2WO2A

Crystal structure of the epha4-ephrinb2 complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
178
structure length
178
Chain Sequence
TGEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKRTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
molecule keywords EPHRIN TYPE-A RECEPTOR
total genus 36
structure length 178
sequence length 178
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wo2A00
1JU3A 5EIYB 3ACGA 2BERA 3OGVA 1I5PA 1DYOA 2ZEWA 5EJ1B 1GQPA 2VZRA 2VR4A 3T2OA 4D0QA 1IQDC 3E1F1 3NJVA 1D7PM 3CMGA 1XNTA 2Y6LA 3F2ZA 1NKGA 4P00B 2DCJA 2WO1A 2WABA 4ZXEA 2W95A 3HOBA 1F4AA 4QB2A 2VQTA 5FUIA 4A45A 1YQ2A 1R64A 5LA1A 2CDPA 4UI9L 5JXJA 3UETA 4XUPA 2YB7A 4DUVA 3HJRA 2LS6A 2W1UA 2OKXA 4GWIA 1US3A 2J1UA 2WAAA 2W91A 5IHRA 4UAPA 1DP0A 2E31A 3LE0A 3DECA 1JYXA 1T2XA 4MO3M 2VZOA 4CUAA 3PUIA 3W5NA 3GXUA 4OMDA 2XONA 2BGPA 2QQKA 3HPNA 4RYDA 5B4XA 3VDCA 2JDAA 2VOTA 4P02B 5HPOA 1CIYA 1UWWA 2RJ2A 5JXHA 1ULPA 3IAQA 1PMHX 3T0AA 3P6BA 1ULOA 3T2QA 1UX7A 3ACHA 1UMHA 2C26A 2WAOA 4QB6A 3VD3A 1NAEA 4ZY9A 5C7GA 1UY3A 1CZSA 2VMDA 4JKMA 1CZVA 1CZTA 1WKYA 4JX0A 3OBAA 2LW8A 3WF3A 3I2JA 4JHZA 1UMIA 4BK4A 1PX3A 5G05L 5EJZB 4M4PA 4A44A 2PQSA 2BGOA 4AAXA 4CUBA 4HG6B 5DPNA 1DLCA 1UY2A 5J1XA 4TXWA 4A3ZA 4E8CA 4D8MA 2VMFA 3I2FA 2ZEZA 4PQQA 5IFTA 3MUZ1 4PT6A 2YFUA 3IIIA 3CZJA 3LPFA 4W4ZA 3W5MA 2V5DA 4CVUA 5IFPA 2V72A 3HNMA 4OUEA 5G04L 2ID4A 4DXSA 5CZKA 4TTGA 3OEBA 4FI9A 2C4XA 3ECQA 2WZEA 4GWJA 1JI6A 4IUGA 5B4NA 3K4ZA 1OF4A 5DQ0A 2VJXA 2WUHA 4XUOA 1PX4A 4QPWA 2VL4A 2WO3A 3WF4A 3THDA 3K77A 1JZ4A 5F7UA 1LNSA 1UXZA 5C70A 4LPLA 4QX1A 3DYMA 2WO2A 2C9KA 2HYXA 5LA0A 1JYWA 2W87A 2WQ8A 4MADA 3C7GA 3FHAA 1SHWB 3GDBA 4GZ9A 5DN2A 3SEPA 3AC0A 3I2HA 3THCA 2W46A 1UY1A 1K3IA 1JHJA 4DEVA 2QQNA 2QQMA 1UYXA 4A6OA 4ARXA 3CQOA 3VD9A 3MV11 4BJ0A 3D3AA 3LEGA 2W1WA 2QQLA 2VZTA 4CU8A 3T0DA 2YC4A 3T2PA 5CYYA 2R7EB 2Y6GA 3K75B 3MBWA 1JZ7A 4XUQA 4QX3A 2BBAA 4MGSA 1JYNA 1H6YA 1O8SA 4DEQA 4AG4A 4M4RA 5LCWL 3OEAA 1JZ6A 2VZVA 4XUTA 4DUXA 3HEIA 1XPWA 2W94A 4RN5A 2W1SA 1JZ3A 1JZ2A 1J83A 3NQHA 4XVHA 4JKKA 1K42A 1SG3A 2ZEXA 3DYPA 3T08A 4ARYA 4QX2A 1PMJX 2VZQA 5IYYA 1KEXA 1OF3A 1EUTA 3VD5A 5JXIA 1O59A 4KI5M 3WF1A 4BXSV 2JE8A 2VZ1A 2B4KA 2QQOA 1NUKA 3K46A 2L9LA 1XNAA 2XQXA 4XZUG 1JZ8A 4W50A 3NNGA 1WCQA 1TG7A 1HN1A 1O8PA 5JMOA 4PF1A 1XC6A 1SDDB 4CU6A 2EICA 1W9TA 3LEKA 4KMQA 3WSOA 2W47A 4E8DA 4A4AA 2Y6HA 4YPJA 3I3BA 3T09A 1K12A 2VCBA 2J1AA 3C8XA 3A22A 1GUIA 3LPGA 4OMCA 2W3JA 3NRUA 1W9WA 1JZ5A 2J1TA 2X10A 2W5FA 5JR2A 2J7MA 3I97A 2Y6KA 3C7HA 3IB3A 4UOJA 3I2GA 1EUUA 1K45A 2X05A 1UY0A 2VZ3A 2DDUA 3VDBA 1CX1A 2WN2A 1W99A 4P08A 2WDBA 4ET7A 2DCKA 3I2KA 1UZ0A 3CKHA 3NJXA 4A42A 4QAWA 2BZDA 2WZ8A 1MPXA 1W9SA 4LQRA 2YC2A 3EYPA 3IAPA 3HN3A 4DUWA 3FN9A 4CUCA 5JUVA 4LHSA 3WEZA 1P8JA 2V4VA 2X09A 2QQIA 3VDAA 3WNOA 2VMEA 1US2A 1J84A 2B9VA 3ACIA 2CDOA 2VC9A 2J1VA 1BHGA 1TVGA 2HLEA 4BK5A 3GGLA 2YFZA 3OG2A 3WQBA 3DYOA 3FL7A 3PUHA 2VCCA 3EB7A 3OGSA 3C7EA 3LEIA 4W8JA 5A1AA 2QBXA 3GM8A 4QX0A 1UY4A 3HNBM 4MGQA 1UYYA 2J1SA 2WBKA 3WNNA 1W0NA 1GOFA 2E26A 4QB1A 3WNKA 4CU7A 3OB8A 2QQJA 2WN3A 1OT5A 2VCAA 3CZUA 2YG0A 3C7OA 2E33A 2J22A 3HNYM 2E32A 1GNYA 4QDSA 2RVAA 3CIHA 1H6XA 3SEEA 2EIEA 1L7RA 1NX9A 3WF2A 3K4DA 5I0DA 2ZEYA 2Y8KA 1UYZA 2XHNA 4QDRA 3T0BA 3A23A 2KD7A 1JU4A 3MV01 2W1QA 5LA2A 1OH4A 2ORXA 4BDVB 4KWUA 2VZUA 4QDQA 3OGRA 4DXTA 3ETPA 3SKJE 2J1EA 4DXRA 3MO4A 2Y6JA 3FHQA 3VD7A 1GOGA 3MUY1 3WNMA 4XURA 5JXGA 2Z4FA 3BGAA 4ZZ5A 5HXMA 2XOMA 3A7QA 2J1RA 2EIBA 3P1IA 4OYUA 3WF0A 3UESA 5IJRA 2VTFA 1W8OA 3CDZB 4A41A 3I3DA 3J7HA 4OZOA 4ZZ8A 3ZM8A 1JYVA 1GU3A 3VD4A 5C71A 1F4HA 4JKLA 3UNPA 1KGYA 2ORZA 2VZSA 3C7FA 3ABZA 3I2IA 4L0PA 4P5YA 2VO5A 1W8NA 3WNPA 2W9XA 2Y64A 3LQCA 3IDAA 2JD9A 1UXXX 3K4AA 3SKVA 4CU9A 1GMMA 4Z2AA 2WYSA 3BN6A 2VM9A 4LKSA 3I3EA 3A21A 2RV9A 3U37A 3WNLA 4MOAA 2W92A 2EIDA 2VQUA 3ACFA 2VZPA 1RYYA 2ZXQA 1L7QA 4XUNA 2JKXA 1OD3A 1GOHA 2VMCA 5DMYA 3JXSA
chains in the Genus database with same CATH superfamily
2WZR2 1OA2A 4C1XA 1N47A 2MEV1 2ET7A 3JZVA 5L36A 3GZUC 3KV4A 2AACA 4WV8A 1CN1A 1AX2A 5FYCA 1F2NA 2GAUA 2H6BA 2ZEWA 1YEWA 2VTXJ 2XWBB 3EXUA 3KCCA 2ZAAA 5EJ1B 3ON7A 1O5LA 5APAA 3NJVA 3IWZA 2QVSB 4FOQA 1GNHA 2JDMA 2D3SA 3CMGA 4PI0A 5FZ0A 2VOVA 3PUSA 3OGGA 1IS3A 1RUC1 2D7FA 1IKQA 2A6VA 1NKGA 4GH4B 4L9BA 4FVVA 4P00B 2DCJA 1W6QB 1JHNA 3G6JB 1YQ6A 1HRI2 2BOJA 2WO1A 4YW7A 1GQHA 4FPFA 3AKQA 3JCIA 5F2SA 1QJY1 2GALA 1UU4A 4FCAA 3Q8BA 4Z1VA 4A45A 1HN0A 3KQRA 1ZBE2 5D8AC 4UI9L 5JAXA 4ZU7A 2CSGA 4OFGA 3W9AA 1SFPA 3BYWA 3POJA 4XTPA 3E5XA 1X8EA 4V1PA 4R9CA 3AYCA 3TN91 1WCSA 1R081 4DUVA 3AZWA 1TE1B 4H7MA 1Y43B 3MIGA 2QNKA 1SQ4A 4E4DX 2R062 3ILFA 4LOSA 4COWA 1US3A 4AEDA 3H0OA 5C8WA 4R9BA 1MEC3 1S0JA 4UAPA 3MZHA 4META 3ZO0B 1DP0A 2GC3A 1QEXA 2WNVB 1QQP3 5EYXA 2A3YA 5FXWA 3S6PA 5T3NA 4F83A 4AI0A 3ME2A 2VZOA 5FZFA 2HWB3 4CUAA 1IS6A 1CAUA 4QU2A 3AFKA 2FCVA 3GXUA 2IVIB 3J7NA 4LE4A 3ZKYA 1W6QA 1WMDA 5LB6A 4XF3A 2VOTA 1ASJ2 4KH9A 1AHSA 3AMHA 3VHOA 5LK7B 5HPOA 1ODMA 1POV0 1U5YA 5FK8A 4ZU4A 3LSEA 4OI1A 1QOOA 1TZOA 2WA3A 1RITA 3TOJA 2RMU2 2ET1A 2WAOA 3M3CA 1ZRFA 4FT8A 4CDUC 4YVSC 5IUQA 4TWTA 4ATFA 4CEYB 1EAH3 1WLTA 5CG8A 3I54A 1UY3A 2IC1A 3J8F3 4JKMA 3RI9A 1N1YA 2GP5A 4QHBA 2YMZA 4GWMA 1CZTA 4LBNA 3H1MA 3Q8AA 2CGOA 2ZGUA 3NAPA 4RGGA 3KV6A 1RINA 4ZPIA 5FO7B 2DUQA 5F3GA 5FUNA 4C91A 1BKZA 1TME2 2D5HA 4NROA 2BRTA 1OOPB 3M1HA 4X8PA 1XNCA 1UMZA 3NL1A 4XJZA 4ATEA 1VBE1 1PVC1 5FJHA 5FK7A 2PLV2 3IPVB 4I0BA 2BWAA 4CUBA 2VY0A 4AEJA 5JSOA 1G7YA 4B4PA 1OQ1A 4IE0A 2E7AA 4GULA 1H8VA 2K2SA 4BMEA 4A3ZA 1JYTA 2YGLA 1QJX3 1C3HA 4AVCA 4JGYB 5EZWA 4AVAA 4CCEA 2QTWB 3ILRA 3FBMA 1HB2A 3I2FA 3R05A 4Q29A 5CFCB 5F37A 2QZ2A 1RUI3 2ZEZA 4IEUA 5GZDA 5CAZA 4XJUA 4GMP3 4NHMA 4XHBA 1JOJA 3VZJA 3VL8A 2MEV2 2PHTA 4XF4A 4FFHA 2EXKA 3ILNA 3SCHA 5LBBA 2FDIA 3LPFA 2FQPA 3WDUA 4M01A 2ATFA 2V5DA 3ZFGA 1VMHA 5I0RA 2V72A 3HNMA 4OUEA 5G04L 2ZTNA 3TN93 4D6RA 4DXSA 3OEBA 2JDPA 3LFMA 4R4XA 1W2TA 1JI6A 5I0UA 5B4NA 2WQZC 1YIPA 1GV9A 2R1DA 4IEPA 3KF3A 4WM7B 2LROA 3TYJA 2E51A 3M3IA 5JPNB 3PLQA 4LBQD 1R091 1UZWA 4QPWA 4N43A 4Y3OA 5A7WB 3GBGA 2DCTA 2Y60A 3WF4A 4FAHA 2ZZJA 4D6SA 4WM8A 4FBFA 3I4IA 3WDVA 4HOOA 1LNSA 1UXZA 4AI8A 3D0JA 1ASJ3 5L7OC 1WCUA 3WP4A 2Y6FA 3HQUA 4HK8A 4N43C 3RS6A 3NMBA 2GC2A 3AMNA 4CCCA 3CEWA 4RL7A 3T4VA 2C9KA 4URTA 1QH6A 5LA0A 3Q8EA 1WWYA 4YW4A 1FOD2 1OPOA 4Q4X2 2XUEA 3T30A 2FBEA 3C7GA 1EAH2 3FHAA 5CKQA 3PHMA 5KHJA 1AR91 1SHWB 1Z0HA 2MEV3 4XXAA 4W6XA 1AR81 2MHFA 1RJ7A 3BALA 3FLRA 5JVVA 2E63A 1RXGA 5H9PA 5HCFA 1KS5A 1WUVA 2XQRA 1F31A 1KJRA 1XYNA 2BOIA 5J48A 1AX1A 3CJIB 5E8AA 1BZWA 1LHUA 2HWC2 4XACA 3VGIA 2QQMA 5KHHA 1GZ9A 2FCUA 3CQOA 2EXIA 3K3NA 2JECA 5ACA2 1ASJ1 3VD9A 4EN8B 4LUKA 1W6MA 4CP0A 2VUAA 1RJ8A 3ZSJA 4R52A 4KGGA 4I09A 4WVWA 2QQLA 5KWRA 1AJKA 5EXOA 1HX6A 2Z79A 2RM23 5FYYA 1ZRDA 2R7EB 5LBCA 2VVFA 3DF0A 4JQTA 1ZBA1 5A7SA 4UT5A 2DVAA 5IK7A 4FQZA 3K75B 3MBWA 4QX7A 5LZ6A 4QPIA 1SLAA 2P5BA 4MXWB 2VPVA 1DZRA 4OHWA 1XBFA 1RHI3 2BBAA 3N9OA 5FYBA 1EPWA 4PIXA 3IIAA 4IE4A 1H6YA 1O8SA 4KWKA 1WMEA 4AG4A 4PBOA 4UYBA 5LCWL 3ZX7A 2ZX0A 3GZEA 4IETA 4MXVA 1JZ6A 1UW8A 5FZ1A 5L19A 4KBBA 4AQSA 1XPWA 4HBNA 2W94A 3PVBB 2Q1ZB 4RN5A 4BB3A 1FNZA 1ZZCA 2WKKA 1OSGA 1LU2A 3NSTA 1J83A 1Q43A 3VDDC 1SDWA 1RUF1 1K42A 4RQPB 3DYPA 4QMAA 2WNUC 3BPZA 3KGZA 1PMJX 2ZX4A 1N3QA 4A3XA 3OBRA 4HVOA 2VZQA 2Q8CA 3WV6A 1OF3A 1NLSA 3HT1A 4I3PA 4UFJA 3RJRA 1GZTA 1RUJ3 5FQ0A 4PHZA 3J7MA 1RUI1 5FZMA 3K46A 5ISLA 3GHMA 1COV3 3K48A 2YC0A 1ZVFA 4PF1A 3KM5A 2AR6A 1O6UA 2DUOA 3HVDA 3VBOC 2EICA 3ZYBA 1R092 2RHPA 3FC0A 1YFXA 3R0RA 5A7OA 3WSOA 4X6RB 4BLJA 4TN7A 4YVSB 2WL1A 3IMMA 2Q8DA 4YPJA 1B35B 1OXCA 3I3BA 3LA3A 4FXGB 4CDQB 1LOFC 2JG8A 3N9PA 3JBG2 3N7JA 1WLCA 4QT6A 4RHV3 4HFSA 3A22A 1NA1C 1YXWA 3LFIA 4OMCA 5T5OA 5FY9A 1X82A 1PGW1 1D4M3 3R4DB 5FZIA 5C8CC 1YWKA 1JZ5A 1FOD1 1AR71 2X10A 4Q4X1 5HXVA 5C9AB 1BMV1 5JR2A 4GALA 3N35A 3KSCA 4RA0A 1U5IA 2Y6KA 3C7HA 3IB3A 4Q1RA 2OS2A 3U1XA 2PAKA 3HQRA 4AQTA 1H30A 2LUWA 2WZPP 4BQWA 4CDXC 2FMDA 1SACA 1UY0A 1NOVA 4LBQA 2BEOA 5FPBA 2DDUA 5FPLA 4A7KA 3DGTA 4DPNA 2ZGOA 2PAEA 1QOSA 2EVXA 1PO11 3OBTA 1W99A 1LOCA 1V6LA 5FYIA 2YBSA 4PF5A 2PHLA 2IXCA 4UF0A 2D40A 4BIFA 1UZ0A 4C1WA 3NJXA 2DTWA 1R1ZA 2BZDA 2WZ8A 1YRZA 4QGMA 3ZVXA 5FUPA 3D5OA 5FZGA 3WXPA 5HCHA 2C24A 3AX4A 3LWCA 2ZHMA 3FJSA 5BUVA 3EYPA 3UJOA 3LOIA 4YSFA 3IAPA 2DF7A 4QGNA 3HN3A 3VBOA 4DUWA 2P3JA 2D93A 2JXAA 1ZBA2 4KG0A 5LW9A 5C9AA 2ZGNA 1S2BA 1URXA 3VHNA 3WCRA 5FLHA 4EN9B 3I3QA 1FPN2 2X09A 3ZDSA 2QQIA 3VDAA 5F6LB 3O1OA 3LGRA 2JB4A 1US2A 1QJFA 4IW3A 4QXHA 4K8RB 3IDEA 4RFRB 4B1LA 2CDOA 4MGTA 1CAXA 1X36A 4KG8A 1TVGA 5L9RA 3VBUB 1XYOA 1RL3A 1XSRA 4NMIA 3VB9A 2JICA 1BXHA 1UOBA 4YWAA 2JEMA 3VKNA 1XE7A 1QIQA 2GC1A 4JRLA 4FSJA 3B9CA 4B7EA 4R9DA 1RUF2 3J8F1 3G7DA 3LEIA 3RNSA 1X50A 1MS0A 4XQWA 3GM8A 4BQ4A 4HVRA 5FZAA 1H9PA 4IEYA 3HNBM 2XBO2 2CGPA 2HJIA 3V0BB 2YU1A 5KXEA 2HEVF 1AYN3 4XJ9A 2YUEA 2HWC3 1WW5A 1Q56A 1C5IA 2VXRA 1IPSA 1C8M2 1LEDA 4DMIA 4XZPA 3WG3A 4YARA 1QF3A 5JI7A 1RUH2 1ZA4A 4H2AA 4IV3B 2VNGA 3RYKA 5DUWA 2PQQA 4AL9A 2ZCWA 4CP9A 1JYCA 2WJSA 3O0XA 4DINB 2P6HA 4KWJA 2X8KA 4LKDA 2WFPA 4Y1XA 4CU7A 2QQJA 4FPOB 2WN3A 2E53A 4F8AA 4LMFA 1FAYA 1KJLA 4YYOA 3CZUA 2YG0A 3GZTB 2E33A 2J22A 3GF6A 2E32A 1GNYA 2FZ2A 3GNEA 2RVAA 4HPKA 1LB2A 3B02A 3VHRA 3O1VA 1S0DA 2XJUA 1UU5A 3NO8A 5A80A 2XH6A 2ZHNA 2F17A 1CJPA 1RMU3 5LRRA 3WF2A 4AQ6A 1NE6A 2ZEYA 5LRSA 2Y8KA 2ZPXA 3FX3A 4WM8B 2BBVA 4CPBA 2XHNA 4Y4RA 1ODNA 1NY71 1Z7S1 1W6OB 2IXKA 3KQ4B 3H9AA 1G6NA 3CBNA 3ENRA 5C33A 5BNPA 4LE3A 3WQ7A 3MV01 2WR9A 4AVTA 2R0FA 4Y5Z0 3LA7A 4OUSA 4YG3A 2ORXA 2YGMA 4I0WB 3KHBA 4PDWC 4AEKA 2HWB2 4BZ4A 1G9DA 3QBQA 1LENA 2IWGB 2TBVA 3NKTA 4MLOA 3VKOA 1V00A 1ENXA 1NE4A 5FZCA 5A6ZA 1D4M1 4DXRA 2D6LX 4O7XA 2WNUB 1YQ5A 2LRPA 4LBLA 3TEWA 3UGFA 4EJRA 1YQCA 2ENRA 2NZ9A 3VD7A 1PHMA 3MUY1 4UWDA 1WCKA 2Z4FA 3JQXA 3VBRC 3I59A 3QH7A 4JRAA 2J1RA 5A7PA 4GJYA 4XFBA 3UESA 2VTFA 4JQRA 4AEDB 1AYN2 1SCSA 1BLZA 3CDZB 4LO4B 5FYZA 3E97A 5A32B 4A41A 3I3DA 1X8MA 2EXJA 2WS92 1GBGA 1A6CA 3GCXA 3POFA 1VBB2 5C71A 1F4HA 5FOJB 1VBC3 4Q5OA 3U11A 3A0NA 1AYM2 1Q8OA 1OI6A 4N9HA 4Q0VA 3MLKA 3UKVA 2ORZA 5JOXA 5J3UA 1WGPA 1Q8QA 3ABZA 1GANA 1NLRA 2Q5TA 4JAAA 3IT8A 3UKNA 2BYVE 4KNCA 4LHNA 1BJQA 1RUJ2 5EYYA 3M2MA 4RS5A 3WNPA 2W9XA 3DV8A 1H9WA 2O0OA 5BYNA 2BP6A 1OA3A 1CAWA 2RS33 1Q5OA 3NV3A 4CU9A 2YHJA 5C3OA 1RTVA 1WBFA 4LXLA 1PO22 2VM9A 3HR9A 2G9FA 1TMF2 4L99A 4MGKE 1WA6X 4QQLA 5D2AA 1K5MC 1UIJA 2IXIA 3A21A 3NNLA 