2WO2A

Crystal structure of the epha4-ephrinb2 complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
178
structure length
178
Chain Sequence
TGEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKRTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
molecule keywords EPHRIN TYPE-A RECEPTOR
total genus 36
structure length 178
sequence length 178
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wo2A00
3C7GA 3LPFA 2ORXA 3IAQA 1UY1A 1US3A 2VQUA 1UY0A 3A22A 4DXSA 4DXRA 1SHWB 4UOJA 5HXMA 2WO1A 4A45A 3HNYM 3OBAA 4QX3A 3SKVA 3HNMA 1O8PA 5EJ1B 3I2FA 3OGSA 5IYYA 1JYNA 2WYSA 3BN6A 4QX2A 4JKMA 4YPJA 1NAEA 1PX3A 3EB7A 3SEPA 5DMYA 3WNOA 5C71A 2B9VA 1IQDC 4W4ZA 3LPGA 1O59A 1DLCA 3LEKA 2W9XA 4XUPA 1J83A 1UY3A 2EIDA 2BZDA 4MGQA 4QAWA 2W46A 4L0PA 3WF4A 1HN1A 2LS6A 4KMQA 4PF1A 2VZTA 5JXGA 3HJRA 1P8JA 4A41A 2BBAA 2W1UA 3WF2A 4CUBA 3HN3A 3CDZB 2W1WA 3LQCA 4BXSV 5B4XA 4CU6A 3CQOA 3VDBA 2W5FA 1UX7A 2Y8KA 4GWIA 2E33A 2VOTA 2EIBA 1H6XA 2VZPA 4KI5M 4A42A 5DPNA 5G05L 2J1VA 2WN2A 5F7UA 3T2QA 3T0AA 1EUTA 1W9TA 3MV11 4D8MA 2HYXA 3K4AA 4RN5A 2E31A 5FUIA 3DYPA 3C8XA 2C4XA 3SKJE 3HPNA 4E8CA 2RJ2A 4LHSA 1CX1A 4P08A 2RV9A 3LEIA 1XC6A 2W91A 4D0QA 1JZ3A 4BK5A 5A1AA 2VO5A 4JKKA 4QPWA 3DYOA 4QX0A 2XONA 1GNYA 3J7HA 1CZVA 2V5DA 4ZY9A 4OUEA 4MADA 3CZJA 3ETPA 1KEXA 2DDUA 1TG7A 2VZVA 1D7PM 2QQNA 2ZEYA 3IB3A 4CVUA 1F4AA 2W1QA 2QQJA 1UXXX 2WZEA 3I97A 2VM9A 3OEBA 4MO3M 4XUNA 5DQ0A 4XUTA 1OT5A 4OYUA 3LEGA 2W47A 4XUOA 5J1XA 3T0DA 2VR4A 2ZEWA 4E8DA 5CZKA 2LW8A 2X05A 1UYXA 1OD3A 1GMMA 3THDA 4A44A 4CU7A 3WNMA 3C7EA 3I2JA 1SDDB 3ZM8A 1W99A 2J1AA 2YC2A 3THCA 3WNNA 1UYYA 2QQOA 3VDCA 2YG0A 1K45A 5HPOA 1XNAA 1NKGA 2Z4FA 1T2XA 3MUZ1 3UNPA 1GOGA 4P02B 5JMOA 4QDRA 4MGSA 1WKYA 3MO4A 1WCQA 1YQ2A 2L9LA 3DYMA 1UZ0A 4DUVA 4UAPA 2WBKA 2Y6HA 1GOHA 3T2OA 2J1SA 2JKXA 4HG6B 4P00B 2W92A 2WO3A 3HNBM 4PT6A 4ZZ5A 5IFTA 5JR2A 3I2GA 3OB8A 4XVHA 1W9SA 2VTFA 5JXHA 4P5YA 1EUUA 3I2KA 3LE0A 2C26A 2YC4A 3D3AA 4GWJA 1JU4A 3SEEA 2E26A 2VZUA 1NX9A 3OGVA 4UI9L 1GQPA 1XNTA 3IDAA 3UETA 3K46A 3VD7A 2VCBA 5EJZB 1CIYA 1UYZA 5EIYB 1CZSA 4QB2A 2VJXA 4BJ0A 2W3JA 3T09A 1OF4A 3WF0A 3ACIA 3OG2A 2YB7A 5JXJA 1UMIA 4MOAA 2ORZA 2WO2A 4ZXEA 1L7QA 2J1UA 1W0NA 4ARYA 1JZ4A 4QB6A 3IIIA 3WSOA 4LPLA 3WF3A 2XHNA 2YFUA 3NNGA 3PUIA 5G04L 2KD7A 3AC0A 1ULOA 4PQQA 1PMJX 2VMFA 2CDOA 1UY4A 3ACGA 2J22A 2EIEA 4OMCA 3MV01 1ULPA 2VZ3A 2Y6JA 3I2HA 3I2IA 4QDSA 3I3BA 3WQBA 2ZEXA 1JU3A 1JZ8A 3OEAA 1KGYA 3ACHA 2WN3A 1LNSA 3T0BA 2HLEA 5CYYA 4M4PA 2Y6GA 2W1SA 1R64A 2VCCA 3I3DA 2QQMA 3U37A 3GDBA 3CIHA 4FI9A 2XOMA 5JUVA 5IJRA 2VMEA 1W8NA 3MUY1 3JXSA 3FL7A 4Z2AA 4ARXA 2BGOA 4QX1A 4QB1A 4A6OA 4BK4A 3E1F1 5LCWL 1UY2A 1W8OA 2JE8A 4A4AA 5IFPA 2RVAA 5LA2A 1K42A 1CZTA 1K3IA 4DXTA 3F2ZA 3C7FA 1JZ6A 4KWUA 3VD5A 4XZUG 3VDAA 4IUGA 2VMCA 5LA1A 4LKSA 3VD3A 5C70A 3T08A 4BDVB 4DUWA 2VZQA 2V4VA 2WQ8A 1US2A 3K77A 1JHJA 2BERA 2V72A 3IAPA 4W8JA 3NQHA 4GZ9A 2R7EB 4CUAA 1O8SA 3GGLA 1W9WA 3WNLA 3DECA 1JYXA 3HOBA 1K12A 2QQLA 1JI6A 2WUHA 3W5MA 4DEQA 2J1TA 1SG3A 3C7OA 3P1IA 2XQXA 2ZXQA 4M4RA 1PMHX 5DN2A 3GM8A 4OMDA 3FHQA 2YFZA 2DCJA 1DYOA 2VMDA 3FN9A 3GXUA 4LQRA 4AG4A 1UXZA 3NJVA 2QQIA 1JZ7A 3VD4A 2QBXA 2QQKA 1BHGA 1OH4A 2WAAA 3CZUA 4W50A 3ECQA 2VZRA 4XUQA 2WABA 2WAOA 3T2PA 4ZZ8A 5JXIA 2E32A 4DEVA 4RYDA 4XURA 1DP0A 4DUXA 5B4NA 2ID4A 2VZSA 2X10A 3ACFA 1JZ5A 2Y6KA 2Y64A 2VCAA 4QDQA 1JYVA 1JZ2A 3EYPA 4CU9A 3VD9A 2CDPA 3NRUA 3P6BA 2DCKA 1XPWA 2VL4A 1MPXA 3K4ZA 5LA0A 4TTGA 2J7MA 1I5PA 2ZEZA 3K75B 3A21A 3K4DA 4TXWA 1TVGA 3UESA 1GOFA 2PQSA 2OKXA 3PUHA 1OF3A 2W87A 1UMHA 1GU3A 4ET7A 2Y6LA 3A7QA 3WEZA 3A23A 3CMGA 1H6YA 2JD9A 1NUKA 2B4KA 2J1RA 2X09A 4CU8A 1UWWA 4AAXA 3WNPA 3FHAA 4CUCA 5I0DA 4JX0A 3W5NA 2VZ1A 4JKLA 3WNKA 2C9KA 2WZ8A 4A3ZA 3ABZA 3WF1A 1PX4A 1J84A 2JDAA 1JYWA 1RYYA 2BGPA 1L7RA 2J1EA 1GUIA 4JHZA 2W94A 3I3EA 3HEIA 2W95A 2WDBA 3OGRA 2VZOA 5C7GA 2VQTA 1F4HA 3CKHA 3NJXA 3C7HA 3BGAA 5IHRA 2EICA 4OZOA 3MBWA 2VC9A
