 1RVF3 3ITQA 5EJZB 5FK8A 4MGTA 1H2LA 3E6BA 1HX6A 2WS91 1UN1A 3AYEA 3IMNA 2A70A 5JPMB 2V5YA 1KRIA 4NRQA 2P3KA 4M4PA 1LHOA 1V70A 3N9QA 4HKLA 3R4SA 5KHIA 5F3EA 4ATEA 3JUUA 1XNAA 3SKVA 5J7MA 4XUQA 3FX3A 1H1IA 4YGDA 1OA3A 2IXIA 2QJVA 1GKBA 2P17A 4KBZA 1BBT3 4Q5OA 2O8OA 1PMJX 3VKFC 4AVVA 1TME1 1SFPA 1QWRA 2YG0A 4UFJA 3APBA 5HCBA 3IAPA 1FOD2 1W6PA 2Z42A 3V65A 1H0BA 4COVA 4FQZA 4NHMA 5G05L 2A6WA 1SHWB 5FV3A 4Y1UA 4I09A 5JZGB 5FZEA 2QQKA 1UOGA 4N9HA 1UWWA 3J9SA 4PIYA 2A1XA 4Y26A 2CTVA 2BOJA 5GLTA 4QDSA 1N47A 3TWIA 1YJKA 2PMWB 5JZGC 4R52A 3PL0A 4Y3OA 1WGPA 1VBA3 2D5HA 4E4DX 1ZA7A 3H8XA 3POIA 4D7YA 3K77A 1ZBA1 4HK9A 3H8UA 2W1WA 3RWKX 2UWBA 1JZ3A 1XNTA 1C8M2 4FPFA 2MNGA 2Y8KA 2YC0A 3LPFA 1UF2C 3W20A 2A71A 4AQTA 2R16A 4JKKA 5GLWA 2X05A 2DCJA 2DV9A 2PHTA 2CU5A 2E7TA 2WABA 4XDOA 3T2PA 4KH9A 5FQ0B 2XJVA 3O0VA 4H3WA 1RITA 1OF3A 1QQP1 4Y1XA 1POV1 2ZHNA 1OHFA 3VZOA 1H4HA 1IS6A 1E5RA 3WY6A 1SACA 1RMU1 4BB3A 4CDWA 1HRV1 1Z7S3 2OIIA 3I54A 2QQNA 3ZXJA 1BJQA 3P3PA 5FZ4A 4DY5A 4XMAA 3FWEA 2GC0A 1J84A 4YRDA 3ZPOA 3LSDA 3GCWA 2J1SA 1JW6A 1XOYA 4H55A 2CHHA 3VBUB 5DZFA 3VKLA 1AR91 3I2KA 4DQAA 1OH3A 2WKKA 5DAVA 4CDQA 1EPZA 1RUJ3 5FZFA 5LB6A 1W6OB 2X5IA 2WNUB 4NIHA 2IFWA 3FJSA 5FYYA 3POYA 4J1XA 5JIUA 1A3KA 1V9U3 1VRBA 1RINA 1W8HA 2GSYA 2VZTA 3LDKA 3SCFA 3TN93 4QM8A 5JXJA 3N35A 4RR3B 3G7DA 1O3TA 2CGNA 4CDUB 5JMCA 3OPWA 1RTVA 5E89A 2WNUC 5LA0A 3MEPA 4B1MA 2RMU2 5F6KA 3ZXGA 1VP6A 1CIWA 2D6NA 1S0JA 5A7WB 3NSTA 4OLLA 3HNYM 5FKCA 4CP2A 4CDUC 2ZEXA 2ZHKA 4G4FA 4GH4B 4ORFA 1DZRA 1FPN2 4SLIA 2WN2A 2BOIA 1UU6A 2PN5A 3J8F1 4E2QA 2BPA2 4JQRA 2OPKA 4OI2A 2ZAHA 3NL1A 4IDZA 1W6MA 4IE7A 3BTAA 3ORJA 1UL9A 4YW1A 1C8NA 2R7EB 2WWSA 3USSA 2BWCA 3JBG3 3N9PA 2XKOA 4YFWA 3KV5A 2RS32 4UW5A 5JSOA 3O1RA 1HXS2 1OFNA 4DINB 4YNIA 5FPAA 4FO9A 5FYZA 1VPHA 1E5SA 2C9KA 4FOWA 2V09A 1AXZA 3I2FA 4UF0A 3VHOA 4I0AA 4ARYA 1DGRA 2RM23 1YIPA 4S2GA 4GD4A 1F4HA 2KR2A 1LCLA 5KHHA 2RS12 1W2NA 1OXCA 3IB3A 2HH9A 1L7QA 1S0EA 3WP6A 4A6OA 3UJOA 3URFA 3AKRA 2C1FA 4R4ZA 3SQOA 4YZ1A 4EWEA 1YXWA 3AXEA 3ZYHA 1BK0A 1ZZ9A 3RS6A 5C9AC 3GYDA 3ZO0B 5FO9B 3LDRA 1X36A 3THPA 1V6IA 2D7FA 2EXIA 4Q0QA 5EYYA 3WDWA 5GLUA 2VMEA 4B4RA 4CEYB 2J1VA 2VG9A 1K3IA 3LE0A 3N4MA 3T08A 3ZM8A 1TNRA 4COUA 1MACA 4LBQB 1T2XA 2B4KA 1J3RA 4AGRA 1GICA 1SBEA 1RUC3 3NNMA 2WDBA 4YGBA 4F83A 1PM7A 1EUTA 1D0HA 1FNYA 1H2NA 1MVEA 3JB4C 2ETEA 2OX0A 1NAEA 2E32A 4HXCA 4ZS2A 4W6WA 4GA9A 4JQTA 2WWUA 2L9LA 2C4XA 1C5HA 2TBVA 3FLPA 3I97A 4X8NA 3WZ1A 5C3RA 3DXUA 3RVHA 1JUIA 4Q4W3 1QJU3 2Q8EA 2VXRA 5I8TA 2QQLA 2NP0A 5FP9A 2OYZA 4PF5A 1VBC1 1R092 3O7OA 2R1DA 2AC1A 3MPBA 3SC7X 1JYNA 1TG7A 1ZNPA 3ENRA 5D2AA 4BYYA 4IV1C 3VD3A 3WG1A 5JZGA 2R49A 2GH2A 4IGQA 4AQSA 2D97A 4K21A 5C6CA 2XVGA 4EV0A 5F32A 5ACA1 3ZX7A 4BU2A 4IL7A 4PI2A 1DIWA 2WC2A 1U0AA 4AAPA 2WRAA 5FXZA 1QJX1 2QCSB 5C5TA 4URTA 2AENA 3MW2A 4MG2A 3ZXKA 2VW0A 4Q0PA 3ON7A 3JQXA 1KD7A 2WNOA 2DVGA 5A3PA 2QBXA 1PGSA 2W87A 4B3NA 4A7ZA 3I8TA 4R9BA 4HFSA 4YW7A 4K20A 2K2SA 3ZMNA 3FHAA 3AZXA 1GUIA 2ZGLA 3CF6E 3MIGA 2W1UA 3PVBB 1MEC3 4AI8A 5FY9A 5FQ0A 5FMCA 1RUOA 1QHDA 2Q0AA 2MEV1 1MZ5A 4QX8A 5LRSA 3NQHA 3H7YA 3HBKA 4Q4Y1 4CE8A 3JD71 2XH6A 4XFCA 1QOTA 1LOGA 1I1EA 1AR83 1MPXA 3MV01 3R4UA 3FE5A 5F5AA 2JD9A 4ZU4A 2FDHA 3P3NA 2QFEA 4OUEA 3I49A 5FBJA 4HMZA 4N53C 1AYN1 4QMAA 3LWCA 5EJ3A 1GLHA 3PVEA 3VD7A 3KCCA 2B42B 1JTZX 2XMLA 3W5NA 1GP6A 5APAA 3U75A 3BIWE 4IE0A 5D21A 1CAUB 5JR2A 1GZCA 2WT1A 4JX0A 3NW4A 4JCKA 4LHNA 1NY71 3S7IA 2HEVF 3ZIWA 1W6OA 5HV4A 4MGSA 2WNUA 2PQQA 2XVKA 1OQDA 4QB6A 3VDDB 3H3ZA 2UWAA 5JVVA 5JDBA 4XFBA 4RR3A 5K8SA 4CDUA 4RGAA 2XJTA 3BYWA 4XHXA 3VDDC 3WNXA 3KSCA 5A7WA 3S5QA 5FAXA 5FP7A 4PBOA 4O61A 3I3DA 4FPEA 1ODNA 4QGNA 1LOCA 4GH4A 4XILA 2AYHA 3UGGA 1NLRA 5A6XA 4LO4B 2WIIB 2G4IA 2ILMA 2D6OX 4GULA 5BNNC 5IAVA 3WF3A 3T0DA 4XETA 3W5MA 4RHV2 4XAEA 1W8TA 5CIRA 5FZCA 1HQLA 1QOSA 5J96B 4KNCA 1UKGA 2NMNA 3PHMA 5F5IA 4P5HA 2IUWA 1XYOA 2VMFA 3KF3A 2P3YA 3QH7A 1X8EA 2AREA 5IVBA 4Y5SA 4CCDA 4RD7A 2HWD3 2WFF3 2WZR1 4BISA 2JD4A 1KJRA 2OQ6A 3RYRA 4AVSA 3LF7A 4QX2A 2JICA 2R043 5FZAA 2OXBA 5A70A 3SH3A 2HWE1 3W58A 4LT5A 1PIV3 3POFA 3HPNA 4AEDB 4O65A 1AF9A 4FPYA 3KLSA 4QHBA 3MFCA 4Y1YA 3WDVA 5FZKA 4RFT0 1RHI2 4MYEA 5GZFA 4A45A 5C9AA 1WKYA 1VAKA 5IYYA 1CZVA 3BU7A 3SITA 4AEDC 3VDBA 3O1SA 1IQAA 4MGZE 4BQ5A 1JU3A 1DQ0A 2H6BA 4XFGA 1A8MA 1UKRA 3HT1A 1BK1A 4IEUA 4MXVA 3H50A 1VRH1 2EIEA 5A7NA 1IG0A 2XBO1 3H9AA 3K48A 3KT1A 2H0VA 3CEWA 4FVVA 4GJYA 2JG9B 4NWVA 5IATA 1EV12 2F6BA 2UYAA 5ERLA 4E4ZA 4LBQA 2GC1A 5F3CA 2CV6A 2JE8A 2WSUA 1XNCA 3N9NA 3AJZA 4EWAA 1LR5A 2D98A 2O0OA 3J7HA 1UYXA 5I91A 2CDOA 2FZ1A 2TNFA 5FY7A 3ZDVA 4B1LA 4NIDA 5JOXA 4WM8B 5FPZA 3GBWA 1XU1A 1A78A 3C7OA 4OHVA 1RUF1 1QU0A 3HQRA 5HV0A 5B4NA 1AX2A 1OF4A 5F9TA 3I3BA 3OBZA 2OT7A 4MHUA 3WQ0A 2DUQA 4DS0A 4TN7A 2XLGA 2ZX1A 4WM8C 2WO3A 4O9GA 1G9AA 3RJ2X 1AX1A 3A22A 1MS0A 4XJ9A 1J58A 4NHXA 1GMMA 5K4LA 3DPRC 3FN9A 4XJZA 1N3QA 2Y33A 2HBTA 3IIAA 4I3GA 3UNPA 2HWF3 5DG2A 3T4HB 1DQ5A 2JG8B 1FYUA 1HB3A 1W3VA 3RZGA 4M3CE 4B7EA 1GZWA 3U0ZA 4P14A 3WW4A 1SCRA 1UQXA 2JG8C 4A6SA 1BEV1 4V2VA 3CU7A 1S0IA 4CU7A 2ERFA 2OS2A 2W68A 2CAVA 4Y20A 1COV3 2VUJA 4MGIE 3SMHA 1ENRA 4CU9A 2QNKA 1PGW2 2VVDA 2VMCA 2BFUS 2PFWA 4OCTA 4D0QA 1MS1A 2D3PA 3BPZA 1YQ2A 3ZYPA 1TQ5A 2VZSA 4R9DA 1JHJA 2CGPA 4JGZB 2OUJA 1E5HA 1RYYA 2Q1MA 4XZPA 4FTBA 4FSJA 2CL2A 3NV4A 2RR12 2XONA 4E27A 3OEAA 5FY0A 4NAMA 4YZ5A 2JKXA 1LEDA 2WSVA 3JU9A 3MLKA 4JGZC 4XBLA 1GR3A 2VCBA 4LBKA 1WA4A 4N53A 2ZGTA 3NVCA 5EXOA 1K5MB 3GBGA 2JDHA 4KQ7A 1G86A 2JDKA 2H0BA 4CUAA 3ES1A 2HWB2 3KZ4C 5FYBA 2R071 1F5JA 3M2MA 1US2A 1CPMA 1K5MC 2E33A 1VIWB 4C1XA 4DY3A 1XBFA 3WHUA 1WCKA 1CAUA 2FDIA 1UYZA 3WLUA 2QQUA 1FOD3 1S0BA 4IEWA 4FP2A 4XQDA 2A6VA 1H30A 1RUH1 3VDDA 4LIVA 1RUD1 2LROA 3AL5A 4QQLA 5FZOB 2ZAAA 4EE2A 1A34A 1HRI2 2BVBA 3Q8AA 5FJHA 1H8TB 2XOMA 3N7MA 4LIUA 3AMHA 1CZTA 3LZZA 3Q9OA 3GZTB 4QKFA 4DUVA 4Q4V1 2HWC2 2QKDA 4W8JA 2N7GA 2LTNA 1VMJA 2C9AA 2BEOA 3TYJA 4RFRB 2ZGOA 5DG1A 4QU2A 4Y1ZA 5DXDA 4QXBA 1UD1A 1YI7A 2QQWA 4ZU7A 3RFRA 5A7QA 1V6OA 3TEYA 2EIDA 1LESA 2HEWF 1V6NA 2BP6A 2EIBA 2WS92 4X8PA 1C8M3 1WUVA 1GZ9A 1JS9A 4AF9A 3TEZA 2PHUA 4Y5Z0 1UZWA 2ZHMA 3ELNA 5T52A 3NNFA 4N9IA 5HI0A 2ZKNA 4XFAA 2TEPA 4DXTA 4QPGB 5I0SA 1B35C 1GP4A 5F3GA 3BTZA 1NZCA 1ULEA 4FFHA 2W94A 3OD4A 2JEMA 4IEYA 3S7EA 3GZEA 1ZZBA 2ZXQA 2JIGA 3MHZA 3QD6A 1CQ9A 1ST8A 1BXHA 1TME2 2ARCA 2ZGPA 1D4M1 2HBUA 1NLQA 1MQTC 3GXUA 1CD3G 3R4DB 4QXCA 4AEDA 2EAAA 3KD4A 5JXGA 3UKNA 3BB6A 3DKQA 3MICA 1RJ7A 1Q56A 1C4RA 2R30A 2ZGMA 3DECA 5DZGA 2DVAA 5CA6A 3K46A 3WUDA 4L9BA 2NPIA 1BVVA 3IZOA 4YG3A 2G9FA 3KF5A 4JVAA 4S2FA 4YVSB 4AYUA 3ZIXA 1VBD1 3ASIA 2TUNA 3FBMA 3MF9A 2W46A 3AKSA 3WQBA 1PGL1 2ZMKA 1ZZCA 1OPOA 5CFCB 2JG9A 3WQ7A 1HN0A 2FDKA 2ARXA 3S5AA 3E6DA 3K4ZA 1JYCA 2DYCA 1ZBA2 4FT8A 2RMU3 4COYA 5DZEA 1ZM1A 1U5XA 2PHRA 2YC2A 5IT6A 3QLQA 4MLOA 3LB9A 3H42B 4JKMA 2VE1A 1J83A 2EIGA 1OURA 4AFCA 5L73A 4WM8A 3U1XA 1VBA1 1FPN3 2VZVA 3WCRA 3AZYA 2OUHA 2JKBA 3EQEA 2XJSA 4LEJA 4LKFA 3PLQA 4YM1A 2I07B 4N7IA 2EALA 1QQP2 5CG8A 3USUB 4P00B 4EQVA 3KWVA 3VKOA 2RS33 3FZ3A 3J4UH 3ZYBA 1RMU2 4QPIB 4QX3A 1HRV2 2CSGA 3CO2A 3ZFGB 3MW4A 1ODMA 2Y64A 1BYHA 2JG8A 4M01A 3KV4A 5GJ6A 1UU5A 4QPIC 5C33A 2DTWA 1S2KA 3ZFGC 1W8UA 1GQHA 2GNTA 2ZGQA 3EMRA 4HN1A 1OLME 4LBQD 1NZIA 4BDVB 3I2GA 4QU1A 2Y6LA 2QTWB 5FZ9A 3O5SA 2R32A 3ACGA 3L2HA 1AR92 2RS13 5FZHA 1URXA 1LHNA 2R0FA 2Z2SB 1X82A 3WT3A 4FBFA 1SQ4A 2DFCA 4L2NA 3I3EA 2BNOA 1QNWA 2ZTNA 3ZOIA 5DDJ3 4O9EA 2W95A 3PUIA 1JYXA 1S0GA 5FLJA 3AZZA 3SCGA 2YU2A 3NV3A 5I8SA 2XG3A 1L7LA 1N3OA 1RUJ1 1WLDA 2BVVA 2SBAA 4JGZA 4UT5A 3SH4A 1W8WA 1GNZA 5IAXA 3W21A 4CDWC 1ULDA 5A3LA 3IT8A 4R4XA 1JU4A 4UW6A 4KGGA 3T0BA 1MS9A 3WP5A 3O1VA 2CAUA 1VMFA 4N8MA 4CZSA 1HJFA 3VUOA 1EY2A 3J8F2 5AC91 2WO1A 4IGPA 1MS3A 4LKEA 2C24A 3VB9A 4EROA 1UOBA 2OZJA 4WBBA 1BMV1 2QUOA 1KEXA 4FCAA 2XUEA 1K5MA 4AK3A 3I59B 4ZZ8A 3QCWA 2QZ2A 1LEMA 2ZEYA 1DG6A 1F5FA 4CDQC 4DUWA 5I8YA 1CJPA 1OMIA 3PDQA 4KWKA 4EN0A 1DGWX 2IVIB 1Z0HA 1UY4A 3J7LA 5FXWA 4NN0A 3ZVXA 2E7QA 4MZUA 1ZZ6A 3PUSA 1BCXA 4L99A 1CJDA 3J7MA 4PF1A 5FZOA 4LLOA 2D3RA 4B29A 4XJAA 4B8EA 4P08A 1H8TA 4AG4A 3VL8A 3VGIA 1HLCA 2WNVB 2ET1A 3RGBA 5EIYB 1RUE1 1N1VA 2W08A 4GZ9A 4QKDA 2DU1A 3H8OA 3MIEA 3H1WA 3VV1A 1H2KA 2FBEA 4KGQA 1UXXX 5IJRA 5F5QA 1DU3D 1R1A1 2UU8A 1UYPA 4UW3A 1OC1A 3KMHA 4XDQA 3KB5A 5FOJB 1AUYA 5T5LA 5KC6A 2EICA 1O3QA 2A3YA 2ZHLA 4RA0A 1S0DA 4RYDA 5A1LA 5JXHA 4I2OA 3AFGA 2GMEA 2ZACA 4LBLA 1V6KA 1KQRA 5GLZA 4PIXA 1EP0A 4HVRA 1JZ5A 1REDA 2XDVA 2VZ1A 3F2ZA 5FXVA 2ZJCA 5A3MA 2DCZA 2FMDA 5F5CA 1MVQA 4GMP3 4XJ8A 4OVEA 2IXCA 1YFUA 2XLAA 2JIJA 2VD7A 3V0BB 4J25A 4XIKA 5FYUA 5DQ0A 3A0NA 1LU1A 3HN3A 4K8FA 4RL7A 4XF3A 2Q1ZB 5FTTC 1Y9MA 3AYDA 3KVAA 2WUHA 3M8LA 5F2SA 1CZSA 4ZY9A 3DUIA 5A3TA 1S55A 2RS51 1UU4A 3F95A 5FYMA 4MX3A 2RJKA 1VBC2 3BIEA 5GZCA 1QXJA 5E88A 1DF0A 3OGJA 4D8MA 3MO4A 3WEZA 4LO5B 4YVSA 4LUKA 4XMIA 1AJKA 3MBWA 5DUXA 2JXAA 4QX0A 5ACA2 3E6CC 4AFAA 1UPIA 1MS8A 5EP9A 1QJX2 5FJKA 5EJ1B 1W99A 3KCXA 4LR4A 4E9KA 4CXYA 2PELA 4Q1PA 4NOTA 5K7PA 4JHZA 4W65A 3UV9A 4IQPA 4JRLA 3HNMA 1WCSA 2GC3A 3PVOA 3VBFB 4U2AA 4RS5B 3BUCA 4ZONA 3VBFC 4DXRA 1F9KA 3MLLA 1DGLA 4YVWB 5FZ3A 1VB4A 1OVSA 3OYWB 4YARA 1TMF1 