3WNLA 1GZWB 5IVCA 5BNNB 4IXLA 3NVCA 1NCRC 2B42B 2XUMA 4XF0A 3OTFA 1FT9A 1RYYA 1L7QA 4XUNA 3K51A 3BUCA 1SPPA 1J3PA 4XFIA 5DAPA 5DMYA 1UPSA 4XC9A 3LCPA 2D3PA 4LK6A 4N90A 3VZLA 5A70A 5FFOC 5AFBA 2RG4A 5JLVA 4E2GA 1CPMA 5FIXA 2D3RA 3OGVA 1I9RA 4LHLA 3VV1A 1ZRIA 5IVJA 4ZXKA 3ZIXA 5FXZA 1UL9A 3AB0A 2IXJA 5JWPA 3WQ1A 4AW7A 5CKMA 1MZEA 1IQDC 3MGUA 2FDKA 4C8DA 2ZS6B 4ISRA 4I3GA 1O3TA 1PNGA 2PHRA 4AHXA 4EYUA 1OBNA 1W8TA 1S0BA 2JWPA 2WT0A 4XAAA 5GLVA 5A1FA 2ZGRA 1E5HA 1W6OA 2VOXA 3F2ZA 2VAUA 1V9U2 2DBIA 4XILA 2WABA 5F6KA 5FDBA 1GYKA 3HOBA 3ZXDA 5E1RA 4TLGA 4NIDA 4GB31 4AZZA 2CDPA 3SHRA 5AVPA 1FMD2 1S4CA 3VZMA 1MS8A 2D98A 2B46X 4Y1YA 5AC93 3N9MA 5EQUA 1NY72 1Z7S2 3GHNA 4RHV2 1W6NB 2OKXA 4E4ZA 2PHDA 4GWIA 3KF5A 4AAPA 1HQLA 4HKLA 4Q27A 5CADA 2R1BA 2WWJA 4FQ4A 3O14A 4NO4A 3WG2A 4D69A 1HDKA 2E7TA 4ES8A 1GFF2 1OC1A 2E31A 2HWB1 4H14A 3LE0A 3WDYA 4BMBA 3DECA 1DGRN 4Q4X3 5JZGC 5FZHA 5JDBA 2G4IA 1PVC3 4YGDA 3FBYA 2PA7A 3HBKA 1GSLA 4D7TA 3WP3A 2BGPA 2D6KA 3AP4A 5SV5A 2GNTA 1XRUA 4XETA 4EWAA 2JDAA 1RUD2 2W0XA 1V6OA 5C3SA 3ZYRA 3H3ZA 1W2OA 1PM7A 3T0AA 1RVF3 2R072 3APBA 1UX7A 1RUE3 1UMHA 2BJSA 2C26A 2HWE1 3ACHA 4HT1T 3WW1A 1MR5A 3O1MA 1OKOA 3THTA 5C7GA 1LTEA 2UURA 3POYA 2JX9A 1W2AX 1AYM1 1CZSA 5IAXA 4PQ9A 3T1LA 1CZVA 3AZVA 3ZYJB 5BNOA 1HV0A 4UFLA 2PHUA 3MEPA 2YY1A 3AL5A 4ASKA 1RGSA 5FAXA 3UYJA 1R1A2 1V6JA 4ASLA 2JG8C 3WF3A 3WG1A 2FDJA 2RS51 2ILMA 2FCTA 4UBGA 3MFAA 4GH4C 4ZS2A 2QFEA 1AXZA 1HRV3 4XAEA 5I8SA 4BXFA 4XQ4A 2VG9A 3PURA 2VUDA 2PHWA 1CAVA 5G05L 2Q8OA 2WFF1 4A44A 5F3IA 2BGOA 3ROUA 4YW1A 4FPEA 2OIIA 4HG6B 1UO9A 5IAVA 1ZX5A 2QJVA 4IV3A 1BK1A 1DLCA 3RZLA 5F32A 1UY2A 1WW4A 4EWEA 2VMIA 2F4LA 4E8CA 1KS4A 2ES3A 4YVWA 1H0BA 4PQQA 4LKFA 2BWCA 1X9PA 5A3LA 4WZCA 2YFUA 5JIAA 1UIKA 4TYSA 4CDQC 5CBLA 3IIIA 4BQ5A 1NCRA 4QGLA 4E4HA 3B00A 3CZJA 3W58A 4E4SA 1JMUB 1MS3A 1RHI1 1YIFA 2JG8B 3MF9A 5BNOB 2P4EA 5FZ3A 3IDCB 4MX3A 1L7LA 3LDKA 3SNMA 4PLNA 4BJ0A 3OYWB 1MS9A 1DZQA 4NUBA 3SH3A 2CWSA 4GKXA 1RUD3 1IG3A 1OPMA 1QOTA 5F5AA 2PAMA 5EFUA 4K7JA 1QXJA 3JUUA 5DAVA 4K9SA 1QY4A 1BVVA 1V9U1 3L2HA 1QMJA 1AF9A 2VL4A 3T1MA 3THDA 4A2UA 5FO9B 3O1RA 1IQAA 2CV6A 2B39A 3K77A 5HCBA 3WW2A 1JZ4A 3AFGA 3H8OA 4P14A 4NOTA 4IV3C 4LPLA 1SBEA 1OLQA 4XBQA 4QX1A 4GB32 3ES1A 3FUOA 2PXJA 4QU1A 5AVAA 4XOGA 5FO8B 2JDHA 1M4WA 2WO2A 3MPBA 5L9BA 3VBUC 3POBA 3K3OA 2W87A 4P9WA 2LM3A 5ERLA 5EJ3A 2RR12 1BQPA 1LGCA 2Z69A 3WD5A 2AEYA 4AOCA 5DDJ3 2BNOA 3PTYA 5DN2A 3H3LA 5F3EA 1VJ2A 4NAMA 1DBNA 5C3PA 1ALYA 5A7NA 2AH2A 3AC0A 3ZFEC 2A1XA 2XDVA 2B9UA 4BU2A 5I0TA 2UWAA 5ABJA 4DZGA 3BVCA 4G3YC 5JIUA 1GICA 2GP3A 1TNFA 4CDXB 4L92A 1A8DA 4QHOA 1MZFA 1Y4WA 2R043 3OPTA 1K3IA 1JUHA 3OCPA 1FATA 1YJKA 2ETEA 5HI0A 4FP2A 4NN0A 2JG9C 4MYEA 1LOFA 1LHVA 3DUIA 1RUD1 4Y22B 3CU7A 1ACCA 2YU2A 3M4FA 3MV11 5FYMA 1W04A 3NKGA 4HMZA 3D3AA 4LNVA 1LOGA 2VQAA 5DAWA 3VBSC 4DQAA 1WLDA 2AYHA 1SLIA 2N7GA 4CTEA 3D82A 2D43A 5FLIA 1AR62 2GN3A 2HWE2 3T2PA 2DVGA 1JXNA 5CYYA 3AZXA 1KRIA 3OSDA 4KBZA 4M3CE 3RMXA 3ZN5A 1XE8A 3QCWA 5A32A 1S0EA 2NPIA 1UYPA 2XMLA 1ZYBA 1ND2A 2UWBA 1O3RA 3MIBA 4MHRA 1LJ7A 1R1A1 1LHWA 3W20A 1JYNA 1SPPB 1JODA 4CCOA 5J7MA 3LF7A 2D97A 4M4RA 2XR4A 3AKPA 2OW4A 2E7QA 2RJKA 4JHTA 4QKFA 4DUXA 1T6GC 3VBOB 2LTNA 1Y9GA 5GJ6A 3NV4A 2RS32 4OI4A 4YZ4A 4CP9B 5BNPC 4IEOA 4FPLA 1S0FA 2QQVA 2WT2A 3L9JT 2ZEXA 1QGLA 1O7FA 4NPLA 1YUDA 1UOGA 1VBE3 2VMGA 4YG6A 3PUQA 5FY0A 4UBHA 1WA4A 3VDDA 4CYDA 5CU1A 4QX5A 5C5TA 3QLQA 2NQYA 3VBFA 3RZMA 1O59A 2VMHA 3WF1A 5IK8A 4BXSV 4Q8KA 3CJIA 1C1FA 1F9KA 1D0GA 1SEFA 3UV9A 2R042 5C5UA 1HB3A 1LODA 1MVQA 4J25A 2GMPA 3B69A 1FX5A 2ZGLA 5GLTA 4DY3A 1DGWA 1WCQA 3PJYA 5FZDA 1HN1A 2B7YA 4CEYA 4B4RA 2VTXA 4Y1VA 5T5LA 4CU6A 4AK3A 1UX6A 4LK7A 1PGL2 1W9TA 2CTVA 4ZS3A 4J1WA 1N1VA 1PZ7A 1VPHA 3OY8A 4KMQA 4XF9A 1W05A 3U78A 1XNDA 1A3KA 2W47A 1OMIA 4GIQA 4H55A 1DIWA 3USSA 4E8DA 2HWD3 3OBZA 4OLLA 4Y33A 3ZN6B 4A4AA 4OQ8A 1KDKA 3SMHA 3DCQA 5DZEA 3KT1A 3C8XA 1OUXA 3KT7A 4XJAA 2Y33A 2OZJA 3RPQA 3W21A 2WLPA 3PVOA 1GUIA 2DCYA 2ZAHA 3LPGA 3NW4A 4ZU5A 3WW3A 5A1LA 2Q4SA 3NRUA 1W9WA 4ITCA 2J1TA 4FOYA 1QQP1 1ST8A 5FP7A 3T2TA 4K40A 5F3CA 4AQ2A 3SITA 5BNNC 2J7MA 3TNQA 4V2WA 3ZPYA 4UOJA 4XFFA 2D44A 3ZSMA 2FMYA 5J36A 3JB4C 4I0AA 3EQEA 3GBFA 3P3PA 4CDUA 1K45A 4HONA 4N53C 3DL3A 1DQ0A 1EPZA 2VZ3A 1UZYA 3KWVA 4KWLA 2O8OA 3H8RA 4YFZA 2BNMA 1FV3A 1WD3A 2DFCA 2ARBA 1QHDA 2O8QA 3FLTA 1TME3 3GJAA 4Q0SA 4Y4YA 2DCKA 3ZYGA 1AR83 1S2EA 1C4RA 3TAYA 2G9GA 3VZOA 4DFSA 2Y0IA 5E6HA 3PIJA 5JMCA 3I3MA 1AL23 2OX0A 1CX4A 4FFFA 3CHXA 4P5HA 1REDA 4CDWB 4Z82A 3JD73 5CFCA 2YC2A 2CL2A 1AR61 1YFUA 2AENA 3LD8A 1HW5A 2Q8EA 4AEDC 1PIV2 2JDNA 3I49A 1UNBA 4RS5C 2OYZA 2D5FA 1ZZBA 4HN0A 1QJX1 1UF2C 1ZM1A 4LHSA 4XABA 4PBPA 4BISA 4JGZB 1W0PA 2VU9A 4XEZA 2HWF3 4IGPA 4AVVA 3ZPOA 4N53A 2ZOEB 4OCTA 5DUVA 2FD8A 1W3XA 3ACIA 2A5ZA 5K0UC 1B35A 3ZXFA 1BHGA 1EYBA 3VBHC 5B2GB 1W28A 3ST7A 5FYUA 1G9BA 4AYUA 5M0TA 3QH6A 4IEVA 1VBA1 2UY8A 4YW6A 3ZR6A 1ONAA 3PUHA 4QQ2A 4QQPA 3ZR5A 2AC1A 1O3QA 4FOWA 2WT1A 2QDNA 1PZ8A 3AL6A 4XDQA 1FI2A 3AMPA 5K9YA 3C7EA 1HRV1 4P9XA 4XMAA 5KBFA 2QBXA 3MLJA 1DQ4A 4FPKA 4IEQA 4V2VA 4AVBA 1UY4A 2WZR1 1ULGA 2BW8A 4FPYA 4MGQA 4ONUA 5FZ8A 1CAWB 4A7ZA 4HN1A 4IEXA 4LJHA 1E5IA 4EN0A 1MVEA 3D6EA 2DUPA 2A6XA 2GC0A 1LGBA 1VBD3 2PHFA 3WNKA 2KXLA 2TNFA 1KXGA 4Q4W3 4J6GA 3NAPC 4NRQA 2IXHA 1J3RA 2QZ3A 3ES4A 2A70A 3OD4A 4CCDA 3D0SA 5I8YA 1ZZ7A 1LRHA 4JV4A 1LULA 1OKQA 1GZWA 1DQ2A 3V0AB 4HSJA 4OHZA 4HANA 1MEC1 3POEA 3CIHA 2XLAA 5JOYA 1FMD3 3CL1A 1F5JA 1C8M3 2DVBA 1ZREA 3SEEA 1L7RA 2CYFA 4GB33 4Y1ZA 5I93A 4WVZA 1Z7S3 1G8WA 1NX9A 2HWF2 5FY7A 5I0DA 5CFDB 2XBO3 1NXMA 1UN1A 3UL2A 4NIHA 1UYZA 3VKFC 3BKZA 4QDRA 3T0BA 4AFDA 4NIGA 5A6YA 2I2SA 5ABJC 5FTTC 2JB8A 1V0AA 4UFIA 1RUF3 2R061 5F5QA 4FAGA 2DV9A 4INDA 4MV2A 4CUGA 1SMVA 1RMU2 3NWKA 3UGGA 1JOPA 1OH4A 4Y24A 4AWDA 2K0GA 2CY6A 5CG9A 1YQ8A 3ZOIA 1PK6C 4DXTA 1JN2P 4XFCA 1BBT3 3ZYFA 1XJAA 5E16A 5A3PA 1LOAA 2J1EA 3AXEA 3LIHA 3ZFGC 3ZMNA 5GALA 1RB8G 3WP5A 3FHQA 2FHRA 3BI3A 1O4TA 1V6NA 1GOGA 2A75A 4LBMA 1RUOA 1PM4A 5JXGA 5FMDA 1SBDA 3BGAA 5HXMA 1RC6A 2XOMA 2WSVA 2EIBA 1DU3D 4MUVA 1HQWA 3BTYA 3AKRA 2Z5WA 2BV4A 3WUCA 1K5MB 2BTVC 4LOTA 5FMCA 4BA6A 5HV0A 4BQYA 4LORA 3VBRA 4CPBD 1IOAA 1W6NA 3BU7A 5BXXA 4PI2A 3KLSA 3POIA 4IE6A 4HXCA 4H3WA 5FP9A 4XHXA 4M0NA 1VRH2 4AI9A 2Q0AA 3D4KA 3HD8B 3MF6A 3SH5A 3TRSB 3I2IA 2C1FA 4UFKA 2I45A 3H8UA 1DGLA 1FXZA 2VNRA 4P5YA 4XBNA 2EAAA 4P9IA 1W8NA 4EN7B 1TNRA 2Y64A 4G4FA 3O1TA 2JD9A 3DKWA 1BYHA 4RD7A 1UXXX 3BOWA 1GMMA 1H4HA 3FE5A 3LZZA 1ZNPA 1VBE2 4Z2AA 5JSRA 2PLV1 4MG2A 2WYSA 1VBC2 3IKWA 2JJ6A 5DAQA 3RSJA 4AI3A 4AFMA 2W92A 1LR5A 2EIDA 1J1LA 1HXS1 4W6YA 4O65A 1PO13 1DLLA 1W0OA 4D94A 5HV4A 4QKNA 4Q8LA 1OD3A 1K5JA 1DG6A 1HRV2 1ND3B 2VMCA 1IPJA 1QJU2 1VALA 5CEHA 1HQNA 2JD4A 3AKTA 3BIWE 4EWDA 1JU3A 3ZXEA 4AI1A 3ZFFC 5A3OA 3OOXA 3E5QA 5FP3A 1IS4A 1D4VB 2ZKLA 1DYOA 4KL1A 1PO23 1GQPA 2X5IC 2WQ4A 3WDXA 1FOD3 5FKCA 3HIFA 5FXVA 2FZ1A 4YM1A 1MS5A 3LIGA 2CU5A 2IFRA 1D7PM 2IUWA 1ZRCA 4I2OA 3CF6E 1XNTA 3WDTA 3RWKX 1NCQB 3PNAA 1ZZ6A 2Y6LA 4QHZA 5BNQA 2A71A 4ZXEA 2W95A 5LY2A 4TZDA 5DAXA 1ND3C 2QE3A 4QB2A 1FYUA 2VQTA 4YM2A 1YQ2A 1R64A 5LA1A 2DVDA 2ZX2A 3N7MA 1KFXL 3LDBA 4MGYE 2JKBA 1OLMA 1ND3A 1ULFA 4Q4V1 2YB7A 1GWMA 4MZUA 3ZN6A 5JZGA 5LY1A 1EAH1 2GNMA 3PDQA 4RR3C 2LS6A 4K21A 4NJ4A 2P17A 4D7SA 4BLIA 1QJZA 5K8SA 4P9LA 3PVNA 2HBUA 5C3QA 1ULDA 1BEV3 1V6IA 4OUMA 2J1UA 1AR82 1FNYA 1RMU1 1YFYA 1CONA 5F5CA 4CA9A 4XDPA 5LK5A 5IWFA 4EE2A 1W2UA 1JYXA 4YRDA 4Q4Y3 1V6MA 5J96B 2HWC1 2NYYA 4OMDA 2VCMA 4B1MA 4GQ7A 3HPNA 4RYDA 1A8MA 1S0GA 4R8HA 2D6MA 2NMOA 1BBT1 5B4XA 3ZFFA 5ACA1 2R6QA 3MW2A 2YZ4A 3AZYA 4P02B 2FDHA 4HLTA 1XOYA 2X53S 1IZ3A 1CIYA 1UWWA 3MIEA 2RJLA 3ITQA 5FBJA 5FJKA 1ULPA 4BQ3A 4UW5A 5GZGA 2P37A 3P6BA 4GJZA 1ULOA 1TQ5A 1ULEA 5C4WA 4UXAA 5LATA 4AEMA 3T2QA 4B4QA 3AYEA 3AVRA 4DOUA 4QB6A 5DUUA 4LT5A 1XNBA 1MZ5A 1NAEA 2BGCA 4CCLA 4UFHA 3GJBA 3TBDA 3DEMA 3THPA 2VMDA 3GYDA 5FMOL 4S2DA 2V5YA 1W8WA 1AL22 3NV1A 4AHWA 4JX0A 3OBAA 4LA3A 2LW8A 2QKDA 2HKXA 4O9GA 1E57A 2R30A 1RVF2 3EHKA 1ZZ8A 3ZIWA 1UMIA 1MS4A 3J26N 1OQEA 4BK4A 4M3CB 5F39A 4OI0A 4N53B 2XJPA 4YW3A 5FZ6A 3LAGA 5FCCA 3K2OA 5FZ4A 5FPUA 2GNDA 4QQHA 1CJDA 2GMMA 2OT7A 4CCMA 3AP9A 5F8PA 3PL0A 3VZNA 1OOPA 3DKQA 2O14A 2YPJA 3KZ4C 2VMFA 1EY2A 2DYCA 3NAPB 1QJU1 4N7IA 4PT6A 1LECA 1WLWA 2Q1MA 2H0VA 3PMEA 1UPIA 2XJVA 4U2AA 1BVP1 1RUI2 5I0SA 4FPHA 4YM3A 2ID4A 2R073 1Q3EA 4MH0E 4XDOA 4Y1UA 1O91A 2C4XA 4FI9A 5C6CA 2NP0A 2WZEA 4GWJA 3TEYA 3QOPA 2Z2SB 3KCXA 3K4ZA 3BTZA 4LR4A 2XXZA 1OF4A 4FPCA 5DQ0A 2VJXA 4F3JA 1NYWA 3FHIB 2WUHA 1RUNA 3ZSLA 5LASA 4XUOA 4K20A 1PGSA 3RJ2X 2CAVA 1PX4A 1H8TC 2DU1A 2DFBA 2WO3A 5IVBA 4QKDA 1MS1A 3ORJA 2ZKNA 2XWJB 1XQNA 2WNUA 1ZBA3 1H8TA 1QJY2 2OQ7A 4CEWB 3RZZA 3J9SA 3ZMOA 1ZBE1 2YBPA 1Y3TA 2HYXA 4AHZA 1VAVA 1JYWA 1ENRA 1Z78A 4MADA 2XVGA 4XQDA 3TN92 3S0MA 1BMV2 3J4UH 3LKJA 5JCTA 3MPPG 2OPWA 5JSPA 2RS12 1YHFA 2F4PA 5FR3A 3IZOA 5T5PA 3OYWA 1DFQA 2H6CA 4CDWA 2NM1A 2UY9A 4NIAA 3WX5A 3T4HB 1OHFA 1UAIA 3H7YA 1GWKA 1OFSA 4XTMA 3WHUA 2IXLA 4XW3A 5A6QA 1UY1A 2ZMNA 1PO12 3MIDA 1JHJA 4DEVA 3WR0A 4DS0A 1EV12 1UYXA 2ZGPA 4ARXA 1N3PA 2G19A 1DYPA 2TUNA 1RUG2 2VNVA 3B93A 3MLLA 4GD4A 4Q4Y1 4QPYA 3VHPA 4D7YA 4E2QA 3FFQA 2EF6A 3O0WA 3SLIA 3Q8CA 2Y38A 4AHYA 3KGLA 5FP8A 1CPNA 4CDUB 2W1WA 2V4AA 1QDOA 3IMNA 2VZTA 4CU8A 2OQ6A 2XGXA 2VVDA 1OH3A 4QWNA 1GZCA 1NA1B 2ZMKA 1J1TA 2B45X 5KHKA 5IW0A 1YJLA 1XXNA 4LBJA 5FY5A 3RMYA 3ALQA 4DB5A 1FPN1 1SZBA 4XUQA 1WW7A 3V0BA 3TEZA 1G86A 3J7LA 3MI8A 4MGSA 2YROA 1G9AA 3ZYPA 4IEWA 2VGDA 4K1YA 2UU8A 4FTBA 4YGBA 2XHKA 1TME1 4CP2A 4MXWA 1CVNA 2P6CA 1E5RA 3JQWA 4AGGA 1S1AA 1PVC2 4Y5TA 2XVKA 3OEAA 5BPXA 1VB2A 5D8AA 5TSWA 2VZVA 5K0UB 3KMHA 4QPIB 1JZ3A 4PDWB 5CFCC 1PK6B 1X7NA 4JKKA 3J8F2 3N36A 1V6KA 4ARYA 5BV6A 4XFHA 1LU1A 2CNAA 1HKDA 3HT2A 1PMIA 4CSWA 4YW5A 3URFA 2R49A 4Z2WA 1UZZA 1NLQA 2G1MA 5IYYA 1KEXA 1OVPA 1EUTA 2C9AA 1JS9A 4Q2FA 5DXDA 3VD5A 5JXIA 4KI5M 4GXLA 2AUYA 1V70A 4X8NA 1QJU3 3OGJA 2B4KA 2QQOA 1Q8VA 2L9LA 1XNAA 2XQXA 4XZUG 3AK0A 4W50A 2YV8A 1ZZ9A 3R6SA 1RUH1 2G9ZA 1MQTB 1JUIA 2Q30A 2D6NA 1RIRA 2AZ5A 4I01A 4IGQA 4AGRA 5FBZA 1XC6A 4WVVA 4RQPA 1SDDB 2UWCA 4BIOA 3ATGA 3NNFA 2LALA 3PJQA 3LEKA 3M70A 5J98B 3H8XA 4UW4A 4DRVA 1J58A 3AKSA 5FWEA 1AUYA 4JTNA 4GKYA 4JCKA 3DXUA 5FMOS 1M06G 5FY1A 2VCBA 4Q0UA 2J1AA 3FFZA 1X33A 1N3OA 2ZGKA 1POV1 4TSVA 5GLWA 2IZWA 3B01A 4HK9A 2QCSB 5FLJA 3VN4A 1ND2B 4LEJA 2GH8A 3HAGA 1O5UA 1F35A 2W3JA 4LBQB 4X6QB 4YZ5A 2I74A 2XL9A 1C28A 1YFWA 1HB4A 4COZA 