chains in the Genus database with same CATH superfamily
1XE0A 3N9NA 3IAQA 4Y20A 1MS0A 2WA4A 5D8AC 4LHKA 1W6NA 4D7YA 2GNMA 4D69A 5FLIA 1UY0A 3ZN5A 1YIFA 4DXSA 4DXRA 5CIRA 2R042 3ZVXA 1C5IA 1VALA 3AZWA 3HNMA 1O8PA 4AFAA 1EV12 2VQ0A 1ZA4A 4WM8A 4Y24A 5JSRA 1QU0A 1UU6A 2R061 4R9DA 2WINB 1A3KA 5DZEA 2B9VA 4N53C 1W8ZA 4R9BA 4HVRA 4K9SA 2VTXA 2EXHA 3VZKA 3RNSA 5BNNC 5I91A 4XUPA 4A3XA 2D44A 1JXNA 2XB6C 2EIDA 1MZFA 3VZMA 1KD7A 4PJYA 4ASKA 4FAGA 2W46A 4LO4B 2B9UA 3WLUA 5F6LB 1FNYA 1HN1A 4KMQA 2JDZA 1ZZ8A 4UFIA 4FFIA 1JYNA 1FI2A 3B7MA 3ZFFA 4J6GA 4BXFA 1ZNPA 4QKFA 2W1UA 5ACA1 1TMF2 3HN3A 4LBLA 1VLNA 3OGJA 2QJVA 2XLGA 3EBRA 4AI1A 5FAXA 1OKQA 2YU1A 4MGIE 1RXFA 4XMAA 4NHMA 2VW0A 4CA9A 4CU6A 5E16A 5A32A 4CXYA 2W39A 2WL1A 2AEYA 5FRAA 1ZA7A 4Z82A 4GMP1 1FV3A 5FV3A 1AYM3 2XQRA 2WZR2 3JD71 3N9OA 1ACCA 4HKOA 3PTYA 4RQPB 3EHKA 1F35A 4B4PA 1JHNA 1YUDA 2R16A 3CJIA 1MQTC 1ULFA 1BEV2 3AM2A 4KI5M 2B7YA 1O6UA 4RL7A 5I0RA 3KT1A 5G05L 1O91A 5C3SA 1UZWA 1R082 3POBA 2BRTA 4OHVA 4QKDA 1EUTA 4KL1A 5L73A 2P4EA 2E31A 4FPHA 3FX3A 3N9MA 4Q4V3 4CXWA 1ZBA1 4KH9A 4CP0A 5FPLA 1WW4A 4G4FA 3ZKYA 4B1LA 3LEIA 4AI3A 2NQYA 1PO13 2MEV3 5A70A 5JOWA 2V4AA 4D0QA 1JZ3A 4BK5A 3O1TA 3R05A 1BQPA 3GCWA 4Z8BA 2FCUA 4KBZA 3M3QA 1SMVA 3ZXLA 4AYUA 4AEDC 4CDXA 2ZCWA 4AGRA 2FZ2A 3N3HA 4G9SB 4DIQA 1ZRIA 3AP5A 1HRI2 2BFUS 5GKAC 5ACA2 1OBNA 4HONA 2GNDA 4MADA 5FZ4A 5CFCC 4TSVA 4RSUA 2PHDA 3ETPA 1YLLA 1HB1A 4CDXC 2DDUA 2FDJA 3TEZA 1QH7A 1TG7A 4I30A 1VAKA 2PA7A 1UZZA 2VZVA 2PHFA 3LEMA 3DXTA 1QJX3 2VXRA 2Z42A 3URFA 1O3SA 5FZ6A 3JUUA 3KD4A 4GH4B 3FE5A 4HZFA 1RUC1 3Q8EA 2AR6A 3HQRA 1JW6A 5KXBA 3VL8A 2VUCA 1RUJ2 4DPNA 1FPN1 4NROA 2Z69A 3TN93 5CKQA 5DQ0A 2JENA 3JB8A 1YFWA 2QDNA 1E5IA 1ULCA 2Y6FA 4NJ4A 3WDYA 5FZ0A 4XUOA 3MLKA 4Z1VA 5C3QA 5F5IA 1H2KA 2CAVA 1KQRA 2XWJB 4YW4A 3IKWA 1S0BA 2ZEWA 5CZKA 1VAVA 3CU7A 3RZGA 1QDOA 1GMMA 1K5MB 4AI0A 5ABJC 1ZREA 4CU7A 1C4RA 1QJZA 4CEWA 2IZWA 2D97A 3C7EA 4AFDA 3I2JA 5BNOC 1SDDB 3ZXJA 4ITCA 1H8VA 3S30A 4EWDA 1BMV1 4AVSA 3RZKA 5A7WB 1W6PB 5AVAA 2VVFA 1QY4A 3OY8A 5IATA 4BZ4A 1RUF2 4FQZA 2QQOA 4NR1A 3ZIWA 2WNUA 2VNVA 4DRRA 5IWFA 4L99A 3DPRC 5FREA 2VNRA 2XBO2 5JWPA 4XAAA 2PFWA 1T2XA 5C33A 2FDKA 3AMMA 3IMNA 3KV6A 5BNQA 4IEOA 2ZX0A 1GWMA 3CHXA 5IVBA 3UGGA 4P02B 1RITA 1PMIA 3JZVA 4GAZA 3U0ZA 1HX6A 1X8EA 1VBC1 4MGSA 1CWPA 1QJY1 4CRQA 4DUVA 4UAPA 2WBKA 1MVEA 1DIWA 2VE1A 1Y3TA 3W58A 2NLRA 2ILMA 1TQ5A 1SPPB 2VGDA 5IFTA 3SCGA 1W28A 4AEDA 1KXGA 3BIEA 3VBRA 1W9SA 4EE2A 5JXHA 4P5YA 1FNZA 2QQPA 3FFQA 1EUUA 5FMBA 2C26A 3D3AA 3UL2A 1AVBA 2VMHA 3SEEA 3RI9A 2JDYA 3WDTA 5D1IA 4UW3A 3AP7A 4R4XA 1ZX5A 2RR11 3IT8A 1CD3G 2N7GA 5F32A 1BK0A 4WM7B 4F83A 3PL0A 2EA7A 1UPSA 3Q8FA 2VMGA 3ZMOA 5EFUA 1HRV2 3ZSEA 1W2AX 4CP9B 3K46A 5L9BA 5KHHA 2WNUB 2HWF1 2BP6A 4CDUC 3I4IA 4AEDB 5GZDA 5A33A 2KA3A 4O65A 1VR3A 2VAUA 1YRZA 5T5OA 1XSQA 1Y43B 2LRPA 4FO9A 4I02A 3LB9A 2DF7A 2W3JA 2FDFA 2JEMA 5L36A 2A6YA 2OA2A 1O3TA 3ACIA 1QJX2 3OG2A 2YB7A 3CEWA 1J3RA 1IS4A 2GMEA 1DZTA 2WFF1 4LLFA 4NPLA 1CX4A 5FOJB 1LHNA 1UAIA 4MOAA 1YJLA 5LWBA 1CAXB 2BFUL 3UKTA 5JOXA 2CGPA 3VBSA 4CDQA 5LZ6A 4KWLA 3TEYA 