2MEV2 1OA4A 4EN6B 3USUA 3OEBA 2W2IA 5FO7B 4AVBA 4DNYA 1MS4A 1W9WA 3BOPA 3PMEA 4Q4Y2 4DXZA 1ZZ8A 3B01A 4META 4QPIA 3JD72 4YVWC 1JZ8A 1W9YA 2R061 1DGWA 1MEC1 3ZFGA 3BI3A 1GSLA 2ZGNA 5A1AA 4JKLA 4AW7A 4CU8A 5ISLA 4XEZA 3RMYA 4QHOA 3THDA 1HQNA 1AYN2 1JI6A 1IHMA 1UNBA 4JHTA 4GALA 3PUHA 1YQCA 2ZGSA 2XLFA 4FXKB 1AR81 1G9FA 3B3QE 2PHLA 4XXPA 2G19A 2Q8CA 4A2UA 1RHI3 3W9AA 5ABJB 4AR2A 1NY72 4I0WB 3M3EA 4V2WA 2VECA 2FDGA 2WL1A 1NKGA 4FPKA 4OHXA 4BIFA 5C7GA 5ABJC 4K3UA 1LJ7A 2LUWA 2D40A 2RDNA 2QVSB 4ISQA 4BHPA 1JYVA 4UXAA 1PM4A 2CYFA 2GN7A 2IXJA 5FZ0A 1GWKA 3WNLA 3M3QA 1JODA 1YQ6A 1RIRA 3MIDA 1YFYA 4P9GA 1EV13 5LY2A 3BTYA 1PZ9A 1SBFA 3UK9A 4HSLA 1GZTA 3M3IA 1ONAA 1AYM1 4FPGA 3LEGA 1XE7A 1RXFA 2VUCA 3AMPA 4Y33A 4AFMA 2LS6A 1WCQA 3LDBA 4DZGA 5DAXA 1E5IA 4CA9A 3BODA 3I59A 3VBUC 1V6JA 4HKWA 3AMNA 1LAJA 1UAIA 4P9YA 3IPVB 4W6YA 3ZSMA 4K6BA 4OFGA 4YWAA 4TTGA 4Q0VA 4UYBA 4AHWA 2WZR2 5A3OA 1F35A 5JOYA 2QDRA 3SNMA 3DKWA 3NO8A 4RR3C 3T2OA 4AI9A 4YSFA 4C8DA 4DOUA 5LATA 5T3NA 2HWE2 1P8JA 1IS4A 1W6NA 4JAAA 4EN7B 3LEIA 4QDRA 4GH4C 3VL9A 1GNYA 2JDUA 2P3JA 2WNVA 4GQ7A 2VPVA 2R041 4I0BA 5ANNA 3O1OA 5FBZA 4HN0A 3DYOA 4BXSV 4AWDA 3RSJA 4M3CF 1JYIA 1WZXA 1MZFA 2VUDA 4LA3A 4N43B 1D2SA 2EAKA 2W1SA 3E5UA 1VRH2 1BQPA 1LOFC 2XBO2 1IKQA 4D6QA 1O91A 4H7LA 3LIHA 2FMYA 3ATGA 3UGFA 1U5ZA 2VULA 1FXZA 1XE0A 2YYOA 4N43C 4UI9L 5FMOL 3MZHA 1Z78A 2VVEA 3IM0A 4PLMA 1NCQB 4PQQA 1KXGA 3A21A 2A7AA 1UX6A 3SCHA 1DLCA 1DYPA 5JUVA 3WG4A 2RR13 1XU2A 4LHSA 1W04A 1UZ0A 1OUXA 3THTA 2DBNA 4P9LA 4MXWB 1DLLA 2ADDA 1EAH1 1FMD1 3ABZA 4XUNA 2V72A 1ACCA 1RUF2 2D5FA 4LBOA 2XL7A 1HV0A 5CVRA 4GB31 3ACHA 3WW2A 3V0BA 4M00A 4QHZA 2VTFA 1QKQA 1XPWA 1XXNA 2NYYA 3AXDA 2PQSA 4XF9A 2E26A 1SLCA 4YG0A 4A4AA 4CXWA 1NE4A 2C6SA 5FO8B 4JV4A 2Y6GA 2HWB3 2VU9A 4ZXKA 1ENQA 5IVYA 1WWYA 1IZ3A 3MV11 1J1TA 1AX0A 2WFPA 2WO7A 3MIFA 1ASJ3 4CEYC 5FXXA 3VHNA 5IVJA 4FXGB 1FX5A 4XCBA 3ACLA 1W9SA 4NRPA 3O0XA 1LNSA 2PLV3 3N36A 4GXLA 4QGMA 3ETPA 1WD4A 5HCFA 1STMA 5DAQA 2OKXA 1G9BA 1BEV2 5I0UA 1AR73 2E6VA 2W47A 4C0HA 1IGOA 4K1YA 3H1MA 1V6MA 2EXJA 4E4SA 1W6QB 2VOXA 5C8WA 2B9UA 2HWC3 5DMYA 2I74A 1RC6A 2W3JA 3VBFA 5F39A 5C4WB 5BYNA 3KHCA 3GF6A 1VAVA 1Y3TA 3POGA 4RS5A 1JUHA 4QD2A 1COV1 4HSJA 5A6ZA 1AXYA 4YVWA 5C4WC 2WS93 4IEZA 1W0NA 3OYWA 4FQ4A 3IDEA 4D7TA 4FPLA 4BK4A 4YGCA 3MIBA 1R1ZA 2YY1A 4PBPA 3KT4A 1GWLA 4OMCA 1PO21 2G9ZA 2F17A 1WCDJ 3S6PA 1OLRA 1SMVA 2Y6FA 4IEVA 4QGLA 4H14A 4EWDA 1IQDC 2VMIA 5A3UA 1LGNA 3A0KA 4PLNA 4FTEA 2D6MA 1AL21 2R072 3WOGA 1TME3 2VCCA 4ZU5A 3VN4A 4AHZA 3VZNA 4Z2WA 2VOTA 2ZGKA 4MSVA 5B4XA 5ABJA 2V5DA 2IXLA 3LFIA 2Q5TA 2QZ3A 1HB2A 2GNDA 1K45A 5L9VA 1RUH2 1XRUA 1RUD2 1UMZA 2VZRA 5FWJA 2JDMA 2B39A 2R6QA 4L97A 4GWMA 1CR7A 4BQ3A 3PMSA 5E16A 3LEKA 4Q4V2 1RUG1 3V64A 4DRRA 4Q4X1 2HYXA 2MPFA 3TEWA 3IMMA 4TWTA 2D93A 1LHUA 3RG0A 3T2QA 5FR3A 1F4AA 1HB4A 4EN8B 1PNGA 1JH5A 3WSOA 4Q0SA 2UURA 4HVOA 3T0AA 3VBUA 4AI0A 4BWOA 4ZS3A 2Y34A 1POQA 4E8CA 3I4IA 5IWFA 1PO11 1W8ZA 4XFFA 3O14A 4XBNA 1D0GA 2CWMA 5GKAC 5L9RA 2NLRA 4AQ6A 3N9LA 3WX5A 4XXAA 4BLIA 1OBNA 4IW3A 2DF7A 3DEMA 3Q8BA 5I0TA 3T4VA 5C3SA 1QJEA 2VNOA 3IPVA 3ACFA 3T2TA 2XJRA 4JZRA 2YBKA 2XHKA 4KWJA 3G6JB 4PLOA 1ULPA 3KGLA 2GC2A 1QQP3 3AKQA 1GBGA 2VR4A 1POV3 2YFUA 1BVP1 4CUGA 1VBB1 4K1ZA 1RMU3 2W92A 4S2DA 5BNQA 1HRV3 1D4M2 2FQPA 3GBFA 1JZ4A 4YZ3A 4OI1A 1XNKA 1O5UA 4KU7A 2Y6KA 5HBAA 1KS5A 4TLGA 1W9TA 5FMBA 1CONA 1X8MA 4BXFA 1LOFA 5BNOB 4MVTA 5J48A 1CAXB 1YC61 1WMXA 4N43A 1AR93 2RDSA 3KCYA 3C8XA 3ZYRA 5KXBA 1SLLA 3POWA 3T30A 1VBD2 1XNDA 1NE6A 4AFDA 3OUJA 2NN8A 5FZ6A 3WXPA 2BGCA 2VW2A 3POBA 1SPPB 3VBRB 1PGL2 3M4FA 3HVDA 1ULOA 3PIJA 3POEA 5F6LB 4NAOA 3CZUA 5K0UB 2ZS6B 4BK5A 2AR6A 1NCQA 1OVPA 2BYVE 3HJRA 2GP3A 2YB7A 2JDYA 3VBRC 5JAXA 3IWZA 4LJHA 1AR61 2BJSA 4NPLA 3VKMA 1EUUA 4RGGA 1H4GA 5K0UC 4QB2A 4LO8A 1VBA2 3J8F3 1NYWA 3OB8A 3ZYGA 5T55A 1QJY1 3WNNA 3V0AB 3PTRB 1PMIA 4LULA 4CEYA 4CP0A 1O6UA 3KHBA 4BQWA 2J22A 4A42A 2D6LX 1LOEA 3ILFA 3UETA 3K2OA 4LBNA 5FMOS 1DQ1A 1NUKA 3SHRA 3LA3A 2JG9C 4G9SB 2FZ2A 1F8VA 4FPHA 1B09A 4IEQA 4JDOA 3VZMA 5LK5A 3NAPB 1YYNA 5BV6A 4P9XA 2JB4A 2JDPA 1Y9QA 4QX1A 4OMDA 4AI3A 1W28A 4QX7A 5LBFA 1KS4A 1W6QA 4NROA 4XYXA 4DXSA 3I3MA 2P37A 3LOBA 2XJQA 5LBEA 3INAA 1U12A 3I3QA 4FPOB 3UKVA 1AHSA 2DU0A 2MHFA 3LA2A 4B7KA 1IS5A 5C4WA 3AK0A 5AFBA 4NHLA 4V1PA 1ND3B 4A7YA 4LTAA 2ZX3A 1C3HA 1RUJ2 1UY1A 3KS7A 4QPYA 2WZEA 3J26N 1BLZA 2WLQA 1D4VB 3KQRA 4E2GA 1KFUL 5DDJ1 3D82A 4KWLA 1UZVA 4IUGA 5AC92 5KHJA 1FI2A 5FYVA 4Z2AA 1CGPA 1LRHA 1BMV2 4ZZ5A 1ND2B 2PAMA 1X50A 1OH4A 4NWWA 4ASLA 3E5XA 4WV8A 2VMHA 3TBDA 2WQZC 4DPNA 2DUPA 4HK8A 5F1RA 2LM3A 1ND2C 4BMEA 4MOAA 3ROUA 4UFMA 2GDFA 4FP3A 4Y4RA 3I2DA 1A8DA 1O8PA 4CDXB 1KJLA 3WR0A 1QIQA 2ENRA 2DVBA 2RE9A 1VBE1 1PVC1 1ZBE1 2ZMLA 3T1LA 3THCA 4ET7A 3B93A 2VOVA 5IVCA 1SDWA 2O14A 5FKBA 1XSQA 2XQRA 1IG3A 1OD3A 1S2BA 2P2KA 3AZWA 4M4RA 1GOGA 4LOTA 1NCRB 4ZPIA 2R0HA 4QAWA 5BUVA 5C3OA 5KWRA 1JHNA 1RUE2 1CESA 1DQ6A 2J1RA 3AP4A 3IIIA 5AVPA 2JWPA 1JYTA 5ACA3 4D6SA 1SFYA 1YLLA 3ZFFB 1Q8OA 1HN1A 4IEXA 3AKPA 1ENSA 3M70A 5EZWA 5KBFA 3R6SA 1UOJA 1R1A2 1QJX3 3WNPA 2WYFA 4HKOA 5KHKA 1R081 3NRUA 5IVVA 4YLZA 2W39A 1LODA 2D6KA 3MW3A 4YW2A 2YGMA 2LW8A 4OQ9A 1XC6A 1QDCA 5I0RA 1W2AX 1KDMA 2RV9A 2X8KA 4IESA 4A3ZA 5DPNA 3NJYA 4IGOA 2A6XA 2FDJA 4PDWB 2FCVA 3EXUA 4OZXA 4P9JA 1AJOA 3NJXA 2WT2A 1BZWA 2A6ZA 1ZRIA 3ZR6A 4K9SA 5EHDA 2MEV3 4ISRA 3ZR5A 1H8TC 4M0NA 4FI9A 1YFXA 4M3CB 4Q0UA 3K75B 4Q4Y3 2XXZA 3CBNA 4CCNA 3JD73 1GV9A 1REEA 2KA3A 4F3JA 1G8WA 3NJZA 4IE6A 4HT1T 1QY4A 2RDQA 3HIFA 3CNAA 3N9MA 3R0RA 2WBKA 1OOPB 2RS52 4GMP1 4FAHA 2HEYF 2VBPA 1T6GC 4CU6A 1TNFA 4MADA 1RUI1 2BNNA 2WWJA 2YROA 5BNOA 1CAXA 1RVF1 2BWAA 2IFRA 2K0GA 1BHGA 1GQPA 4I02A 3WDXA 4AAXA 3GGLA 3CJXA 3ME2A 4AEJA 2VQTA 3PU3A 1W0OA 4PCRA 4NIAA 1LHWA 5JLVA 4QPGC 1SPPA 1ZVFA 1GANA 4XF4A 4WM7B 3VBRA 3FUQA 1IPKA 4LO7A 4Z07A 5FZGA 5FPUA 3TRSB 5K0UA 2VTXA 1SEFA 3LFMA 3U37A 3GJAA 4H2AA 2YV8A 1DQ2A 1MR5A 1H9WA 2W91A 3ES4A 4ES8A 5FZLA 5LA1A 2B5HA 4K40A 1BBT1 1S0CA 2IZWA 4MGKE 4RQPB 5IFPA 1S0FA 1LOBA 3RDIA 4Y22B 5I93A 5H9QA 1YFWA 2JJ6A 2ZEWA 5DUVA 3V0AA 5FLHA 3OPTA 4RQPC 3AP6A 5CBLA 1TMF2 3O1PA 1XNBA 3AB0A 5FZBA 2DURA 2RG4A 4BCUA 3VDCA 4Y5TA 4YVSC 2J1AA 2QQOA 4YW6A 5EWSA 5A80A 3WHTA 2R062 1MEC2 2F4LA 2WJSA 1O5LA 2WZR3 4NR1A 1O3RA 1ALYA 5CFCC 3B69A 2FD8A 3AZVA 3P6BA 1JOBA 1CAWB 5L7OB 1L3JA 3NAPA 1G7YA 5DUUA 1AR82 4UFIA 3TNQA 5L19A 4UAPA 4I30A 4S2HA 1V00A 3FFQA 4AQ2A 5L7OC 4HL0A 3BGAA 2DCYA 4KU8A 3ZN4A 2VXJA 4PQ9A 1WBFA 3VDAA 4HBNA 1HXS3 3E1F1 4HG6B 4N90A 5EFUA 3LPGA 2ZBJA 5GLVA 3WW1A 4D3WA 1ND3A 4MHRA 2GALA 3KGZA 1VRH3 2Q4SA 5T5JA 2A75A 5JI9A 4LUMA 3BALA 1KFXL 3D3AA 4X6RB 5KC5A 3HD8B 1X7NA 5G04L 1Z7S1 3HBZA 1OKOA 4XABA 1VALA 1J59A 4LBMA 1WW7A 3IDCB 1AYM2 1ND2A 3HQXA 4GJZA 4QWNA 3BU0A 3H3UA 2Y6JA 3AVRA 3RMXA 5SV5A 4HANA 1EV11 4CRQA 1LGBA 2OZ6A 4SBVA 3IKWA 2QQIA 2XUMA 3CDZB 2J42A 1SLAA 4R9CA 1DHKB 2ID4A 1CX4A 2WLPA 4Q1RA 1V0AA 4XFHA 3POSA 4CDXA 4OI4A 4OHYA 2ZZJA 3UT0A 4OI0A 4BJ0A 3HQUA 3NNGA 3TAYA 1V9U1 3TN91 1MS5A 3ZFEB 5BNPB 3MF6A 2DUOA 2WR9A 5CU1A 3WP4A 2Z69A 2PXJA 3RYPA 3E97A 3BVCA 4QKBA 3DXTA 3ZFEC 5B2GB 1NCRA 5BNPC 4E8DA 2R042 2EXKA 5FP8A 3ECQA 3CQOA 4LITA 2EA7A 4NPRA 4XQWA 3ZFFA 4KI5M 5A32B 1BEV3 1E57A 1UOFA 3GDBA 5LBBA 5CNAA 2P34A 5J98B 4D94A 3B94A 3JBG1 1Y4WA 3WNKA 1KDKA 2D43A 1JOPA 2VQAA 4YW5A 1DZTA 2WQ4A 4CVUA 1S4CA 2RDRA 2VBDA 5H9RA 1R093 1PX3A 2V4AA 5KR7A 4PDWA 1JZ2A 2XJPA 2B45X 2OVUA 2EVXA 1Q3EA 2CDPA 4NO4A 3O1TA 4BH9A 4XUOA 1NT0A 2DCKA 1QOOA 5I0DA 4LPLA 5JCTA 3N7KA 2PAKA 1EAH2 1FMD2 2RM21 1PZ8A 3OD0A 4M3CA 2WNVC 2YHJA 4GB32 4QQOA 3ILRA 2F4PA 5FUPA 2WAOA 3C7HA 5FZ8A 3S30A 3SEEA 1J3PA 2Q8OA 2BTVC 5F3IA 1BKZA 1OOPA 1WW4A 2AGSA 1OA2A 5EYXA 4CCCA 1Y43B 1OQ1A 2WN3A 2R073 2E63A 2XB6C 1Q8QA 3MUZ1 5FYIA 1DBNA 2WAAA 1XSRA 4QPGA 3OPZA 2A6YA 4YPJA 1CIYA 3C2UA 4XCAA 3TB0A 3LOIA 3BTXA 3AFKA 3EYPA 4A3XA 3GM8A 1UIKA 2AH2A 2VCMA 3GHMA 3LQCA 4XACA 1RUD3 1ASJ1 1LU2A 4KWUA 2NMOA 3GALA 1RUC1 4WZCA 1VJ2A 4YW4A 3OUIA 1U5YA 2BGOA 2PLV1 3HOBA 4Q4V3 4AGGA 1EPWA 1YIFA 4EN9B 5DUWA 2A3WA 2Y38A 4A41A 1WLWA 3GCXA 1AR71 4RQPA 4Q4W1 5FIXA 1TE1B 1QJU1 3CIHA 1COV2 4Y22A 2BU9A 3PUAA 1YJLA 4GIQA 1UCXA 4D69A 1FAYA 4JTNA 1NLSA 1IOAA 5FYHA 3ZN6B 4AVAA 5CFCA 2VW1A 3DN7A 5C70A 1PO22 3HN1A 4W50A 4Y1VA 4D7SA 1G9CA 3EBRA 3FMGA 3QBQA 1LECA 1FT9A 3MGUA 4XVHA 5F2WA 3PU8A 4XAAA 5JSPA 4CPBA 1AL22 1Q43A 1W9FA 3B02A 1CAWA 1GYKA 3OBTA 5L7OA 3B5LB 4C90A 1D4M3 1AL0G 3WW3A 2G9GA 2YBSA 5DN2A 3WINE 3WVJA 2VZUA 1K42A 3SKJE 4R8HA 2WA3A 4RHV3 4I3PA 4OUMA 5CZKA 3OG2A 5L36A 3OCPA 4RS5C 4IV3B 5FFOC 3U11A 3Q8CA 1VAMA 3WF4A 3VZJA 1W06A 2PAEA 3ST7A 4XDPA 3WP3A 2JE7A 3MPPG 1W8FA 4AXOA 4IV3C 1RL3A 3VBHB 4NUBA 1VBD3 2ET7A 1RUG2 2FCUA 3KV6A 4Q4X2 2GN3A 3I7DA 3WDYA 2YPJA 2VNVA 1H2MA 1XJAA 4IERA 1C1FA 1SZBA 4KMQA 3VBHC 1F2NA 2GH8A 4IEOA 2VY0A 4TYSA 4MGYE 1PO12 3X29B 1UPSA 2AUYA 3Q8EA 2WZPP 5FUIA 2KXLA 1JZ7A 4QT6A 1W90A 3M3OA 2PHFA 2Q1FA 4QKNA 4L11A 1DZQA 3WD5A 1MZ6A 3GZAA 4PJYA 4C91A 5LY1A 3SH5A 1ZZ7A 2IXHA 3FUOA 3KT7A 3LEMA 4OUSA 5FYCA 1JN2P 3ZKUA 2LRPA 4NRMA 1LULA 4HLTA 4XC9A 1LOAA 3ZFEA 4AI2A 2JB8A 5BNPA 1VBB2 1YEWA 4OZOA 1VLNA 3GJBA 1APNA 5C3PA 2NZ9A 1SLIA 4NMIA 5J36A 3R05A 5CKMA 1W05A 