4LO5B 1Q8PA 1R093 4WVMA 2RS11 5FRAA 1O4ZA 2VBDA 5FZOA 1AR92 1MZ6A 1EUUA 1D2SA 1Y7BA 1K5MA 3B5LB 2ADEA 4BM8A 3DN7A 3S30A 1PZ9A 3P5BA 4XCBA 4LO6B 3ZYIB 2WN2A 2PYTA 4NRMA 4M0HA 4BQXA 3CJXA 1D4M2 1WD4A 3RZKA 2VE1A 2X29A 5CFDA 2X5IB 3SQOA 3EMRA 1EV11 3JBG3 1W6PA 3I2KA 4JZRA 4OVEA 3VDDB 4Q4Y2 4A42A 1RUG1 4CXXA 4K6BA 4RQPC 2XJSA 1LOEA 5FYTA 3VBFB 2VBPA 2WO7A 1W9SA 4OHYA 1AYN1 2GSYA 4IV1B 4LO8A 2YDEA 1DQ5A 4P9GA 4LQRA 4W6WA 4YVWB 3VKMA 3WNXA 1VRH3 3CO2A 3U10A 3TB0A 2JDZA 3NNJA 1G9CA 3FN9A 2BQPA 4RFT0 1W2NA 4DIQA 2QQWA 4WVMB 4CXYA 3PUAA 1VLNA 2WRAA 1P8JA 3WEZA 2V4VA 4ORFA 3WOGA 3WNOA 2VMEA 3RYRA 5A3MA 4YNIA 5FYSA 1RUJ1 2B9VA 2DU0A 1VIWB 4K8FA 4J1XA 3PMSA 4BWOA 2VC9A 2HEYF 2J1VA 5D21A 2HLEA 4BK5A 2VNOA 4B7KA 5F2WA 3RDIA 3WHTA 1H2MA 3OG2A 4FPJA 5FZ7A 3WQBA 1TMF1 3ZXKA 2TEPA 3N7LA 3EO6A 4HETA 5C8CA 1LCLA 3AP5A 4W8JA 2ZHKA 1SCRA 4FTEA 4QX0A 2XVLA 5ANQA 3WY6A 1RXFA 4AXOA 5AC92 1YC61 1WW6A 2GN7A 4HZFA 5DZGA 3M3OA 4IL7A 4E27A 1LHNA 2WBKA 3WNNA 5CFDC 3V56A 3FMGA 5JPMB 1KDMA 2Q1FA 1CAUB 1VP6A 2VUJA 4QB1A 3AYAA 4XIKA 5ABJB 1I1EA 2ERFA 5CA6A 2JG9A 2JDYA 4LIUA 3UK9A 5F1RA 1IPKA 4CDXA 1YCIA 2P3KA 2RM21 4NHLA 3ZFEA 3TNPB 1OT5A 3VKLA 2BFUS 1W9YA 2JE9A 2VCAA 2ZJCA 3C7OA 3GZAA 4PCRA 5DUXA 1NZIA 3HNYM 4Q4W2 2ZBJA 1D0HA 2EIEA 1EV13 3AP7A 3JBG1 3USUB 4I30A 4COVA 4GAZA 1W8FA 4KU7A 3K4DA 1FMD1 2Y34A 4S2HA 4AGVA 1PGW2 5C8CB 1VAKA 5HCAA 4Q4V3 4LIVA 4LO7A 5C4WC 5FZBA 2BNNA 1AR72 1H1AA 4XFAA 2PELA 4HPKB 1R083 4OI2A 2DTYA 4RHV1 3A23A 3MYXA 5H9RA 3I8TA 2ADDA 3V65A 1JU4A 3E5UA 4WM7A 1SLLA 4RR3B 2DWRA 5IVEA 2W1QA 3JD71 3IPVA 2P2KA 2R16A 4BDVB 4QPIC 2VZUA 1OA4A 3S7IA 4FXKB 4YLZA 3WW4A 1KD7A 2NN8A 5EP9A 2JIGA 5DZFA 4NPMA 4H7LA 5H9SA 3RFRA 2PFWA 4ZKTB 2FDFA 4URAA 5IVFA 4CDQA 5A6XA 5FREA 4XURA 4YZ1A 4ZZ5A 4XXPA 1COV1 3A7QA 5L7OA 3B7MA 3IM0A 3PVEA 3P1IA 3AJYA 3Q8FA 3IN9A 2ZMLA 1C1LA 1W8OA 1VMFA 2V73A 4ZONA 3LDRA 4RGKA 2RS53 1I6XA 3J7HA 2R071 3ZM8A 3ZXAC 3S5AA 1JYVA 1J59A 1O3SA 1GU3A 2XJRA 5KC6A 3WCSA 1VBA3 1CAVB 5LA9A 2ZHLA 4JDMA 3WZ1A 1KGYA 3UNPA 5KHGA 4NHKA 2VZSA 1WZXA 3C7FA 3KV5A 4XE9A 5KC5A 2KA3A 3ZFFB 4CEWC 2UYAA 3I59B 2GMEA 3E6BA 5FV3A 4YZ2A 3KD4A 2WWUA 3IDBB 3LQCA 3ZSEA 4UF0B 2WNVC 5BNOC 2I07B 4XCAA 2CGNA 3O7OA 3OY8B 4B29A 1IGOA 3KVAA 5GZEA 5ACA3 5KXCA 2WFF2 3BN6A 5I91A 4TTGA 4NPRA 3VBRB 2RV9A 2WS93 1DF0A 1OD5A 4MOAA 4BH9A 4CE8A 2D6OX 4DRRA 1W6MB 2VZPA 3ACFA 3MHZA 4G9SB 4UW6A 3U4XA 2ZXQA 4M00A 3LB9A 2JKXA 1GP4A 5D8AB 1GR3A 3JXSA 2OXBA 5AC91 1BCXA 2XBO1 3FUQA 4NHXA 3ACGA 4XF1A 3VBUA 4EROA 5EIYB 3OF1A 4EN6B 1QDCA 2ARXA 1J3QA 2BERA 4CEYC 1I5PA 3AP6A 3HQXA 1RHI2 1LEMA 1TMF3 2J42A 1C8M1 1G9FA 2QDRA 3A0KA 2W39A 4AFAA 4CEWA 2VZRA 3VUOA 4YZ3A 1SLBA 5K4LA 2HWD1 5BNNA 1OLME 2CWMA 2VR4A 3T2OA 4B8EA 3WLUA 4FO9A 4D0QA 4E9KA 1SFYA 3E1F1 3O1UA 2KR2A 3OPZA 2XB6C 2ZX1A 4GA9A 4N9IA 3VBFC 3H3UA 4AI2A 2RM22 2AEZA 3GBWA 3JU9A 4RGAA 3MIHA 3H50A 4C0BA 2OZ6A 4IERA 4AFBA 5FZOB 5FWJA 4OULA 3SXWA 2DURA 4Q4W1 3N9NA 1RUH3 1VMJA 4LLFA 5FKBA 4E2SA 1LHOA 1QXRA 1H2LA 1F4AA 2BDRA 1D2QA 3ASIA 1AR93 4AE2A 2VQ0A 3KT4A 5FUIA 1PIV3 4EV0A 4RSUA 1DGRA 5EHDA 5FQ0B 5JXJA 4XJWA 3UETA 1YYNA 2SBAA 2X5IA 3KVBA 4MVTA 4XUPA 5F9TA 2VW0A 2RR11 1S55A 3BB6A 3HJRA 4N8MA 5DABA 2UYBA 2W1UA 1NZCA 1IG0A 2VBBA 2OPKA 3O12A 4JGZA 5FP4A 1JH5A 2WWSA 1TEIA 1AR63 3FZ3A 4JGYA 4D3WA 3AM2A 1W90A 2WAAA 1DQ6A 1ENQA 2W91A 3JD72 3W59A 4IESA 4JDOA 5IHRA 5IK4A 3KCYA 2BU9A 4KQ7A 4HKOA 1T2XA 2XJTA 4MO3M 2XLGA 4Y26A 2ARAA 3PUIA 1KFUL 1HJGA 3CLPA 3KV9A 4WM7C 3W5NA 2AREA 2XONA 3B9IA 1POV3 2DCZA 2QQKA 1CD3G 3AJZA 3VLBB 4LITA 1MQTC 3BTAA 4MGZE 3VDCA 2PLV3 4IEZA 3RRDA 5IATA 1COV2 2PTMA 4M3CF 2IFWA 1NXD1 1OFNA 1VBD2 4MSVA 2RJ2A 4COYA 5A3TA 2XG3A 5CVRA 5JXHA 2ZACA 3IAQA 1PMHX 3MW4A 1YLLA 4XIOA 2YYOA 2QQUA 4N43B 1CIWA 4EZHA 4GMP1 5A33B 2B5HA 2WS91 4LHKA 4D6QA 1UQXA 3NNMA 1H1IA 1VBB1 3VBSB 3VD3A 4ZY9A 2VD7A 3PU3A 5BNPB 1VR3A 3RI8A 3SH4A 4I02A 1W03A 2GU9A 2CAUA 4IV1A 5EPAA 4Z8BA 3T3YA 3UKTA 4BOWA 1WKYA 4CZSA 1S0CA 4NIIA 4BHPA 3ACLA 1POQA 2YXSA 4YVSA 4YM0A 3I2JA 2ZABA 4QD2A 1GQGA 1GP6A 5CISA 4JHZA 3B94A 3ZN4A 2HYKA 4P9YA 1YI9A 5A3NA 3NJZA 1WMFA 1PX3A 3RZGA 3MIFA 4Q1PA 5EJZB 4M4PA 1PO21 2PQSA 3NJYA 4XBLA 4AAXA 1SFNA 1GWLA 5C4WB 2RS31 1SLCA 2WINB 4YFWA 1H1MA 5DPNA 3BTXA 2A73B 3R4UA 3SCFA 5J1XA 4OHVA 4TXWA 3ZXLA 3FLPA 3HWJA 3H1YA 4LUMA 4D8MA 3DPRC 3O5SA 3M3QA 1AL0G 4NHYA 1ZA7A 4DNYA 3U07A 3PU8A 3MUZ1 5IFTA 2A6ZA 3SCGA 4C0HA 1R1A3 2ZA9A 4W4ZA 5JOZA 3W5MA 3ZDVA 2R041 3LSDA 4CVUA 4Y5SA 1RUE1 3WT3A 5IFPA 2P1BA 5CZKA 5GLZA 4QM8A 4Y20B 3U75A 4OZXA 4QM9A 2HWD2 1E5SA 3ECQA 4YVWC 1UKGA 4PDWA 1L3JA 4NRPA 2WNOA 3OPWA 4IUGA 2RDRA 4Q0QA 3AZZA 4XPVA 2VULA 4LBKA 5FYHA 3CJIC 4B3NA 3MICA 4Z92B 5GLUA 4PJYA 4JDNA 2HEWF 3U4SA 2Y0OA 2EALA 1JTZX 2JG9B 1AR73 1C8NA 5F7UA 1XU2A 3LA2A 5C70A 5ANNA 3WP6A 2FDGA 2YBKA 1UD1A 3O1PA 4SLIA 1GLHA 4YW2A 2QUOA 4L2NA 3DYMA 1IHMA 2XL7A 3AYDA 4NVPA 4DY5A 1EP0A 5L9VA 2VW1A 1A78A 2K9ZA 2WQ8A 3AMQA 1QQP2 2VOKA 1DHKB 3M8LA 2P3YA 3Q9OA 2VH9A 1JYIA 1ENSA 1GNZA 4LKEA 4FTSA 1QJY3 3GDBA 4GZ9A 2HWE3 5CKNA 3SEPA 2ZGTA 5FPAA 3PIGA 1OVSA 4AF9A 1H2KA 1MACA 3I2HA 4LLOA 5A33A 3THCA 1NG0A 2W46A 3BOPA 4XMIA 5J37A 5GZFA 3O0VA 2QQNA 1H8TB 5LEJA 3I2OA 5DG1A 4A6OA 5T55A 4BCUA 1H4GA 4SBVA 2RDQA 5DDJ2 3U14A 2RS13 4COUA 3FWEA 1GP5A 1VBD1 1F8VA 1DZTA 2RDNA 2XKOA 3BCWA 1XNKA 3LEGA 4QXBA 2VOWA 3EBRA 1NCQA 5CB7A 3BIEA 1CGPA 5LBFA 3WG4A 1PNFA 3D8CA 3SISA 1C57A 3T0DA 2YC4A 1IS5A 3OJBA 4CDWC 1PIV1 4CRQA 1LGNA 4L11A 1DDLA 4Y22A 2Y6GA 4JVAA 1SBFA 1QJX2 3MDPA 4AR2A 1JZ7A 1JW6A 1CESA 1YO8A 3NV2A 4IE5A 2D6PA 1OLRA 1VRBA 2YPDA 4IE7A 1U12A 4QX3A 5SV8A 2C0ZA 3RYPA 1BK0A 1NQDA 4PLMA 4OQ9A 4UFMA 2E6VA 1C5HA 1NQJA 1QNYA 2B8MA 2RS52 4DEQA 2VXJA 4Z07A 3BPSA 3POWA 3BU0A 4A6SA 2C6SA 4W65A 4CCNA 1HIXA 4QKBA 1QU0A 1YI7A 2VVEA 4XUTA 3HEIA 3UJQA 1IKPA 4QXCA 3VBHB 1F5FA 2W1SA 2A7AA 3POGA 1B35C 2GZWA 1JZ2A 3NQHA 4XVHA 5LEKA 2WFF3 5F5IA 1SG3A 3T08A 1APNA 4QX2A 2W08A 2WYFA 4IDZA 4EQVA 5LBEA 2GH2A 3ZXJA 5JZGB 3WQ0A 5J09A 1BEV2 2MPFA 3KB5A 2MNGA 1DCSA 1N1TA 5KXBA 4RS5B 1VBB3 2JE8A 2VZ1A 3ELNA 4Q0PA 1NUKA 3AVSA 1JZ8A 1RUE2 3USUA 4CCJA 3NNGA 3MW3A 5KXDA 1OURA 1AX0A 1TG7A 1O8PA 4NAOA 5JMOA 3LEMA 2O1QA 3OUJA 4K1ZA 3HBZA 4KU8A 1SLTA 5JOWA 4MHUA 1VB4A 1W3VA 3RZHA 3RZJA 2HH9A 1VE0A 1UU6A 4L8QA 3E6DA 3I7DA 5FOBB 1UOFA 3ETQA 1CR7A 4PLOA 5FY4A 3BODA 4QPGC 2Y6HA 1MEC2 1WBLA 2R0HA 4LA2A 4NWWA 3T09A 1K12A 1CAXB 3RG0A 3ZFGB 1XSQA 2A6WA 1W8ZA 2Z42A 3ZYHA 4BQ2A 1UZVA 1WCDJ 2HWF1 1LOBA 2WLQA 1PVXA 1XU1A 1XB9A 4OHXA 2WNVA 2W5FA 1JBCA 1VAMA 5FY8A 3ZFEB 1HB1A 3I97A 2A3XA 1OUSA 3RWNA 4MGIE 1I5ZA 3I2DA 4GH4A 4NWVA 3I2GA 2IVJA 5A7WA 1AJOA 2DVFA 2PHXA 4U36A 1ZBE3 3N4MA 5CIRA 1KITA 2X05A 2QQPA 5A3UA 2XPJA 3TEXA 3VDBA 4NR1A 1CX1A 3OUHA 4ZHNA 4S2GA 4Q26A 1UCXA 2ARCA 4F7ZA 1HRI3 5IVYA 4M3CA 5L73A 4P08A 1LAJA 4QPGB 5JI9A 4LBOA 2WDBA 1LKNA 2NLRA 2RE9A 5DG2A 4JGYC 5LWBA 4ET7A 1YNAA 5T5JA 5IVVA 3CKHA 2BFUL 4O61A 2OUJA 3PTRB 4QAWA 5DDJ1 3VL9A 4ES9A 3U0ZA 1QWRA 3M3EA 1CQ9A 1AXKA 1MPXA 2RR13 1AVBA 3WUDA 1HLCA 1AZDA 5AFEA 1KQRA 5C9AC 1DGWX 3DXTA 3OD0A 1B09A 4TLFA 1DQ1A 2R063 4IGOA 2WNEA 1ND2C 1QKQA 3POSA 5HBAA 1MQTA 4R9AA 1REFA 3HN1A 5E88A 5EV7A 4CUCA 2JDUA 4DXZA 4RR3A 1VRH1 4WM8C 5JUVA 4XJ8A 5FPVA 1W9FA 3VBHA 1JOBA 3KHCA 4O9EA 4BQ1A 4JC1A 3WDWA 1H2NA 3ZKUA 1J84A 2C5DA 5L7OB 5E89A 2W68A 4DO0A 4UW3A 1W8HA 5T54A 4NE9A 4AVSA 5IK5A 1W6PB 3N9QA 3KS7A 3C2UA 1QH7A 3E6CC 1FV2A 1DYKA 2P34A 2ZZQA 3GGLA 3M7AA 4FFGA 3B3QE 5IT6A 2YFZA 3LOBA 4FOVA 4FPGA 5GZCA 1VBC1 2RDSA 2JIJA 3DYOA 3FL7A 2WA4A 2VCCA 3EB7A 4PIZA 2RMU3 5GM0A 4N7UA 2F6BA 5H9QA 1HXS2 4FP3A 1S2KA 4GWNA 4YGEA 3OGSA 5EWSA 2R32A 5A1AA 2ZGMA 1I3HA 1ZRRA 3L2YA 4QQOA 2VECA 2WIIB 1BEV1 1UYYA 2J1SA 1W0NA 3N3HA 3INAA 3UGHA 1GOFA 1NT0A 2SLIA 5BY5A 2E26A 1Q8SA 3DPRA 3GCWA 1W39A 4HL0A 4WBBA 1LESA 4ASMB 2ZX3A 1CWPA 1QJEA 3H7JA 4GMP0 4CXWA 2W2IA 4HVQA 2W52A 5FXXA 5FZEA 3OB8A 1A34A 1QNWA 3GALA 5A3WA 1PGL1 1RUC2 5FZKA 4HKWA 5GKAC 2XLFA 4Y20A 5T52A 3AMMA 3HMYA 4QDSA 2EIGA 3JB8A 1F15A 1HRI1 1W8UA 3F95A 4IV1C 4KGQA 3WINE 1H6XA 1ULCA 1AYM3 4ISQA 1RUG3 3EJKA 4CP1A 2WC2A 1OOPC 3R4SA 4S2FA 2VUCA 2CHHA 3V64A 3X29B 1NCRB 4LULA 4YG0A 4HSLA 3V0AA 2WZR3 4QPGA 4Q4V2 4BPZA 2BVVA 2PN5A 3N9LA 5FZ9A 1OQDA 1R082 3VZKA 1Y9QA 4EZ4A 2KD7A 4JTOA 3TWIA 2PMWB 5FYVA 1NA1A 3P3NA 1UOJA 5LA2A 3S7EA 2A3WA 5KHIA 1REEA 3DPRB 4A7YA 2XKPA 1T6BX 4XFGA 2NMNA 4KWUA 4L97A 4QDQA 3OGRA 3ETPA 5C3RA 2V09A 4LTAA 5K7PA 1HXS3 3SKJE 3WVJA 5K0UA 4FFIA 3QD6A 4BE3A 3MO4A 2Y6JA 5KR7A 4CCKA 2OVUA 1NCQC 1BBT2 3WNMA 2JENA 4QXKA 1AXYA 1QXPA 1PK6A 2KM2A 3SC7X 4OYUA 3WF0A 4C90A 4P9JA 1FPN3 5IJRA 1UKRA 2EXHA 5T50A 2HBTA 2JDKA 2OUHA 2ZGSA 3UT0A 1Y9MA 2E9QA 4OZOA 3ZSKA 4ZZ8A 2RMU1 3VD4A 3A4UA 4QX8A 2DBNA 2EAKA 2H0BA 3H1WA 2K46A 4JGZC 5FZLA 4JKLA 3C3VA 5JR7B 5I8TA 5CNAA 2Y26A 3AXDA 5A7QA 4R4ZA 2WSUA 4K3UA 1W06A 1GKBA 5FMBA 3RGBA 1XE0A 4L0PA 2EA7A 1V9U3 1STMA 1U5XA 1AL21 2GDFA 1U0AA 2VO5A 2AGSA 2BUKA 3IBMA 3RQ0A 3ZXGA 4AFCA 2XJQA 4IQPA 4PIYA 3IDAA 1HJFA 4XYXA 1RVF1 2GNBA 1XYPA 2BPA2 3K4AA 3SKVA 3S57A 1O4YA 3OUIA 3RVHA 4YGCA 3S5QA 1RUC3 4WZFA 3N7KA 3ZLIA 1VBA2 4LKSA 3I3EA 3U37A 1X9TA 2ZGQA 1HV1A 1U5ZA 2A6YA 2VQUA 5D1IA 4BYYA 3VBSA 3CNAA 2P3IA 3QACA 2OA2A 3MFCA 2JE7A 1GOHA 3H42B 1N1SA 2VW2A 3O1SA 5FPZA 5FPXA 1WMXA 2BVBA 1S0IA
chains in the Genus database with same CATH topology