2JDUA 1F5FA 4QB6A 3CO2A 1Q8OA 1LB2A 1QJY3 4I0AA 1ULGA 4BQ5A 3I49A 4WBBA 2YFUA 2J42A 4V1PA 1IPSA 5F37A 3KF5A 1ULOA 1QJU3 4JRLA 4PQQA 4AVBA 1MS8A 5HI0A 3WR0A 4Y3OA 5APAA 2W2IA 4LKDA 5E6HA 1AR82 1HB2A 2PAMA 1UY4A 2VMFA 4CPBD 3AYDA 1AX1A 4M01A 4XACA 1YI7A 4MVTA 5FPBA 1S0EA 2VZ3A 3B94A 1JOJA 5DAWA 1UL9A 1CJPA 2BYVE 2BOIA 3WQBA 3OEAA 4TZDA 4W6WA 3MIDA 1V9U3 4Y4YA 1SZBA 4AHYA 3U4SA 2JIGA 2KXLA 3T0BA 1EAH1 5CYYA 1AR92 2P6HA 1OA4A 3H9AA 5JIAA 4CEYC 4YGDA 4AHZA 3F95A 4H7MA 1UZYA 4GB33 5FTTC 3U37A 4KGQA 3VBSB 4BQ1A 3CIHA 4WVWA 2B5HA 4Q8LA 5GLVA 5A1LA 4YZ3A 2G9FA 4QM9A 2VVDA 1H9PA 2VMEA 4XF3A 3MUY1 5ACA3 3JXSA 3KHCA 2DFBA 4GH4A 2BGOA 4PLOA 3Q8AA 5KC6A 2IWGB 2A6VA 1R093 3LFIA 4A6OA 5LCWL 3BTZA 2P3YA 5IVCA 1UY2A 5DAPA 2A6ZA 3RMYA 5IFPA 4CDUA 4HMZA 5CU1A 3OBRA 3WXPA 5ISLA 4R52A 2ZMKA 4XJUA 4XDPA 2VBPA 1NA1C 1OC1A 3C7FA 1V6JA 3IPVA 1O5UA 4KWUA 1DGRN 2BW8A 1O7FA 2RJLA 4I0BA 3VDAA 3OSDA 1OI6A 2DVAA 3NAPC 1C8NA 5A80A 3RJ2X 3P3PA 1EP0A 4QXCA 1PVC1 2ZJCA 4AOCA 3CJXA 2QCSB 2RMU2 4XPVA 4BDVB 4XMIA 4E4ZA 5GZEA 4HK8A 2VZQA 2O0OA 3WCRA 2B45X 2BERA 2V72A 2XUEA 4XDQA 4W8JA 4MXVA 4IE4A 5A6XA 3P5BA 5FJHA 2P3JA 4LLOA 3KWVA 1A78A 2D5HA 2YZ4A 3HBKA 4YRDA 3HOBA 1K12A 2LROA 3P3NA 2Q8CA 3VDDC 5GZCA 5K0UB 2K46A 3MYXA 1IS6A 3NV2A 4KU8A 3W5MA 2O14A 3MIFA 2J1TA 1C28A 1V6MA 1LGNA 4QD2A 5FP7A 4IE0A 3B69A 3IM0A 3A0NA 3P1IA 5A6ZA 2BBVA 4XF0A 1PK6A 4QHOA 3WW2A 3FHQA 5KHKA 2ZKNA 4H55A 1H2LA 1UOFA 4GWMA 4YW5A 1GYKA 1UXZA 2CWMA 3BTYA 3EQEA 4JGYA 4QX7A 3WUCA 3J9SA 1W3XA 2EVXA 2GU9A 3WP3A 4GKXA 1X8MA 4NN0A 3UT0A 4LO8A 1LCLA 2RS51 1CAWA 4LMFA 4Y26A 1S0IA 1IKPA 4YW7A 2PHRA 4QQ2A 4QKBA 3CZUA 3T1LA 2VZRA 2WAOA 4COUA 1TME1 4FSJA 1JBCA 4LBMA 1Q3EA 1Q43A 1GP4A 4MGKE 4IGOA 1MS4A 2PYTA 4UYBA 1YQ5A 4XFCA 1TME2 2TEPA 5B4NA 2ID4A 4Q4V2 1LESA 3RJRA 3ZYIB 3S7IA 4YM2A 3T30A 2B39A 2WS93 3M3OA 3AK0A 4XTMA 3ILFA 2DVBA 2Y64A 1PVC3 4FT8A 2R0HA 3EYPA 1AZDA 4FFFA 2VW1A 1HB3A 1EV13 2DUOA 1D4M3 2A73B 3BOPA 1N1SA 2ZGMA 4XBLA 2QDRA 4CU9A 2RS33 4L9BA 4WM8B 1QIQA 3D8CA 2CDPA 1GR3A 2RDSA 1Q8QA 2PLV1 3HQUA 3H8RA 5C5UA 1LOAA 2NMNA 4JDOA 2O1QA 2OIIA 2MHFA 1MPXA 1X9TA 4LR4A 3J7LA 2J7MA 2CAUA 2PLV2 2WS91 3IBMA 4I01A 3ZFGC 2Q5TA 3OUIA 5I93A 3VB9A 4COVA 4QX5A 5K0UC 1TVGA 4GALA 4V2WA 1LECA 1GOFA 2QZ3A 4FVVA 2GZWA 2VVEA 5KHJA 4J1WA 3ZXFA 1W2TA 1E5HA 2PHTA 1H30A 4WZFA 4UFLA 3ROUA 5K0UA 1NZIA 4BQXA 5IVFA 1W06A 1OF3A 1UMHA 2HWB3 2WNOA 3NNLA 5LA9A 1RUJ3 2RS53 3POSA 2E6VA 3GHNA 1VAMA 4JGZB 3S7EA 4FXKB 2YPJA 3WEZA 2B46X 1WBFA 2JD9A 5I8SA 3VBFC 2DWRA 1AR91 1OQEA 1NYWA 1LOEA 3LSDA 4CU8A 5A6QA 1AYN2 5F5AA 4UWDA 5A3PA 1MQTA 5I0DA 4OHXA 1CESA 2G9ZA 1UOBA 1LOBA 1I9RA 3KF3A 4XTPA 2WZ8A 3CL1A 2BUKA 2TUNA 4YVWC 5JZGB 3SMHA 2HWF2 4LA3A 1J1TA 1SBFA 1PZ7A 4XXPA 4DQAA 1BLZA 3J7NA 1QJU2 3CLPA 1W9FA 1DGRA 3VBOB 3N9PA 5T54A 3ZXEA 4NIDA 1YQ6A 1WLDA 2QQUA 3HEIA 4A2UA 4GKYA 4OUMA 3MHZA 3FFZA 3OGRA 3USUA 3VHPA 2ENRA 4CCNA 1ALYA 1PGW2 1STMA 2VZOA 4CUGA 5C7GA 1NCQC 5H9QA 2ZHLA 3E6DA 2VOVA 5DG1A 3O0XA 4O7XA 4RS5C 3NJXA 4CCKA 3BU7A 3BGAA 3U10A 2Z79A 4HETA 3VLBB 1MACA 3VHNA 4AWDA 3AX4A 2JIJA 1FYUA 1ZBE3 3VZOA 2A3WA 1TMF1 1UY1A 2JXAA 4MYEA 5JZGA 3MEPA 1US3A 5LBEA 4AGGA 3S57A 5CNAA 1KJLA 1XRUA 4CCDA 3GBWA 4UOJA 1AR63 4YLZA 2WO1A 3ZIXA 1A8DA 1MQTB 3SKVA 3VHOA 5EJ1B 3PHMA 5GLZA 1RUI3 5HCHA 3EB7A 1RTVA 1PX3A 4YW6A 1W90A 3N9LA 4PQ9A 2WLQA 3I8TA 1XYOA 5A3LA 1YCIA 3B00A 5FPZA 4H3WA 3AXEA 2BWCA 4IEQA 4NAMA 3LPGA 2R32A 4FOQA 1VBB1 2YDEA 1DLCA 1EAH2 1ULDA 2E63A 4FPOB 3THTA 1RUF3 1ZYBA 1J83A 1Z78A 4MV2A 1UY3A 2OPWA 