4BQ4A 1XYNA 2B8MA 4CCMA 5FP4A 3VD9A 3EO6A 3V56A 1CAVB 2JDNA 4RGKA 1HQWA 2P6CA 3I2OA 5CG9A 2YBPA 2LALA 3B9IA 4CP9B 5A3NA 5T54A 3QH6A 2VUAA 5GZDA 2YFZA 3RI9A 3KV9A 4CCJA 4LQRA 5A32A 1DFQA 4UW4A 3AM2A 5JIAA 5IK7A 3IBMA 1ULFA 4XF0A 3UYJA 2DFBA 2PTMA 3L2YA 1FV3A 2VQUA 3WV6A 4LOSA 2Q30A 4ES9A 1SLBA 1UO9A 3LAGA 3I2IA 1OT5A 4QDQA 1GNHA 4JC1A 2HWD1 2WFF1 1PNFA 4XOGA 3N7JA 1JXNA 3MFAA 5LW9A 1AR62 2WNEA 2ORXA 1ZRRA 4WVWA 1DYKA 1PVXA 3NJVA 5HXVA 1PIV1 2VVFA 2BERA 5AC93 4MO3M 2E7AA 5CB7A 4KBBA 4BA6A 4EYUA 1DDLA 2ATFA 1OLMA 1QJY2 4L0PA 4LLFA 2QE3A 1ZX5A 5LK7B 4UFLA 5LCWL 5FZ1A 1UIJA 2AEYA 2VZ3A 2ARBA 4AOCA 2ES3A 2ZGRA 1WMEA 4FPJA 4WVVA 1M4WA 1QGLA 1RXGA 2YPDA 2BNMA 4CUBA 3VD5A 3AKTA 3L9JT 4WZFA 4BM8A 4L8QA 3WNOA 2AACA 2FDFA 1NCQC 5F37A 5D1IA 2ZEZA 4CEWB 3ZSJA 1WBLA 4KG0A 5CFDB 4Q26A 5A7SA 3AC0A 3T1MA 2I45A 5CISA 4CEWC 2E53A 2KD7A 5FPXA 1RUE3 1PK6B 4UWDA 5CFDC 4YM0A 4TLFA 2BQPA 2GP5A 3RRDA 3W59A 2DDUA 1I5PA 4NIIA 1YUDA 2GNMA 3ALQA 1PK6C 1J3QA 1R1A3 5C9AB 1O4YA 1DCSA 1KITA 2ZCWA 2SLIA 1GOFA 1WW5A 2CWSA 4IXLA 4Q27A 5FMDA 4UFHA 4RSUA 3WF2A 3VBOB 5DDJ2 1TZOA 3JZVA 3ZSEA 1H6YA 4P9IA 3ZN6A 1H6XA 1N1TA 1HRI3 2HWF1 2J1EA 4XZUG 5HCAA 4OHWA 1YI9A 1S1AA 3VBOC 5T5PA 4QXKA 2IWGB 1DP0A 2WZ8A 4XPVA 4AE2A 4ASMB 5LWBA 2ZMNA 1GWMA 3RQ0A 1OFSA 2Y60A 1NG0A 3ZSKA 5GZGA 2E9QA 3HAGA 1N1YA 4FOYA 5A33B 2BUKA 4TSVA 1VBE2 1PVC2 1ZBE2 2HJIA 5A7PA 3CJIB 2RS53 2KM2A 4C0BA 4YZ2A 2DBIA 3LSEA 3LCPA 4IV3A 5IW0A 4Z92B 3PIGA 2XL9A 1YCIA 1REFA 1IPJA 3DGTA 2RVAA 2GNBA 3CJIC 2W1QA 2BFUL 3UL2A 4AGVA 2JDZA 1I5ZA 1OLQA 4FFFA 3VBHA 4IV1B 4BMBA 2UWCA 1PHMA 4IE5A
chains in the Genus database with same CATH topology
4IUGA 3OGVA 2Y64A 4QDSA 4Z2AA 2J7MA 5HXMA 4ZZ5A 1OH4A 3K77A 4BDVB 3A7QA 3I2GA 2Y6LA 2W1WA 3ACGA 1JZ3A 4MOAA 1XNTA 2Y8KA 1O8PA 3LPFA 3I3EA 4ET7A 4JKKA 2X05A 2DCJA 3THCA 2W95A 3PUIA 1JYXA 1TVGA 2WABA 3T2PA 1DYOA 1OF3A 1OD3A 4M4RA 1GOGA 2E31A 1JZ6A 1JU4A 4QAWA 3T0BA 2J1RA 3IIIA 5J1XA 2QQNA 2WO1A 2VCAA 1UMIA 1HN1A 5HPOA 1KEXA 3WNPA 1J84A 3NRUA 4ZZ8A 2J1SA 4DUWA 2LW8A 2ZEYA 1XC6A 3I2KA 2RV9A 2ORZA 5DPNA 4A3ZA 1UY4A 3EB7A 2VZTA 1UY3A 3NJXA 5JXJA 2WYSA 5LA0A 5LA2A 1UY0A 4PF1A 4FI9A 4P08A 3BN6A 3K75B 5C71A 3HNYM 2XQXA 4AG4A 2J1TA 3JXSA 2ZEXA 5EIYB 4GZ9A 2WN2A 2WBKA 4GWIA 1UXXX 5IJRA 4CU6A 4MADA 2R7EB 2JDAA 1BHGA 1GQPA 2EICA 4XUPA 3IAQA 4AAXA 3GGLA 2WO2A 2VQTA 4RYDA 5JXHA 1PMHX 3WF1A 1JZ5A 3VD4A 2C9KA 3I2FA 3F2ZA 2VZ1A 4UOJA 3U37A 4ARYA 2W91A 1F4HA 4QB1A 3P1IA 5LA1A 3CKHA 5JXIA 3IB3A 5DQ0A 3HN3A 1L7QA 4A6OA 5IFPA 3HNBM 2WUHA 4ZY9A 1CZSA 1UYYA 2ZEWA 3IDAA 2RJ2A 3VDCA 4D8MA 3MO4A 2VMEA 3WEZA 4ARXA 2J1VA 1K3IA 2BZDA 2J1AA 2QQOA 3I2JA 3LE0A 3T08A 3ZM8A 2VZOA 3MBWA 5IHRA 1UMHA 4QX0A 1T2XA 2B4KA 2HLEA 2WDBA 3P6BA 1EUTA 3SEPA 1NAEA 2E32A 5EJ1B 1W99A 4UAPA 4XUTA 1UY2A 2L9LA 2C4XA 4JHZA 3I97A 3HNMA 3BGAA 4ZXEA 2Z4FA 3VDAA 3E1F1 4HG6B 4P02B 2QQLA 4DXRA 3LPGA 3OEBA 1JYNA 1TG7A 1NX9A 3VD3A 1W9WA 3D3AA 1JZ8A 5G04L 2VZPA 5A1AA 4JKLA 4CU8A 2W9XA 4W4ZA 4P5YA 2BGPA 3HEIA 3THDA 4GWJA 1JI6A 2Y6JA 2W5FA 3A23A 3I2HA 1O59A 3PUHA 2QQIA 3CDZB 1K12A 2ID4A 2QBXA 2W87A 1W8OA 1US3A 1NKGA 2V4VA 3FHAA 4BJ0A 1GUIA 3NNGA 2XHNA 5C7GA 2W1UA 5IFTA 4DEVA 5CYYA 1JYVA 3NQHA 3FL7A 4MGQA 3WNLA 4E8DA 2VO5A 5F7UA 1MPXA 3K4DA 3MV01 3ECQA 3CQOA 2JD9A 4KI5M 4OUEA 4TXWA 3LEGA 2LS6A 1WCQA 3GDBA 3VD7A 1SG3A 3WNKA 3W5NA 5JR2A 4JX0A 4CVUA 4TTGA 1PX3A 4MGSA 1JZ2A 4QB6A 2CDPA 2VZQA 3T2OA 1GU3A 4XUOA 2DCKA 5I0DA 4LPLA 1P8JA 3OGRA 2VJXA 3LEIA 4QDRA 1GNYA 3I3DA 2WAOA 3C7HA 3SEEA 3DYOA 4BXSV 1SDDB 3OGSA 4DUXA 3WF3A 3T0DA 3K4AA 4CUCA 2WN3A 3W5MA 2W1SA 3MUZ1 2WAAA 2VMFA 1CIYA 2X10A 4YPJA 2VL4A 4UI9L 2Y6HA 3EYPA 3GM8A 3LQCA 4PQQA 4KWUA 4QX2A 3A21A 1DLCA 3WF0A 5JUVA 3C7FA 4LHSA 2BGOA 1UZ0A 3HOBA 3HPNA 3ABZA 4XUNA 2V72A 5JMOA 3ACHA 4A45A 4A41A 1WKYA 2VTFA 1KGYA 3OBAA 1XPWA 5IYYA 1CZVA 3VDBA 2PQSA 2E26A 3CIHA 4A4AA 1JU3A 3ACIA 2Y6GA 3MV11 2C26A 2EIEA 1W9SA 5C70A 2X09A 4W50A 1LNSA 3ETPA 2OKXA 2VC9A 2WQ8A 4XVHA 2JE8A 2W47A 3J7HA 1UYXA 1CX1A 2CDOA 2QQMA 5DN2A 2VZUA 1K42A 3C7OA 3SKJE 5DMYA 3CZJA 2W3JA 5CZKA 1OF4A 3OG2A 5B4NA 3I3BA 1L7RA 2WO3A 2VM9A 3WF4A 3A22A 1GMMA 3FN9A 1W0NA 4BK4A 3UNPA 4OMCA 4KMQA 1PX4A 1IQDC 2YC4A 1W8NA 1D7PM 2VMDA 5FUIA 4CU7A 1JZ7A 2VCCA 2VOTA 4CU9A 5B4XA 3MUY1 2VMCA 2V5DA 4D0QA 3WNMA 1YQ2A 1K45A 3C7GA 2VZSA 4RN5A 1JHJA 2BBAA 2VZRA 1RYYA 4OZOA 2XONA 3OEAA 4PT6A 2JKXA 1JYWA 3LEKA 2HYXA 4QPWA 4DEQA 3VD9A 2J1UA 2VCBA 3T2QA 1F4AA 3WSOA 3T0AA 4XURA 2YFZA 4E8CA 4CUAA 2B9VA 4LQRA 1UXZA 1US2A 2QQJA 2VQUA 2E33A 1GOHA 1UYZA 3ACFA 3I2IA 1OT5A 4QDQA 3C7EA 1ULPA 3UESA 2YFUA 2VR4A 3T09A 2ORXA 2XOMA 3NJVA 1CZTA 2W92A 1JZ4A 4DUVA 4W8JA 3DYPA 2BERA 4MO3M 2Y6KA 1W9TA 4L0PA 2EIDA 5LCWL 2VZ3A 2EIBA 3C8XA 3DYMA 1R64A 4CUBA 3VD5A 1UX7A 4DXTA 1ULOA 3WNOA 3CZUA 2W94A 4BK5A 2ZEZA 3FHQA 3HJRA 4LKSA 2YB7A 2ZXQA 3AC0A 4A44A 1EUUA 3GXUA 2KD7A 4QB2A 1O8SA 5JXGA 4OYUA 3CMGA 2DDUA 3OB8A 1I5PA 3WNNA 3DECA 3K46A 5EJZB 1GOFA 2J22A 4A42A 3WF2A 1H6YA 4M4PA 3UETA 2W46A 1H6XA 1NUKA 3WQBA 4XZUG 2J1EA 3SKVA 1XNAA 1DP0A 2WZ8A 3K4ZA 4XUQA 2YC2A 4QX1A 4OMDA 4JKMA 1PMJX 4DXSA 1J83A 2YG0A 2VZVA 3IAPA 5G05L 1SHWB 1UY1A 2WZEA 4P00B 2RVAA 2W1QA 2QQKA 4QX3A 1UWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUG A;  3OGV A;  2Y64 A;  4QDS A;  4Z2A A;  2J7M A;  5HXM A;  4ZZ5 A;  1OH4 A;  3K77 A;  4BDV B;  3A7Q A;  3I2G A;  2Y6L A;  2W1W A;  3ACG A;  1JZ3 A;  4MOA A;  1XNT A;  2Y8K A;  1O8P A;  3LPF A;  3I3E A;  4ET7 A;  4JKK A;  2X05 A;  2DCJ A;  3THC A;  2W95 A;  3PUI A;  1JYX A;  1TVG A;  2WAB A;  3T2P A;  1DYO A;  1OF3 A;  1OD3 A;  4M4R A;  1GOG A;  2E31 A;  1JZ6 A;  1JU4 A;  4QAW A;  3T0B A;  2J1R A;  3III A;  5J1X A;  2QQN A;  2WO1 A;  2VCA A;  1UMI A;  1HN1 A;  5HPO A;  1KEX A;  3WNP A;  1J84 A;  3NRU A;  4ZZ8 A;  2J1S A;  4DUW A;  2LW8 A;  2ZEY A;  1XC6 A;  3I2K A;  2RV9 A;  2ORZ A;  5DPN A;  4A3Z A;  1UY4 A;  3EB7 A;  2VZT A;  1UY3 A;  3NJX A;  5JXJ A;  2WYS A;  5LA0 A;  5LA2 A;  1UY0 A;  4PF1 A;  4FI9 A;  4P08 A;  3BN6 A;  3K75 B;  5C71 A;  3HNY M;  2XQX A;  4AG4 A;  2J1T A;  3JXS A;  2ZEX A;  5EIY B;  4GZ9 A;  2WN2 A;  2WBK A;  4GWI A;  1UXX X;  5IJR A;  4CU6 A;  4MAD A;  2R7E B;  2JDA A;  1BHG A;  1GQP A;  2EIC A;  4XUP A;  3IAQ A;  4AAX A;  3GGL A;  2WO2 A;  2VQT A;  4RYD A;  5JXH A;  1PMH X;  3WF1 A;  1JZ5 A;  3VD4 A;  2C9K A;  3I2F A;  3F2Z A;  2VZ1 A;  4UOJ A;  3U37 A;  4ARY A;  2W91 A;  1F4H A;  4QB1 A;  3P1I A;  5LA1 A;  3CKH A;  5JXI A;  3IB3 A;  5DQ0 A;  3HN3 A;  1L7Q A;  4A6O A;  5IFP A;  3HNB M;  2WUH A;  4ZY9 A;  1CZS A;  1UYY A;  2ZEW A;  3IDA A;  2RJ2 A;  3VDC A;  4D8M A;  3MO4 A;  2VME A;  3WEZ A;  4ARX A;  2J1V A;  1K3I A;  2BZD A;  2J1A A;  2QQO A;  3I2J A;  3LE0 A;  3T08 A;  3ZM8 A;  2VZO A;  3MBW A;  5IHR A;  1UMH A;  4QX0 A;  1T2X A;  2B4K A;  2HLE A;  2WDB A;  3P6B A;  1EUT A;  3SEP A;  1NAE A;  2E32 A;  5EJ1 B;  1W99 A;  4UAP A;  4XUT A;  1UY2 A;  2L9L A;  2C4X A;  4JHZ A;  3I97 A;  3HNM A;  3BGA A;  4ZXE A;  2Z4F A;  3VDA A;  3E1F 1;  4HG6 B;  4P02 B;  2QQL A;  4DXR A;  3LPG A;  3OEB A;  1JYN A;  1TG7 A;  1NX9 A;  3VD3 A;  1W9W A;  3D3A A;  1JZ8 A;  5G04 L;  2VZP A;  5A1A A;  4JKL A;  4CU8 A;  2W9X A;  4W4Z A;  4P5Y A;  2BGP A;  3HEI A;  3THD A;  4GWJ A;  1JI6 A;  2Y6J A;  2W5F A;  3A23 A;  3I2H A;  1O59 A;  3PUH A;  2QQI A;  3CDZ B;  1K12 A;  2ID4 A;  2QBX A;  2W87 A;  1W8O A;  1US3 A;  1NKG A;  2V4V A;  3FHA A;  4BJ0 A;  1GUI A;  3NNG A;  2XHN A;  5C7G A;  2W1U A;  5IFT A;  4DEV A;  5CYY A;  1JYV A;  3NQH A;  3FL7 A;  4MGQ A;  3WNL A;  4E8D A;  2VO5 A;  5F7U A;  1MPX A;  3K4D A;  3MV0 1;  3ECQ A;  3CQO A;  2JD9 A;  4KI5 M;  4OUE A;  4TXW A;  3LEG A;  2LS6 A;  1WCQ A;  3GDB A;  3VD7 A;  1SG3 A;  3WNK A;  3W5N A;  5JR2 A;  4JX0 A;  4CVU A;  4TTG A;  1PX3 A;  4MGS A;  1JZ2 A;  4QB6 A;  2CDP A;  2VZQ A;  3T2O A;  1GU3 A;  4XUO A;  2DCK A;  5I0D A;  4LPL A;  1P8J A;  3OGR A;  2VJX A;  3LEI A;  4QDR A;  1GNY A;  3I3D A;  2WAO A;  3C7H A;  3SEE A;  3DYO A;  4BXS V;  1SDD B;  3OGS A;  4DUX A;  3WF3 A;  3T0D A;  3K4A A;  4CUC A;  2WN3 A;  3W5M A;  2W1S A;  3MUZ 1;  2WAA A;  2VMF A;  1CIY A;  2X10 A;  4YPJ A;  2VL4 A;  4UI9 L;  2Y6H A;  3EYP A;  3GM8 A;  3LQC A;  4PQQ A;  4KWU A;  4QX2 A;  3A21 A;  1DLC A;  3WF0 A;  5JUV A;  3C7F A;  4LHS A;  2BGO A;  1UZ0 A;  3HOB A;  3HPN A;  3ABZ A;  4XUN A;  2V72 A;  5JMO A;  3ACH A;  4A45 A;  4A41 A;  1WKY A;  2VTF A;  1KGY A;  3OBA A;  1XPW A;  5IYY A;  1CZV A;  3VDB A;  2PQS A;  2E26 A;  3CIH A;  4A4A A;  1JU3 A;  3ACI A;  2Y6G A;  3MV1 1;  2C26 A;  2EIE A;  1W9S A;  5C70 A;  2X09 A;  4W50 A;  1LNS A;  3ETP A;  2OKX A;  2VC9 A;  2WQ8 A;  4XVH A;  2JE8 A;  2W47 A;  3J7H A;  1UYX A;  1CX1 A;  2CDO A;  2QQM A;  5DN2 A;  2VZU A;  1K42 A;  3C7O A;  3SKJ E;  5DMY A;  3CZJ A;  2W3J A;  5CZK A;  1OF4 A;  3OG2 A;  5B4N A;  3I3B A;  1L7R A;  2WO3 A;  2VM9 A;  3WF4 A;  3A22 A;  1GMM A;  3FN9 A;  1W0N A;  4BK4 A;  3UNP A;  4OMC A;  4KMQ A;  1PX4 A;  1IQD C;  2YC4 A;  1W8N A;  1D7P M;  2VMD A;  5FUI A;  4CU7 A;  1JZ7 A;  2VCC A;  2VOT A;  4CU9 A;  5B4X A;  3MUY 1;  2VMC A;  2V5D A;  4D0Q A;  3WNM A;  1YQ2 A;  1K45 A;  3C7G A;  2VZS A;  4RN5 A;  1JHJ A;  2BBA A;  2VZR A;  1RYY A;  4OZO A;  2XON A;  3OEA A;  4PT6 A;  2JKX A;  1JYW A;  3LEK A;  2HYX A;  4QPW A;  4DEQ A;  3VD9 A;  2J1U A;  2VCB A;  3T2Q A;  1F4A A;  3WSO A;  3T0A A;  4XUR A;  2YFZ A;  4E8C A;  4CUA A;  2B9V A;  4LQR A;  1UXZ A;  1US2 A;  2QQJ A;  2VQU A;  2E33 A;  1GOH A;  1UYZ A;  3ACF A;  3I2I A;  1OT5 A;  4QDQ A;  3C7E A;  1ULP A;  3UES A;  2YFU A;  2VR4 A;  3T09 A;  2ORX A;  2XOM A;  3NJV A;  1CZT A;  2W92 A;  1JZ4 A;  4DUV A;  4W8J A;  3DYP A;  2BER A;  4MO3 M;  2Y6K A;  1W9T A;  4L0P A;  2EID A;  5LCW L;  2VZ3 A;  2EIB A;  3C8X A;  3DYM A;  1R64 A;  4CUB A;  3VD5 A;  1UX7 A;  4DXT A;  1ULO A;  3WNO A;  3CZU A;  2W94 A;  4BK5 A;  2ZEZ A;  3FHQ A;  3HJR A;  4LKS A;  2YB7 A;  2ZXQ A;  3AC0 A;  4A44 A;  1EUU A;  3GXU A;  2KD7 A;  4QB2 A;  1O8S A;  5JXG A;  4OYU A;  3CMG A;  2DDU A;  3OB8 A;  1I5P A;  3WNN A;  3DEC A;  3K46 A;  5EJZ B;  1GOF A;  2J22 A;  4A42 A;  3WF2 A;  1H6Y A;  4M4P A;  3UET A;  2W46 A;  1H6X A;  1NUK A;  3WQB A;  4XZU G;  2J1E A;  3SKV A;  1XNA A;  1DP0 A;  2WZ8 A;  3K4Z A;  4XUQ A;  2YC2 A;  4QX1 A;  4OMD A;  4JKM A;  1PMJ X;  4DXS A;  1J83 A;  2YG0 A;  2VZV A;  3IAP A;  5G05 L;  1SHW B;  1UY1 A;  2WZE A;  4P00 B;  2RVA A;  2W1Q A;  2QQK A;  4QX3 A;  1UWW A; 