1JU3A 5EIYB 3ACGA 2BERA 3OGVA 1I5PA 1DYOA 2ZEWA 5EJ1B 1GQPA 2VZRA 2VR4A 3T2OA 4D0QA 1IQDC 3E1F1 3NJVA 1D7PM 3CMGA 1XNTA 2Y6LA 3F2ZA 1NKGA 4P00B 2DCJA 2WO1A 2WABA 4ZXEA 2W95A 3HOBA 1F4AA 4QB2A 2VQTA 5FUIA 4A45A 1YQ2A 1R64A 5LA1A 2CDPA 4UI9L 5JXJA 3UETA 4XUPA 2YB7A 4DUVA 3HJRA 2LS6A 2W1UA 2OKXA 4GWIA 1US3A 2J1UA 2WAAA 2W91A 5IHRA 4UAPA 1DP0A 2E31A 3LE0A 3DECA 1JYXA 1T2XA 4MO3M 2VZOA 4CUAA 3PUIA 3W5NA 3GXUA 4OMDA 2XONA 2BGPA 2QQKA 3HPNA 4RYDA 5B4XA 3VDCA 2JDAA 2VOTA 4P02B 5HPOA 1CIYA 1UWWA 2RJ2A 5JXHA 1ULPA 3IAQA 1PMHX 3T0AA 3P6BA 1ULOA 3T2QA 1UX7A 3ACHA 1UMHA 2C26A 2WAOA 4QB6A 3VD3A 1NAEA 4ZY9A 5C7GA 1UY3A 1CZSA 2VMDA 4JKMA 1CZVA 1CZTA 1WKYA 4JX0A 3OBAA 2LW8A 3WF3A 3I2JA 4JHZA 1UMIA 4BK4A 1PX3A 5G05L 5EJZB 4M4PA 4A44A 2PQSA 2BGOA 4AAXA 4CUBA 4HG6B 5DPNA 1DLCA 1UY2A 5J1XA 4TXWA 4A3ZA 4E8CA 4D8MA 2VMFA 3I2FA 2ZEZA 4PQQA 5IFTA 3MUZ1 4PT6A 2YFUA 3IIIA 3CZJA 3LPFA 4W4ZA 3W5MA 2V5DA 4CVUA 5IFPA 2V72A 3HNMA 4OUEA 5G04L 2ID4A 4DXSA 5CZKA 4TTGA 3OEBA 4FI9A 2C4XA 3ECQA 2WZEA 4GWJA 1JI6A 4IUGA 5B4NA 3K4ZA 1OF4A 5DQ0A 2VJXA 2WUHA 4XUOA 1PX4A 4QPWA 2VL4A 2WO3A 3WF4A 3THDA 3K77A 1JZ4A 5F7UA 1LNSA 1UXZA 5C70A 4LPLA 4QX1A 3DYMA 2WO2A 2C9KA 2HYXA 5LA0A 1JYWA 2W87A 2WQ8A 4MADA 3C7GA 3FHAA 1SHWB 3GDBA 4GZ9A 5DN2A 3SEPA 3AC0A 3I2HA 3THCA 2W46A 1UY1A 1K3IA 1JHJA 4DEVA 2QQNA 2QQMA 1UYXA 4A6OA 4ARXA 3CQOA 3VD9A 3MV11 4BJ0A 3D3AA 3LEGA 2W1WA 2QQLA 2VZTA 4CU8A 3T0DA 2YC4A 3T2PA 5CYYA 2R7EB 2Y6GA 3K75B 3MBWA 1JZ7A 4XUQA 4QX3A 2BBAA 4MGSA 1JYNA 1H6YA 1O8SA 4DEQA 4AG4A 4M4RA 5LCWL 3OEAA 1JZ6A 2VZVA 4XUTA 4DUXA 3HEIA 1XPWA 2W94A 4RN5A 2W1SA 1JZ3A 1JZ2A 1J83A 3NQHA 4XVHA 4JKKA 1K42A 1SG3A 2ZEXA 3DYPA 3T08A 4ARYA 4QX2A 1PMJX 2VZQA 5IYYA 1KEXA 1OF3A 1EUTA 3VD5A 5JXIA 1O59A 4KI5M 3WF1A 4BXSV 2JE8A 2VZ1A 2B4KA 2QQOA 1NUKA 3K46A 2L9LA 1XNAA 2XQXA 4XZUG 1JZ8A 4W50A 3NNGA 1WCQA 1TG7A 1HN1A 1O8PA 5JMOA 4PF1A 1XC6A 1SDDB 4CU6A 2EICA 1W9TA 3LEKA 4KMQA 3WSOA 2W47A 4E8DA 4A4AA 2Y6HA 4YPJA 3I3BA 3T09A 1K12A 2VCBA 2J1AA 3C8XA 3A22A 1GUIA 3LPGA 4OMCA 2W3JA 3NRUA 1W9WA 1JZ5A 2J1TA 2X10A 2W5FA 5JR2A 2J7MA 3I97A 2Y6KA 3C7HA 3IB3A 4UOJA 3I2GA 1EUUA 1K45A 2X05A 1UY0A 2VZ3A 2DDUA 3VDBA 1CX1A 2WN2A 1W99A 4P08A 2WDBA 4ET7A 2DCKA 3I2KA 1UZ0A 3CKHA 3NJXA 4A42A 4QAWA 2BZDA 2WZ8A 1MPXA 1W9SA 4LQRA 2YC2A 3EYPA 3IAPA 3HN3A 4DUWA 3FN9A 4CUCA 5JUVA 4LHSA 3WEZA 1P8JA 2V4VA 2X09A 2QQIA 3VDAA 3WNOA 2VMEA 1US2A 1J84A 2B9VA 3ACIA 2CDOA 2VC9A 2J1VA 1BHGA 1TVGA 2HLEA 4BK5A 3GGLA 2YFZA 3OG2A 3WQBA 3DYOA 3FL7A 3PUHA 2VCCA 3EB7A 3OGSA 3C7EA 3LEIA 4W8JA 5A1AA 2QBXA 3GM8A 4QX0A 1UY4A 3HNBM 4MGQA 1UYYA 2J1SA 2WBKA 3WNNA 1W0NA 1GOFA 2E26A 4QB1A 3WNKA 4CU7A 3OB8A 2QQJA 2WN3A 1OT5A 2VCAA 3CZUA 2YG0A 3C7OA 2E33A 2J22A 3HNYM 2E32A 1GNYA 4QDSA 2RVAA 3CIHA 1H6XA 3SEEA 2EIEA 1L7RA 1NX9A 3WF2A 3K4DA 5I0DA 2ZEYA 2Y8KA 1UYZA 2XHNA 4QDRA 3T0BA 3A23A 2KD7A 1JU4A 3MV01 2W1QA 5LA2A 1OH4A 2ORXA 4BDVB 4KWUA 2VZUA 4QDQA 3OGRA 4DXTA 3ETPA 3SKJE 2J1EA 4DXRA 3MO4A 2Y6JA 3FHQA 3VD7A 1GOGA 3MUY1 3WNMA 4XURA 5JXGA 2Z4FA 3BGAA 4ZZ5A 5HXMA 2XOMA 3A7QA 2J1RA 2EIBA 3P1IA 4OYUA 3WF0A 3UESA 5IJRA 2VTFA 1W8OA 3CDZB 4A41A 3I3DA 3J7HA 4OZOA 4ZZ8A 3ZM8A 1JYVA 1GU3A 3VD4A 5C71A 1F4HA 4JKLA 3UNPA 1KGYA 2ORZA 2VZSA 3C7FA 3ABZA 3I2IA 4L0PA 4P5YA 2VO5A 1W8NA 3WNPA 2W9XA 2Y64A 3LQCA 3IDAA 2JD9A 1UXXX 3K4AA 3SKVA 4CU9A 1GMMA 4Z2AA 2WYSA 3BN6A 2VM9A 4LKSA 3I3EA 3A21A 2RV9A 3U37A 3WNLA 4MOAA 2W92A 2EIDA 2VQUA 3ACFA 2VZPA 1RYYA 2ZXQA 1L7QA 4XUNA 2JKXA 1OD3A 1GOHA 2VMCA 5DMYA 3JXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JU3 A;  5EIY B;  3ACG A;  2BER A;  3OGV A;  1I5P A;  1DYO A;  2ZEW A;  5EJ1 B;  1GQP A;  2VZR A;  2VR4 A;  3T2O A;  4D0Q A;  1IQD C;  3E1F 1;  3NJV A;  1D7P M;  3CMG A;  1XNT A;  2Y6L A;  3F2Z A;  1NKG A;  4P00 B;  2DCJ A;  2WO1 A;  2WAB A;  4ZXE A;  2W95 A;  3HOB A;  1F4A A;  4QB2 A;  2VQT A;  5FUI A;  4A45 A;  1YQ2 A;  1R64 A;  5LA1 A;  2CDP A;  4UI9 L;  5JXJ A;  3UET A;  4XUP A;  2YB7 A;  4DUV A;  3HJR A;  2LS6 A;  2W1U A;  2OKX A;  4GWI A;  1US3 A;  2J1U A;  2WAA A;  2W91 A;  5IHR A;  4UAP A;  1DP0 A;  2E31 A;  3LE0 A;  3DEC A;  1JYX A;  1T2X A;  4MO3 M;  2VZO A;  4CUA A;  3PUI A;  3W5N A;  3GXU A;  4OMD A;  2XON A;  2BGP A;  2QQK A;  3HPN A;  4RYD A;  5B4X A;  3VDC A;  2JDA A;  2VOT A;  4P02 B;  5HPO A;  1CIY A;  1UWW A;  2RJ2 A;  5JXH A;  1ULP A;  3IAQ A;  1PMH X;  3T0A A;  3P6B A;  1ULO A;  3T2Q A;  1UX7 A;  3ACH A;  1UMH A;  2C26 A;  2WAO A;  4QB6 A;  3VD3 A;  1NAE A;  4ZY9 A;  5C7G A;  1UY3 A;  1CZS A;  2VMD A;  4JKM A;  1CZV A;  1CZT A;  1WKY A;  4JX0 A;  3OBA A;  2LW8 A;  3WF3 A;  3I2J A;  4JHZ A;  1UMI A;  4BK4 A;  1PX3 A;  5G05 L;  5EJZ B;  4M4P A;  4A44 A;  2PQS A;  2BGO A;  4AAX A;  4CUB A;  4HG6 B;  5DPN A;  1DLC A;  1UY2 A;  5J1X A;  4TXW A;  4A3Z A;  4E8C A;  4D8M A;  2VMF A;  3I2F A;  2ZEZ A;  4PQQ A;  5IFT A;  3MUZ 1;  4PT6 A;  2YFU A;  3III A;  3CZJ A;  3LPF A;  4W4Z A;  3W5M A;  2V5D A;  4CVU A;  5IFP A;  2V72 A;  3HNM A;  4OUE A;  5G04 L;  2ID4 A;  4DXS A;  5CZK A;  4TTG A;  3OEB A;  4FI9 A;  2C4X A;  3ECQ A;  2WZE A;  4GWJ A;  1JI6 A;  4IUG A;  5B4N A;  3K4Z A;  1OF4 A;  5DQ0 A;  2VJX A;  2WUH A;  4XUO A;  1PX4 A;  4QPW A;  2VL4 A;  2WO3 A;  3WF4 A;  3THD A;  3K77 A;  1JZ4 A;  5F7U A;  1LNS A;  1UXZ A;  5C70 A;  4LPL A;  4QX1 A;  3DYM A;  2WO2 A;  2C9K A;  2HYX A;  5LA0 A;  1JYW A;  2W87 A;  2WQ8 A;  4MAD A;  3C7G A;  3FHA A;  1SHW B;  3GDB A;  4GZ9 A;  5DN2 A;  3SEP A;  3AC0 A;  3I2H A;  3THC A;  2W46 A;  1UY1 A;  1K3I A;  1JHJ A;  4DEV A;  2QQN A;  2QQM A;  1UYX A;  4A6O A;  4ARX A;  3CQO A;  3VD9 A;  3MV1 1;  4BJ0 A;  3D3A A;  3LEG A;  2W1W A;  2QQL A;  2VZT A;  4CU8 A;  3T0D A;  2YC4 A;  3T2P A;  5CYY A;  2R7E B;  2Y6G A;  3K75 B;  3MBW A;  1JZ7 A;  4XUQ A;  4QX3 A;  2BBA A;  4MGS A;  1JYN A;  1H6Y A;  1O8S A;  4DEQ A;  4AG4 A;  4M4R A;  5LCW L;  3OEA A;  1JZ6 A;  2VZV A;  4XUT A;  4DUX A;  3HEI A;  1XPW A;  2W94 A;  4RN5 A;  2W1S A;  1JZ3 A;  1JZ2 A;  1J83 A;  3NQH A;  4XVH A;  4JKK A;  1K42 A;  1SG3 A;  2ZEX A;  3DYP A;  3T08 A;  4ARY A;  4QX2 A;  1PMJ X;  2VZQ A;  5IYY A;  1KEX A;  1OF3 A;  1EUT A;  3VD5 A;  5JXI A;  1O59 A;  4KI5 M;  3WF1 A;  4BXS V;  2JE8 A;  2VZ1 A;  2B4K A;  2QQO A;  1NUK A;  3K46 A;  2L9L A;  1XNA A;  2XQX A;  4XZU G;  1JZ8 A;  4W50 A;  3NNG A;  1WCQ A;  1TG7 A;  1HN1 A;  1O8P A;  5JMO A;  4PF1 A;  1XC6 A;  1SDD B;  4CU6 A;  2EIC A;  1W9T A;  3LEK A;  4KMQ A;  3WSO A;  2W47 A;  4E8D A;  4A4A A;  2Y6H A;  4YPJ A;  3I3B A;  3T09 A;  1K12 A;  2VCB A;  2J1A A;  3C8X A;  3A22 A;  1GUI A;  3LPG A;  4OMC A;  2W3J A;  3NRU A;  1W9W A;  1JZ5 A;  2J1T A;  2X10 A;  2W5F A;  5JR2 A;  2J7M A;  3I97 A;  2Y6K A;  3C7H A;  3IB3 A;  4UOJ A;  3I2G A;  1EUU A;  1K45 A;  2X05 A;  1UY0 A;  2VZ3 A;  2DDU A;  3VDB A;  1CX1 A;  2WN2 A;  1W99 A;  4P08 A;  2WDB A;  4ET7 A;  2DCK A;  3I2K A;  1UZ0 A;  3CKH A;  3NJX A;  4A42 A;  4QAW A;  2BZD A;  2WZ8 A;  1MPX A;  1W9S A;  4LQR A;  2YC2 A;  3EYP A;  3IAP A;  3HN3 A;  4DUW A;  3FN9 A;  4CUC A;  5JUV A;  4LHS A;  3WEZ A;  1P8J A;  2V4V A;  2X09 A;  2QQI A;  3VDA A;  3WNO A;  2VME A;  1US2 A;  1J84 A;  2B9V A;  3ACI A;  2CDO A;  2VC9 A;  2J1V A;  1BHG A;  1TVG A;  2HLE A;  4BK5 A;  3GGL A;  2YFZ A;  3OG2 A;  3WQB A;  3DYO A;  3FL7 A;  3PUH A;  2VCC A;  3EB7 A;  3OGS A;  3C7E A;  3LEI A;  4W8J A;  5A1A A;  2QBX A;  3GM8 A;  4QX0 A;  1UY4 A;  3HNB M;  4MGQ A;  1UYY A;  2J1S A;  2WBK A;  3WNN A;  1W0N A;  1GOF A;  2E26 A;  4QB1 A;  3WNK A;  4CU7 A;  3OB8 A;  2QQJ A;  2WN3 A;  1OT5 A;  2VCA A;  3CZU A;  2YG0 A;  3C7O A;  2E33 A;  2J22 A;  3HNY M;  2E32 A;  1GNY A;  4QDS A;  2RVA A;  3CIH A;  1H6X A;  3SEE A;  2EIE A;  1L7R A;  1NX9 A;  3WF2 A;  3K4D A;  5I0D A;  2ZEY A;  2Y8K A;  1UYZ A;  2XHN A;  4QDR A;  3T0B A;  3A23 A;  2KD7 A;  1JU4 A;  3MV0 1;  2W1Q A;  5LA2 A;  1OH4 A;  2ORX A;  4BDV B;  4KWU A;  2VZU A;  4QDQ A;  3OGR A;  4DXT A;  3ETP A;  3SKJ E;  2J1E A;  4DXR A;  3MO4 A;  2Y6J A;  3FHQ A;  3VD7 A;  1GOG A;  3MUY 1;  3WNM A;  4XUR A;  5JXG A;  2Z4F A;  3BGA A;  4ZZ5 A;  5HXM A;  2XOM A;  3A7Q A;  2J1R A;  2EIB A;  3P1I A;  4OYU A;  3WF0 A;  3UES A;  5IJR A;  2VTF A;  1W8O A;  3CDZ B;  4A41 A;  3I3D A;  3J7H A;  4OZO A;  4ZZ8 A;  3ZM8 A;  1JYV A;  1GU3 A;  3VD4 A;  5C71 A;  1F4H A;  4JKL A;  3UNP A;  1KGY A;  2ORZ A;  2VZS A;  3C7F A;  3ABZ A;  3I2I A;  4L0P A;  4P5Y A;  2VO5 A;  1W8N A;  3WNP A;  2W9X A;  2Y64 A;  3LQC A;  3IDA A;  2JD9 A;  1UXX X;  3K4A A;  3SKV A;  4CU9 A;  1GMM A;  4Z2A A;  2WYS A;  3BN6 A;  2VM9 A;  4LKS A;  3I3E A;  3A21 A;  2RV9 A;  3U37 A;  3WNL A;  4MOA A;  2W92 A;  2EID A;  2VQU A;  3ACF A;  2VZP A;  1RYY A;  2ZXQ A;  1L7Q A;  4XUN A;  2JKX A;  1OD3 A;  1GOH A;  2VMC A;  5DMY A;  3JXS A; 
#chains in the Genus database with same CATH topology
 2WZR 2;  1OA2 A;  4C1X A;  1N47 A;  2MEV 1;  2ET7 A;  3JZV A;  5L36 A;  3GZU C;  3KV4 A;  2AAC A;  4WV8 A;  1CN1 A;  1AX2 A;  5FYC A;  1F2N A;  2GAU A;  2H6B A;  2ZEW A;  1YEW A;  2VTX J;  2XWB B;  3EXU A;  3KCC A;  2ZAA A;  5EJ1 B;  3ON7 A;  1O5L A;  5APA A;  3NJV A;  3IWZ A;  2QVS B;  4FOQ A;  1GNH A;  2JDM A;  2D3S A;  3CMG A;  4PI0 A;  5FZ0 A;  2VOV A;  3PUS A;  3OGG A;  1IS3 A;  1RUC 1;  2D7F A;  1IKQ A;  2A6V A;  1NKG A;  4GH4 B;  4L9B A;  4FVV A;  4P00 B;  2DCJ A;  1W6Q B;  1JHN A;  3G6J B;  1YQ6 A;  1HRI 2;  2BOJ A;  2WO1 A;  4YW7 A;  1GQH A;  4FPF A;  3AKQ A;  3JCI A;  5F2S A;  1QJY 1;  2GAL A;  1UU4 A;  4FCA A;  3Q8B A;  4Z1V A;  4A45 A;  1HN0 A;  3KQR A;  1ZBE 2;  5D8A C;  4UI9 L;  5JAX A;  4ZU7 A;  2CSG A;  4OFG A;  3W9A A;  1SFP A;  3BYW A;  3POJ A;  4XTP A;  3E5X A;  1X8E A;  4V1P A;  4R9C A;  3AYC A;  3TN9 1;  1WCS A;  1R08 1;  4DUV A;  3AZW A;  1TE1 B;  4H7M A;  1Y43 B;  3MIG A;  2QNK A;  1SQ4 A;  4E4D X;  2R06 2;  3ILF A;  4LOS A;  4COW A;  1US3 A;  4AED A;  3H0O A;  5C8W A;  4R9B A;  1MEC 3;  1S0J A;  4UAP A;  3MZH A;  4MET A;  3ZO0 B;  1DP0 A;  2GC3 A;  1QEX A;  2WNV B;  1QQP 3;  5EYX A;  2A3Y A;  5FXW A;  3S6P A;  5T3N A;  4F83 A;  4AI0 A;  3ME2 A;  2VZO A;  5FZF A;  2HWB 3;  4CUA A;  1IS6 A;  1CAU A;  4QU2 A;  3AFK A;  2FCV A;  3GXU A;  2IVI B;  3J7N A;  4LE4 A;  3ZKY A;  1W6Q A;  1WMD A;  5LB6 A;  4XF3 A;  2VOT A;  1ASJ 2;  4KH9 A;  1AHS A;  3AMH A;  3VHO A;  5LK7 B;  5HPO A;  1ODM A;  1POV 0;  1U5Y A;  5FK8 A;  4ZU4 A;  3LSE A;  4OI1 A;  1QOO A;  1TZO A;  2WA3 A;  1RIT A;  3TOJ A;  2RMU 2;  2ET1 A;  2WAO A;  3M3C A;  1ZRF A;  4FT8 A;  4CDU C;  4YVS C;  5IUQ A;  4TWT A;  4ATF A;  4CEY B;  1EAH 3;  1WLT A;  5CG8 A;  3I54 A;  1UY3 A;  2IC1 A;  3J8F 3;  4JKM A;  3RI9 A;  1N1Y A;  2GP5 A;  4QHB A;  2YMZ A;  4GWM A;  1CZT A;  4LBN A;  3H1M A;  3Q8A A;  2CGO A;  2ZGU A;  3NAP A;  4RGG A;  3KV6 A;  1RIN A;  4ZPI A;  5FO7 B;  2DUQ A;  5F3G A;  5FUN A;  4C91 A;  1BKZ A;  1TME 2;  2D5H A;  4NRO A;  2BRT A;  1OOP B;  3M1H A;  4X8P A;  1XNC A;  1UMZ A;  3NL1 A;  4XJZ A;  4ATE A;  1VBE 1;  1PVC 1;  5FJH A;  5FK7 A;  2PLV 2;  3IPV B;  4I0B A;  2BWA A;  4CUB A;  2VY0 A;  4AEJ A;  5JSO A;  1G7Y A;  4B4P A;  1OQ1 A;  4IE0 A;  2E7A A;  4GUL A;  1H8V A;  2K2S A;  4BME A;  4A3Z A;  1JYT A;  2YGL A;  1QJX 3;  1C3H A;  4AVC A;  4JGY B;  5EZW A;  4AVA A;  4CCE A;  2QTW B;  3ILR A;  3FBM A;  1HB2 A;  3I2F A;  3R05 A;  4Q29 A;  5CFC B;  5F37 A;  2QZ2 A;  1RUI 3;  2ZEZ A;  4IEU A;  5GZD A;  5CAZ A;  4XJU A;  4GMP 3;  4NHM A;  4XHB A;  1JOJ A;  3VZJ A;  3VL8 A;  2MEV 2;  2PHT A;  4XF4 A;  4FFH A;  2EXK A;  3ILN A;  3SCH A;  5LBB A;  2FDI A;  3LPF A;  2FQP A;  3WDU A;  4M01 