3LDRA 4PIZA 4TLGA 3ZXGA 4AVVA 1G9AA 2VPVA 4JHTA 1NOVA 5F8PA 4D7TA 4MGQA 4QAWA 1TNRA 3DPRA 4L0PA 3ZFGB 4HL0A 3WHUA 2XXZA 5IYYA 1AR72 2ZACA 2PQQA 4A41A 4NOTA 2TBVA 3WF2A 4CUBA 1IQAA 1EYBA 2AGSA 4ISQA 1WD3A 2W1WA 3LQCA 2XKOA 1GNHA 4Q27A 1VBC2 3MIBA 3QCWA 3AKPA 3CJIB 1TEIA 3H7YA 5B4XA 1C1FA 5IVEA 4Q4W1 3S0MA 4N53B 4EZ4A 2UYBA 2ZGLA 1RJ7A 1TNFA 2D43A 4QGLA 4Q0PA 1G9FA 4R9CA 2E33A 2VOTA 1VBA3 1AXYA 1KFXL 2JDKA 3B5LB 2ZGRA 5A3TA 1RUI2 4XQ4A 4P9LA 3BODA 5CISA 4HVOA 1LOGA 1V6LA 4XJ9A 4A42A 4FPGA 2BQPA 2ARBA 4NIAA 5K8SA 3T0AA 4AHXA 3ES1A 3MV11 2HYXA 2ZAHA 2WS92 3OYWB 5JCTA 3ZFFB 4N9HA 4Y5Z0 1I6XA 3R4DB 2XHKA 3C8XA 4E8CA 4E2QA 5SV5A 1H4HA 5CFCB 2Z2SB 3M3EA 2RV9A 3SCHA 5FYBA 4YG6A 4BM8A 3SQOA 1XC6A 4P9GA 4NHYA 4FTEA 2W91A 2IFWA 2W08A 3K48A 1HW5A 4P9JA 4F7ZA 3DEMA 5A1AA 3PUSA 5FYVA 3LCPA 3NWKA 4MUVA 4XABA 3O1OA 3TBDA 3USSA 2MEV1 5T3NA 4QPWA 1W3VA 1GP5A 1PZ9A 3BTXA 2YGMA 1Y9QA 2XONA 4CEWC 1X82A 4A6SA 3KV9A 3MF6A 5FMDA 1COV1 4DO0A 5FQ0A 4PF5A 1AYN1 1Z7S2 2X29A 2HWE2 5LBFA 2P3IA 3VBUB 4ZHNA 3JQWA 2QTWB 1KEXA 1ENQA 2JG8A 4QXHA 3PIJA 2CYFA 1D7PM 1IHMA 2QQNA 3GZEA 1DZRA 3PVNA 4AQ6A 2RHPA 3IB3A 4Q0VA 4F8AA 2C9AA 3MLLA 5KXDA 1CPMA 1WGPA 2AH2A 4DXZA 3DKQA 1F4AA 4Q4V1 3E5UA 1VBA1 4Y1UA 1UXXX 1F5JA 3M7AA 1D0GA 4CDQB 2WZEA 2O8QA 3PDQA 2VM9A 4LXLA 5BYNA 3LOBA 3OEBA 4AVCA 5FP3A 1POV0 5L19A 1REFA 4OYUA 2FD8A 1DCSA 2Q8EA 4D6RA 5GLTA 3T0DA 5J96B 4L2NA 4LT5A 1N3QA 1OSGA 1U5IA 4EWAA 3RG0A 2AYHA 4E8DA 1DGWX 1OLME 1W8HA 1G9DA 2JG8B 5DAXA 4Y33A 5CFDA 3OUJA 5F3EA 3EO6A 3N7MA 1UYXA 1H1IA 5T5PA 2X05A 3K2OA 4A44A 4S2FA 1ZZ7A 2AEZA 3WNMA 1RUD1 3LF7A 4YM0A 2ZBJA 3N35A 5EZWA 2Y60A 5EYXA 2WNVB 3QOPA 1W99A 2EF6A 4QHBA 2YC2A 4TYSA 3WNNA 3U4XA 4Q8KA 3HD8B 4XETA 4EV0A 2R063 5D2AA 5HPOA 1K45A 1W2UA 1XNAA 3JD72 5HCBA 4HPKB 3ZOIA 2IVIB 4AGVA 2QUOA 1V6IA 1NKGA 1XB9A 2WFPA 1D4M2 3TNPB 4SBVA 3VKNA 1GOGA 1YNAA 3GHMA 1F8VA 3SISA 1SFNA 4W6XA 1X50A 4META 4XF1A 2D6NA 1FXZA 3LA2A 3TEWA 4QDRA 4QU2A 1XQNA 2Q1FA 4MX3A 3MO4A 2XKPA 5FY0A 3R0RA 4HLTA 1IZ3A 1VBB3 3CF6E 1E5SA 1QWRA 2JKXA 4BHPA 5F5QA 2R071 4N9IA 3O1PA 2W92A 2WO3A 1K5MA 1QHDA 2WC2A 3BTAA 4LUMA 4XF9A 5AVPA 5A3WA 3MPPG 1GZCA 2VXJA 1AJOA 5K4LA 1AL0G 4GA9A 1UD1A 5CB7A 3OB8A 3IDCB 1PNFA 4IESA 4L8QA 4XJWA 5FBZA 5FR3A 1RMU1 3B3QE 2HWB1 3AKRA 2I2SA 4YVSC 5FWEA 3I2KA 4JGZC 1UQXA 4XZPA 2UURA 2XBO1 5A7PA 3U14A 1X33A 1RMU2 5IW0A 5CFDC 1OXCA 4D6SA 1LOFC 2WJSA 2ZGPA 5FK7A 1NX9A 1X7NA 5FY9A 3LIGA 4P5HA 4Q4Y3 1VBD2 3ZYFA 3AJYA 2D3PA 1NLRA 2BNMA 3ASIA 4LUKA 3W20A 3OGVA 3VBUC 1WW5A 5A7WA 4L11A 1WCUA 1GQPA 5CG8A 1S0FA 4COYA 3VD7A 4BPZA 4AFBA 5JLVA 5KR7A 4Q0QA 5EJZB 5GM0A 1PIV3 3HWJA 1CIYA 2WO7A 1BCXA 1MEC1 5FKCA 4BIFA 1UYZA 2VBBA 2P3KA 2ZS6B 4NRPA 2WSUA 1OURA 2X5IA 2ZHMA 3WX5A 1CZSA 4QB2A 2XMLA 2GP3A 4XBNA 3DKWA 1UO9A 3FC0A 5L7OB 5FZ8A 4M0HA 3WF0A 1OPOA 2ZMLA 5LATA 1U0AA 3SLIA 1AL21 4AI9A 1AJKA 4YVWB 1SFPA 1BYHA 1SQ4A 1L7QA 1VBD3 4MGZE 4K1ZA 2Q4SA 4TLFA 3ZDSA 5FZAA 3ZYGA 4ASLA 5DZGA 1OD5A 1CONA 4CTEA 4CDWC 4JVAA 1QEXA 1AR73 3NNGA 3PUIA 2H0BA 1BEV1 3MFCA 5L9RA 3OGGA 3NV3A 4LO7A 4OHYA 1GLHA 1YFYA 3VBFA 3ZXKA 3VBOA 2ZX2A 3NMBA 1TMF3 1RMU3 1ZRCA 4LO5B 3HAGA 4CCJA 4CCMA 1C8M1 1H8TA 2XGXA 2CDOA 4LE4A 1YYNA 4Z92B 4YZ4A 3ACGA 3CJIC 3LA7A 2J22A 4CDXB 3LIHA 4IW3A 4XJ8A 2F17A 5DZFA 3T4VA 2D6LX 4COZA 4IEWA 3I2DA 2R1DA 1AHSA 2HH9A 2QQWA 1AR71 1YXWA 2HLEA 2IXJA 3OD0A 1GANA 4QPIA 2DV9A 4ZU4A 2W1SA 2B42B 4XFAA 3I3DA 2R041 4AEKA 5IAXA 1XNBA 2D40A 2FDHA 4INDA 4JQTA 1RGSA 5FZGA 1MVQA 4I3PA 1Z0HA 2VOWA 2DVDA 2YBPA 5JZGC 2YHJA 