#chains in the Genus database with same CATH topology
 4CCE A;  3OGV A;  3GHN A;  5J3U A;  3BKZ A;  2J7M A;  5HXM A;  3NV1 A;  1WD3 A;  2PHX A;  3RPQ A;  3WUC A;  5CEH A;  1R08 2;  1PZ7 A;  3AMQ A;  1ZRF A;  1GZW B;  3A7Q A;  4COW A;  4MV2 A;  1LHV A;  4JRA A;  3WDU A;  4F7Z A;  5KXD A;  1NA1 B;  4CPB D;  1QJZ A;  2DVF A;  4XHB A;  5C5U A;  2Y0I A;  5IK4 A;  1K5J A;  5JR7 B;  1W2U A;  2ZA9 A;  4Y20 B;  2BV4 A;  1JMU B;  5FZ7 A;  5FRE A;  3SLI A;  1FOD 1;  4MUV A;  1NA1 C;  5CKQ A;  1TVG A;  1ZYB A;  5JPN B;  1TMF 3;  1DYO A;  5FUN A;  2XVL A;  5T5O A;  1A6C A;  2E31 A;  4HPK B;  4NPM A;  5LBC A;  1JZ6 A;  1H1A A;  3O1M A;  3RZL A;  2R06 3;  5AVA A;  2C5D A;  2VTX J;  2XGX A;  1ZBA 3;  2AZ5 A;  5J1X A;  2VCA A;  2OW4 A;  2YDE A;  3ZLI A;  3ETQ A;  1RGS A;  1UMI A;  1JOJ A;  2P6H A;  3EJK A;  1CAV A;  1NQD A;  3K3O A;  4LHK A;  4YW3 A;  4AEM A;  5HPO A;  5J37 A;  3GNE A;  2RJL A;  2Y26 A;  1N1S A;  2PYT A;  1RUI 2;  3B9C A;  4N53 B;  2VAU A;  4QQH A;  1RVF 2;  3VBS B;  4CP9 A;  5BY5 A;  3GZU C;  3UGH A;  1CWP A;  4Z1V A;  4IEP A;  5FZM A;  4O7X A;  1C8M 1;  2G1M A;  1Q8V A;  3D8C A;  3N3H A;  4W6X A;  3VBS C;  3ZSL A;  4QM9 A;  2ORZ A;  2ZX4 A;  1SFN A;  3HWJ A;  3ZMO A;  5JOZ A;  3C3V A;  3EB7 A;  1H9P A;  3D6E A;  1RB8 G;  1UY3 A;  1W03 A;  1W2T A;  2WYS A;  3AP7 A;  5LA2 A;  1UY0 A;  3ZYI B;  1Y9G A;  4NE9 A;  5FWE A;  4JGY B;  3BN6 A;  1W3X A;  2O1Q A;  4URA A;  5C71 A;  1QMJ A;  2XQX A;  1BBT 2;  3EHK A;  3NNJ A;  2J1T A;  3JXS A;  4LBJ A;  5JOW A;  4BLJ A;  4AVC A;  3ZYJ B;  3OY8 B;  4Z8B A;  5EPA A;  4JGY C;  4AHX A;  1AYM 3;  5FPV A;  3RZZ A;  1O4T A;  1X33 A;  4GWI A;  3DV8 A;  3CHX A;  3S0M A;  2PHD A;  4KL1 A;  5BNO C;  5BNN B;  4AEK A;  2ADE A;  4A7K A;  1OPM A;  3MI8 A;  4LMF A;  1OQE A;  2JDA A;  4UBG A;  2P4E A;  4E2S A;  2UY8 A;  4EZ4 A;  3MYX A;  3AL6 A;  4XUP A;  3IAQ A;  1WLC A;  2WO2 A;  4QQP A;  3WQ1 A;  2W0X A;  3JCI A;  4CTE A;  5A1F A;  5BXX A;  1PMH X;  5GZE A;  3WF1 A;  3VD4 A;  3FBY A;  1GFF 2;  3AJY A;  4AZZ A;  5IVE A;  4UOJ A;  4MXW A;  1GQG A;  1YQ8 A;  4BQX A;  1CPN A;  1IKP A;  4UFK A;  3ZXA C;  4CEW A;  1VE0 A;  5CFD A;  4ITC A;  2B7Y A;  2EXH A;  2RHP A;  2RMU 1;  4QB1 A;  3WG3 A;  5IVF A;  3P1I A;  4FFI A;  4CSW A;  1HDK A;  3UKT A;  3CKH A;  3ZXD A;  4CCK A;  1CVN A;  2DWR A;  1H8V A;  5JXI A;  4NJ4 A;  2XR4 A;  1PK6 A;  4NIG A;  5DAW A;  4XW3 A;  4FPC A;  1FPN 1;  3HNB M;  4YM2 A;  1VMH A;  1I9R A;  1O7F A;  2JEN A;  1UYY A;  3LD8 A;  2ARA A;  5L9B A;  4YYO A;  1XB9 A;  1HB1 A;  4GMP 0;  2CNA A;  4X6Q B;  4BQ1 A;  3IDA A;  2A3X A;  1EYB A;  3VZL A;  2RJ2 A;  2BRT A;  1QH6 A;  2CY6 A;  3T3Y A;  2RS3 1;  4ARX A;  2BZD A;  3I2J A;  3VBO A;  1HXS 1;  2VZO A;  1Z7S 2;  3OSD A;  5IHR A;  1UMH A;  5TSW A;  4TZD A;  1NQJ A;  4LE3 A;  4U36 A;  2HLE A;  3AP5 A;  2ZAB A;  1XE8 A;  2GAU A;  3NAP C;  1X9T A;  3SEP A;  3U14 A;  5LEK A;  3AYC A;  1N3P A;  3PUQ A;  5FPL A;  1EAH 3;  1FMD 3;  4D6R A;  3K3N A;  4XUT A;  3FC0 A;  1UY2 A;  4J1W A;  4XQ4 A;  4GB3 3;  3FFZ A;  4LO6 B;  4XF1 A;  1Q8S A;  1ULG A;  2RS1 1;  2OQ7 A;  1C5I A;  4ZKT B;  3J7N A;  5A33 A;  4N7U A;  4ZXE A;  3U78 A;  4FFG A;  2JEC A;  2Z4F A;  1C1L A;  2YMZ A;  1V9U 2;  3CJI A;  4P02 B;  4BOW A;  1ND3 C;  3TN9 2;  4CP1 A;  2BW8 A;  2OA2 A;  2P1B A;  4JDM A;  2YGL A;  4COZ A;  4XJW A;  4ZHN A;  3CLP A;  4Q8K A;  4HVQ A;  3NWK A;  1OKQ A;  1RJ8 A;  1VB2 A;  3Q8F A;  3DPR B;  1NX9 A;  2X53 S;  4LHL A;  4OHZ A;  4IV1 A;  3VHR A;  5C3Q A;  4EZH A;  2VZP A;  3SXW A;  4IET A;  1F15 A;  1AZD A;  2GU9 A;  1WMD A;  2W9X A;  3OBR A;  4P5Y A;  4W4Z A;  1HJG A;  2BGP A;  3HEI A;  3O1U A;  1AXK A;  4GWJ A;  2JE9 A;  2VH9 A;  5LEJ A;  3H8R A;  3A23 A;  2W5F A;  3I2H A;  1O59 A;  3U4S A;  2FCT A;  4Y4Y A;  1M06 G;  1JBC A;  3JBG 2;  2C0Z A;  1UZZ A;  3BCW A;  2VMG A;  3HR9 A;  5ANQ A;  4PHZ A;  5H9P A;  3ZPY A;  4CDX C;  1NA1 A;  4XFI A;  1VBC 3;  4L92 A;  4YG6 A;  1K12 A;  3TNP B;  2XPJ A;  1W8O A;  1US3 A;  4XTM A;  1D2Q A;  5C8C B;  3M7A A;  1QDO A;  4LOR A;  2V4V A;  3PVN A;  2FHR A;  2XHN A;  2I2S A;  5IFT A;  3RZK A;  2DTY A;  3JB8 A;  4DEV A;  3NMB A;  5C8C C;  5KXE A;  4OUL A;  5CYY A;  2RM2 2;  3VZK A;  1R09 1;  3FL7 A;  3RI8 A;  1NCR C;  4XBQ A;  4MGQ A;  4NHK A;  1H1M A;  4HPK A;  3NNL A;  4LXL A;  3O0W A;  1PO2 3;  2VO5 A;  3TOJ A;  3M3C A;  3RZH A;  5F7U A;  4NHY A;  3K4D A;  4HOO A;  3ZFF C;  3KM5 A;  2Y0O A;  2VOW A;  2WA4 A;  4AHY A;  4PIZ A;  2GZW A;  4TXW A;  5M0T A;  4IE4 A;  4GWN A;  3O12 A;  1AL2 3;  1QEX A;  3VBS A;  1SG3 A;  2YXS A;  1NXD 1;  3FLR A;  3ZN5 A;  5FYT A;  4PDW C;  5KHG A;  1YO8 A;  5F8P A;  2ZPX A;  4AVT A;  4Q2F A;  5D8A B;  1ASJ 2;  4B4Q A;  2VZQ A;  1VR3 A;  1GU3 A;  1RUC 2;  1V6L A;  5FZD A;  1O3S A;  3A4U A;  1C28 A;  4FOV A;  4JDN A;  2D6P A;  4NVP A;  2PLV 2;  3KVB A;  4R9A A;  5FRA A;  2YU1 A;  3OGR A;  1ULC A;  1RUG 3;  3D5O A;  5D8A C;  4JGY A;  2Z79 A;  4Q4X 3;  2VJX A;  3AYA A;  5FOB B;  1AYN 3;  5CAZ A;  1Y7B A;  1O4Z A;  1I3H A;  1AR7 2;  3RJR A;  3SIS A;  1RUN A;  4Q4W 2;  3OY8 A;  4WVM B;  1YHF A;  1QJU 2;  1OOP C;  2ZX2 A;  4BZ4 A;  1SDD B;  2K46 A;  1CN1 A;  2P5B A;  3OGG A;  4Q8L A;  3OGS A;  2H6C A;  5GAL A;  1PO1 3;  4DUX A;  5CAD A;  3K4A A;  1LTE A;  4CUC A;  5BNN A;  5KXC A;  1WLT A;  3NV2 A;  4J6G A;  5EQU A;  2VNG A;  4CXX A;  5J09 A;  5E6H A;  4LE4 A;  3VLB B;  1F31 A;  2X10 A;  5BPX A;  3RNS A;  3ZDS A;  2VL4 A;  2X29 A;  5LZ6 A;  3PJY A;  5A3W A;  2Y6H A;  3K51 A;  4XIO A;  3BPS A;  3FLT A;  5JSR A;  3QOP A;  1B35 B;  4WM7 C;  3B00 A;  4BQY A;  1AVB A;  2IXK A;  3D4K A;  1Q8P A;  3BOW A;  2ZZQ A;  3OJB A;  5FP3 A;  3WF0 A;  1VBB 3;  1OD5 A;  3C7F A;  4LKD A;  1FAT A;  5IK8 A;  3FHI B;  5CKN A;  3WDT A;  3N7L A;  1QNY A;  5JMO A;  5K9Y A;  1HW5 A;  1MQT B;  1OSG A;  3WCS A;  3RZJ A;  4F8A A;  3H7J A;  1IS3 A;  4JTO A;  1KGY A;  1X9P A;  2DVD A;  3OBA A;  1UW8 A;  2AEZ A;  2BDR A;  5FYS A;  1MZE A;  3MIH A;  3RYK A;  5LRR A;  4Q29 A;  2QQP A;  1YRZ A;  5LA9 A;  3ACI A;  2ZX0 A;  3OOX A;  3UJQ A;  3HT2 A;  3IDB B;  4RHV 1;  1DGR N;  2C26 A;  1NOV A;  2DCT A;  5T50 A;  5A6Q A;  3OUH A;  4GKY A;  1LEN A;  1YNA A;  4CYD A;  2X09 A;  2HWE 3;  4YM3 A;  1ENX A;  3H3L A;  3U10 A;  3IN9 A;  2D44 A;  5E1R A;  5HCH A;  2VC9 A;  2WQ8 A;  4LK6 A;  1AR6 3;  1SBD A;  2Q8D A;  4H7M A;  2E51 A;  2JX9 A;  2K9Z A;  2QDN A;  2W52 A;  3POJ A;  1ZRD A;  2QQM A;  1CX1 A;  4GKX A;  1I6X A;  3OF1 A;  4IND A;  3CZJ A;  1QXR A;  4XTP A;  4YFZ A;  3U4X A;  1RHI 1;  1W6P B;  2QQV A;  5FK7 A;  1QJY 3;  3NKG A;  1G9D A;  2XBO 3;  2ZGU A;  2ZKL A;  4KG8 A;  1L7R A;  4QX5 A;  3N9O A;  2VM9 A;  1WMF A;  4BIO A;  2UY9 A;  2Z5W A;  3PJQ A;  4GAZ A;  5FZI A;  4DFS A;  4AL9 A;  1SLT A;  4BQ2 A;  1QH7 A;  3S57 A;  3DPR A;  3ZXF A;  3H1Y A;  1LKN A;  5FPB A;  3ZKY A;  2IC1 A;  2CGO A;  1W2O A;  1C57 A;  4BE3 A;  2EF6 A;  1UZY A;  1NXM A;  3MDP A;  1IPS A;  2VBB A;  3CL1 A;  3MLJ A;  2ZOE B;  1PX4 A;  1G6N A;  1RUF 3;  2R1B A;  1XQN A;  3HMY A;  3LA7 A;  1U5I A;  4G3Y C;  3AMM A;  4QXH A;  5GM0 A;  2YC4 A;  1W8N A;  1D7P M;  4FTS A;  2IVJ A;  2OPW A;  1T6B X;  2VMD A;  5FCC A;  3VHP A;  2XWB B;  4XE9 A;  3ZYF A;  5IUQ A;  1QJF A;  1W0P A;  2A5Z A;  4DRV A;  2PHW A;  3ZXE A;  2WIN B;  4LK7 A;  4EJR A;  4AFB A;  3MUY 1;  1S2E A;  4I01 A;  4B4P A;  3WNM A;  3C7G A;  2HWD 2;  2WFF 2;  4RN5 A;  5C8C A;  1QXP A;  2BBA A;  2VOK A;  3QAC A;  4M0H A;  1TEI A;  3LGR A;  3H0O A;  5DAP A;  5H9S A;  5JWP A;  3NKT A;  5SV8 A;  4XJU A;  4K7J A;  4DMI A;  4PT6 A;  4CDW B;  2V73 A;  1PIV 2;  1JYW A;  2D3S A;  2UYB A;  1HIX A;  4QPW A;  4Y24 A;  3E5Q A;  4DEQ A;  1WCU A;  2J1U A;  5FLI A;  1HV1 A;  4K8R B;  4Z82 A;  2VQ0 A;  2NM1 A;  3RZM A;  1Q5O A;  4XUR A;  3U07 A;  