A;  2ATF A;  2V5D A;  3ZFG A;  1VMH A;  5I0R A;  2V72 A;  3HNM A;  4OUE A;  5G04 L;  2ZTN A;  3TN9 3;  4D6R A;  4DXS A;  3OEB A;  2JDP A;  3LFM A;  4R4X A;  1W2T A;  1JI6 A;  5I0U A;  5B4N A;  2WQZ C;  1YIP A;  1GV9 A;  2R1D A;  4IEP A;  3KF3 A;  4WM7 B;  2LRO A;  3TYJ A;  2E51 A;  3M3I A;  5JPN B;  3PLQ A;  4LBQ D;  1R09 1;  1UZW A;  4QPW A;  4N43 A;  4Y3O A;  5A7W B;  3GBG A;  2DCT A;  2Y60 A;  3WF4 A;  4FAH A;  2ZZJ A;  4D6S A;  4WM8 A;  4FBF A;  3I4I A;  3WDV A;  4HOO A;  1LNS A;  1UXZ A;  4AI8 A;  3D0J A;  1ASJ 3;  5L7O C;  1WCU A;  3WP4 A;  2Y6F A;  3HQU A;  4HK8 A;  4N43 C;  3RS6 A;  3NMB A;  2GC2 A;  3AMN A;  4CCC A;  3CEW A;  4RL7 A;  3T4V A;  2C9K A;  4URT A;  1QH6 A;  5LA0 A;  3Q8E A;  1WWY A;  4YW4 A;  1FOD 2;  1OPO A;  4Q4X 2;  2XUE A;  3T30 A;  2FBE A;  3C7G A;  1EAH 2;  3FHA A;  5CKQ A;  3PHM A;  5KHJ A;  1AR9 1;  1SHW B;  1Z0H A;  2MEV 3;  4XXA A;  4W6X A;  1AR8 1;  2MHF A;  1RJ7 A;  3BAL A;  3FLR A;  5JVV A;  2E63 A;  1RXG A;  5H9P A;  5HCF A;  1KS5 A;  1WUV A;  2XQR A;  1F31 A;  1KJR A;  1XYN A;  2BOI A;  5J48 A;  1AX1 A;  3CJI B;  5E8A A;  1BZW A;  1LHU A;  2HWC 2;  4XAC A;  3VGI A;  2QQM A;  5KHH A;  1GZ9 A;  2FCU A;  3CQO A;  2EXI A;  3K3N A;  2JEC A;  5ACA 2;  1ASJ 1;  3VD9 A;  4EN8 B;  4LUK A;  1W6M A;  4CP0 A;  2VUA A;  1RJ8 A;  3ZSJ A;  4R52 A;  4KGG A;  4I09 A;  4WVW A;  2QQL A;  5KWR A;  1AJK A;  5EXO A;  1HX6 A;  2Z79 A;  2RM2 3;  5FYY A;  1ZRD A;  2R7E B;  5LBC A;  2VVF A;  3DF0 A;  4JQT A;  1ZBA 1;  5A7S A;  4UT5 A;  2DVA A;  5IK7 A;  4FQZ A;  3K75 B;  3MBW A;  4QX7 A;  5LZ6 A;  4QPI A;  1SLA A;  2P5B A;  4MXW B;  2VPV A;  1DZR A;  4OHW A;  1XBF A;  1RHI 3;  2BBA A;  3N9O A;  5FYB A;  1EPW A;  4PIX A;  3IIA A;  4IE4 A;  1H6Y A;  1O8S A;  4KWK A;  1WME A;  4AG4 A;  4PBO A;  4UYB A;  5LCW L;  3ZX7 A;  2ZX0 A;  3GZE A;  4IET A;  4MXV A;  1JZ6 A;  1UW8 A;  5FZ1 A;  5L19 A;  4KBB A;  4AQS A;  1XPW A;  4HBN A;  2W94 A;  3PVB B;  2Q1Z B;  4RN5 A;  4BB3 A;  1FNZ A;  1ZZC A;  2WKK A;  1OSG A;  1LU2 A;  3NST A;  1J83 A;  1Q43 A;  3VDD C;  1SDW A;  1RUF 1;  1K42 A;  4RQP B;  3DYP A;  4QMA A;  2WNU C;  3BPZ A;  3KGZ A;  1PMJ X;  2ZX4 A;  1N3Q A;  4A3X A;  3OBR A;  4HVO A;  2VZQ A;  2Q8C A;  3WV6 A;  1OF3 A;  1NLS A;  3HT1 A;  4I3P A;  4UFJ A;  3RJR A;  1GZT A;  1RUJ 3;  5FQ0 A;  4PHZ A;  3J7M A;  1RUI 1;  5FZM A;  3K46 A;  5ISL A;  3GHM A;  1COV 3;  3K48 A;  2YC0 A;  1ZVF A;  4PF1 A;  3KM5 A;  2AR6 A;  1O6U A;  2DUO A;  3HVD A;  3VBO C;  2EIC A;  3ZYB A;  1R09 2;  2RHP A;  3FC0 A;  1YFX A;  3R0R A;  5A7O A;  3WSO A;  4X6R B;  4BLJ A;  4TN7 A;  4YVS B;  2WL1 A;  3IMM A;  2Q8D A;  4YPJ A;  1B35 B;  1OXC A;  3I3B A;  3LA3 A;  4FXG B;  4CDQ B;  1LOF C;  2JG8 A;  3N9P A;  3JBG 2;  3N7J A;  1WLC A;  4QT6 A;  4RHV 3;  4HFS A;  3A22 A;  1NA1 C;  1YXW A;  3LFI A;  4OMC A;  5T5O A;  5FY9 A;  1X82 A;  1PGW 1;  1D4M 3;  3R4D B;  5FZI A;  5C8C C;  1YWK A;  1JZ5 A;  1FOD 1;  1AR7 1;  2X10 A;  4Q4X 1;  5HXV A;  5C9A B;  1BMV 1;  5JR2 A;  4GAL A;  3N35 A;  3KSC A;  4RA0 A;  1U5I A;  2Y6K A;  3C7H A;  3IB3 A;  4Q1R A;  2OS2 A;  3U1X A;  2PAK A;  3HQR A;  4AQT A;  1H30 A;  2LUW A;  2WZP P;  4BQW A;  4CDX C;  2FMD A;  1SAC A;  1UY0 A;  1NOV A;  4LBQ A;  2BEO A;  5FPB A;  2DDU A;  5FPL A;  4A7K A;  3DGT A;  4DPN A;  2ZGO A;  2PAE A;  1QOS A;  2EVX A;  1PO1 1;  3OBT A;  1W99 A;  1LOC A;  1V6L A;  5FYI A;  2YBS A;  4PF5 A;  2PHL A;  2IXC A;  4UF0 A;  2D40 A;  4BIF A;  1UZ0 A;  4C1W A;  3NJX A;  2DTW A;  1R1Z A;  2BZD A;  2WZ8 A;  1YRZ A;  4QGM A;  3ZVX A;  5FUP A;  3D5O A;  5FZG A;  3WXP A;  5HCH A;  2C24 A;  3AX4 A;  3LWC A;  2ZHM A;  3FJS A;  5BUV A;  3EYP A;  3UJO A;  3LOI A;  4YSF A;  3IAP A;  2DF7 A;  4QGN A;  3HN3 A;  3VBO A;  4DUW A;  2P3J A;  2D93 A;  2JXA A;  1ZBA 2;  4KG0 A;  5LW9 A;  5C9A A;  2ZGN A;  1S2B A;  1URX A;  3VHN A;  3WCR A;  5FLH A;  4EN9 B;  3I3Q A;  1FPN 2;  2X09 A;  3ZDS A;  2QQI A;  3VDA A;  5F6L B;  3O1O A;  3LGR A;  2JB4 A;  1US2 A;  1QJF A;  4IW3 A;  4QXH A;  4K8R B;  3IDE A;  4RFR B;  4B1L A;  2CDO A;  4MGT A;  1CAX A;  1X36 A;  4KG8 A;  1TVG A;  5L9R A;  3VBU B;  1XYO A;  1RL3 A;  1XSR A;  4NMI A;  3VB9 A;  2JIC A;  1BXH A;  1UOB A;  4YWA A;  2JEM A;  3VKN A;  1XE7 A;  1QIQ A;  2GC1 A;  4JRL A;  4FSJ A;  3B9C A;  4B7E A;  4R9D A;  1RUF 2;  3J8F 1;  3G7D A;  3LEI A;  3RNS A;  1X50 A;  1MS0 A;  4XQW A;  3GM8 A;  4BQ4 A;  4HVR A;  5FZA A;  1H9P A;  4IEY A;  3HNB M;  2XBO 2;  2CGP A;  2HJI A;  3V0B B;  2YU1 A;  5KXE A;  2HEV F;  1AYN 3;  4XJ9 A;  2YUE A;  2HWC 3;  1WW5 A;  1Q56 A;  1C5I A;  2VXR A;  1IPS A;  1C8M 2;  1LED A;  4DMI A;  4XZP A;  3WG3 A;  4YAR A;  1QF3 A;  5JI7 A;  1RUH 2;  1ZA4 A;  4H2A A;  4IV3 B;  2VNG A;  3RYK A;  5DUW A;  2PQQ A;  4AL9 A;  2ZCW A;  4CP9 A;  1JYC A;  2WJS A;  3O0X A;  4DIN B;  2P6H A;  4KWJ A;  2X8K A;  4LKD A;  2WFP A;  4Y1X A;  4CU7 A;  2QQJ A;  4FPO B;  2WN3 A;  2E53 A;  4F8A A;  4LMF A;  1FAY A;  1KJL A;  4YYO A;  3CZU A;  2YG0 A;  3GZT B;  2E33 A;  2J22 A;  3GF6 A;  2E32 A;  1GNY A;  2FZ2 A;  3GNE A;  2RVA A;  4HPK A;  1LB2 A;  3B02 A;  3VHR A;  3O1V A;  1S0D A;  2XJU A;  1UU5 A;  3NO8 A;  5A80 A;  2XH6 A;  2ZHN A;  2F17 A;  1CJP A;  1RMU 3;  5LRR A;  3WF2 A;  4AQ6 A;  1NE6 A;  2ZEY A;  5LRS A;  2Y8K A;  2ZPX A;  3FX3 A;  4WM8 B;  2BBV A;  4CPB A;  2XHN A;  4Y4R A;  1ODN A;  1NY7 1;  1Z7S 1;  1W6O B;  2IXK A;  3KQ4 B;  3H9A A;  1G6N A;  3CBN A;  3ENR A;  5C33 A;  5BNP A;  4LE3 A;  3WQ7 A;  3MV0 1;  2WR9 A;  4AVT A;  2R0F A;  4Y5Z 0;  3LA7 A;  4OUS A;  4YG3 A;  2ORX A;  2YGM A;  4I0W B;  3KHB A;  4PDW C;  4AEK A;  2HWB 2;  4BZ4 A;  1G9D A;  3QBQ A;  1LEN A;  2IWG B;  2TBV A;  3NKT A;  4MLO A;  3VKO A;  1V00 A;  1ENX A;  1NE4 A;  5FZC A;  5A6Z A;  1D4M 1;  4DXR A;  2D6L X;  4O7X A;  2WNU B;  1YQ5 A;  2LRP A;  4LBL A;  3TEW A;  3UGF A;  4EJR A;  1YQC A;  2ENR A;  2NZ9 A;  3VD7 A;  1PHM A;  3MUY 1;  4UWD A;  1WCK A;  2Z4F A;  3JQX A;  3VBR C;  3I59 A;  3QH7 A;  4JRA A;  2J1R A;  5A7P A;  4GJY A;  4XFB A;  3UES A;  2VTF A;  4JQR A;  4AED B;  1AYN 2;  1SCS A;  1BLZ A;  3CDZ B;  4LO4 B;  5FYZ A;  3E97 A;  5A32 B;  4A41 A;  3I3D A;  1X8M A;  2EXJ A;  2WS9 2;  1GBG A;  1A6C A;  3GCX A;  3POF A;  1VBB 2;  5C71 A;  1F4H A;  5FOJ B;  1VBC 3;  4Q5O A;  3U11 A;  3A0N A;  1AYM 2;  1Q8O A;  1OI6 A;  4N9H A;  4Q0V A;  3MLK A;  3UKV A;  2ORZ A;  5JOX A;  5J3U A;  1WGP A;  1Q8Q A;  3ABZ A;  1GAN A;  1NLR A;  2Q5T A;  4JAA A;  3IT8 A;  3UKN A;  2BYV E;  4KNC A;  4LHN A;  1BJQ A;  1RUJ 2;  5EYY A;  3M2M A;  4RS5 A;  3WNP A;  2W9X A;  3DV8 A;  1H9W A;  2O0O A;  5BYN A;  2BP6 A;  1OA3 A;  1CAW A;  2RS3 3;  1Q5O A;  3NV3 A;  4CU9 A;  2YHJ A;  5C3O A;  1RTV A;  1WBF A;  4LXL A;  1PO2 2;  2VM9 A;  3HR9 A;  2G9F A;  1TMF 2;  4L99 A;  4MGK E;  1WA6 X;  4QQL A;  5D2A A;  1K5M C;  1UIJ A;  2IXI A;  3A21 A;  3NNL A;  3WNL A;  1GZW B;  5IVC A;  5BNN B;  4IXL A;  3NVC A;  1NCR C;  2B42 B;  2XUM A;  4XF0 A;  3OTF A;  1FT9 A;  1RYY A;  1L7Q A;  4XUN A;  3K51 A;  3BUC A;  1SPP A;  1J3P A;  4XFI A;  5DAP A;  5DMY A;  1UPS A;  4XC9 A;  3LCP A;  2D3P A;  4LK6 A;  4N90 A;  3VZL A;  5A70 A;  5FFO C;  5AFB A;  2RG4 A;  5JLV A;  4E2G A;  1CPM A;  5FIX A;  2D3R A;  3OGV A;  1I9R A;  4LHL A;  3VV1 A;  1ZRI A;  5IVJ A;  4ZXK A;  3ZIX A;  5FXZ A;  1UL9 A;  3AB0 A;  2IXJ A;  5JWP A;  3WQ1 A;  4AW7 A;  5CKM A;  1MZE A;  1IQD C;  3MGU A;  2FDK A;  4C8D A;  2ZS6 B;  4ISR A;  4I3G A;  1O3T A;  1PNG A;  2PHR A;  4AHX A;  4EYU A;  1OBN A;  1W8T A;  1S0B A;  2JWP A;  2WT0 A;  4XAA A;  5GLV A;  5A1F A;  2ZGR A;  1E5H A;  1W6O A;  2VOX A;  3F2Z A;  2VAU A;  1V9U 2;  2DBI A;  4XIL A;  2WAB A;  5F6K A;  5FDB A;  1GYK A;  3HOB A;  3ZXD A;  5E1R A;  4TLG A;  4NID A;  4GB3 1;  4AZZ A;  2CDP A;  3SHR A;  5AVP A;  1FMD 2;  1S4C A;  3VZM A;  1MS8 A;  2D98 A;  2B46 X;  4Y1Y A;  5AC9 3;  3N9M A;  5EQU A;  1NY7 2;  1Z7S 2;  3GHN A;  4RHV 2;  1W6N B;  2OKX A;  4E4Z A;  2PHD A;  4GWI A;  3KF5 A;  4AAP A;  1HQL A;  4HKL A;  4Q27 A;  5CAD A;  2R1B A;  2WWJ A;  4FQ4 A;  3O14 A;  4NO4 A;  3WG2 A;  4D69 A;  1HDK A;  2E7T A;  4ES8 A;  1GFF 2;  1OC1 A;  2E31 A;  2HWB 1;  4H14 A;  3LE0 A;  3WDY A;  4BMB A;  3DEC A;  1DGR N;  4Q4X 3;  5JZG C;  5FZH A;  5JDB A;  2G4I A;  1PVC 3;  4YGD A;  3FBY A;  2PA7 A;  3HBK A;  1GSL A;  4D7T A;  3WP3 A;  2BGP A;  2D6K A;  3AP4 A;  5SV5 A;  2GNT A;  1XRU A;  4XET A;  4EWA A;  2JDA A;  1RUD 2;  2W0X A;  1V6O A;  5C3S A;  3ZYR A;  3H3Z A;  1W2O A;  1PM7 A;  3T0A A;  1RVF 3;  2R07 2;  3APB A;  1UX7 A;  1RUE 3;  1UMH A;  2BJS A;  2C26 A;  2HWE 1;  3ACH A;  4HT1 T;  3WW1 A;  1MR5 A;  3O1M A;  1OKO A;  3THT A;  5C7G A;  1LTE A;  2UUR A;  3POY A;  2JX9 A;  1W2A X;  1AYM 1;  1CZS A;  5IAX A;  4PQ9 A;  3T1L A;  1CZV A;  3AZV A;  3ZYJ B;  5BNO A;  1HV0 A;  4UFL A;  2PHU A;  3MEP A;  2YY1 A;  3AL5 A;  4ASK A;  1RGS A;  5FAX A;  3UYJ A;  1R1A 2;  1V6J A;  4ASL A;  2JG8 C;  3WF3 A;  3WG1 A;  2FDJ A;  2RS5 1;  2ILM A;  2FCT A;  4UBG A;  3MFA A;  4GH4 C;  4ZS2 A;  2QFE A;  1AXZ A;  1HRV 3;  4XAE A;  5I8S A;  4BXF A;  4XQ4 A;  2VG9 A;  3PUR A;  2VUD A;  2PHW A;  1CAV A;  5G05 L;  2Q8O A;  2WFF 1;  4A44 A;  5F3I A;  2BGO A;  3ROU A;  4YW1 A;  4FPE A;  2OII A;  4HG6 B;  1UO9 A;  5IAV A;  1ZX5 A;  2QJV A;  4IV3 A;  1BK1 A;  1DLC A;  3RZL A;  5F32 A;  1UY2 A;  1WW4 A;  4EWE A;  2VMI A;  2F4L A;  4E8C A;  1KS4 A;  2ES3 A;  4YVW A;  1H0B A;  4PQQ A;  4LKF A;  2BWC A;  1X9P A;  5A3L A;  4WZC A;  2YFU A;  5JIA A;  1UIK A;  4TYS A;  4CDQ C;  5CBL A;  3III A;  4BQ5 A;  1NCR A;  4QGL A;  4E4H A;  3B00 A;  3CZJ A;  3W58 A;  4E4S A;  1JMU B;  1MS3 A;  1RHI 1;  1YIF A;  2JG8 B;  3MF9 A;  5BNO B;  2P4E A;  5FZ3 A;  3IDC B;  4MX3 A;  1L7L A;  3LDK A;  3SNM A;  4PLN A;  4BJ0 A;  3OYW B;  1MS9 A;  1DZQ A;  4NUB A;  3SH3 A;  2CWS A;  4GKX A;  1RUD 3;  1IG3 A;  1OPM A;  1QOT A;  5F5A A;  2PAM A;  5EFU A;  4K7J A;  1QXJ A;  3JUU A;  5DAV A;  4K9S A;  1QY4 A;  1BVV A;  1V9U 1;  3L2H A;  1QMJ A;  1AF9 A;  2VL4 A;  3T1M A;  3THD A;  4A2U A;  5FO9 B;  3O1R A;  1IQA A;  2CV6 A;  2B39 A;  3K77 A;  5HCB A;  3WW2 A;  1JZ4 A;  3AFG A;  3H8O A;  4P14 A;  4NOT A;  4IV3 C;  4LPL A;  1SBE A;  1OLQ A;  4XBQ A;  4QX1 A;  4GB3 2;  3ES1 A;  3FUO A;  2PXJ A;  4QU1 A;  5AVA A;  4XOG A;  5FO8 B;  2JDH A;  1M4W A;  2WO2 A;  3MPB A;  5L9B A;  3VBU C;  3POB A;  3K3O A;  