4BH9A 3AZXA 1DGWA 2XWBB 4OI0A 4WM8C 4ARXA 2CWSA 1OUSA 2WT2A 3UKVA 3NAPA 4YZ2A 3KM5A 3E1F1 1D2SA 4IEPA 2IVJA 1CR7A 1W8OA 2Y0OA 4A4AA 3QLQA 1DZQA 5BNNB 1IG0A 4IEYA 1DGLA 3SXWA 4CP9A 3PMEA 2XJVA 2LTNA 1CZTA 3F2ZA 4LBNA 4YFWA 3NAPB 5FO8B 3UJQA 4B3NA 4AVTA 1Q8SA 4GWNA 1R1A3 4MGYE 4DOUA 4NIHA 1A6CA 2VMCA 1V70A 3T2TA 1GWKA 4LKSA 4Y1YA 3AP6A 2QKDA 2DCZA 2E9QA 5KHGA 4LO6B 3OF1A 1EAH3 1Y7BA 4DUWA 3D82A 1WMDA 2WA3A 2V4VA 3ZKUA 1CAVA 3K77A 3IAPA 1FMD1 3A4UA 3POFA 5FXVA 5D8AA 1B35C 2PMWB 1DQ5A 1WLTA 3D6EA 4UFMA 2FMDA 3D0SA 3GGLA 4AFCA 5HCAA 2OXBA 2FDGA 3DECA 1JYXA 1WCKA 2QFEA 2QQLA 4IEVA 4WV8A 2YXSA 3LAGA 1HRV1 1VMFA 3W59A 1GFF2 3GJBA 5LK5A 4DZGA 2JICA 3IMMA 4RHV2 2GN7A 5LEKA 1SG3A 3VBOC 2CL2A 4E4SA 1LULA 5FPAA 1H8TC 2ZTNA 3SH3A 3JB4C 2OX0A 2XQXA 1W0PA 3BCWA 4K7JA 1ZRRA 5DN2A 3PJYA 4OMDA 1QOSA 3UK9A 1ZBE2 2DU0A 3FN9A 3GXUA 2RJKA 3NV4A 1NY72 2XBO3 5FZOA 4OQ9A 2P5BA 1WMEA 1ZBA2 3ZN6B 2LM3A 3ZFEC 5ABJB 4ZS3A 1VRH1 2QQKA 3VBHA 4Q4X2 5FUPA 2WWJA 3K3NA 1J58A 1U5YA 4X6RB 5BNPA 3O5SA 4QGNA 1OHFA 3WW3A 4RS5B 3RYRA 4W50A 3ECQA 4A7YA 5FXXA 5C4WB 5K9YA 1BBT1 1J59A 1SBDA 1W6MB 4LIUA 1JUIA 3U78A 3T2PA 2AACA 1U5XA 4QPYA 3ZFGA 4ATEA 3BPZA 4RHV3 2P34A 1RUD3 4YGBA 4RYDA 4DUXA 1GQHA 2CU5A 3RQ0A 4FPLA 2X10A 1JZ5A 4Y22B 4I2OA 3W21A 4NPMA 2Y6KA 5A6YA 2D3RA 1WWYA 2BVVA 2VCAA 3V0AA 1HJGA 1DQ1A 1XNDA 3KT7A 4U36A 2HWD2 4LJHA 1DQ2A 2NMOA 3E5XA 2BNNA 2VMIA 5DUVA 5F39A 1UW8A 4ES9A 2D6OX 1KITA 4LK6A 3AFGA 2RMU3 1VMJA 3DCQA 5BNPB 1DQ6A 3VD9A 1S55A 1ZRDA 3AJZA 5FMOL 2VNOA 4XW3A 3USUB 3ZXAC 5FPXA 2F6BA 2A5ZA 1W8UA 3K4ZA 4PDWA 2BU9A 4Y1VA 5LA0A 4UW5A 1Q5OA 2ZEZA 4CDUB 2WIIB 4LHLA 3DL3A 1W9YA 1DYKA 4TXWA 4XJAA 1RC6A 1WW6A 3UYJA 3UESA 3VZNA 5AC91 2E7TA 2DBIA 1JUHA 1MS5A 1UKRA 5EHDA 5KWRA 1PZ8A 3DN7A 5FYSA 1QOTA 1HXS3 1S2BA 1V9U1 1XBFA 1POQA 4N90A 2OKXA 4YARA 3PUHA 1GZWB 1F31A 4IDZA 3ZMNA 3ZYRA 1OVPA 5FZKA 2OS2A 4YG3A 1QH6A 1ZZ9A 4QX8A 1DLLA 2P6CA 4LOSA 1BK1A 1UKGA 3MLJA 2DFCA 2HWC2 3WUDA 1AF9A 4K8RB 4DB5A 3O1MA 1O3QA 1N3OA 1NA1A 1QQP1 2JKBA 4BIOA 2DURA 2W0XA 2B4KA 5FZ9A 1ST8A 2R30A 5FZMA 2HWC1 2X09A 3HVDA 4AR2A 1UWWA 1VBE3 3EMRA 5C8CA 3RZJA 2Y33A 3NVCA 4FPJA 2WWUA 5DUWA 4JX0A 1R091 4YG0A 4R4ZA 3M1HA 3ZDVA 2R1BA 3ABZA 3WP5A 2HWD1 1PX4A 1WMXA 2YGLA 4HN1A 5JI9A 3I2OA 4MGTA 4AE2A 3N36A 1SBEA 1F15A 4LBKA 3AFKA 2ZGUA 3MW4A 4GMP0 2BGPA 2G19A 4BB3A 4MG2A 1XU1A 3AMHA 4C8DA 2A1XA 3APBA 3KHBA 2W94A 2D6PA 2ZAAA 3TN91 2YUEA 2ZGOA 2FCTA 2HBUA 2WDBA 5F2SA 1KJRA 1SLAA 1QNYA 4KU7A 4FP3A 4M3CE 1GICA 4LK7A 4Q4Y2 1F4HA 2SLIA 1XXNA 4LULA 2VNGA 4MSVA 3CKHA 4AEMA 4YZ1A 3C7HA 4JRAA 4WM7C 3WP4A 2WWSA 4HSLA 1NXMA 2A7AA 1ZZCA 3NNFA 2VC9A 3AYEA 3MIHA 1UOGA 4YSFA 3KCXA 2ORXA 2OVUA 2WZR1 4YVSB 1G9CA 3H1MA 4CSWA 1S2EA 3OUHA 3IDEA 1QF3A 3A22A 1N1VA 1TE1B 2MPFA 1JMUB 1SHWB 5HXMA 4GB32 1UN1A 5J7MA 4A45A 2GALA 1VBA2 2R6QA 2ARAA 1PO21 3LD8A 4Q4W3 1VPHA 1BEV3 3E97A 3I2FA 2WFF2 3OGSA 2VUDA 1TZOA 2WYSA 4QX2A 4Y5TA 4DFSA 1GNZA 4M00A 5LY2A 1YEWA 3NSTA 5A32B 4FP2A 4ONUA 5DMYA 4N53A 4AVAA 4WVVA 3FMGA 2YROA 5C71A 4BE3A 1RUH2 2UU8A 1IOAA 1NY71 2CNAA 3BOWA 1H9WA 3LEKA 5FZCA 2CTVA 4YWAA 3AL5A 4PI0A 4YM3A 4IL7A 2JDNA 5BNNA 4QPIC 1VMHA 3WDWA 1AYM1 2XL9A 5GLUA 2VU9A 1UZVA 1SCSA 3WF4A 4RS5A 3ZYHA 4PF1A 4N7UA 5HV0A 2D93A 4QT6A 1U12A 1YIPA 1V00A 1VB2A 4C0HA 1CAVB 3WNLA 5C9AB 5AC93 2ZA9A 4KBBA 5EWSA 4IERA 4TWTA 3D4KA 4WM7A 2PLV3 5HV4A 4JGYB 1C1LA 1UF2C 3MICA 3WP6A 4BLJA 4RFT0 3CQOA 2W5FA 2Y8KA 4QXBA 5JR2A 2GH2A 4AI2A 4IE5A 5FXWA 3GZTB 4AAPA 1H4GA 4PI2A 2ZHKA 4OLLA 1QQP3 3MGUA 1H6XA 2QVSB 