2B9V A;  1HKD A;  1QF3 A;  2XJU A;  3WG2 A;  2GMP A;  1UXZ A;  2A73 B;  2QQJ A;  2YUE A;  4FOQ A;  5E8A A;  3TEX A;  4CDQ B;  3ZXL A;  4LA2 A;  1GOH A;  4DB5 A;  2X5I B;  1VBE 3;  1PVC 3;  1ZBE 3;  1PGW 1;  5A6Y A;  1XYP A;  3C7E A;  2VNR A;  4WVZ A;  2WT0 A;  4HET A;  2X5I C;  3PTY A;  2VGD A;  2O8Q A;  3JQW A;  5D8A A;  3UES A;  3VKN A;  3AX4 A;  4YZ4 A;  4BPZ A;  3T09 A;  1ZRC A;  2PA7 A;  5FY1 A;  5FY5 A;  1LGC A;  2RR1 1;  4PI0 A;  3DF0 A;  5DAB A;  3DYP A;  1YWK A;  5A7O A;  1FV2 A;  1W6N B;  5AFE A;  3B7M A;  5LAS A;  3ILN A;  4C1W A;  3AP9 A;  1W6M B;  4QQ2 A;  4WVM A;  4CCO A;  1POV 0;  4ASK A;  4HON A;  1R08 3;  3AVS A;  5JI7 A;  4HZF A;  4DO0 A;  3D0J A;  1DQ4 A;  2HWB 1;  1LB2 A;  1ZA4 A;  1WA6 X;  1FNZ A;  1R64 A;  1RUH 3;  3DYM A;  3LKJ A;  3P5B A;  4WM7 A;  4DIQ A;  1GP5 A;  2HWF 2;  3PNA A;  1UX7 A;  2NQY A;  2XWJ B;  2GMM A;  3RWN A;  4P9W A;  3KQ4 B;  4CCL A;  1B35 A;  3D0S A;  4UF0 B;  1OI6 A;  3FHQ A;  1W39 A;  4E4H A;  4LKS A;  1J1L A;  3M1H A;  2HYK A;  5FY4 A;  4FAG A;  4MH0 E;  5FY8 A;  1ZRE A;  1HRI 1;  4ONU A;  4A44 A;  4UBH A;  1WW6 A;  4ATF A;  3OTF A;  3PUR A;  5FDB A;  2P3I A;  3DCQ A;  3LIG A;  5IK5 A;  1OUS A;  2HWC 1;  4YGE A;  2B46 X;  4AI1 A;  1MQT A;  1O8S A;  4OYU A;  3CMG A;  4LNV A;  2YZ4 A;  2XKP A;  1SCS A;  4OQ8 A;  3DL3 A;  1YQ5 A;  2HKX A;  1RUI 3;  5EV7 A;  2BBV A;  1RVF 3;  3ITQ A;  5EJZ B;  5FK8 A;  4MGT A;  1H2L A;  3E6B A;  1HX6 A;  2WS9 1;  1UN1 A;  3AYE A;  3IMN A;  2A70 A;  5JPM B;  2V5Y A;  1KRI A;  4NRQ A;  2P3K A;  4M4P A;  1LHO A;  1V70 A;  3N9Q A;  4HKL A;  3R4S A;  5KHI A;  5F3E A;  4ATE A;  3JUU A;  1XNA A;  3SKV A;  5J7M A;  4XUQ A;  3FX3 A;  1H1I A;  4YGD A;  1OA3 A;  2IXI A;  2QJV A;  1GKB A;  2P17 A;  4KBZ A;  1BBT 3;  4Q5O A;  2O8O A;  1PMJ X;  3VKF C;  4AVV A;  1TME 1;  1SFP A;  1QWR A;  2YG0 A;  4UFJ A;  3APB A;  5HCB A;  3IAP A;  1FOD 2;  1W6P A;  2Z42 A;  3V65 A;  1H0B A;  4COV A;  4FQZ A;  4NHM A;  5G05 L;  2A6W A;  1SHW B;  5FV3 A;  4Y1U A;  4I09 A;  5JZG B;  5FZE A;  2QQK A;  1UOG A;  4N9H A;  1UWW A;  3J9S A;  4PIY A;  2A1X A;  4Y26 A;  2CTV A;  2BOJ A;  5GLT A;  4QDS A;  1N47 A;  3TWI A;  1YJK A;  2PMW B;  5JZG C;  4R52 A;  3PL0 A;  4Y3O A;  1WGP A;  1VBA 3;  2D5H A;  4E4D X;  1ZA7 A;  3H8X A;  3POI A;  4D7Y A;  3K77 A;  1ZBA 1;  4HK9 A;  3H8U A;  2W1W A;  3RWK X;  2UWB A;  1JZ3 A;  1XNT A;  1C8M 2;  4FPF A;  2MNG A;  2Y8K A;  2YC0 A;  3LPF A;  1UF2 C;  3W20 A;  2A71 A;  4AQT A;  2R16 A;  4JKK A;  5GLW A;  2X05 A;  2DCJ A;  2DV9 A;  2PHT A;  2CU5 A;  2E7T A;  2WAB A;  4XDO A;  3T2P A;  4KH9 A;  5FQ0 B;  2XJV A;  3O0V A;  4H3W A;  1RIT A;  1OF3 A;  1QQP 1;  4Y1X A;  1POV 1;  2ZHN A;  1OHF A;  3VZO A;  1H4H A;  1IS6 A;  1E5R A;  3WY6 A;  1SAC A;  1RMU 1;  4BB3 A;  4CDW A;  1HRV 1;  1Z7S 3;  2OII A;  3I54 A;  2QQN A;  3ZXJ A;  1BJQ A;  3P3P A;  5FZ4 A;  4DY5 A;  4XMA A;  3FWE A;  2GC0 A;  1J84 A;  4YRD A;  3ZPO A;  3LSD A;  3GCW A;  2J1S A;  1JW6 A;  1XOY A;  4H55 A;  2CHH A;  3VBU B;  5DZF A;  3VKL A;  1AR9 1;  3I2K A;  4DQA A;  1OH3 A;  2WKK A;  5DAV A;  4CDQ A;  1EPZ A;  1RUJ 3;  5FZF A;  5LB6 A;  1W6O B;  2X5I A;  2WNU B;  4NIH A;  2IFW A;  3FJS A;  5FYY A;  3POY A;  4J1X A;  5JIU A;  1A3K A;  1V9U 3;  1VRB A;  1RIN A;  1W8H A;  2GSY A;  2VZT A;  3LDK A;  3SCF A;  3TN9 3;  4QM8 A;  5JXJ A;  3N35 A;  4RR3 B;  3G7D A;  1O3T A;  2CGN A;  4CDU B;  5JMC A;  3OPW A;  1RTV A;  5E89 A;  2WNU C;  5LA0 A;  3MEP A;  4B1M A;  2RMU 2;  5F6K A;  3ZXG A;  1VP6 A;  1CIW A;  2D6N A;  1S0J A;  5A7W B;  3NST A;  4OLL A;  3HNY M;  5FKC A;  4CP2 A;  4CDU C;  2ZEX A;  2ZHK A;  4G4F A;  4GH4 B;  4ORF A;  1DZR A;  1FPN 2;  4SLI A;  2WN2 A;  2BOI A;  1UU6 A;  2PN5 A;  3J8F 1;  4E2Q A;  2BPA 2;  4JQR A;  2OPK A;  4OI2 A;  2ZAH A;  3NL1 A;  4IDZ A;  1W6M A;  4IE7 A;  3BTA A;  3ORJ A;  1UL9 A;  4YW1 A;  1C8N A;  2R7E B;  2WWS A;  3USS A;  2BWC A;  3JBG 3;  3N9P A;  2XKO A;  4YFW A;  3KV5 A;  2RS3 2;  4UW5 A;  5JSO A;  3O1R A;  1HXS 2;  1OFN A;  4DIN B;  4YNI A;  5FPA A;  4FO9 A;  5FYZ A;  1VPH A;  1E5S A;  2C9K A;  4FOW A;  2V09 A;  1AXZ A;  3I2F A;  4UF0 A;  3VHO A;  4I0A A;  4ARY A;  1DGR A;  2RM2 3;  1YIP A;  4S2G A;  4GD4 A;  1F4H A;  2KR2 A;  1LCL A;  5KHH A;  2RS1 2;  1W2N A;  1OXC A;  3IB3 A;  2HH9 A;  1L7Q A;  1S0E A;  3WP6 A;  4A6O A;  3UJO A;  3URF A;  3AKR A;  2C1F A;  4R4Z A;  3SQO A;  4YZ1 A;  4EWE A;  1YXW A;  3AXE A;  3ZYH A;  1BK0 A;  1ZZ9 A;  3RS6 A;  5C9A C;  3GYD A;  3ZO0 B;  5FO9 B;  3LDR A;  1X36 A;  3THP A;  1V6I A;  2D7F A;  2EXI A;  4Q0Q A;  5EYY A;  3WDW A;  5GLU A;  2VME A;  4B4R A;  4CEY B;  2J1V A;  2VG9 A;  1K3I A;  3LE0 A;  3N4M A;  3T08 A;  3ZM8 A;  1TNR A;  4COU A;  1MAC A;  4LBQ B;  1T2X A;  2B4K A;  1J3R A;  4AGR A;  1GIC A;  1SBE A;  1RUC 3;  3NNM A;  2WDB A;  4YGB A;  4F83 A;  1PM7 A;  1EUT A;  1D0H A;  1FNY A;  1H2N A;  1MVE A;  3JB4 C;  2ETE A;  2OX0 A;  1NAE A;  2E32 A;  4HXC A;  4ZS2 A;  4W6W A;  4GA9 A;  4JQT A;  2WWU A;  2L9L A;  2C4X A;  1C5H A;  2TBV A;  3FLP A;  3I97 A;  4X8N A;  3WZ1 A;  5C3R A;  3DXU A;  3RVH A;  1JUI A;  4Q4W 3;  1QJU 3;  2Q8E A;  2VXR A;  5I8T A;  2QQL A;  2NP0 A;  5FP9 A;  2OYZ A;  4PF5 A;  1VBC 1;  1R09 2;  3O7O A;  2R1D A;  2AC1 A;  3MPB A;  3SC7 X;  1JYN A;  1TG7 A;  1ZNP A;  3ENR A;  5D2A A;  4BYY A;  4IV1 C;  3VD3 A;  3WG1 A;  5JZG A;  2R49 A;  2GH2 A;  4IGQ A;  4AQS A;  2D97 A;  4K21 A;  5C6C A;  2XVG A;  4EV0 A;  5F32 A;  5ACA 1;  3ZX7 A;  4BU2 A;  4IL7 A;  4PI2 A;  1DIW A;  2WC2 A;  1U0A A;  4AAP A;  2WRA A;  5FXZ A;  1QJX 1;  2QCS B;  5C5T A;  4URT A;  2AEN A;  3MW2 A;  4MG2 A;  3ZXK A;  2VW0 A;  4Q0P A;  3ON7 A;  3JQX A;  1KD7 A;  2WNO A;  2DVG A;  5A3P A;  2QBX A;  1PGS A;  2W87 A;  4B3N A;  4A7Z A;  3I8T A;  4R9B A;  4HFS A;  4YW7 A;  4K20 A;  2K2S A;  3ZMN A;  3FHA A;  3AZX A;  1GUI A;  2ZGL A;  3CF6 E;  3MIG A;  2W1U A;  3PVB B;  1MEC 3;  4AI8 A;  5FY9 A;  5FQ0 A;  5FMC A;  1RUO A;  1QHD A;  2Q0A A;  2MEV 1;  1MZ5 A;  4QX8 A;  5LRS A;  3NQH A;  3H7Y A;  3HBK A;  4Q4Y 1;  4CE8 A;  3JD7 1;  2XH6 A;  4XFC A;  1QOT A;  1LOG A;  1I1E A;  1AR8 3;  1MPX A;  3MV0 1;  3R4U A;  3FE5 A;  5F5A A;  2JD9 A;  4ZU4 A;  2FDH A;  3P3N A;  2QFE A;  4OUE A;  3I49 A;  5FBJ A;  4HMZ A;  4N53 C;  1AYN 1;  4QMA A;  3LWC A;  5EJ3 A;  1GLH A;  3PVE A;  3VD7 A;  3KCC A;  2B42 B;  1JTZ X;  2XML A;  3W5N A;  1GP6 A;  5APA A;  3U75 A;  3BIW E;  4IE0 A;  5D21 A;  1CAU B;  5JR2 A;  1GZC A;  2WT1 A;  4JX0 A;  3NW4 A;  4JCK A;  4LHN A;  1NY7 1;  3S7I A;  2HEV F;  3ZIW A;  1W6O A;  5HV4 A;  4MGS A;  2WNU A;  2PQQ A;  2XVK A;  1OQD A;  4QB6 A;  3VDD B;  3H3Z A;  2UWA A;  5JVV A;  5JDB A;  4XFB A;  4RR3 A;  5K8S A;  4CDU A;  4RGA A;  2XJT A;  3BYW A;  4XHX A;  3VDD C;  3WNX A;  3KSC A;  5A7W A;  3S5Q A;  5FAX A;  5FP7 A;  4PBO A;  4O61 A;  3I3D A;  4FPE A;  1ODN A;  4QGN A;  1LOC A;  4GH4 A;  4XIL A;  2AYH A;  3UGG A;  1NLR A;  5A6X A;  4LO4 B;  2WII B;  2G4I A;  2ILM A;  2D6O X;  4GUL A;  5BNN C;  5IAV A;  3WF3 A;  3T0D A;  4XET A;  3W5M A;  4RHV 2;  4XAE A;  1W8T A;  5CIR A;  5FZC A;  1HQL A;  1QOS A;  5J96 B;  4KNC A;  1UKG A;  2NMN A;  3PHM A;  5F5I A;  4P5H A;  2IUW A;  1XYO A;  2VMF A;  3KF3 A;  2P3Y A;  3QH7 A;  1X8E A;  2ARE A;  5IVB A;  4Y5S A;  4CCD A;  4RD7 A;  2HWD 3;  2WFF 3;  2WZR 1;  4BIS A;  2JD4 A;  1KJR A;  2OQ6 A;  3RYR A;  4AVS A;  3LF7 A;  4QX2 A;  2JIC A;  2R04 3;  5FZA A;  2OXB A;  5A70 A;  3SH3 A;  2HWE 1;  3W58 A;  4LT5 A;  1PIV 3;  3POF A;  3HPN A;  4AED B;  4O65 A;  1AF9 A;  4FPY A;  3KLS A;  4QHB A;  3MFC A;  4Y1Y A;  3WDV A;  5FZK A;  4RFT 0;  1RHI 2;  4MYE A;  5GZF A;  4A45 A;  5C9A A;  1WKY A;  1VAK A;  5IYY A;  1CZV A;  3BU7 A;  3SIT A;  4AED C;  3VDB A;  3O1S A;  1IQA A;  4MGZ E;  4BQ5 A;  1JU3 A;  1DQ0 A;  2H6B A;  4XFG A;  1A8M A;  1UKR A;  3HT1 A;  1BK1 A;  4IEU A;  4MXV A;  3H50 A;  1VRH 1;  2EIE A;  5A7N A;  1IG0 A;  2XBO 1;  3H9A A;  3K48 A;  3KT1 A;  2H0V A;  3CEW A;  4FVV A;  4GJY A;  2JG9 B;  4NWV A;  5IAT A;  1EV1 2;  2F6B A;  2UYA A;  5ERL A;  4E4Z A;  4LBQ A;  2GC1 A;  5F3C A;  2CV6 A;  2JE8 A;  2WSU A;  1XNC A;  3N9N A;  3AJZ A;  4EWA A;  1LR5 A;  2D98 A;  2O0O A;  3J7H A;  1UYX A;  5I91 A;  2CDO A;  2FZ1 A;  2TNF A;  5FY7 A;  3ZDV A;  4B1L A;  4NID A;  5JOX A;  4WM8 B;  5FPZ A;  3GBW A;  1XU1 A;  1A78 A;  3C7O A;  4OHV A;  1RUF 1;  1QU0 A;  3HQR A;  5HV0 A;  5B4N A;  1AX2 A;  1OF4 A;  5F9T A;  3I3B A;  3OBZ A;  2OT7 A;  4MHU A;  3WQ0 A;  2DUQ A;  4DS0 A;  4TN7 A;  2XLG A;  2ZX1 A;  4WM8 C;  2WO3 A;  4O9G A;  1G9A A;  3RJ2 X;  1AX1 A;  3A22 A;  1MS0 A;  4XJ9 A;  1J58 A;  4NHX A;  1GMM A;  5K4L A;  3DPR C;  3FN9 A;  4XJZ A;  1N3Q A;  2Y33 A;  2HBT A;  3IIA A;  4I3G A;  3UNP A;  2HWF 3;  5DG2 A;  3T4H B;  1DQ5 A;  2JG8 B;  1FYU A;  1HB3 A;  1W3V A;  3RZG A;  4M3C E;  4B7E A;  1GZW A;  3U0Z A;  4P14 A;  3WW4 A;  1SCR A;  1UQX A;  2JG8 C;  4A6S A;  1BEV 1;  4V2V A;  3CU7 A;  1S0I A;  4CU7 A;  2ERF A;  2OS2 A;  2W68 A;  2CAV A;  4Y20 A;  1COV 3;  2VUJ A;  4MGI E;  3SMH A;  1ENR A;  4CU9 A;  2QNK A;  1PGW 2;  2VVD A;  2VMC A;  