2W87 A;  4P9W A;  2LM3 A;  5ERL A;  5EJ3 A;  2RR1 2;  1BQP A;  1LGC A;  2Z69 A;  3WD5 A;  2AEY A;  4AOC A;  5DDJ 3;  2BNO A;  3PTY A;  5DN2 A;  3H3L A;  5F3E A;  1VJ2 A;  4NAM A;  1DBN A;  5C3P A;  1ALY A;  5A7N A;  2AH2 A;  3AC0 A;  3ZFE C;  2A1X A;  2XDV A;  2B9U A;  4BU2 A;  5I0T A;  2UWA A;  5ABJ A;  4DZG A;  3BVC A;  4G3Y C;  5JIU A;  1GIC A;  2GP3 A;  1TNF A;  4CDX B;  4L92 A;  1A8D A;  4QHO A;  1MZF A;  1Y4W A;  2R04 3;  3OPT A;  1K3I A;  1JUH A;  3OCP A;  1FAT A;  1YJK A;  2ETE A;  5HI0 A;  4FP2 A;  4NN0 A;  2JG9 C;  4MYE A;  1LOF A;  1LHV A;  3DUI A;  1RUD 1;  4Y22 B;  3CU7 A;  1ACC A;  2YU2 A;  3M4F A;  3MV1 1;  5FYM A;  1W04 A;  3NKG A;  4HMZ A;  3D3A A;  4LNV A;  1LOG A;  2VQA A;  5DAW A;  3VBS C;  4DQA A;  1WLD A;  2AYH A;  1SLI A;  2N7G A;  4CTE A;  3D82 A;  2D43 A;  5FLI A;  1AR6 2;  2GN3 A;  2HWE 2;  3T2P A;  2DVG A;  1JXN A;  5CYY A;  3AZX A;  1KRI A;  3OSD A;  4KBZ A;  4M3C E;  3RMX A;  3ZN5 A;  1XE8 A;  3QCW A;  5A32 A;  1S0E A;  2NPI A;  1UYP A;  2XML A;  1ZYB A;  1ND2 A;  2UWB A;  1O3R A;  3MIB A;  4MHR A;  1LJ7 A;  1R1A 1;  1LHW A;  3W20 A;  1JYN A;  1SPP B;  1JOD A;  4CCO A;  5J7M A;  3LF7 A;  2D97 A;  4M4R A;  2XR4 A;  3AKP A;  2OW4 A;  2E7Q A;  2RJK A;  4JHT A;  4QKF A;  4DUX A;  1T6G C;  3VBO B;  2LTN A;  1Y9G A;  5GJ6 A;  3NV4 A;  2RS3 2;  4OI4 A;  4YZ4 A;  4CP9 B;  5BNP C;  4IEO A;  4FPL A;  1S0F A;  2QQV A;  2WT2 A;  3L9J T;  2ZEX A;  1QGL A;  1O7F A;  4NPL A;  1YUD A;  1UOG A;  1VBE 3;  2VMG A;  4YG6 A;  3PUQ A;  5FY0 A;  4UBH A;  1WA4 A;  3VDD A;  4CYD A;  5CU1 A;  4QX5 A;  5C5T A;  3QLQ A;  2NQY A;  3VBF A;  3RZM A;  1O59 A;  2VMH A;  3WF1 A;  5IK8 A;  4BXS V;  4Q8K A;  3CJI A;  1C1F A;  1F9K A;  1D0G A;  1SEF A;  3UV9 A;  2R04 2;  5C5U A;  1HB3 A;  1LOD A;  1MVQ A;  4J25 A;  2GMP A;  3B69 A;  1FX5 A;  2ZGL A;  5GLT A;  4DY3 A;  1DGW A;  1WCQ A;  3PJY A;  5FZD A;  1HN1 A;  2B7Y A;  4CEY A;  4B4R A;  2VTX A;  4Y1V A;  5T5L A;  4CU6 A;  4AK3 A;  1UX6 A;  4LK7 A;  1PGL 2;  1W9T A;  2CTV A;  4ZS3 A;  4J1W A;  1N1V A;  1PZ7 A;  1VPH A;  3OY8 A;  4KMQ A;  4XF9 A;  1W05 A;  3U78 A;  1XND A;  1A3K A;  2W47 A;  1OMI A;  4GIQ A;  4H55 A;  1DIW A;  3USS A;  4E8D A;  2HWD 3;  3OBZ A;  4OLL A;  4Y33 A;  3ZN6 B;  4A4A A;  4OQ8 A;  1KDK A;  3SMH A;  3DCQ A;  5DZE A;  3KT1 A;  3C8X A;  1OUX A;  3KT7 A;  4XJA A;  2Y33 A;  2OZJ A;  3RPQ A;  3W21 A;  2WLP A;  3PVO A;  1GUI A;  2DCY A;  2ZAH A;  3LPG A;  3NW4 A;  4ZU5 A;  3WW3 A;  5A1L A;  2Q4S A;  3NRU A;  1W9W A;  4ITC A;  2J1T A;  4FOY A;  1QQP 1;  1ST8 A;  5FP7 A;  3T2T A;  4K40 A;  5F3C A;  4AQ2 A;  3SIT A;  5BNN C;  2J7M A;  3TNQ A;  4V2W A;  3ZPY A;  4UOJ A;  4XFF A;  2D44 A;  3ZSM A;  2FMY A;  5J36 A;  3JB4 C;  4I0A A;  3EQE A;  3GBF A;  3P3P A;  4CDU A;  1K45 A;  4HON A;  4N53 C;  3DL3 A;  1DQ0 A;  1EPZ A;  2VZ3 A;  1UZY A;  3KWV A;  4KWL A;  2O8O A;  3H8R A;  4YFZ A;  2BNM A;  1FV3 A;  1WD3 A;  2DFC A;  2ARB A;  1QHD A;  2O8Q A;  3FLT A;  1TME 3;  3GJA A;  4Q0S A;  4Y4Y A;  2DCK A;  3ZYG A;  1AR8 3;  1S2E A;  1C4R A;  3TAY A;  2G9G A;  3VZO A;  4DFS A;  2Y0I A;  5E6H A;  3PIJ A;  5JMC A;  3I3M A;  1AL2 3;  2OX0 A;  1CX4 A;  4FFF A;  3CHX A;  4P5H A;  1RED A;  4CDW B;  4Z82 A;  3JD7 3;  5CFC A;  2YC2 A;  2CL2 A;  1AR6 1;  1YFU A;  2AEN A;  3LD8 A;  1HW5 A;  2Q8E A;  4AED C;  1PIV 2;  2JDN A;  3I49 A;  1UNB A;  4RS5 C;  2OYZ A;  2D5F A;  1ZZB A;  4HN0 A;  1QJX 1;  1UF2 C;  1ZM1 A;  4LHS A;  4XAB A;  4PBP A;  4BIS A;  4JGZ B;  1W0P A;  2VU9 A;  4XEZ A;  2HWF 3;  4IGP A;  4AVV A;  3ZPO A;  4N53 A;  2ZOE B;  4OCT A;  5DUV A;  2FD8 A;  1W3X A;  3ACI A;  2A5Z A;  5K0U C;  1B35 A;  3ZXF A;  1BHG A;  1EYB A;  3VBH C;  5B2G B;  1W28 A;  3ST7 A;  5FYU A;  1G9B A;  4AYU A;  5M0T A;  3QH6 A;  4IEV A;  1VBA 1;  2UY8 A;  4YW6 A;  3ZR6 A;  1ONA A;  3PUH A;  4QQ2 A;  4QQP A;  3ZR5 A;  2AC1 A;  1O3Q A;  4FOW A;  2WT1 A;  2QDN A;  1PZ8 A;  3AL6 A;  4XDQ A;  1FI2 A;  3AMP A;  5K9Y A;  3C7E A;  1HRV 1;  4P9X A;  4XMA A;  5KBF A;  2QBX A;  3MLJ A;  1DQ4 A;  4FPK A;  4IEQ A;  4V2V A;  4AVB A;  1UY4 A;  2WZR 1;  1ULG A;  2BW8 A;  4FPY A;  4MGQ A;  4ONU A;  5FZ8 A;  1CAW B;  4A7Z A;  4HN1 A;  4IEX A;  4LJH A;  1E5I A;  4EN0 A;  1MVE A;  3D6E A;  2DUP A;  2A6X A;  2GC0 A;  1LGB A;  1VBD 3;  2PHF A;  3WNK A;  2KXL A;  2TNF A;  1KXG A;  4Q4W 3;  4J6G A;  3NAP C;  4NRQ A;  2IXH A;  1J3R A;  2QZ3 A;  3ES4 A;  2A70 A;  3OD4 A;  4CCD A;  3D0S A;  5I8Y A;  1ZZ7 A;  1LRH A;  4JV4 A;  1LUL A;  1OKQ A;  1GZW A;  1DQ2 A;  3V0A B;  4HSJ A;  4OHZ A;  4HAN A;  1MEC 1;  3POE A;  3CIH A;  2XLA A;  5JOY A;  1FMD 3;  3CL1 A;  1F5J A;  1C8M 3;  2DVB A;  1ZRE A;  3SEE A;  1L7R A;  2CYF A;  4GB3 3;  4Y1Z A;  5I93 A;  4WVZ A;  1Z7S 3;  1G8W A;  1NX9 A;  2HWF 2;  5FY7 A;  5I0D A;  5CFD B;  2XBO 3;  1NXM A;  1UN1 A;  3UL2 A;  4NIH A;  1UYZ A;  3VKF C;  3BKZ A;  4QDR A;  3T0B A;  4AFD A;  4NIG A;  5A6Y A;  2I2S A;  5ABJ C;  5FTT C;  2JB8 A;  1V0A A;  4UFI A;  1RUF 3;  2R06 1;  5F5Q A;  4FAG A;  2DV9 A;  4IND A;  4MV2 A;  4CUG A;  1SMV A;  1RMU 2;  3NWK A;  3UGG A;  1JOP A;  1OH4 A;  4Y24 A;  4AWD A;  2K0G A;  2CY6 A;  5CG9 A;  1YQ8 A;  3ZOI A;  1PK6 C;  4DXT A;  1JN2 P;  4XFC A;  1BBT 3;  3ZYF A;  1XJA A;  5E16 A;  5A3P A;  1LOA A;  2J1E A;  3AXE A;  3LIH A;  3ZFG C;  3ZMN A;  5GAL A;  1RB8 G;  3WP5 A;  3FHQ A;  2FHR A;  3BI3 A;  1O4T A;  1V6N A;  1GOG A;  2A75 A;  4LBM A;  1RUO A;  1PM4 A;  5JXG A;  5FMD A;  1SBD A;  3BGA A;  5HXM A;  1RC6 A;  2XOM A;  2WSV A;  2EIB A;  1DU3 D;  4MUV A;  1HQW A;  3BTY A;  3AKR A;  2Z5W A;  2BV4 A;  3WUC A;  1K5M B;  2BTV C;  4LOT A;  5FMC A;  4BA6 A;  5HV0 A;  4BQY A;  4LOR A;  3VBR A;  4CPB D;  1IOA A;  1W6N A;  3BU7 A;  5BXX A;  4PI2 A;  3KLS A;  3POI A;  4IE6 A;  4HXC A;  4H3W A;  5FP9 A;  4XHX A;  4M0N A;  1VRH 2;  4AI9 A;  2Q0A A;  3D4K A;  3HD8 B;  3MF6 A;  3SH5 A;  3TRS B;  3I2I A;  2C1F A;  4UFK A;  2I45 A;  3H8U A;  1DGL A;  1FXZ A;  2VNR A;  4P5Y A;  4XBN A;  2EAA A;  4P9I A;  1W8N A;  4EN7 B;  1TNR A;  2Y64 A;  4G4F A;  3O1T A;  2JD9 A;  3DKW A;  1BYH A;  4RD7 A;  1UXX X;  3BOW A;  1GMM A;  1H4H A;  3FE5 A;  3LZZ A;  1ZNP A;  1VBE 2;  4Z2A A;  5JSR A;  2PLV 1;  4MG2 A;  2WYS A;  1VBC 2;  3IKW A;  2JJ6 A;  5DAQ A;  3RSJ A;  4AI3 A;  4AFM A;  2W92 A;  1LR5 A;  2EID A;  1J1L A;  1HXS 1;  4W6Y A;  4O65 A;  1PO1 3;  1DLL A;  1W0O A;  4D94 A;  5HV4 A;  4QKN A;  4Q8L A;  1OD3 A;  1K5J A;  1DG6 A;  1HRV 2;  1ND3 B;  2VMC A;  1IPJ A;  1QJU 2;  1VAL A;  5CEH A;  1HQN A;  2JD4 A;  3AKT A;  3BIW E;  4EWD A;  1JU3 A;  3ZXE A;  4AI1 A;  3ZFF C;  5A3O A;  3OOX A;  3E5Q A;  5FP3 A;  1IS4 A;  1D4V B;  2ZKL A;  1DYO A;  4KL1 A;  1PO2 3;  1GQP A;  2X5I C;  2WQ4 A;  3WDX A;  1FOD 3;  5FKC A;  3HIF A;  5FXV A;  2FZ1 A;  4YM1 A;  1MS5 A;  3LIG A;  2CU5 A;  2IFR A;  1D7P M;  2IUW A;  1ZRC A;  4I2O A;  3CF6 E;  1XNT A;  3WDT A;  3RWK X;  1NCQ B;  3PNA A;  1ZZ6 A;  2Y6L A;  4QHZ A;  5BNQ A;  2A71 A;  4ZXE A;  2W95 A;  5LY2 A;  4TZD A;  5DAX A;  1ND3 C;  2QE3 A;  4QB2 A;  1FYU A;  2VQT A;  4YM2 A;  1YQ2 A;  1R64 A;  5LA1 A;  2DVD A;  2ZX2 A;  3N7M A;  1KFX L;  3LDB A;  4MGY E;  2JKB A;  1OLM A;  1ND3 A;  1ULF A;  4Q4V 1;  2YB7 A;  1GWM A;  4MZU A;  3ZN6 A;  5JZG A;  5LY1 A;  1EAH 1;  2GNM A;  3PDQ A;  4RR3 C;  2LS6 A;  4K21 A;  4NJ4 A;  2P17 A;  4D7S A;  4BLI A;  1QJZ A;  5K8S A;  4P9L A;  3PVN A;  2HBU A;  5C3Q A;  1ULD A;  1BEV 3;  1V6I A;  4OUM A;  2J1U A;  1AR8 2;  1FNY A;  1RMU 1;  1YFY A;  1CON A;  5F5C A;  4CA9 A;  4XDP A;  5LK5 A;  5IWF A;  4EE2 A;  1W2U A;  1JYX A;  4YRD A;  4Q4Y 3;  1V6M A;  5J96 B;  2HWC 1;  2NYY A;  4OMD A;  2VCM A;  4B1M A;  4GQ7 A;  3HPN A;  4RYD A;  1A8M A;  1S0G A;  4R8H A;  2D6M A;  2NMO A;  1BBT 1;  5B4X A;  3ZFF A;  5ACA 1;  2R6Q A;  3MW2 A;  2YZ4 A;  3AZY A;  4P02 B;  2FDH A;  4HLT A;  1XOY A;  2X53 S;  1IZ3 A;  1CIY A;  1UWW A;  3MIE A;  2RJL A;  3ITQ A;  5FBJ A;  5FJK A;  1ULP A;  4BQ3 A;  4UW5 A;  5GZG A;  2P37 A;  3P6B A;  4GJZ A;  1ULO A;  1TQ5 A;  1ULE A;  5C4W A;  4UXA A;  5LAT A;  4AEM A;  3T2Q A;  4B4Q A;  3AYE A;  3AVR A;  4DOU A;  4QB6 A;  5DUU A;  4LT5 A;  1XNB A;  1MZ5 A;  1NAE A;  2BGC A;  4CCL A;  4UFH A;  3GJB A;  3TBD A;  3DEM A;  3THP A;  2VMD A;  3GYD A;  5FMO L;  4S2D A;  2V5Y A;  1W8W A;  1AL2 2;  3NV1 A;  4AHW A;  4JX0 A;  3OBA A;  4LA3 A;  2LW8 A;  2QKD A;  2HKX A;  4O9G A;  1E57 A;  2R30 A;  1RVF 2;  3EHK A;  1ZZ8 A;  3ZIW A;  1UMI A;  1MS4 A;  3J26 N;  1OQE A;  4BK4 A;  4M3C B;  5F39 A;  4OI0 A;  4N53 B;  2XJP A;  4YW3 A;  5FZ6 A;  3LAG A;  5FCC A;  3K2O A;  5FZ4 A;  5FPU A;  2GND A;  4QQH A;  1CJD A;  2GMM A;  2OT7 A;  4CCM A;  3AP9 A;  5F8P A;  3PL0 A;  3VZN A;  1OOP A;  3DKQ A;  2O14 A;  2YPJ A;  3KZ4 C;  2VMF A;  1EY2 A;  2DYC A;  3NAP B;  1QJU 1;  4N7I A;  4PT6 A;  1LEC A;  1WLW A;  2Q1M A;  2H0V A;  3PME A;  1UPI A;  2XJV A;  4U2A A;  1BVP 1;  1RUI 2;  5I0S A;  4FPH A;  4YM3 A;  2ID4 A;  2R07 3;  1Q3E A;  4MH0 E;  4XDO A;  4Y1U A;  1O91 A;  2C4X A;  4FI9 A;  5C6C A;  2NP0 A;  2WZE A;  4GWJ A;  3TEY A;  3QOP A;  2Z2S B;  3KCX A;  3K4Z A;  3BTZ A;  4LR4 A;  2XXZ A;  1OF4 A;  4FPC A;  5DQ0 A;  2VJX A;  4F3J A;  1NYW A;  3FHI B;  2WUH A;  1RUN A;  3ZSL A;  5LAS A;  4XUO A;  4K20 A;  1PGS A;  3RJ2 X;  2CAV A;  1PX4 A;  1H8T C;  2DU1 A;  2DFB A;  2WO3 A;  5IVB A;  4QKD A;  1MS1 A;  3ORJ A;  2ZKN A;  2XWJ B;  1XQN A;  2WNU A;  1ZBA 3;  1H8T A;  1QJY 2;  2OQ7 A;  4CEW B;  3RZZ A;  3J9S A;  3ZMO A;  1ZBE 1;  2YBP A;  1Y3T A;  2HYX A;  4AHZ A;  1VAV A;  1JYW A;  1ENR A;  1Z78 A;  4MAD A;  2XVG A;  4XQD A;  3TN9 2;  3S0M A;  1BMV 2;  3J4U H;  3LKJ A;  5JCT A;  3MPP G;  2OPW A;  5JSP A;  2RS1 2;  1YHF A;  2F4P A;  5FR3 A;  3IZO A;  5T5P A;  3OYW A;  1DFQ A;  2H6C A;  4CDW A;  2NM1 A;  2UY9 A;  4NIA A;  3WX5 A;  3T4H B;  1OHF A;  1UAI A;  3H7Y A;  1GWK A;  1OFS A;  4XTM A;  3WHU A;  2IXL A;  4XW3 A;  5A6Q A;  1UY1 A;  2ZMN A;  1PO1 2;  3MID A;  1JHJ A;  4DEV A;  3WR0 A;  4DS0 A;  1EV1 2;  1UYX A;  2ZGP A;  4ARX A;  1N3P A;  2G19 A;  1DYP A;  2TUN A;  1RUG 2;  2VNV A;  3B93 A;  3MLL A;  4GD4 A;  4Q4Y 1;  4QPY A;  3VHP A;  4D7Y A;  4E2Q A;  3FFQ A;  2EF6 A;  3O0W A;  3SLI A;  3Q8C A;  2Y38 A;  4AHY A;  3KGL A;  5FP8 A;  1CPN A;  4CDU B;  2W1W A;  2V4A A;  1QDO A;  3IMN A;  2VZT A;  4CU8 A;  2OQ6 A;  2XGX A;  2VVD A;  1OH3 A;  4QWN A;  1GZC