2ZGQA 4C0BA 5KXCA 2VZPA 3ALQA 5DPNA 1H0BA 4AXOA 3FUQA 3QH7A 4Y22A 4H7LA 2BDRA 4FPFA 4RQPC 3T2QA 1W9TA 4GXLA 2XJUA 4MLOA 2GDFA 5FYTA 4D8MA 3B9CA 4RN5A 4XILA 3MPBA 2FQPA 3SKJE 1FOD2 1W05A 4LHSA 1CX1A 4XE9A 1YFUA 3NKTA 4JQRA 4L92A 4P08A 1W0OA 3NJZA 1OLQA 2HWE1 4P14A 1QJX1 2D98A 2GC2A 3ELNA 4DY3A 3QD6A 4Q4X1 4UFKA 3ZPOA 1OFSA 2ZPXA 3LDKA 2XVGA 5FJKA 4QQLA 4DMIA 1IGOA 2NP0A 3S6PA 1ASJ3 1G6NA 2D7FA 3DYOA 3OD4A 2RM23 3ZPYA 1VB4A 1HJFA 1OPMA 4QX0A 1ZRFA 3J7HA 2PAEA 4UXAA 1DG6A 3ME2A 1CZVA 1H2MA 1YQCA 4GULA 2V5DA 3PTRB 3OYWA 3WQ7A 5L9VA 3J8F1 1LEDA 3ZSMA 1CAUB 1OVSA 1LHOA 1UYPA 3CZJA 3LOIA 3RVHA 4C1WA 4M3CA 4EN8B 1WMFA 2JWPA 1B35B 1DYPA 1AL22 4HVQA 3ZSLA 1BKZA 4FAHA 3ORJA 3ENRA 2QQVA 1AYM2 4Y5SA 5H9PA 4BOWA 1HQWA 4B29A 4BQ2A 1ZM1A 2MNGA 3WVJA 3JD73 2WRAA 3RDIA 4CPBA 2QQJA 3NV1A 3KVBA 4IEXA 1NA1B 3LSEA 5F2WA 2RS32 1QDCA 1OOPC 3I97A 1NQJA 1RIRA 4LBJA 4ZS2A 5F3GA 4YW3A 4AZZA 3SH4A 4XUNA 5BV6A 1FX5A 1G86A 4XFHA 2WSVA 4CDWA 5EQUA 2BVBA 3LEGA 1RVF3 5J1XA 1V0AA 5JPNB 1NE6A 2RS52 3FLRA 3AVSA 2LW8A 1NT0A 4FBFA 1FOD1 5C3OA 4LBQB 3RMXA 5IK5A 1OD3A 1PO12 3THDA 5FYZA 4PIYA 3DPRB 1SEFA 3CNAA 5ERLA 2K0GA 3HR9A 3DXUA 4XDOA 3ZM8A 5IK8A 5EXOA 5TSWA 2C5DA 3HN1A 2UY9A 3SHRA 5A33B 1UYYA 5FQ0B 1WCDJ 5FPVA 4XHBA 3VDCA 1JH5A 3L2HA 4UFHA 4J25A 2WNUC 4YW2A 2AENA 4R9AA 5BNOB 1XSRA 3MUZ1 1N1TA 2ET1A 2UYAA 4FPEA 5E89A 2RDRA 3BIWE 1URXA 5F3IA 3UNPA 1JYIA 5JMOA 4SLIA 1UU5A 3AZZA 5IVJA 1IPKA 2F4LA 4OHWA 1WKYA 3VZLA 3V0AB 4Z07A 1WCQA 1YQ2A 3AVRA 3DYMA 1UZ0A 2LUWA 4KGGA 4NE9A 2Y6HA 2NN8A 1RUD2 2VY0A 1V6NA 3WDXA 4MXWB 1VRH3 1W6OB 5DG2A 4P00B 4CCCA 5DUUA 1SLTA 4D6QA 1UPIA 3I2GA 1HRV3 2IUWA 4ZU7A 3QBQA 4XVHA 5H9RA 2VTFA 1PHMA 1NCRA 3KCCA 5T50A 3GJAA 1SACA 1WLCA 4Q4Y1 2YC4A 5I8TA 3BUCA 3JU9A 4GWJA 4DRVA 2OW4A 4HOOA 2B8MA 3D5OA 2ES3A 3UKNA 3ZN6A 3RZLA 5BXXA 3X29B 1OA2A 5FYMA 4JDNA 1QMJA 3MF9A 2FMYA 2WQ4A 3WQ0A 4BQWA 2XL7A 3U11A 3IDAA 1EPZA 3UETA 3DGTA 4ORFA 4OVEA 2VCBA 1RJ8A 2QNKA 1NLSA 1WW7A 4IV3A 1W6OA 2NM1A 5FLJA 5FMOS 3UV9A 1UX6A 5EIYB 2VOKA 1FAYA 4H14A 1QJU1 2I07B 4Q5OA 4YVSA 3BYWA 3LWCA 2CY6A 5C8WA 2XH6A 3J8F3 4Y1ZA 5FY4A 1RUNA 5J36A 2RDQA 1AR62 1EV11 2UWCA 3ZSKA 1XYNA 2Y38A 4AFMA 2BNOA 5BNPC 4NWVA 1XU2A 2XLAA 1K5MC 2GC0A 4QWNA 5E88A 5LBBA 4K40A 3WG3A 2OUHA 4E9KA 1QQP2 1X36A 3RZZA 2CV6A 3AXDA 4BMEA 3M4FA 2GMMA 4ZXEA 3EXUA 2J1UA 1W0NA 2Q1ZB 2IC1A 1FT9A 3KT4A 1D4VB 1JZ4A 2ZZJA 3AB0A 3C3VA 3WSOA 4FFHA 4LPLA 5FYCA 5IUQA 5EP9A 5FP4A 4RD7A 3E6BA 4P9WA 5FP8A 1W6PA 5G04L 5FOBB 2KD7A 1FPN3 3NL1A 3AC0A 3ZFEA 3PURA 1WUVA 4LEJA 5JSOA 5LRSA 2IXIA 2JDPA 4N7IA 3IN9A 2DVGA 5FZ7A 4ZU5A 4QPGB 4N43C 4LBQA 2NYYA 3MI8A 2YU2A 2IFRA 3BU0A 4KG8A 1UOJA 5JSPA 2Y6JA 1PM7A 3N7LA 2EIGA 4Z2WA 1WA4A 3I3BA 2RS13 3KLSA 1D2QA 3WV6A 4A7ZA 1KGYA 5B2GB 4IV1A 5IVYA 1OQDA 2DCYA 4LNVA 4XXAA 3AKSA 3KB5A 2PN5A 5LASA 3CBNA 5C9AC 4M4PA 2TNFA 3PMSA 1MS3A 2Y6GA 4MZUA 1R64A 5BY5A 1MZ5A 5T52A 1HXS1 3GNEA 5T5LA 5JIUA 2QQMA 2DTYA 2XJTA 1Q8PA 1DU3D 4FOVA 2PHLA 1COV2 3EJKA 3GDBA 3I7DA 3B93A 2ZABA 3MW3A 2HEYF 1W2NA 1LJ7A 1PNGA 3FUOA 1O5LA 1GQGA 5IJRA 3POYA 2OQ6A 2DCTA 4LOTA 1W8NA 4Z2AA 2GNTA 1V9U2 4DINB 2VTXJ 1AR83 4BK4A 1XJAA 5DXDA 4FXGB 3ZSJA 1MZEA 2JE8A 4Q0UA 2BPA2 3LDBA 1K42A 1NXD1 1KDKA 3WHTA 2RG4A 5FZDA 2ZX1A 4G3YC 2GMPA 1FATA 1MS1A 1QXJA 1PVXA 2HJIA 4YM1A 2A3YA 2I45A 3FLTA 4XJZA 3RZHA 1HLCA 1S0GA 3WW4A 1QGLA 2XR4A 4HKWA 3VD3A 5JMCA 3PIGA 4URAA 5C70A 3T08A 1ASJ1 2C24A 2WLPA 2WNEA 4WVMA 2WQ8A 1US2A 4MHRA 1JHJA 4XFIA 5FZ3A 3RRDA 3VKFC 5GALA 1HKDA 5KXEA 1D0HA 4C90A 1IKQA 1VJ2A 