2BFU S;  2PFW A;  4OCT A;  4D0Q A;  1MS1 A;  2D3P A;  3BPZ A;  1YQ2 A;  3ZYP A;  1TQ5 A;  2VZS A;  4R9D A;  1JHJ A;  2CGP A;  4JGZ B;  2OUJ A;  1E5H A;  1RYY A;  2Q1M A;  4XZP A;  4FTB A;  4FSJ A;  2CL2 A;  3NV4 A;  2RR1 2;  2XON A;  4E27 A;  3OEA A;  5FY0 A;  4NAM A;  4YZ5 A;  2JKX A;  1LED A;  2WSV A;  3JU9 A;  3MLK A;  4JGZ C;  4XBL A;  1GR3 A;  2VCB A;  4LBK A;  1WA4 A;  4N53 A;  2ZGT A;  3NVC A;  5EXO A;  1K5M B;  3GBG A;  2JDH A;  4KQ7 A;  1G86 A;  2JDK A;  2H0B A;  4CUA A;  3ES1 A;  2HWB 2;  3KZ4 C;  5FYB A;  2R07 1;  1F5J A;  3M2M A;  1US2 A;  1CPM A;  1K5M C;  2E33 A;  1VIW B;  4C1X A;  4DY3 A;  1XBF A;  3WHU A;  1WCK A;  1CAU A;  2FDI A;  1UYZ A;  3WLU A;  2QQU A;  1FOD 3;  1S0B A;  4IEW A;  4FP2 A;  4XQD A;  2A6V A;  1H30 A;  1RUH 1;  3VDD A;  4LIV A;  1RUD 1;  2LRO A;  3AL5 A;  4QQL A;  5FZO B;  2ZAA A;  4EE2 A;  1A34 A;  1HRI 2;  2BVB A;  3Q8A A;  5FJH A;  1H8T B;  2XOM A;  3N7M A;  4LIU A;  3AMH A;  1CZT A;  3LZZ A;  3Q9O A;  3GZT B;  4QKF A;  4DUV A;  4Q4V 1;  2HWC 2;  2QKD A;  4W8J A;  2N7G A;  2LTN A;  1VMJ A;  2C9A A;  2BEO A;  3TYJ A;  4RFR B;  2ZGO A;  5DG1 A;  4QU2 A;  4Y1Z A;  5DXD A;  4QXB A;  1UD1 A;  1YI7 A;  2QQW A;  4ZU7 A;  3RFR A;  5A7Q A;  1V6O A;  3TEY A;  2EID A;  1LES A;  2HEW F;  1V6N A;  2BP6 A;  2EIB A;  2WS9 2;  4X8P A;  1C8M 3;  1WUV A;  1GZ9 A;  1JS9 A;  4AF9 A;  3TEZ A;  2PHU A;  4Y5Z 0;  1UZW A;  2ZHM A;  3ELN A;  5T52 A;  3NNF A;  4N9I A;  5HI0 A;  2ZKN A;  4XFA A;  2TEP A;  4DXT A;  4QPG B;  5I0S A;  1B35 C;  1GP4 A;  5F3G A;  3BTZ A;  1NZC A;  1ULE A;  4FFH A;  2W94 A;  3OD4 A;  2JEM A;  4IEY A;  3S7E A;  3GZE A;  1ZZB A;  2ZXQ A;  2JIG A;  3MHZ A;  3QD6 A;  1CQ9 A;  1ST8 A;  1BXH A;  1TME 2;  2ARC A;  2ZGP A;  1D4M 1;  2HBU A;  1NLQ A;  1MQT C;  3GXU A;  1CD3 G;  3R4D B;  4QXC A;  4AED A;  2EAA A;  3KD4 A;  5JXG A;  3UKN A;  3BB6 A;  3DKQ A;  3MIC A;  1RJ7 A;  1Q56 A;  1C4R A;  2R30 A;  2ZGM A;  3DEC A;  5DZG A;  2DVA A;  5CA6 A;  3K46 A;  3WUD A;  4L9B A;  2NPI A;  1BVV A;  3IZO A;  4YG3 A;  2G9F A;  3KF5 A;  4JVA A;  4S2F A;  4YVS B;  4AYU A;  3ZIX A;  1VBD 1;  3ASI A;  2TUN A;  3FBM A;  3MF9 A;  2W46 A;  3AKS A;  3WQB A;  1PGL 1;  2ZMK A;  1ZZC A;  1OPO A;  5CFC B;  2JG9 A;  3WQ7 A;  1HN0 A;  2FDK A;  2ARX A;  3S5A A;  3E6D A;  3K4Z A;  1JYC A;  2DYC A;  1ZBA 2;  4FT8 A;  2RMU 3;  4COY A;  5DZE A;  1ZM1 A;  1U5X A;  2PHR A;  2YC2 A;  5IT6 A;  3QLQ A;  4MLO A;  3LB9 A;  3H42 B;  4JKM A;  2VE1 A;  1J83 A;  2EIG A;  1OUR A;  4AFC A;  5L73 A;  4WM8 A;  3U1X A;  1VBA 1;  1FPN 3;  2VZV A;  3WCR A;  3AZY A;  2OUH A;  2JKB A;  3EQE A;  2XJS A;  4LEJ A;  4LKF A;  3PLQ A;  4YM1 A;  2I07 B;  4N7I A;  2EAL A;  1QQP 2;  5CG8 A;  3USU B;  4P00 B;  4EQV A;  3KWV A;  3VKO A;  2RS3 3;  3FZ3 A;  3J4U H;  3ZYB A;  1RMU 2;  4QPI B;  4QX3 A;  1HRV 2;  2CSG A;  3CO2 A;  3ZFG B;  3MW4 A;  1ODM A;  2Y64 A;  1BYH A;  2JG8 A;  4M01 A;  3KV4 A;  5GJ6 A;  1UU5 A;  4QPI C;  5C33 A;  2DTW A;  1S2K A;  3ZFG C;  1W8U A;  1GQH A;  2GNT A;  2ZGQ A;  3EMR A;  4HN1 A;  1OLM E;  4LBQ D;  1NZI A;  4BDV B;  3I2G A;  4QU1 A;  2Y6L A;  2QTW B;  5FZ9 A;  3O5S A;  2R32 A;  3ACG A;  3L2H A;  1AR9 2;  2RS1 3;  5FZH A;  1URX A;  1LHN A;  2R0F A;  2Z2S B;  1X82 A;  3WT3 A;  4FBF A;  1SQ4 A;  2DFC A;  4L2N A;  3I3E A;  2BNO A;  1QNW A;  2ZTN A;  3ZOI A;  5DDJ 3;  4O9E A;  2W95 A;  3PUI A;  1JYX A;  1S0G A;  5FLJ A;  3AZZ A;  3SCG A;  2YU2 A;  3NV3 A;  5I8S A;  2XG3 A;  1L7L A;  1N3O A;  1RUJ 1;  1WLD A;  2BVV A;  2SBA A;  4JGZ A;  4UT5 A;  3SH4 A;  1W8W A;  1GNZ A;  5IAX A;  3W21 A;  4CDW C;  1ULD A;  5A3L A;  3IT8 A;  4R4X A;  1JU4 A;  4UW6 A;  4KGG A;  3T0B A;  1MS9 A;  3WP5 A;  3O1V A;  2CAU A;  1VMF A;  4N8M A;  4CZS A;  1HJF A;  3VUO A;  1EY2 A;  3J8F 2;  5AC9 1;  2WO1 A;  4IGP A;  1MS3 A;  4LKE A;  2C24 A;  3VB9 A;  4ERO A;  1UOB A;  2OZJ A;  4WBB A;  1BMV 1;  2QUO A;  1KEX A;  4FCA A;  2XUE A;  1K5M A;  4AK3 A;  3I59 B;  4ZZ8 A;  3QCW A;  2QZ2 A;  1LEM A;  2ZEY A;  1DG6 A;  1F5F A;  4CDQ C;  4DUW A;  5I8Y A;  1CJP A;  1OMI A;  3PDQ A;  4KWK A;  4EN0 A;  1DGW X;  2IVI B;  1Z0H A;  1UY4 A;  3J7L A;  5FXW A;  4NN0 A;  3ZVX A;  2E7Q A;  4MZU A;  1ZZ6 A;  3PUS A;  1BCX A;  4L99 A;  1CJD A;  3J7M A;  4PF1 A;  5FZO A;  4LLO A;  2D3R A;  4B29 A;  4XJA A;  4B8E A;  4P08 A;  1H8T A;  4AG4 A;  3VL8 A;  3VGI A;  1HLC A;  2WNV B;  2ET1 A;  3RGB A;  5EIY B;  1RUE 1;  1N1V A;  2W08 A;  4GZ9 A;  4QKD A;  2DU1 A;  3H8O A;  3MIE A;  3H1W A;  3VV1 A;  1H2K A;  2FBE A;  4KGQ A;  1UXX X;  5IJR A;  5F5Q A;  1DU3 D;  1R1A 1;  2UU8 A;  1UYP A;  4UW3 A;  1OC1 A;  3KMH A;  4XDQ A;  3KB5 A;  5FOJ B;  1AUY A;  5T5L A;  5KC6 A;  2EIC A;  1O3Q A;  2A3Y A;  2ZHL A;  4RA0 A;  1S0D A;  4RYD A;  5A1L A;  5JXH A;  4I2O A;  3AFG A;  2GME A;  2ZAC A;  4LBL A;  1V6K A;  1KQR A;  5GLZ A;  4PIX A;  1EP0 A;  4HVR A;  1JZ5 A;  1RED A;  2XDV A;  2VZ1 A;  3F2Z A;  5FXV A;  2ZJC A;  5A3M A;  2DCZ A;  2FMD A;  5F5C A;  1MVQ A;  4GMP 3;  4XJ8 A;  4OVE A;  2IXC A;  1YFU A;  2XLA A;  2JIJ A;  2VD7 A;  3V0B B;  4J25 A;  4XIK A;  5FYU A;  5DQ0 A;  3A0N A;  1LU1 A;  3HN3 A;  4K8F A;  4RL7 A;  4XF3 A;  2Q1Z B;  5FTT C;  1Y9M A;  3AYD A;  3KVA A;  2WUH A;  3M8L A;  5F2S A;  1CZS A;  4ZY9 A;  3DUI A;  5A3T A;  1S55 A;  2RS5 1;  1UU4 A;  3F95 A;  5FYM A;  4MX3 A;  2RJK A;  1VBC 2;  3BIE A;  5GZC A;  1QXJ A;  5E88 A;  1DF0 A;  3OGJ A;  4D8M A;  3MO4 A;  3WEZ A;  4LO5 B;  4YVS A;  4LUK A;  4XMI A;  1AJK A;  3MBW A;  5DUX A;  2JXA A;  4QX0 A;  5ACA 2;  3E6C C;  4AFA A;  1UPI A;  1MS8 A;  5EP9 A;  1QJX 2;  5FJK A;  5EJ1 B;  1W99 A;  3KCX A;  4LR4 A;  4E9K A;  4CXY A;  2PEL A;  4Q1P A;  4NOT A;  5K7P A;  4JHZ A;  4W65 A;  3UV9 A;  4IQP A;  4JRL A;  3HNM A;  1WCS A;  2GC3 A;  3PVO A;  3VBF B;  4U2A A;  4RS5 B;  3BUC A;  4ZON A;  3VBF C;  4DXR A;  1F9K A;  3MLL A;  1DGL A;  4YVW B;  5FZ3 A;  1VB4 A;  1OVS A;  3OYW B;  4YAR A;  1TMF 1;  2MEV 2;  1OA4 A;  4EN6 B;  3USU A;  3OEB A;  2W2I A;  5FO7 B;  4AVB A;  4DNY A;  1MS4 A;  1W9W A;  3BOP A;  3PME A;  4Q4Y 2;  4DXZ A;  1ZZ8 A;  3B01 A;  4MET A;  4QPI A;  3JD7 2;  4YVW C;  1JZ8 A;  1W9Y A;  2R06 1;  1DGW A;  1MEC 1;  3ZFG A;  3BI3 A;  1GSL A;  2ZGN A;  5A1A A;  4JKL A;  4AW7 A;  4CU8 A;  5ISL A;  4XEZ A;  3RMY A;  4QHO A;  3THD A;  1HQN A;  1AYN 2;  1JI6 A;  1IHM A;  1UNB A;  4JHT A;  4GAL A;  3PUH A;  1YQC A;  2ZGS A;  2XLF A;  4FXK B;  1AR8 1;  1G9F A;  3B3Q E;  2PHL A;  4XXP A;  2G19 A;  2Q8C A;  4A2U A;  1RHI 3;  3W9A A;  5ABJ B;  4AR2 A;  1NY7 2;  4I0W B;  3M3E A;  4V2W A;  2VEC A;  2FDG A;  2WL1 A;  1NKG A;  4FPK A;  4OHX A;  4BIF A;  5C7G A;  5ABJ C;  4K3U A;  1LJ7 A;  2LUW A;  2D40 A;  2RDN A;  2QVS B;  4ISQ A;  4BHP A;  1JYV A;  4UXA A;  1PM4 A;  2CYF A;  2GN7 A;  2IXJ A;  5FZ0 A;  1GWK A;  3WNL A;  3M3Q A;  1JOD A;  1YQ6 A;  1RIR A;  3MID A;  1YFY A;  4P9G A;  1EV1 3;  5LY2 A;  3BTY A;  1PZ9 A;  1SBF A;  3UK9 A;  4HSL A;  1GZT A;  3M3I A;  1ONA A;  1AYM 1;  4FPG A;  3LEG A;  1XE7 A;  1RXF A;  2VUC A;  3AMP A;  4Y33 A;  4AFM A;  2LS6 A;  1WCQ A;  3LDB A;  4DZG A;  5DAX A;  1E5I A;  4CA9 A;  3BOD A;  3I59 A;  3VBU C;  1V6J A;  4HKW A;  3AMN A;  1LAJ A;  1UAI A;  4P9Y A;  3IPV B;  4W6Y A;  3ZSM A;  4K6B A;  4OFG A;  4YWA A;  4TTG A;  4Q0V A;  4UYB A;  4AHW A;  2WZR 2;  5A3O A;  1F35 A;  5JOY A;  2QDR A;  3SNM A;  3DKW A;  3NO8 A;  4RR3 C;  3T2O A;  4AI9 A;  4YSF A;  4C8D A;  4DOU A;  5LAT A;  5T3N A;  2HWE 2;  1P8J A;  1IS4 A;  1W6N A;  4JAA A;  4EN7 B;  3LEI A;  4QDR A;  4GH4 C;  3VL9 A;  1GNY A;  2JDU A;  2P3J A;  2WNV A;  4GQ7 A;  2VPV A;  2R04 1;  4I0B A;  5ANN A;  3O1O A;  5FBZ A;  4HN0 A;  3DYO A;  4BXS V;  4AWD A;  3RSJ A;  4M3C F;  1JYI A;  1WZX A;  1MZF A;  2VUD A;  4LA3 A;  4N43 B;  1D2S A;  2EAK A;  2W1S A;  3E5U A;  1VRH 2;  1BQP A;  1LOF C;  2XBO 2;  1IKQ A;  4D6Q A;  1O91 A;  4H7L A;  3LIH A;  2FMY A;  3ATG A;  3UGF A;  1U5Z A;  2VUL A;  1FXZ A;  1XE0 A;  2YYO A;  4N43 C;  4UI9 L;  5FMO L;  3MZH A;  1Z78 A;  2VVE A;  3IM0 A;  4PLM A;  1NCQ B;  4PQQ A;  1KXG A;  3A21 A;  2A7A A;  1UX6 A;  3SCH A;  1DLC A;  1DYP A;  5JUV A;  3WG4 A;  2RR1 3;  1XU2 A;  4LHS A;  1W04 A;  1UZ0 A;  1OUX A;  3THT A;  2DBN A;  4P9L A;  4MXW B;  1DLL A;  2ADD A;  1EAH 1;  1FMD 1;  3ABZ A;  4XUN A;  2V72 A;  1ACC A;  1RUF 2;  2D5F A;  4LBO A;  2XL7 A;  1HV0 A;  5CVR A;  4GB3 1;  3ACH A;  3WW2 A;  3V0B A;  4M00 A;  4QHZ A;  2VTF A;  1QKQ A;  1XPW A;  1XXN A;  2NYY A;  3AXD A;  2PQS A;  4XF9 A;  2E26 A;  1SLC A;  4YG0 A;  4A4A A;  4CXW A;  1NE4 A;  2C6S A;  5FO8 B;  4JV4 A;  2Y6G A;  2HWB 3;  2VU9 A;  4ZXK A;  1ENQ A;  5IVY A;  1WWY A;  1IZ3 A;  3MV1 1;  1J1T A;  1AX0 A;  2WFP A;  2WO7 A;  3MIF A;  1ASJ 3;  4CEY C;  5FXX A;  3VHN A;  5IVJ A;  4FXG B;  1FX5 A;  4XCB A;  3ACL A;  1W9S A;  4NRP A;  3O0X A;  1LNS A;  2PLV 3;  3N36 A;  4GXL A;  4QGM A;  3ETP A;  1WD4 A;  5HCF A;  1STM A;  5DAQ A;  2OKX A;  1G9B A;  1BEV 2;  5I0U A;  1AR7 3;  2E6V A;  2W47 A;  4C0H A;  1IGO A;  4K1Y A;  3H1M A;  1V6M A;  2EXJ A;  4E4S A;  1W6Q B;  2VOX A;  5C8W A;  2B9U A;  2HWC 3;  5DMY