A;  1NA1 B;  2ZMK A;  1J1T A;  2B45 X;  5KHK A;  5IW0 A;  1YJL A;  1XXN A;  4LBJ A;  5FY5 A;  3RMY A;  3ALQ A;  4DB5 A;  1FPN 1;  1SZB A;  4XUQ A;  1WW7 A;  3V0B A;  3TEZ A;  1G86 A;  3J7L A;  3MI8 A;  4MGS A;  2YRO A;  1G9A A;  3ZYP A;  4IEW A;  2VGD A;  4K1Y A;  2UU8 A;  4FTB A;  4YGB A;  2XHK A;  1TME 1;  4CP2 A;  4MXW A;  1CVN A;  2P6C A;  1E5R A;  3JQW A;  4AGG A;  1S1A A;  1PVC 2;  4Y5T A;  2XVK A;  3OEA A;  5BPX A;  1VB2 A;  5D8A A;  5TSW A;  2VZV A;  5K0U B;  3KMH A;  4QPI B;  1JZ3 A;  4PDW B;  5CFC C;  1PK6 B;  1X7N A;  4JKK A;  3J8F 2;  3N36 A;  1V6K A;  4ARY A;  5BV6 A;  4XFH A;  1LU1 A;  2CNA A;  1HKD A;  3HT2 A;  1PMI A;  4CSW A;  4YW5 A;  3URF A;  2R49 A;  4Z2W A;  1UZZ A;  1NLQ A;  2G1M A;  5IYY A;  1KEX A;  1OVP A;  1EUT A;  2C9A A;  1JS9 A;  4Q2F A;  5DXD A;  3VD5 A;  5JXI A;  4KI5 M;  4GXL A;  2AUY A;  1V70 A;  4X8N A;  1QJU 3;  3OGJ A;  2B4K A;  2QQO A;  1Q8V A;  2L9L A;  1XNA A;  2XQX A;  4XZU G;  3AK0 A;  4W50 A;  2YV8 A;  1ZZ9 A;  3R6S A;  1RUH 1;  2G9Z A;  1MQT B;  1JUI A;  2Q30 A;  2D6N A;  1RIR A;  2AZ5 A;  4I01 A;  4IGQ A;  4AGR A;  5FBZ A;  1XC6 A;  4WVV A;  4RQP A;  1SDD B;  2UWC A;  4BIO A;  3ATG A;  3NNF A;  2LAL A;  3PJQ A;  3LEK A;  3M70 A;  5J98 B;  3H8X A;  4UW4 A;  4DRV A;  1J58 A;  3AKS A;  5FWE A;  1AUY A;  4JTN A;  4GKY A;  4JCK A;  3DXU A;  5FMO S;  1M06 G;  5FY1 A;  2VCB A;  4Q0U A;  2J1A A;  3FFZ A;  1X33 A;  1N3O A;  2ZGK A;  1POV 1;  4TSV A;  5GLW A;  2IZW A;  3B01 A;  4HK9 A;  2QCS B;  5FLJ A;  3VN4 A;  1ND2 B;  4LEJ A;  2GH8 A;  3HAG A;  1O5U A;  1F35 A;  2W3J A;  4LBQ B;  4X6Q B;  4YZ5 A;  2I74 A;  2XL9 A;  1C28 A;  1YFW A;  1HB4 A;  4COZ A;  4LO5 B;  1Q8P A;  1R09 3;  4WVM A;  2RS1 1;  5FRA A;  1O4Z A;  2VBD A;  5FZO A;  1AR9 2;  1MZ6 A;  1EUU A;  1D2S A;  1Y7B A;  1K5M A;  3B5L B;  2ADE A;  4BM8 A;  3DN7 A;  3S30 A;  1PZ9 A;  3P5B A;  4XCB A;  4LO6 B;  3ZYI B;  2WN2 A;  2PYT A;  4NRM A;  4M0H A;  4BQX A;  3CJX A;  1D4M 2;  1WD4 A;  3RZK A;  2VE1 A;  2X29 A;  5CFD A;  2X5I B;  3SQO A;  3EMR A;  1EV1 1;  3JBG 3;  1W6P A;  3I2K A;  4JZR A;  4OVE A;  3VDD B;  4Q4Y 2;  4A42 A;  1RUG 1;  4CXX A;  4K6B A;  4RQP C;  2XJS A;  1LOE A;  5FYT A;  3VBF B;  2VBP A;  2WO7 A;  1W9S A;  4OHY A;  1AYN 1;  2GSY A;  4IV1 B;  4LO8 A;  2YDE A;  1DQ5 A;  4P9G A;  4LQR A;  4W6W A;  4YVW B;  3VKM A;  3WNX A;  1VRH 3;  3CO2 A;  3U10 A;  3TB0 A;  2JDZ A;  3NNJ A;  1G9C A;  3FN9 A;  2BQP A;  4RFT 0;  1W2N A;  4DIQ A;  2QQW A;  4WVM B;  4CXY A;  3PUA A;  1VLN A;  2WRA A;  1P8J A;  3WEZ A;  2V4V A;  4ORF A;  3WOG A;  3WNO A;  2VME A;  3RYR A;  5A3M A;  4YNI A;  5FYS A;  1RUJ 1;  2B9V A;  2DU0 A;  1VIW B;  4K8F A;  4J1X A;  3PMS A;  4BWO A;  2VC9 A;  2HEY F;  2J1V A;  5D21 A;  2HLE A;  4BK5 A;  2VNO A;  4B7K A;  5F2W A;  3RDI A;  3WHT A;  1H2M A;  3OG2 A;  4FPJ A;  5FZ7 A;  3WQB A;  1TMF 1;  3ZXK A;  2TEP A;  3N7L A;  3EO6 A;  4HET A;  5C8C A;  1LCL A;  3AP5 A;  4W8J A;  2ZHK A;  1SCR A;  4FTE A;  4QX0 A;  2XVL A;  5ANQ A;  3WY6 A;  1RXF A;  4AXO A;  5AC9 2;  1YC6 1;  1WW6 A;  2GN7 A;  4HZF A;  5DZG A;  3M3O A;  4IL7 A;  4E27 A;  1LHN A;  2WBK A;  3WNN A;  5CFD C;  3V56 A;  3FMG A;  5JPM B;  1KDM A;  2Q1F A;  1CAU B;  1VP6 A;  2VUJ A;  4QB1 A;  3AYA A;  4XIK A;  5ABJ B;  1I1E A;  2ERF A;  5CA6 A;  2JG9 A;  2JDY A;  4LIU A;  3UK9 A;  5F1R A;  1IPK A;  4CDX A;  1YCI A;  2P3K A;  2RM2 1;  4NHL A;  3ZFE A;  3TNP B;  1OT5 A;  3VKL A;  2BFU S;  1W9Y A;  2JE9 A;  2VCA A;  2ZJC A;  3C7O A;  3GZA A;  4PCR A;  5DUX A;  1NZI A;  3HNY M;  4Q4W 2;  2ZBJ A;  1D0H A;  2EIE A;  1EV1 3;  3AP7 A;  3JBG 1;  3USU B;  4I30 A;  4COV A;  4GAZ A;  1W8F A;  4KU7 A;  3K4D A;  1FMD 1;  2Y34 A;  4S2H A;  4AGV A;  1PGW 2;  5C8C B;  1VAK A;  5HCA A;  4Q4V 3;  4LIV A;  4LO7 A;  5C4W C;  5FZB A;  2BNN A;  1AR7 2;  1H1A A;  4XFA A;  2PEL A;  4HPK B;  1R08 3;  4OI2 A;  2DTY A;  4RHV 1;  3A23 A;  3MYX A;  5H9R A;  3I8T A;  2ADD A;  3V65 A;  1JU4 A;  3E5U A;  4WM7 A;  1SLL A;  4RR3 B;  2DWR A;  5IVE A;  2W1Q A;  3JD7 1;  3IPV A;  2P2K A;  2R16 A;  4BDV B;  4QPI C;  2VZU A;  1OA4 A;  3S7I A;  4FXK B;  4YLZ A;  3WW4 A;  1KD7 A;  2NN8 A;  5EP9 A;  2JIG A;  5DZF A;  4NPM A;  4H7L A;  5H9S A;  3RFR A;  2PFW A;  4ZKT B;  2FDF A;  4URA A;  5IVF A;  4CDQ A;  5A6X A;  5FRE A;  4XUR A;  4YZ1 A;  4ZZ5 A;  4XXP A;  1COV 1;  3A7Q A;  5L7O A;  3B7M A;  3IM0 A;  3PVE A;  3P1I A;  3AJY A;  3Q8F A;  3IN9 A;  2ZML A;  1C1L A;  1W8O A;  1VMF A;  2V73 A;  4ZON A;  3LDR A;  4RGK A;  2RS5 3;  1I6X A;  3J7H A;  2R07 1;  3ZM8 A;  3ZXA C;  3S5A A;  1JYV A;  1J59 A;  1O3S A;  1GU3 A;  2XJR A;  5KC6 A;  3WCS A;  1VBA 3;  1CAV B;  5LA9 A;  2ZHL A;  4JDM A;  3WZ1 A;  1KGY A;  3UNP A;  5KHG A;  4NHK A;  2VZS A;  1WZX A;  3C7F A;  3KV5 A;  4XE9 A;  5KC5 A;  2KA3 A;  3ZFF B;  4CEW C;  2UYA A;  3I59 B;  2GME A;  3E6B A;  5FV3 A;  4YZ2 A;  3KD4 A;  2WWU A;  3IDB B;  3LQC A;  3ZSE A;  4UF0 B;  2WNV C;  5BNO C;  2I07 B;  4XCA A;  2CGN A;  3O7O A;  3OY8 B;  4B29 A;  1IGO A;  3KVA A;  5GZE A;  5ACA 3;  5KXC A;  2WFF 2;  3BN6 A;  5I91 A;  4TTG A;  4NPR A;  3VBR B;  2RV9 A;  2WS9 3;  1DF0 A;  1OD5 A;  4MOA A;  4BH9 A;  4CE8 A;  2D6O X;  4DRR A;  1W6M B;  2VZP A;  3ACF A;  3MHZ A;  4G9S B;  4UW6 A;  3U4X A;  2ZXQ A;  4M00 A;  3LB9 A;  2JKX A;  1GP4 A;  5D8A B;  1GR3 A;  3JXS A;  2OXB A;  5AC9 1;  1BCX A;  2XBO 1;  3FUQ A;  4NHX A;  3ACG A;  4XF1 A;  3VBU A;  4ERO A;  5EIY B;  3OF1 A;  4EN6 B;  1QDC A;  2ARX A;  1J3Q A;  2BER A;  4CEY C;  1I5P A;  3AP6 A;  3HQX A;  1RHI 2;  1LEM A;  1TMF 3;  2J42 A;  1C8M 1;  1G9F A;  2QDR A;  3A0K A;  2W39 A;  4AFA A;  4CEW A;  2VZR A;  3VUO A;  4YZ3 A;  1SLB A;  5K4L A;  2HWD 1;  5BNN A;  1OLM E;  2CWM A;  2VR4 A;  3T2O A;  4B8E A;  3WLU A;  4FO9 A;  4D0Q A;  4E9K A;  1SFY A;  3E1F 1;  3O1U A;  2KR2 A;  3OPZ A;  2XB6 C;  2ZX1 A;  4GA9 A;  4N9I A;  3VBF C;  3H3U A;  4AI2 A;  2RM2 2;  2AEZ A;  3GBW A;  3JU9 A;  4RGA A;  3MIH A;  3H50 A;  4C0B A;  2OZ6 A;  4IER A;  4AFB A;  5FZO B;  5FWJ A;  4OUL A;  3SXW A;  2DUR A;  4Q4W 1;  3N9N A;  1RUH 3;  1VMJ A;  4LLF A;  5FKB A;  4E2S A;  1LHO A;  1QXR A;  1H2L A;  1F4A A;  2BDR A;  1D2Q A;  3ASI A;  1AR9 3;  4AE2 A;  2VQ0 A;  3KT4 A;  5FUI A;  1PIV 3;  4EV0 A;  4RSU A;  1DGR A;  5EHD A;  5FQ0 B;  5JXJ A;  4XJW A;  3UET A;  1YYN A;  2SBA A;  2X5I A;  3KVB A;  4MVT A;  4XUP A;  5F9T A;  2VW0 A;  2RR1 1;  1S55 A;  3BB6 A;  3HJR A;  4N8M A;  5DAB A;  2UYB A;  2W1U A;  1NZC A;  1IG0 A;  2VBB A;  2OPK A;  3O12 A;  4JGZ A;  5FP4 A;  1JH5 A;  2WWS A;  1TEI A;  1AR6 3;  3FZ3 A;  4JGY A;  4D3W A;  3AM2 A;  1W90 A;  2WAA A;  1DQ6 A;  1ENQ A;  2W91 A;  3JD7 2;  3W59 A;  4IES A;  4JDO A;  5IHR A;  5IK4 A;  3KCY A;  2BU9 A;  4KQ7 A;  4HKO A;  1T2X A;  2XJT A;  4MO3 M;  2XLG A;  4Y26 A;  2ARA A;  3PUI A;  1KFU L;  1HJG A;  3CLP A;  3KV9 A;  4WM7 C;  3W5N A;  2ARE A;  2XON A;  3B9I A;  1POV 3;  2DCZ A;  2QQK A;  1CD3 G;  3AJZ A;  3VLB B;  4LIT A;  1MQT C;  3BTA A;  4MGZ E;  3VDC A;  2PLV 3;  4IEZ A;  3RRD A;  5IAT A;  1COV 2;  2PTM A;  4M3C F;  2IFW A;  1NXD 1;  1OFN A;  1VBD 2;  4MSV A;  2RJ2 A;  4COY A;  5A3T A;  2XG3 A;  5CVR A;  5JXH A;  2ZAC A;  3IAQ A;  1PMH X;  3MW4 A;  1YLL A;  4XIO A;  2YYO A;  2QQU A;  4N43 B;  1CIW A;  4EZH A;  4GMP 1;  5A33 B;  2B5H A;  2WS9 1;  4LHK A;  4D6Q A;  1UQX A;  3NNM A;  1H1I A;  1VBB 1;  3VBS B;  3VD3 A;  4ZY9 A;  2VD7 A;  3PU3 A;  5BNP B;  1VR3 A;  3RI8 A;  3SH4 A;  4I02 A;  1W03 A;  2GU9 A;  2CAU A;  4IV1 A;  5EPA A;  4Z8B A;  3T3Y A;  3UKT A;  4BOW A;  1WKY A;  4CZS A;  1S0C A;  4NII A;  4BHP A;  3ACL A;  1POQ A;  2YXS A;  4YVS A;  4YM0 A;  3I2J A;  2ZAB A;  4QD2 A;  1GQG A;  1GP6 A;  5CIS A;  4JHZ A;  3B94 A;  3ZN4 A;  2HYK A;  4P9Y A;  1YI9 A;  5A3N A;  3NJZ A;  1WMF A;  1PX3 A;  3RZG A;  3MIF A;  4Q1P A;  5EJZ B;  4M4P A;  1PO2 1;  2PQS A;  3NJY A;  4XBL A;  4AAX A;  1SFN A;  1GWL A;  5C4W B;  2RS3 1;  1SLC A;  2WIN B;  4YFW A;  1H1M A;  5DPN A;  3BTX A;  2A73 B;  3R4U A;  3SCF A;  5J1X A;  4OHV A;  4TXW A;  3ZXL A;  3FLP A;  3HWJ A;  3H1Y A;  4LUM A;  4D8M A;  3DPR C;  3O5S A;  3M3Q A;  1AL0 G;  4NHY A;  1ZA7 A;  4DNY A;  3U07 A;  3PU8 A;  3MUZ 1;  5IFT A;  2A6Z A;  3SCG A;  4C0H A;  1R1A 3;  2ZA9 A;  4W4Z A;  5JOZ A;  3W5M A;  3ZDV A;  2R04 1;  3LSD A;  4CVU A;  4Y5S A;  1RUE 1;  3WT3 A;  5IFP A;  2P1B A;  5CZK A;  5GLZ A;  4QM8 A;  4Y20 B;  3U75 A;  4OZX A;  4QM9 A;  2HWD 2;  1E5S A;  3ECQ A;  4YVW C;  1UKG A;  4PDW A;  1L3J A;  4NRP A;  2WNO A;  3OPW A;  4IUG A;  2RDR A;  4Q0Q A;  3AZZ A;  4XPV A;  2VUL A;  4LBK A;  5FYH A;  3CJI C;  4B3N A;  3MIC A;  4Z92 B;  5GLU A;  4PJY A;  4JDN A;  2HEW F;  3U4S A;  2Y0O A;  2EAL A;  1JTZ X;  2JG9 B;  1AR7 3;  1C8N A;  5F7U A;  1XU2 A;  3LA2 A;  5C70 A;  5ANN A;  3WP6 A;  2FDG A;  2YBK A;  1UD1 A;  3O1P A;  4SLI A;  1GLH A;  4YW2 A;  2QUO A;  4L2N A;  3DYM A;  1IHM A;  2XL7 A;  3AYD A;  4NVP A;  4DY5 A;  1EP0 A;  5L9V A;  2VW1 A;  1A78 A;  2K9Z A;  2WQ8 A;  3AMQ A;  1QQP 2;  2VOK A;  1DHK B;  3M8L A;  2P3Y A;  3Q9O A;  2VH9 A;  1JYI A;  1ENS A;  1GNZ A;  4LKE A;  4FTS A;  1QJY 3;  3GDB A;  4GZ9 A;  2HWE 3;  5CKN A;  3SEP A;  2ZGT A;  5FPA A;  3PIG A;  1OVS A;  4AF9 A;  1H2K A;  1MAC A;  3I2H A;  4LLO A;  5A33 A;  3THC A;  1NG0 A;  2W46 A;  3BOP A;  4XMI A;  5J37 A;  5GZF A;  3O0V A;  2QQN A;  1H8T B;  5LEJ A;  3I2O A;  5DG1 A;  4A6O A;  5T55 A;  4BCU A;  1H4G A;  4SBV A;  2RDQ A;  5DDJ 2;  3U14 A;  2RS1 3;  4COU A;  3FWE A;  1GP5 A;  1VBD 1;  1F8V A;  1DZT A;  2RDN A;  2XKO A;  3BCW A;  1XNK A;  3LEG A;  4QXB A;  2VOW A;  3EBR A;  1NCQ A;  5CB7 A;  3BIE A;  1CGP A;  5LBF A;  3WG4 A;  1PNF A;  3D8C A;  3SIS A;  1C57 A;  3T0D A;  2YC4 A;  1IS5 A;  3OJB A;  4CDW C;  1PIV 1;  4CRQ A;  1LGN A;  4L11 A;  1DDL A;  4Y22 A;  2Y6G A;  4JVA A;  1SBF A;  1QJX 2;  3MDP A;  4AR2 A;  1JZ7 A;  1JW6 A;  1CES A;  1YO8 A;  3NV2 A;  4IE5 A;  2D6P A;  1OLR A;  1VRB A;  2YPD A;  4IE7 A;  1U12 A;  4QX3 A;  5SV8 A;  2C0Z A;  3RYP A;  1BK0 A;  1NQD A;  4PLM A;  4OQ9 A;  4UFM A;  2E6V A;  1C5H A;  1NQJ A;  1QNY A;  2B8M A;  2RS5 2;  4DEQ A;  2VXJ A;  4Z07 A;  3BPS A;  3POW A;  3BU0 A;  4A6S A;  2C6S A;  4W65 A;  4CCN A;  1HIX A;  4QKB A;  1QU0 A;  1YI7 A;  2VVE A;  4XUT A;  3HEI A;  3UJQ A;  1IKP A;  4QXC A;  3VBH B;  1F5F A;  2W1S A;  2A7A A;  3POG A;  1B35 C;  2GZW A;  