2R7EB 3KS7A 4CUAA 1O8SA 1OKOA 2VH9A 5DUXA 4AQSA 4AEJA 5L7OA 1KS4A 1LGCA 1JI6A 1ND2B 2HWE3 2HWF3 3PNAA 4N43A 2P17A 3ST7A 2WUHA 1GWLA 1N3PA 2C0ZA 1PM4A 2FHRA 2HEVF 2WZR3 1W8WA 2ET7A 3OPZA 3OBTA 1C3HA 1XNCA 3PJQA 4E2SA 5CADA 5K7PA 3SCFA 3T1MA 1RUI1 2ZKLA 1N47A 1OUXA 2OZ6A 5EPAA 3C7OA 3W9AA 3I3MA 3I59A 2ZXQA 1G7YA 2JECA 1PMHX 1S0JA 3H3ZA 4M4RA 3BPSA 5JAXA 3GM8A 5LRRA 1GZ9A 3AKTA 3H50A 4RGKA 2JG9B 2YFZA 1DYOA 3ETQA 2P2KA 3NJVA 4RGAA 4KWKA 1VBE1 2QQIA 5C3PA 3OBZA 1IS5A 1RVF1 2QBXA 4LHNA 3T4HB 2ZX4A 4E4HA 2DTWA 1BHGA 3VKOA 2A6WA 2WAAA 4RR3A 3ZN4A 4CP2A 5M0TA 2FCVA 4LIVA 2WABA 5J48A 2PTMA 3NW4A 1NCRB 4HN0A 4IGPA 4ZZ8A 3OOXA 1R083 4PCRA 2ZGKA 3UJOA 4DEVA 4XURA 1DP0A 4JAAA 3E5QA 4HXCA 1YWKA 5FCCA 2VZSA 4OHZA 3AP9A 5F1RA 2ZMNA 4Y20B 2PHXA 5D8AB 2Q0AA 4QDQA 3ES4A 4XAEA 1JYVA 1JZ2A 1RUH1 1VBD1 2WFF3 1KS5A 3RFRA 4EZHA 1DQ0A 1BBT2 2G4IA 5C8CC 3AP4A 4NPRA 4HSJA 4OFGA 2JE9A 1LOFA 2DCKA 4XQWA 2WR9A 3VUOA 1YI9A 4Q4W2 5FY7A 5DDJ1 1CPNA 3E6CC 5CKNA 4X8NA 2VL4A 3DF0A 1H2NA 3JQXA 1SLIA 4TTGA 2YBKA 4XYXA 4UFJA 4NWWA 4OZXA 4XCBA 3SH5A 1ND2C 1QOOA 4BISA 4EWEA 4EN9B 2XUMA 2PQSA 2BOJA 1BXHA 4NUBA 3GALA 5IT6A 3K3OA 2HBTA 3VKMA 3AZYA 3AMPA 1ND2A 4N43B 2Q8DA 1LODA 3ZYPA 4NHXA 4FPCA 3WDUA 4QQHA 2QZ2A 2VW2A 1R1ZA 3VHRA 2Y6LA 3A7QA 4LTAA 3A23A 1ULEA 3POWA 4UW6A 5FYYA 3RWKX 2ARCA 1H6YA 1NUKA 1OMIA 4EN7B 2ATFA 2UWAA 5FBJA 5C4WC 1COV3 3GBFA 4B7KA 4HT1T 3RI8A 3QH6A 3ZXDA 4RA0A 3VKLA 4AAXA 4P9XA 1KDMA 3WNPA 3FHAA 3OTFA 1RUOA 2BWAA 1O4ZA 2BGCA 4FOWA 5I0SA 1LKNA 2K9ZA 2VZ1A 5JPMB 2DVFA 3H3UA 4JKLA 1B35A 4HANA 4HBNA 2VOXA 4XHXA 3WF1A 3O1UA 1LR5A 4P9YA 2IXLA 2A71A 2JDAA 1RUE2 3T3YA 4ES8A 1JYWA 2RS12 1C8M2 2GNBA 2RM22 1RYYA 3OPTA 4OULA 4AHWA 4EROA 4EQVA 1UIJA 1GBGA 1Y9MA 3MDPA 3THPA 1NCQB 1L7RA 2J1EA 1LOCA 2DBNA 2JDHA 1UCXA 4FOYA 5FY1A 5DABA 1MS9A 5A3NA 1DDLA 1RL3A 2GN3A 4LA2A 2W95A 2BTVC 4QPIB 3LA3A 3GCXA 4RFRB 5F9TA 3GZAA 4FTBA 2G9GA 1A8MA 2VQTA 2WYFA 2IXCA 4COWA 4AF9A 2HEWF 4JDMA 3H0OA 3H8UA 2C6SA 1CVNA 4LBQD 4S2HA 1HN0A 5FZIA 2Q1MA 5KHIA 1GP6A 1QJEA 3ZFFC 5JOZA 2EICA 4OZOA 4D7SA 2XDVA 4UBGA 3C7GA 3LPFA 4IV1B 1AX2A 4BQYA 2Q8OA 3PVEA 1L3JA 1LHWA 2W68A 5LB6A 1PO23 1NZCA 3ITQA 4PDWB 2H6BA 2VQUA 4ZKTB 4OCTA 3PUQA 1LU2A 1RUJ1 4QQPA 5JVVA 1MEC2 2PAKA 2XJQA 2ZGSA 3HNYM 3NJYA 2LALA 3OBAA 4QX3A 3KMHA 5FYUA 4WVMB 3V0BB 1I3HA 1RUG2 3A0KA 3AMNA 3BN6A 4GH4C 4JKMA 4YPJA 3ZX7A 1LAJA 1NAEA 3JBG3 4BQ4A 2JG9A 4X8PA 5CVRA 3QACA 3SEPA 3POGA 3Q8BA 4HK9A 1PK6B 4NO4A 3SITA 2P37A 3WNOA 1FMD2 1S4CA 3FBMA 4EYUA 5A3OA 1IQDC 4W4ZA 1O59A 4O9EA 3VBRC 4GJYA 3OPWA 5C3RA 2JG9C 1ND3B 5FUNA 4JGYC 2W9XA 4IE7A 3HBZA 3WT3A 1T6GC 2PHWA 3KZ4C 2RS11 5C9AA 2BZDA 2R49A 5FXZA 1JOPA 2X5IB 1LRHA 1PO22 4V2VA 2UY8A 4CEWB 1PGSA 3K51A 1TME3 1ENRA 1W04A 4O61A 3H8XA 2LS6A 4OI2A 5FZ1A 1GKBA 1RUC3 2W52A 2VZTA 1AX0A 4PLNA 5A7QA 3MIGA 5JXGA 3O1VA 3HJRA 5AFBA 1P8JA 3M2MA 3FJSA 4XFBA 4EJRA 4QM8A 1I5ZA 2IXKA 2BBAA 4EN6B 1SFYA 3J26N 1W2OA 3KQRA 1SLBA 2HKXA 3CDZB 5DAVA 1G9BA 3SC7X 4BXSV 1VRH2 4QQOA 3IDBB 4ZPIA 4GB31 5DAQA 1BBT3 3ILRA 3TEXA 3RSJA 3HIFA 5IVVA 1NCQA 3VDBA 1H1AA 1UX7A 1YO8A 1DF0A 1ZBE1 4GWIA 4NRQA 5CAZA 4XCAA 4BYYA 1MEC3 2EIBA 5GZFA 3V0BA 2WNVA 4JCKA 4P9IA 1L7LA 1MZ6A 1OLRA 1RUG3 1POV3 2KR2A 4GJZA 4IEZA 4Q1PA 4XEZA 3NO8A 4CDQC 1LU1A 5A7SA 3R6SA 4XFFA 1AUYA 2J1VA 2WN2A 4GD4A 1CAUA 4IV1C 3VN4A 4CCOA 3GZUC 4CYDA 5F7UA 1AL23 2AZ5A 3NNJA 5F3CA 1O4YA 3PVOA 2JJ6A 3JBG1 1S1AA 3K4AA 5FY5A 2WT0A 3DYPA 5FUIA 3ZFEB 2ZX3A 2C4XA 3HPNA 3NNMA 1VBE2 4IV3B 2RJ2A 1RB8G 3UGHA 5KBFA 4XQDA 2UWBA 4Q4X3 