A;  2I74 A;  1RC6 A;  2W3J A;  3VBF A;  5F39 A;  5C4W B;  5BYN A;  3KHC A;  3GF6 A;  1VAV A;  1Y3T A;  3POG A;  4RS5 A;  1JUH A;  4QD2 A;  1COV 1;  4HSJ A;  5A6Z A;  1AXY A;  4YVW A;  5C4W C;  2WS9 3;  4IEZ A;  1W0N A;  3OYW A;  4FQ4 A;  3IDE A;  4D7T A;  4FPL A;  4BK4 A;  4YGC A;  3MIB A;  1R1Z A;  2YY1 A;  4PBP A;  3KT4 A;  1GWL A;  4OMC A;  1PO2 1;  2G9Z A;  2F17 A;  1WCD J;  3S6P A;  1OLR A;  1SMV A;  2Y6F A;  4IEV A;  4QGL A;  4H14 A;  4EWD A;  1IQD C;  2VMI A;  5A3U A;  1LGN A;  3A0K A;  4PLN A;  4FTE A;  2D6M A;  1AL2 1;  2R07 2;  3WOG A;  1TME 3;  2VCC A;  4ZU5 A;  3VN4 A;  4AHZ A;  3VZN A;  4Z2W A;  2VOT A;  2ZGK A;  4MSV A;  5B4X A;  5ABJ A;  2V5D A;  2IXL A;  3LFI A;  2Q5T A;  2QZ3 A;  1HB2 A;  2GND A;  1K45 A;  5L9V A;  1RUH 2;  1XRU A;  1RUD 2;  1UMZ A;  2VZR A;  5FWJ A;  2JDM A;  2B39 A;  2R6Q A;  4L97 A;  4GWM A;  1CR7 A;  4BQ3 A;  3PMS A;  5E16 A;  3LEK A;  4Q4V 2;  1RUG 1;  3V64 A;  4DRR A;  4Q4X 1;  2HYX A;  2MPF A;  3TEW A;  3IMM A;  4TWT A;  2D93 A;  1LHU A;  3RG0 A;  3T2Q A;  5FR3 A;  1F4A A;  1HB4 A;  4EN8 B;  1PNG A;  1JH5 A;  3WSO A;  4Q0S A;  2UUR A;  4HVO A;  3T0A A;  3VBU A;  4AI0 A;  4BWO A;  4ZS3 A;  2Y34 A;  1POQ A;  4E8C A;  3I4I A;  5IWF A;  1PO1 1;  1W8Z A;  4XFF A;  3O14 A;  4XBN A;  1D0G A;  2CWM A;  5GKA C;  5L9R A;  2NLR A;  4AQ6 A;  3N9L A;  3WX5 A;  4XXA A;  4BLI A;  1OBN A;  4IW3 A;  2DF7 A;  3DEM A;  3Q8B A;  5I0T A;  3T4V A;  5C3S A;  1QJE A;  2VNO A;  3IPV A;  3ACF A;  3T2T A;  2XJR A;  4JZR A;  2YBK A;  2XHK A;  4KWJ A;  3G6J B;  4PLO A;  1ULP A;  3KGL A;  2GC2 A;  1QQP 3;  3AKQ A;  1GBG A;  2VR4 A;  1POV 3;  2YFU A;  1BVP 1;  4CUG A;  1VBB 1;  4K1Z A;  1RMU 3;  2W92 A;  4S2D A;  5BNQ A;  1HRV 3;  1D4M 2;  2FQP A;  3GBF A;  1JZ4 A;  4YZ3 A;  4OI1 A;  1XNK A;  1O5U A;  4KU7 A;  2Y6K A;  5HBA A;  1KS5 A;  4TLG A;  1W9T A;  5FMB A;  1CON A;  1X8M A;  4BXF A;  1LOF A;  5BNO B;  4MVT A;  5J48 A;  1CAX B;  1YC6 1;  1WMX A;  4N43 A;  1AR9 3;  2RDS A;  3KCY A;  3C8X A;  3ZYR A;  5KXB A;  1SLL A;  3POW A;  3T30 A;  1VBD 2;  1XND A;  1NE6 A;  4AFD A;  3OUJ A;  2NN8 A;  5FZ6 A;  3WXP A;  2BGC A;  2VW2 A;  3POB A;  1SPP B;  3VBR B;  1PGL 2;  3M4F A;  3HVD A;  1ULO A;  3PIJ A;  3POE A;  5F6L B;  4NAO A;  3CZU A;  5K0U B;  2ZS6 B;  4BK5 A;  2AR6 A;  1NCQ A;  1OVP A;  2BYV E;  3HJR A;  2GP3 A;  2YB7 A;  2JDY A;  3VBR C;  5JAX A;  3IWZ A;  4LJH A;  1AR6 1;  2BJS A;  4NPL A;  3VKM A;  1EUU A;  4RGG A;  1H4G A;  5K0U C;  4QB2 A;  4LO8 A;  1VBA 2;  3J8F 3;  1NYW A;  3OB8 A;  3ZYG A;  5T55 A;  1QJY 1;  3WNN A;  3V0A B;  3PTR B;  1PMI A;  4LUL A;  4CEY A;  4CP0 A;  1O6U A;  3KHB A;  4BQW A;  2J22 A;  4A42 A;  2D6L X;  1LOE A;  3ILF A;  3UET A;  3K2O A;  4LBN A;  5FMO S;  1DQ1 A;  1NUK A;  3SHR A;  3LA3 A;  2JG9 C;  4G9S B;  2FZ2 A;  1F8V A;  4FPH A;  1B09 A;  4IEQ A;  4JDO A;  3VZM A;  5LK5 A;  3NAP B;  1YYN A;  5BV6 A;  4P9X A;  2JB4 A;  2JDP A;  1Y9Q A;  4QX1 A;  4OMD A;  4AI3 A;  1W28 A;  4QX7 A;  5LBF A;  1KS4 A;  1W6Q A;  4NRO A;  4XYX A;  4DXS A;  3I3M A;  2P37 A;  3LOB A;  2XJQ A;  5LBE A;  3INA A;  1U12 A;  3I3Q A;  4FPO B;  3UKV A;  1AHS A;  2DU0 A;  2MHF A;  3LA2 A;  4B7K A;  1IS5 A;  5C4W A;  3AK0 A;  5AFB A;  4NHL A;  4V1P A;  1ND3 B;  4A7Y A;  4LTA A;  2ZX3 A;  1C3H A;  1RUJ 2;  1UY1 A;  3KS7 A;  4QPY A;  2WZE A;  3J26 N;  1BLZ A;  2WLQ A;  1D4V B;  3KQR A;  4E2G A;  1KFU L;  5DDJ 1;  3D82 A;  4KWL A;  1UZV A;  4IUG A;  5AC9 2;  5KHJ A;  1FI2 A;  5FYV A;  4Z2A A;  1CGP A;  1LRH A;  1BMV 2;  4ZZ5 A;  1ND2 B;  2PAM A;  1X50 A;  1OH4 A;  4NWW A;  4ASL A;  3E5X A;  4WV8 A;  2VMH A;  3TBD A;  2WQZ C;  4DPN A;  2DUP A;  4HK8 A;  5F1R A;  2LM3 A;  1ND2 C;  4BME A;  4MOA A;  3ROU A;  4UFM A;  2GDF A;  4FP3 A;  4Y4R A;  3I2D A;  1A8D A;  1O8P A;  4CDX B;  1KJL A;  3WR0 A;  1QIQ A;  2ENR A;  2DVB A;  2RE9 A;  1VBE 1;  1PVC 1;  1ZBE 1;  2ZML A;  3T1L A;  3THC A;  4ET7 A;  3B93 A;  2VOV A;  5IVC A;  1SDW A;  2O14 A;  5FKB A;  1XSQ A;  2XQR A;  1IG3 A;  1OD3 A;  1S2B A;  2P2K A;  3AZW A;  4M4R A;  1GOG A;  4LOT A;  1NCR B;  4ZPI A;  2R0H A;  4QAW A;  5BUV A;  5C3O A;  5KWR A;  1JHN A;  1RUE 2;  1CES A;  1DQ6 A;  2J1R A;  3AP4 A;  3III A;  5AVP A;  2JWP A;  1JYT A;  5ACA 3;  4D6S A;  1SFY A;  1YLL A;  3ZFF B;  1Q8O A;  1HN1 A;  4IEX A;  3AKP A;  1ENS A;  3M70 A;  5EZW A;  5KBF A;  3R6S A;  1UOJ A;  1R1A 2;  1QJX 3;  3WNP A;  2WYF A;  4HKO A;  5KHK A;  1R08 1;  3NRU A;  5IVV A;  4YLZ A;  2W39 A;  1LOD A;  2D6K A;  3MW3 A;  4YW2 A;  2YGM A;  2LW8 A;  4OQ9 A;  1XC6 A;  1QDC A;  5I0R A;  1W2A X;  1KDM A;  2RV9 A;  2X8K A;  4IES A;  4A3Z A;  5DPN A;  3NJY A;  4IGO A;  2A6X A;  2FDJ A;  4PDW B;  2FCV A;  3EXU A;  4OZX A;  4P9J A;  1AJO A;  3NJX A;  2WT2 A;  1BZW A;  2A6Z A;  1ZRI A;  3ZR6 A;  4K9S A;  5EHD A;  2MEV 3;  4ISR A;  3ZR5 A;  1H8T C;  4M0N A;  4FI9 A;  1YFX A;  4M3C B;  4Q0U A;  3K75 B;  4Q4Y 3;  2XXZ A;  3CBN A;  4CCN A;  3JD7 3;  1GV9 A;  1REE A;  2KA3 A;  4F3J A;  1G8W A;  3NJZ A;  4IE6 A;  4HT1 T;  1QY4 A;  2RDQ A;  3HIF A;  3CNA A;  3N9M A;  3R0R A;  2WBK A;  1OOP B;  2RS5 2;  4GMP 1;  4FAH A;  2HEY F;  2VBP A;  1T6G C;  4CU6 A;  1TNF A;  4MAD A;  1RUI 1;  2BNN A;  2WWJ A;  2YRO A;  5BNO A;  1CAX A;  1RVF 1;  2BWA A;  2IFR A;  2K0G A;  1BHG A;  1GQP A;  4I02 A;  3WDX A;  4AAX A;  3GGL A;  3CJX A;  3ME2 A;  4AEJ A;  2VQT A;  3PU3 A;  1W0O A;  4PCR A;  4NIA A;  1LHW A;  5JLV A;  4QPG C;  1SPP A;  1ZVF A;  1GAN A;  4XF4 A;  4WM7 B;  3VBR A;  3FUQ A;  1IPK A;  4LO7 A;  4Z07 A;  5FZG A;  5FPU A;  3TRS B;  5K0U A;  2VTX A;  1SEF A;  3LFM A;  3U37 A;  3GJA A;  4H2A A;  2YV8 A;  1DQ2 A;  1MR5 A;  1H9W A;  2W91 A;  3ES4 A;  4ES8 A;  5FZL A;  5LA1 A;  2B5H A;  4K40 A;  1BBT 1;  1S0C A;  2IZW A;  4MGK E;  4RQP B;  5IFP A;  1S0F A;  1LOB A;  3RDI A;  4Y22 B;  5I93 A;  5H9Q A;  1YFW A;  2JJ6 A;  2ZEW A;  5DUV A;  3V0A A;  5FLH A;  3OPT A;  4RQP C;  3AP6 A;  5CBL A;  1TMF 2;  3O1P A;  1XNB A;  3AB0 A;  5FZB A;  2DUR A;  2RG4 A;  4BCU A;  3VDC A;  4Y5T A;  4YVS C;  2J1A A;  2QQO A;  4YW6 A;  5EWS A;  5A80 A;  3WHT A;  2R06 2;  1MEC 2;  2F4L A;  2WJS A;  1O5L A;  2WZR 3;  4NR1 A;  1O3R A;  1ALY A;  5CFC C;  3B69 A;  2FD8 A;  3AZV A;  3P6B A;  1JOB A;  1CAW B;  5L7O B;  1L3J A;  3NAP A;  1G7Y A;  5DUU A;  1AR8 2;  4UFI A;  3TNQ A;  5L19 A;  4UAP A;  4I30 A;  4S2H A;  1V00 A;  3FFQ A;  4AQ2 A;  5L7O C;  4HL0 A;  3BGA A;  2DCY A;  4KU8 A;  3ZN4 A;  2VXJ A;  4PQ9 A;  1WBF A;  3VDA A;  4HBN A;  1HXS 3;  3E1F 1;  4HG6 B;  4N90 A;  5EFU A;  3LPG A;  2ZBJ A;  5GLV A;  3WW1 A;  4D3W A;  1ND3 A;  4MHR A;  2GAL A;  3KGZ A;  1VRH 3;  2Q4S A;  5T5J A;  2A75 A;  5JI9 A;  4LUM A;  3BAL A;  1KFX L;  3D3A A;  4X6R B;  5KC5 A;  3HD8 B;  1X7N A;  5G04 L;  1Z7S 1;  3HBZ A;  1OKO A;  4XAB A;  1VAL A;  1J59 A;  4LBM A;  1WW7 A;  3IDC B;  1AYM 2;  1ND2 A;  3HQX A;  4GJZ A;  4QWN A;  3BU0 A;  3H3U A;  2Y6J A;  3AVR A;  3RMX A;  5SV5 A;  4HAN A;  1EV1 1;  4CRQ A;  1LGB A;  2OZ6 A;  4SBV A;  3IKW A;  2QQI A;  2XUM A;  3CDZ B;  2J42 A;  1SLA A;  4R9C A;  1DHK B;  2ID4 A;  1CX4 A;  2WLP A;  4Q1R A;  1V0A A;  4XFH A;  3POS A;  4CDX A;  4OI4 A;  4OHY A;  2ZZJ A;  3UT0 A;  4OI0 A;  4BJ0 A;  3HQU A;  3NNG A;  3TAY A;  1V9U 1;  3TN9 1;  1MS5 A;  3ZFE B;  5BNP B;  3MF6 A;  2DUO A;  2WR9 A;  5CU1 A;  3WP4 A;  2Z69 A;  2PXJ A;  3RYP A;  3E97 A;  3BVC A;  4QKB A;  3DXT A;  3ZFE C;  5B2G B;  1NCR A;  5BNP C;  4E8D A;  2R04 2;  2EXK A;  5FP8 A;  3ECQ A;  3CQO A;  4LIT A;  2EA7 A;  4NPR A;  4XQW A;  3ZFF A;  4KI5 M;  5A32 B;  1BEV 3;  1E57 A;  1UOF A;  3GDB A;  5LBB A;  5CNA A;  2P34 A;  5J98 B;  4D94 A;  3B94 A;  3JBG 1;  1Y4W A;  3WNK A;  1KDK A;  2D43 A;  1JOP A;  2VQA A;  4YW5 A;  1DZT A;  2WQ4 A;  4CVU A;  1S4C A;  2RDR A;  2VBD A;  5H9R A;  1R09 3;  1PX3 A;  2V4A A;  5KR7 A;  4PDW A;  1JZ2 A;  2XJP A;  2B45 X;  2OVU A;  2EVX A;  1Q3E A;  2CDP A;  4NO4 A;  3O1T A;  4BH9 A;  4XUO A;  1NT0 A;  2DCK A;  1QOO A;  5I0D A;  4LPL A;  5JCT A;  3N7K A;  2PAK A;  1EAH 2;  1FMD 2;  2RM2 1;  1PZ8 A;  3OD0 A;  4M3C A;  2WNV C;  2YHJ A;  4GB3 2;  4QQO A;  3ILR A;  2F4P A;  5FUP A;  2WAO A;  3C7H A;  5FZ8 A;  3S30 A;  3SEE A;  1J3P A;  2Q8O A;  2BTV C;  5F3I A;  1BKZ A;  1OOP A;  1WW4 A;  2AGS A;  1OA2 A;  5EYX A;  4CCC A;  1Y43 B;  1OQ1 A;  2WN3 A;  2R07 3;  2E63 A;  2XB6 C;  1Q8Q A;  3MUZ 1;  5FYI A;  1DBN A;  2WAA A;  1XSR A;  4QPG A;  3OPZ A;  2A6Y A;  4YPJ A;  1CIY A;  3C2U A;  4XCA A;  3TB0 A;  3LOI A;  3BTX A;  3AFK A;  3EYP A;  4A3X A;  3GM8 A;  1UIK A;  2AH2 A;  2VCM A;  3GHM A;  3LQC A;  4XAC A;  1RUD 3;  1ASJ 1;  1LU2 A;  4KWU A;  2NMO A;  3GAL A;  1RUC 1;  4WZC A;  1VJ2 A;  4YW4 A;  3OUI A;  1U5Y A;  2BGO A;  2PLV 1;  3HOB A;  4Q4V 3;  4AGG A;  1EPW A;  1YIF A;  4EN9 B;  5DUW A;  2A3W A;  2Y38 A;  4A41 A;  1WLW A;  3GCX A;  1AR7 1;  4RQP A;  4Q4W 1;  5FIX A;  1TE1 B;  1QJU 1;  3CIH A;  1COV 2;  4Y22 A;  2BU9 A;  3PUA A;  1YJL A;  4GIQ A;  1UCX A;  4D69 A;  1FAY A;  4JTN A;  1NLS A;  1IOA A;  5FYH A;  3ZN6 B;  4AVA A;  5CFC A;  2VW1 A;  3DN7 A;  5C70 A;  1PO2 2;  3HN1 A;  