1JZ2 A;  3NQH A;  4XVH A;  5LEK A;  2WFF 3;  5F5I A;  1SG3 A;  3T08 A;  1APN A;  4QX2 A;  2W08 A;  2WYF A;  4IDZ A;  4EQV A;  5LBE A;  2GH2 A;  3ZXJ A;  5JZG B;  3WQ0 A;  5J09 A;  1BEV 2;  2MPF A;  3KB5 A;  2MNG A;  1DCS A;  1N1T A;  5KXB A;  4RS5 B;  1VBB 3;  2JE8 A;  2VZ1 A;  3ELN A;  4Q0P A;  1NUK A;  3AVS A;  1JZ8 A;  1RUE 2;  3USU A;  4CCJ A;  3NNG A;  3MW3 A;  5KXD A;  1OUR A;  1AX0 A;  1TG7 A;  1O8P A;  4NAO A;  5JMO A;  3LEM A;  2O1Q A;  3OUJ A;  4K1Z A;  3HBZ A;  4KU8 A;  1SLT A;  5JOW A;  4MHU A;  1VB4 A;  1W3V A;  3RZH A;  3RZJ A;  2HH9 A;  1VE0 A;  1UU6 A;  4L8Q A;  3E6D A;  3I7D A;  5FOB B;  1UOF A;  3ETQ A;  1CR7 A;  4PLO A;  5FY4 A;  3BOD A;  4QPG C;  2Y6H A;  1MEC 2;  1WBL A;  2R0H A;  4LA2 A;  4NWW A;  3T09 A;  1K12 A;  1CAX B;  3RG0 A;  3ZFG B;  1XSQ A;  2A6W A;  1W8Z A;  2Z42 A;  3ZYH A;  4BQ2 A;  1UZV A;  1WCD J;  2HWF 1;  1LOB A;  2WLQ A;  1PVX A;  1XU1 A;  1XB9 A;  4OHX A;  2WNV A;  2W5F A;  1JBC A;  1VAM A;  5FY8 A;  3ZFE B;  1HB1 A;  3I97 A;  2A3X A;  1OUS A;  3RWN A;  4MGI E;  1I5Z A;  3I2D A;  4GH4 A;  4NWV A;  3I2G A;  2IVJ A;  5A7W A;  1AJO A;  2DVF A;  2PHX A;  4U36 A;  1ZBE 3;  3N4M A;  5CIR A;  1KIT A;  2X05 A;  2QQP A;  5A3U A;  2XPJ A;  3TEX A;  3VDB A;  4NR1 A;  1CX1 A;  3OUH A;  4ZHN A;  4S2G A;  4Q26 A;  1UCX A;  2ARC A;  4F7Z A;  1HRI 3;  5IVY A;  4M3C A;  5L73 A;  4P08 A;  1LAJ A;  4QPG B;  5JI9 A;  4LBO A;  2WDB A;  1LKN A;  2NLR A;  2RE9 A;  5DG2 A;  4JGY C;  5LWB A;  4ET7 A;  1YNA A;  5T5J A;  5IVV A;  3CKH A;  2BFU L;  4O61 A;  2OUJ A;  3PTR B;  4QAW A;  5DDJ 1;  3VL9 A;  4ES9 A;  3U0Z A;  1QWR A;  3M3E A;  1CQ9 A;  1AXK A;  1MPX A;  2RR1 3;  1AVB A;  3WUD A;  1HLC A;  1AZD A;  5AFE A;  1KQR A;  5C9A C;  1DGW X;  3DXT A;  3OD0 A;  1B09 A;  4TLF A;  1DQ1 A;  2R06 3;  4IGO A;  2WNE A;  1ND2 C;  1QKQ A;  3POS A;  5HBA A;  1MQT A;  4R9A A;  1REF A;  3HN1 A;  5E88 A;  5EV7 A;  4CUC A;  2JDU A;  4DXZ A;  4RR3 A;  1VRH 1;  4WM8 C;  5JUV A;  4XJ8 A;  5FPV A;  1W9F A;  3VBH A;  1JOB A;  3KHC A;  4O9E A;  4BQ1 A;  4JC1 A;  3WDW A;  1H2N A;  3ZKU A;  1J84 A;  2C5D A;  5L7O B;  5E89 A;  2W68 A;  4DO0 A;  4UW3 A;  1W8H A;  5T54 A;  4NE9 A;  4AVS A;  5IK5 A;  1W6P B;  3N9Q A;  3KS7 A;  3C2U A;  1QH7 A;  3E6C C;  1FV2 A;  1DYK A;  2P34 A;  2ZZQ A;  3GGL A;  3M7A A;  4FFG A;  3B3Q E;  5IT6 A;  2YFZ A;  3LOB A;  4FOV A;  4FPG A;  5GZC A;  1VBC 1;  2RDS A;  2JIJ A;  3DYO A;  3FL7 A;  2WA4 A;  2VCC A;  3EB7 A;  4PIZ A;  2RMU 3;  5GM0 A;  4N7U A;  2F6B A;  5H9Q A;  1HXS 2;  4FP3 A;  1S2K A;  4GWN A;  4YGE A;  3OGS A;  5EWS A;  2R32 A;  5A1A A;  2ZGM A;  1I3H A;  1ZRR A;  3L2Y A;  4QQO A;  2VEC A;  2WII B;  1BEV 1;  1UYY A;  2J1S A;  1W0N A;  3N3H A;  3INA A;  3UGH A;  1GOF A;  1NT0 A;  2SLI A;  5BY5 A;  2E26 A;  1Q8S A;  3DPR A;  3GCW A;  1W39 A;  4HL0 A;  4WBB A;  1LES A;  4ASM B;  2ZX3 A;  1CWP A;  1QJE A;  3H7J A;  4GMP 0;  4CXW A;  2W2I A;  4HVQ A;  2W52 A;  5FXX A;  5FZE A;  3OB8 A;  1A34 A;  1QNW A;  3GAL A;  5A3W A;  1PGL 1;  1RUC 2;  5FZK A;  4HKW A;  5GKA C;  2XLF A;  4Y20 A;  5T52 A;  3AMM A;  3HMY A;  4QDS A;  2EIG A;  3JB8 A;  1F15 A;  1HRI 1;  1W8U A;  3F95 A;  4IV1 C;  4KGQ A;  3WIN E;  1H6X A;  1ULC A;  1AYM 3;  4ISQ A;  1RUG 3;  3EJK A;  4CP1 A;  2WC2 A;  1OOP C;  3R4S A;  4S2F A;  2VUC A;  2CHH A;  3V64 A;  3X29 B;  1NCR B;  4LUL A;  4YG0 A;  4HSL A;  3V0A A;  2WZR 3;  4QPG A;  4Q4V 2;  4BPZ A;  2BVV A;  2PN5 A;  3N9L A;  5FZ9 A;  1OQD A;  1R08 2;  3VZK A;  1Y9Q A;  4EZ4 A;  2KD7 A;  4JTO A;  3TWI A;  2PMW B;  5FYV A;  1NA1 A;  3P3N A;  1UOJ A;  5LA2 A;  3S7E A;  2A3W A;  5KHI A;  1REE A;  3DPR B;  4A7Y A;  2XKP A;  1T6B X;  4XFG A;  2NMN A;  4KWU A;  4L97 A;  4QDQ A;  3OGR A;  3ETP A;  5C3R A;  2V09 A;  4LTA A;  5K7P A;  1HXS 3;  3SKJ E;  3WVJ A;  5K0U A;  4FFI A;  3QD6 A;  4BE3 A;  3MO4 A;  2Y6J A;  5KR7 A;  4CCK A;  2OVU A;  1NCQ C;  1BBT 2;  3WNM A;  2JEN A;  4QXK A;  1AXY A;  1QXP A;  1PK6 A;  2KM2 A;  3SC7 X;  4OYU A;  3WF0 A;  4C90 A;  4P9J A;  1FPN 3;  5IJR A;  1UKR A;  2EXH A;  5T50 A;  2HBT A;  2JDK A;  2OUH A;  2ZGS A;  3UT0 A;  1Y9M A;  2E9Q A;  4OZO A;  3ZSK A;  4ZZ8 A;  2RMU 1;  3VD4 A;  3A4U A;  4QX8 A;  2DBN A;  2EAK A;  2H0B A;  3H1W A;  2K46 A;  4JGZ C;  5FZL A;  4JKL A;  3C3V A;  5JR7 B;  5I8T A;  5CNA A;  2Y26 A;  3AXD A;  5A7Q A;  4R4Z A;  2WSU A;  4K3U A;  1W06 A;  1GKB A;  5FMB A;  3RGB A;  1XE0 A;  4L0P A;  2EA7 A;  1V9U 3;  1STM A;  1U5X A;  1AL2 1;  2GDF A;  1U0A A;  2VO5 A;  2AGS A;  2BUK A;  3IBM A;  3RQ0 A;  3ZXG A;  4AFC A;  2XJQ A;  4IQP A;  4PIY A;  3IDA A;  1HJF A;  4XYX A;  1RVF 1;  2GNB A;  1XYP A;  2BPA 2;  3K4A A;  3SKV A;  3S57 A;  1O4Y A;  3OUI A;  3RVH A;  4YGC A;  3S5Q A;  1RUC 3;  4WZF A;  3N7K A;  3ZLI A;  1VBA 2;  4LKS A;  3I3E A;  3U37 A;  1X9T A;  2ZGQ A;  1HV1 A;  1U5Z A;  2A6Y A;  2VQU A;  5D1I A;  4BYY A;  3VBS A;  3CNA A;  2P3I A;  3QAC A;  2OA2 A;  3MFC A;  2JE7 A;  1GOH A;  3H42 B;  1N1S A;  2VW2 A;  3O1S A;  5FPZ A;  5FPX A;  1WMX A;  2BVB A;  1S0I A; 
#chains in the Genus database with same CATH homology
 1JU3 A;  5EIY B;  3ACG A;  2BER A;  3OGV A;  1I5P A;  1DYO A;  2ZEW A;  5EJ1 B;  1GQP A;  2VZR A;  2VR4 A;  3T2O A;  4D0Q A;  1IQD C;  3E1F 1;  3NJV A;  1D7P M;  3CMG A;  1XNT A;  2Y6L A;  3F2Z A;  1NKG A;  4P00 B;  2DCJ A;  2WO1 A;  2WAB A;  4ZXE A;  2W95 A;  3HOB A;  1F4A A;  4QB2 A;  2VQT A;  5FUI A;  4A45 A;  1YQ2 A;  1R64 A;  5LA1 A;  2CDP A;  4UI9 L;  5JXJ A;  3UET A;  4XUP A;  2YB7 A;  4DUV A;  3HJR A;  2LS6 A;  2W1U A;  2OKX A;  4GWI A;  1US3 A;  2J1U A;  2WAA A;  2W91 A;  5IHR A;  4UAP A;  1DP0 A;  2E31 A;  3LE0 A;  3DEC A;  1JYX A;  1T2X A;  4MO3 M;  2VZO A;  4CUA A;  3PUI A;  3W5N A;  3GXU A;  4OMD A;  2XON A;  2BGP A;  2QQK A;  3HPN A;  4RYD A;  5B4X A;  3VDC A;  2JDA A;  2VOT A;  4P02 B;  5HPO A;  1CIY A;  1UWW A;  2RJ2 A;  5JXH A;  1ULP A;  3IAQ A;  1PMH X;  3T0A A;  3P6B A;  1ULO A;  3T2Q A;  1UX7 A;  3ACH A;  1UMH A;  2C26 A;  2WAO A;  4QB6 A;  3VD3 A;  1NAE A;  4ZY9 A;  5C7G A;  1UY3 A;  1CZS A;  2VMD A;  4JKM A;  1CZV A;  1CZT A;  1WKY A;  4JX0 A;  3OBA A;  2LW8 A;  3WF3 A;  3I2J A;  4JHZ A;  1UMI A;  4BK4 A;  1PX3 A;  5G05 L;  5EJZ B;  4M4P A;  4A44 A;  2PQS A;  2BGO A;  4AAX A;  4CUB A;  4HG6 B;  5DPN A;  1DLC A;  1UY2 A;  5J1X A;  4TXW A;  4A3Z A;  4E8C A;  4D8M A;  2VMF A;  3I2F A;  2ZEZ A;  4PQQ A;  5IFT A;  3MUZ 1;  4PT6 A;  2YFU A;  3III A;  3CZJ A;  3LPF A;  4W4Z A;  3W5M A;  2V5D A;  4CVU A;  5IFP A;  2V72 A;  3HNM A;  4OUE A;  5G04 L;  2ID4 A;  4DXS A;  5CZK A;  4TTG A;  3OEB A;  4FI9 A;  2C4X A;  3ECQ A;  2WZE A;  4GWJ A;  1JI6 A;  4IUG A;  5B4N A;  3K4Z A;  1OF4 A;  5DQ0 A;  2VJX A;  2WUH A;  4XUO A;  1PX4 A;  4QPW A;  2VL4 A;  2WO3 A;  3WF4 A;  3THD A;  3K77 A;  1JZ4 A;  5F7U A;  1LNS A;  1UXZ A;  5C70 A;  4LPL A;  4QX1 A;  3DYM A;  2WO2 A;  2C9K A;  2HYX A;  5LA0 A;  1JYW A;  2W87 A;  2WQ8 A;  4MAD A;  3C7G A;  3FHA A;  1SHW B;  3GDB A;  4GZ9 A;  5DN2 A;  3SEP A;  3AC0 A;  3I2H A;  3THC A;  2W46 A;  1UY1 A;  1K3I A;  1JHJ A;  4DEV A;  2QQN A;  2QQM A;  1UYX A;  4A6O A;  4ARX A;  3CQO A;  3VD9 A;  3MV1 1;  4BJ0 A;  3D3A A;  3LEG A;  2W1W A;  2QQL A;  2VZT A;  4CU8 A;  3T0D A;  2YC4 A;  3T2P A;  5CYY A;  2R7E B;  2Y6G A;  3K75 B;  3MBW A;  1JZ7 A;  4XUQ A;  4QX3 A;  2BBA A;  4MGS A;  1JYN A;  1H6Y A;  1O8S A;  4DEQ A;  4AG4 A;  4M4R A;  5LCW L;  3OEA A;  1JZ6 A;  2VZV A;  4XUT A;  4DUX A;  3HEI A;  1XPW A;  2W94 A;  4RN5 A;  2W1S A;  1JZ3 A;  1JZ2 A;  1J83 A;  3NQH A;  4XVH A;  4JKK A;  1K42 A;  1SG3 A;  2ZEX A;  3DYP A;  3T08 A;  4ARY A;  4QX2 A;  1PMJ X;  2VZQ A;  5IYY A;  1KEX A;  1OF3 A;  1EUT A;  3VD5 A;  5JXI A;  1O59 A;  4KI5 M;  3WF1 A;  4BXS V;  2JE8 A;  2VZ1 A;  2B4K A;  2QQO A;  1NUK A;  3K46 A;  2L9L A;  1XNA A;  2XQX A;  4XZU G;  1JZ8 A;  4W50 A;  3NNG A;  1WCQ A;  1TG7 A;  1HN1 A;  1O8P A;  5JMO A;  4PF1 A;  1XC6 A;  1SDD B;  4CU6 A;  2EIC A;  1W9T A;  3LEK A;  4KMQ A;  3WSO A;  2W47 A;  4E8D A;  4A4A A;  2Y6H A;  4YPJ A;  3I3B A;  3T09 A;  1K12 A;  2VCB A;  2J1A A;  3C8X A;  3A22 A;  1GUI A;  3LPG A;  4OMC A;  2W3J A;  3NRU A;  1W9W A;  1JZ5 A;  2J1T A;  2X10 A;  2W5F A;  5JR2 A;  2J7M A;  3I97 A;  2Y6K A;  3C7H A;  3IB3 A;  4UOJ A;  3I2G A;  1EUU A;  1K45 A;  2X05 A;  1UY0 A;  2VZ3 A;  2DDU A;  3VDB A;  1CX1 A;  2WN2 A;  1W99 A;  4P08 A;  2WDB A;  4ET7 A;  2DCK A;  3I2K A;  1UZ0 A;  3CKH A;  3NJX A;  4A42 A;  4QAW A;  2BZD A;  2WZ8 A;  1MPX A;  1W9S A;  4LQR A;  2YC2 A;  3EYP A;  3IAP A;  3HN3 A;  4DUW A;  3FN9 A;  4CUC A;  5JUV A;  4LHS A;  3WEZ A;  1P8J A;  2V4V A;  2X09 A;  2QQI A;  3VDA A;  3WNO A;  2VME A;  1US2 A;  1J84 A;  2B9V A;  3ACI A;  2CDO A;  2VC9 A;  2J1V A;  1BHG A;  1TVG A;  2HLE A;  4BK5 A;  3GGL A;  2YFZ A;  3OG2 A;  3WQB A;  3DYO A;  3FL7 A;  3PUH A;  2VCC A;  3EB7 A;  3OGS A;  3C7E A;  3LEI A;  4W8J A;  5A1A A;  2QBX A;  3GM8 A;  4QX0 A;  1UY4 A;  3HNB M;  4MGQ A;  1UYY A;  2J1S A;  2WBK A;  3WNN A;  1W0N A;  1GOF A;  2E26 A;  4QB1 A;  3WNK A;  4CU7 A;  3OB8 A;  2QQJ A;  2WN3 A;  1OT5 A;  2VCA A;  3CZU A;  2YG0 A;  3C7O A;  2E33 A;  2J22 A;  3HNY M;  2E32 A;  1GNY A;  4QDS A;  2RVA A;  3CIH A;  1H6X A;  3SEE A;  2EIE A;  1L7R A;  1NX9 A;  3WF2 A;  3K4D A;  5I0D A;  2ZEY A;  2Y8K A;  1UYZ A;  2XHN A;  4QDR A;  3T0B A;  3A23 A;  2KD7 A;  1JU4 A;  3MV0 1;  2W1Q A;  5LA2 A;  1OH4 A;  2ORX A;  4BDV B;  4KWU A;  2VZU A;  4QDQ A;  3OGR A;  4DXT A;  3ETP A;  3SKJ E;  2J1E A;  4DXR A;  3MO4 A;  2Y6J A;  3FHQ A;  3VD7 A;  1GOG A;  3MUY 1;  3WNM A;  4XUR A;  5JXG A;  2Z4F A;  3BGA A;  4ZZ5 A;  5HXM A;  2XOM A;  3A7Q A;  2J1R A;  2EIB A;  3P1I A;  4OYU A;  3WF0 A;  3UES A;  5IJR A;  2VTF A;  1W8O A;  3CDZ B;  4A41 A;  3I3D A;  3J7H A;  4OZO A;  4ZZ8 A;  3ZM8 A;  1JYV A;  1GU3 A;  3VD4 A;  5C71 A;  1F4H A;  4JKL A;  3UNP A;  1KGY A;  2ORZ A;  2VZS A;  3C7F A;  3ABZ A;  3I2I A;  4L0P A;  4P5Y A;  2VO5 A;  1W8N A;  3WNP A;  2W9X A;  2Y64 A;  3LQC A;  3IDA A;  2JD9 A;  1UXX X;  3K4A A;  3SKV A;  4CU9 A;  1GMM A;  4Z2A A;  2WYS A;  3BN6 A;  2VM9 A;  4LKS A;  3I3E A;  3A21 A;  2RV9 A;  3U37 A;  3WNL A;  4MOA A;  2W92 A;  2EID A;  2VQU A;  3ACF A;  2VZP A;  1RYY A;  2ZXQ A;  1L7Q A;  4XUN A;  2JKX A;  1OD3 A;  1GOH A;  2VMC A;  5DMY A;  3JXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...