4W50 A;  4Y1V A;  4D7S A;  1G9C A;  3EBR A;  3FMG A;  3QBQ A;  1LEC A;  1FT9 A;  3MGU A;  4XVH A;  5F2W A;  3PU8 A;  4XAA A;  5JSP A;  4CPB A;  1AL2 2;  1Q43 A;  1W9F A;  3B02 A;  1CAW A;  1GYK A;  3OBT A;  5L7O A;  3B5L B;  4C90 A;  1D4M 3;  1AL0 G;  3WW3 A;  2G9G A;  2YBS A;  5DN2 A;  3WIN E;  3WVJ A;  2VZU A;  1K42 A;  3SKJ E;  4R8H A;  2WA3 A;  4RHV 3;  4I3P A;  4OUM A;  5CZK A;  3OG2 A;  5L36 A;  3OCP A;  4RS5 C;  4IV3 B;  5FFO C;  3U11 A;  3Q8C A;  1VAM A;  3WF4 A;  3VZJ A;  1W06 A;  2PAE A;  3ST7 A;  4XDP A;  3WP3 A;  2JE7 A;  3MPP G;  1W8F A;  4AXO A;  4IV3 C;  1RL3 A;  3VBH B;  4NUB A;  1VBD 3;  2ET7 A;  1RUG 2;  2FCU A;  3KV6 A;  4Q4X 2;  2GN3 A;  3I7D A;  3WDY A;  2YPJ A;  2VNV A;  1H2M A;  1XJA A;  4IER A;  1C1F A;  1SZB A;  4KMQ A;  3VBH C;  1F2N A;  2GH8 A;  4IEO A;  2VY0 A;  4TYS A;  4MGY E;  1PO1 2;  3X29 B;  1UPS A;  2AUY A;  3Q8E A;  2WZP P;  5FUI A;  2KXL A;  1JZ7 A;  4QT6 A;  1W90 A;  3M3O A;  2PHF A;  2Q1F A;  4QKN A;  4L11 A;  1DZQ A;  3WD5 A;  1MZ6 A;  3GZA A;  4PJY A;  4C91 A;  5LY1 A;  3SH5 A;  1ZZ7 A;  2IXH A;  3FUO A;  3KT7 A;  3LEM A;  4OUS A;  5FYC A;  1JN2 P;  3ZKU A;  2LRP A;  4NRM A;  1LUL A;  4HLT A;  4XC9 A;  1LOA A;  3ZFE A;  4AI2 A;  2JB8 A;  5BNP A;  1VBB 2;  1YEW A;  4OZO A;  1VLN A;  3GJB A;  1APN A;  5C3P A;  2NZ9 A;  1SLI A;  4NMI A;  5J36 A;  3R05 A;  5CKM A;  1W05 A;  4BQ4 A;  1XYN A;  2B8M A;  4CCM A;  5FP4 A;  3VD9 A;  3EO6 A;  3V56 A;  1CAV B;  2JDN A;  4RGK A;  1HQW A;  2P6C A;  3I2O A;  5CG9 A;  2YBP A;  2LAL A;  3B9I A;  4CP9 B;  5A3N A;  5T54 A;  3QH6 A;  2VUA A;  5GZD A;  2YFZ A;  3RI9 A;  3KV9 A;  4CCJ A;  4LQR A;  5A32 A;  1DFQ A;  4UW4 A;  3AM2 A;  5JIA A;  5IK7 A;  3IBM A;  1ULF A;  4XF0 A;  3UYJ A;  2DFB A;  2PTM A;  3L2Y A;  1FV3 A;  2VQU A;  3WV6 A;  4LOS A;  2Q30 A;  4ES9 A;  1SLB A;  1UO9 A;  3LAG A;  3I2I A;  1OT5 A;  4QDQ A;  1GNH A;  4JC1 A;  2HWD 1;  2WFF 1;  1PNF A;  4XOG A;  3N7J A;  1JXN A;  3MFA A;  5LW9 A;  1AR6 2;  2WNE A;  2ORX A;  1ZRR A;  4WVW A;  1DYK A;  1PVX A;  3NJV A;  5HXV A;  1PIV 1;  2VVF A;  2BER A;  5AC9 3;  4MO3 M;  2E7A A;  5CB7 A;  4KBB A;  4BA6 A;  4EYU A;  1DDL A;  2ATF A;  1OLM A;  1QJY 2;  4L0P A;  4LLF A;  2QE3 A;  1ZX5 A;  5LK7 B;  4UFL A;  5LCW L;  5FZ1 A;  1UIJ A;  2AEY A;  2VZ3 A;  2ARB A;  4AOC A;  2ES3 A;  2ZGR A;  1WME A;  4FPJ A;  4WVV A;  1M4W A;  1QGL A;  1RXG A;  2YPD A;  2BNM A;  4CUB A;  3VD5 A;  3AKT A;  3L9J T;  4WZF A;  4BM8 A;  4L8Q A;  3WNO A;  2AAC A;  2FDF A;  1NCQ C;  5F37 A;  5D1I A;  2ZEZ A;  4CEW B;  3ZSJ A;  1WBL A;  4KG0 A;  5CFD B;  4Q26 A;  5A7S A;  3AC0 A;  3T1M A;  2I45 A;  5CIS A;  4CEW C;  2E53 A;  2KD7 A;  5FPX A;  1RUE 3;  1PK6 B;  4UWD A;  5CFD C;  4YM0 A;  4TLF A;  2BQP A;  2GP5 A;  3RRD A;  3W59 A;  2DDU A;  1I5P A;  4NII A;  1YUD A;  2GNM A;  3ALQ A;  1PK6 C;  1J3Q A;  1R1A 3;  5C9A B;  1O4Y A;  1DCS A;  1KIT A;  2ZCW A;  2SLI A;  1GOF A;  1WW5 A;  2CWS A;  4IXL A;  4Q27 A;  5FMD A;  4UFH A;  4RSU A;  3WF2 A;  3VBO B;  5DDJ 2;  1TZO A;  3JZV A;  3ZSE A;  1H6Y A;  4P9I A;  3ZN6 A;  1H6X A;  1N1T A;  1HRI 3;  2HWF 1;  2J1E A;  4XZU G;  5HCA A;  4OHW A;  1YI9 A;  1S1A A;  3VBO C;  5T5P A;  4QXK A;  2IWG B;  1DP0 A;  2WZ8 A;  4XPV A;  4AE2 A;  4ASM B;  5LWB A;  2ZMN A;  1GWM A;  3RQ0 A;  1OFS A;  2Y60 A;  1NG0 A;  3ZSK A;  5GZG A;  2E9Q A;  3HAG A;  1N1Y A;  4FOY A;  5A33 B;  2BUK A;  4TSV A;  1VBE 2;  1PVC 2;  1ZBE 2;  2HJI A;  5A7P A;  3CJI B;  2RS5 3;  2KM2 A;  4C0B A;  4YZ2 A;  2DBI A;  3LSE A;  3LCP A;  4IV3 A;  5IW0 A;  4Z92 B;  3PIG A;  2XL9 A;  1YCI A;  1REF A;  1IPJ A;  3DGT A;  2RVA A;  2GNB A;  3CJI C;  2W1Q A;  2BFU L;  3UL2 A;  4AGV A;  2JDZ A;  1I5Z A;  1OLQ A;  4FFF A;  3VBH A;  4IV1 B;  4BMB A;  2UWC A;  1PHM A;  4IE5 A; 
#chains in the Genus database with same CATH homology
 4IUG A;  3OGV A;  2Y64 A;  4QDS A;  4Z2A A;  2J7M A;  5HXM A;  4ZZ5 A;  1OH4 A;  3K77 A;  4BDV B;  3A7Q A;  3I2G A;  2Y6L A;  2W1W A;  3ACG A;  1JZ3 A;  4MOA A;  1XNT A;  2Y8K A;  1O8P A;  3LPF A;  3I3E A;  4ET7 A;  4JKK A;  2X05 A;  2DCJ A;  3THC A;  2W95 A;  3PUI A;  1JYX A;  1TVG A;  2WAB A;  3T2P A;  1DYO A;  1OF3 A;  1OD3 A;  4M4R A;  1GOG A;  2E31 A;  1JZ6 A;  1JU4 A;  4QAW A;  3T0B A;  2J1R A;  3III A;  5J1X A;  2QQN A;  2WO1 A;  2VCA A;  1UMI A;  1HN1 A;  5HPO A;  1KEX A;  3WNP A;  1J84 A;  3NRU A;  4ZZ8 A;  2J1S A;  4DUW A;  2LW8 A;  2ZEY A;  1XC6 A;  3I2K A;  2RV9 A;  2ORZ A;  5DPN A;  4A3Z A;  1UY4 A;  3EB7 A;  2VZT A;  1UY3 A;  3NJX A;  5JXJ A;  2WYS A;  5LA0 A;  5LA2 A;  1UY0 A;  4PF1 A;  4FI9 A;  4P08 A;  3BN6 A;  3K75 B;  5C71 A;  3HNY M;  2XQX A;  4AG4 A;  2J1T A;  3JXS A;  2ZEX A;  5EIY B;  4GZ9 A;  2WN2 A;  2WBK A;  4GWI A;  1UXX X;  5IJR A;  4CU6 A;  4MAD A;  2R7E B;  2JDA A;  1BHG A;  1GQP A;  2EIC A;  4XUP A;  3IAQ A;  4AAX A;  3GGL A;  2WO2 A;  2VQT A;  4RYD A;  5JXH A;  1PMH X;  3WF1 A;  1JZ5 A;  3VD4 A;  2C9K A;  3I2F A;  3F2Z A;  2VZ1 A;  4UOJ A;  3U37 A;  4ARY A;  2W91 A;  1F4H A;  4QB1 A;  3P1I A;  5LA1 A;  3CKH A;  5JXI A;  3IB3 A;  5DQ0 A;  3HN3 A;  1L7Q A;  4A6O A;  5IFP A;  3HNB M;  2WUH A;  4ZY9 A;  1CZS A;  1UYY A;  2ZEW A;  3IDA A;  2RJ2 A;  3VDC A;  4D8M A;  3MO4 A;  2VME A;  3WEZ A;  4ARX A;  2J1V A;  1K3I A;  2BZD A;  2J1A A;  2QQO A;  3I2J A;  3LE0 A;  3T08 A;  3ZM8 A;  2VZO A;  3MBW A;  5IHR A;  1UMH A;  4QX0 A;  1T2X A;  2B4K A;  2HLE A;  2WDB A;  3P6B A;  1EUT A;  3SEP A;  1NAE A;  2E32 A;  5EJ1 B;  1W99 A;  4UAP A;  4XUT A;  1UY2 A;  2L9L A;  2C4X A;  4JHZ A;  3I97 A;  3HNM A;  3BGA A;  4ZXE A;  2Z4F A;  3VDA A;  3E1F 1;  4HG6 B;  4P02 B;  2QQL A;  4DXR A;  3LPG A;  3OEB A;  1JYN A;  1TG7 A;  1NX9 A;  3VD3 A;  1W9W A;  3D3A A;  1JZ8 A;  5G04 L;  2VZP A;  5A1A A;  4JKL A;  4CU8 A;  2W9X A;  4W4Z A;  4P5Y A;  2BGP A;  3HEI A;  3THD A;  4GWJ A;  1JI6 A;  2Y6J A;  2W5F A;  3A23 A;  3I2H A;  1O59 A;  3PUH A;  2QQI A;  3CDZ B;  1K12 A;  2ID4 A;  2QBX A;  2W87 A;  1W8O A;  1US3 A;  1NKG A;  2V4V A;  3FHA A;  4BJ0 A;  1GUI A;  3NNG A;  2XHN A;  5C7G A;  2W1U A;  5IFT A;  4DEV A;  5CYY A;  1JYV A;  3NQH A;  3FL7 A;  4MGQ A;  3WNL A;  4E8D A;  2VO5 A;  5F7U A;  1MPX A;  3K4D A;  3MV0 1;  3ECQ A;  3CQO A;  2JD9 A;  4KI5 M;  4OUE A;  4TXW A;  3LEG A;  2LS6 A;  1WCQ A;  3GDB A;  3VD7 A;  1SG3 A;  3WNK A;  3W5N A;  5JR2 A;  4JX0 A;  4CVU A;  4TTG A;  1PX3 A;  4MGS A;  1JZ2 A;  4QB6 A;  2CDP A;  2VZQ A;  3T2O A;  1GU3 A;  4XUO A;  2DCK A;  5I0D A;  4LPL A;  1P8J A;  3OGR A;  2VJX A;  3LEI A;  4QDR A;  1GNY A;  3I3D A;  2WAO A;  3C7H A;  3SEE A;  3DYO A;  4BXS V;  1SDD B;  3OGS A;  4DUX A;  3WF3 A;  3T0D A;  3K4A A;  4CUC A;  2WN3 A;  3W5M A;  2W1S A;  3MUZ 1;  2WAA A;  2VMF A;  1CIY A;  2X10 A;  4YPJ A;  2VL4 A;  4UI9 L;  2Y6H A;  3EYP A;  3GM8 A;  3LQC A;  4PQQ A;  4KWU A;  4QX2 A;  3A21 A;  1DLC A;  3WF0 A;  5JUV A;  3C7F A;  4LHS A;  2BGO A;  1UZ0 A;  3HOB A;  3HPN A;  3ABZ A;  4XUN A;  2V72 A;  5JMO A;  3ACH A;  4A45 A;  4A41 A;  1WKY A;  2VTF A;  1KGY A;  3OBA A;  1XPW A;  5IYY A;  1CZV A;  3VDB A;  2PQS A;  2E26 A;  3CIH A;  4A4A A;  1JU3 A;  3ACI A;  2Y6G A;  3MV1 1;  2C26 A;  2EIE A;  1W9S A;  5C70 A;  2X09 A;  4W50 A;  1LNS A;  3ETP A;  2OKX A;  2VC9 A;  2WQ8 A;  4XVH A;  2JE8 A;  2W47 A;  3J7H A;  1UYX A;  1CX1 A;  2CDO A;  2QQM A;  5DN2 A;  2VZU A;  1K42 A;  3C7O A;  3SKJ E;  5DMY A;  3CZJ A;  2W3J A;  5CZK A;  1OF4 A;  3OG2 A;  5B4N A;  3I3B A;  1L7R A;  2WO3 A;  2VM9 A;  3WF4 A;  3A22 A;  1GMM A;  3FN9 A;  1W0N A;  4BK4 A;  3UNP A;  4OMC A;  4KMQ A;  1PX4 A;  1IQD C;  2YC4 A;  1W8N A;  1D7P M;  2VMD A;  5FUI A;  4CU7 A;  1JZ7 A;  2VCC A;  2VOT A;  4CU9 A;  5B4X A;  3MUY 1;  2VMC A;  2V5D A;  4D0Q A;  3WNM A;  1YQ2 A;  1K45 A;  3C7G A;  2VZS A;  4RN5 A;  1JHJ A;  2BBA A;  2VZR A;  1RYY A;  4OZO A;  2XON A;  3OEA A;  4PT6 A;  2JKX A;  1JYW A;  3LEK A;  2HYX A;  4QPW A;  4DEQ A;  3VD9 A;  2J1U A;  2VCB A;  3T2Q A;  1F4A A;  3WSO A;  3T0A A;  4XUR A;  2YFZ A;  4E8C A;  4CUA A;  2B9V A;  4LQR A;  1UXZ A;  1US2 A;  2QQJ A;  2VQU A;  2E33 A;  1GOH A;  1UYZ A;  3ACF A;  3I2I A;  1OT5 A;  4QDQ A;  3C7E A;  1ULP A;  3UES A;  2YFU A;  2VR4 A;  3T09 A;  2ORX A;  2XOM A;  3NJV A;  1CZT A;  2W92 A;  1JZ4 A;  4DUV A;  4W8J A;  3DYP A;  2BER A;  4MO3 M;  2Y6K A;  1W9T A;  4L0P A;  2EID A;  5LCW L;  2VZ3 A;  2EIB A;  3C8X A;  3DYM A;  1R64 A;  4CUB A;  3VD5 A;  1UX7 A;  4DXT A;  1ULO A;  3WNO A;  3CZU A;  2W94 A;  4BK5 A;  2ZEZ A;  3FHQ A;  3HJR A;  4LKS A;  2YB7 A;  2ZXQ A;  3AC0 A;  4A44 A;  1EUU A;  3GXU A;  2KD7 A;  4QB2 A;  1O8S A;  5JXG A;  4OYU A;  3CMG A;  2DDU A;  3OB8 A;  1I5P A;  3WNN A;  3DEC A;  3K46 A;  5EJZ B;  1GOF A;  2J22 A;  4A42 A;  3WF2 A;  1H6Y A;  4M4P A;  3UET A;  2W46 A;  1H6X A;  1NUK A;  3WQB A;  4XZU G;  2J1E A;  3SKV A;  1XNA A;  1DP0 A;  2WZ8 A;  3K4Z A;  4XUQ A;  2YC2 A;  4QX1 A;  4OMD A;  4JKM A;  1PMJ X;  4DXS A;  1J83 A;  2YG0 A;  2VZV A;  3IAP A;  5G05 L;  1SHW B;  1UY1 A;  2WZE A;  4P00 B;  2RVA A;  2W1Q A;  2QQK A;  4QX3 A;  1UWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...