4C91A 3O1SA 2X8KA 3JCIA 4D94A 5L7OC 4RR3B 1MR5A 4Q29A 1E5RA 3PU3A 1RINA 2EXIA 2O8OA 3LKJA 1RHI3 1XNKA 2IXHA 2VO5A 3TNQA 1RHI2 4LBOA 2XJPA 5LY1A 1BVVA 2VUAA 2YMZA 4JKKA 3H1YA 5FDBA 4BCUA 2KM2A 4PHZA 3I54A 1QXRA 1GNYA 4S2GA 3VGIA 1YFXA 4B4QA 4ZY9A 1VIWB 4OUEA 4QPGA 3MBWA 1Y9GA 2OYZA 2FBEA 3C2UA 3POJA 4IGQA 1EPWA 1W6QA 2YBSA 5I0UA 1DHKB 5I8YA 1RUE3 2ZEYA 3KQ4B 3HQXA 1PGL2 3INAA 4ZXKA 3U75A 4I0WB 2ERFA 2A6XA 4CVUA 2OZJA 5CA6A 2W1QA 5H9SA 1HB4A 3WY6A 3VBFB 3TWIA 3O7OA 5LBCA 5FZFA 3RPQA 3WG4A 2JD4A 3WCSA 3BI3A 1BJQA 1CAXA 1NLQA 3BVCA 2GC3A 2ZHNA 4JGZA 4PLMA 4M0NA 5EJ3A 3LZZA 4MO3M 5FIXA 4CCEA 4XC9A 2YY1A 5I0TA 1XE8A 4XUTA 1DBNA 1OT5A 1V6OA 1YHFA 4D3WA 1WBLA 2W47A 1E57A 1PVC2 4KNCA 4CE8A 5ANQA 4B8EA 2NPIA 4AI8A 1ENSA 2FZ1A 3WDVA 2VR4A 2DUQA 4FPYA 4NMIA 1J1LA 2FDIA 1HIXA 1W6QB 3KGZA 5CFCA 2ZZQA 4E27A 5CKMA 3AYAA 1W39A 1W8TA 1SPPA 5F6KA 5BUVA 5GZGA 4LKEA 3OCPA 2ZGTA 4NHLA 2X53S 4XOGA 1RUC2 4Y1XA 1B09A 1V6KA 4DNYA 1H8TB 1HQLA 1YC61 2V5YA 2Q30A 1HDKA 1LEMA 2VECA 2J1AA 3ZR5A 4YZ5A 3THCA 1OH3A 1RHI1 1OOPA 1A34A 2Y0IA 2A75A 2YG0A 1OLMA 4CEYB 5FFOC 3JBG2 3TAYA 1UNBA 3LFMA 4RR3C 2JB4A 3B02A 5BPXA 2JX9A 2Z4FA 5JR7B 3ZO0B 1QKQA 5JOYA 1SCRA 1FMD3 3I59B 1UIKA 1RXGA 1PO11 3U1XA 1H1MA 2E7QA 3WNXA 1N1YA 3OY8B 3VBRB 3FBYA 4YNIA 2XJRA 2JG8C 3I3QA 2DYCA 1ZZ6A 2L9LA 3TOJA 1PK6C 3T2OA 1BZWA 1GOHA 2J1SA 2BV4A 4QPGC 4HKLA 2OUJA 1GZWA 4HG6B 5A3UA 4PT6A 4ZZ5A 1RUF1 3HNBM 4JTOA 4LE3A 3V56A 1X9PA 4ISRA 2GC1A 4GQ7A 1SLCA 4IEUA 3ZYJB 2DUPA 5GJ6A 4Q1RA 5C5TA 3AMQA 2RR13 3LE0A 1UU4A 4PDWC 1R081 1OQ1A 5FO7B 3WG1A 2NZ9A 1JU4A 1CAWB 3O0WA 4IQPA 2E26A 5FLHA 2VZUA 1QJY2 4CXXA 5CEHA 1QNWA 2YYOA 3IPVB 4BU2A 2VG9A 4CZSA 2JDMA 3U07A 2V09A 4WZCA 5AFEA 4UI9L 1C5HA 1RUH3 3POIA 1XNTA 1EY2A 3BALA 1CQ9A 5J98B 2ADEA 1APNA 4NRMA 4UT5A 4CP1A 2E53A 3KGLA 2ARXA 1UMZA 4JC1A 1JODA 1VP6A 3IWZA 3L2YA 2G1MA 4OI4A 5CG9A 1R092 2VJXA 4YYOA 3WG2A 1Z7S3 4GIQA 4UW4A 4AQTA 3LGRA 4BJ0A 5LK7B 3T09A 3RZMA 1AYN3 1OF4A 2XG3A 2F4PA 4W65A 2SBAA 1ND3A 5T5JA 5JXJA 1UMIA 5C8CB 5FZLA 3RS6A 1VRBA 2ORZA 2WO2A 4E4DX 5CFDB 1KFUL 3MZHA 3FLPA 4KWJA 3PVBB 1PIV2 1HRI3 4ARYA 2D5FA 5EV7A 2Y26A 3UGFA 3IIIA 4OUSA 4MH0E 3IZOA 5A3MA 3RWNA 1OOPB 4XFGA 3TRSB 1ZVFA 4B4RA 3WF3A 5IK4A 2XHNA 4HPKA 4CEYA 4AQ2A 1O4TA 5FZEA 3KV4A 3PLQA 4BQ3A 5E1RA 1JYTA 3AYCA 4RHV1 4BWOA 1AR61 4QKNA 5CBLA 1KRIA 2PXJA 1IG3A 2A70A 5AC92 4QGMA 4YGEA 1F2NA 1PMJX 1GSLA 5GLWA 2E7AA 3ILNA 5FYIA 4OI1A 4M3CF 4LKFA 4QU1A 2EIEA 1OFNA 1CIWA 4OMCA 5DDJ3 4YFZA 2ZOEB 1Q56A 3FHIB 1ULPA 3MV01 5T55A 1K5JA 3I2HA 3I2IA 1NG0A 3AKQA 3O12A 4MXWA 4QDSA 1CN1A 2A3XA 3H3LA 5IAVA 2OQ7A 1JU3A 2ZEXA 4PBOA 2R072 4RQPA 1JZ8A 3S5AA 3KV5A 2H0VA 1DQ4A 2RMU1 4Y4RA 3ACHA 1WA6X 2WN3A 1LNSA 2XJSA 2RM21 4R8HA 4XIOA 3VBSC 1PGL1 2JE7A 3O0VA 3RYKA 3V65A 2D6MA 2R0FA 2WNVC 1FV2A 4K21A 2VCCA 2VD7A 1J3QA 2HWC3 3RGBA 3POEA 4ATFA 5BNOA 2HYKA 3ZR6A 1T6BX 2X5IC 3GBGA 4FI9A 4XIKA 3Q9OA 1PGW1 2XOMA 4AW7A 5JUVA 1YJKA 2E51A 2HWD3 4L97A 1XE7A 3FL7A 5J3UA 1WLWA 5SV8A 4QX1A 2YC0A 5HCFA 4JV4A 4QB1A 3FWEA 2VBDA 1WZXA 2ADDA 1JS9A 1ENXA 3WINE 3DV8A 3VBUA 1SDWA 2WT1A 5A7NA 1HRI1 2RVAA 5HXVA 4K1YA 5LA2A 5C4WA 5FO9B 2OPKA 3R4UA 1K3IA 3J7MA 3N9QA 4DXTA 1REDA 4FPKA 5LEJA 1S0CA 2RS31 1JZ6A 4AL9A 2MEV2 3VD5A 4XZUG 1S2KA 3ATGA 3G7DA 3PU8A 4IUGA 4IE6A 4NVPA 4CCLA 4X6QB 4A7KA 5FZOB 5LA1A 4BA6A 4CDWB 1NCRC 4J1XA 1BVP1 2CSGA 5FKBA 1ZBA3 1J3PA 2AC1A 1C8M3 3D0JA 1NQDA 3TN92 2RR12 4KG0A 4XBQA 3G6JB 3NQHA 3HT2A 4GZ9A 4YVWA 1HV0A 3MW2A 4Q2FA 1WD4A 2OT7A 3S5QA 1W9WA 5J37A 2GH8A 1I1EA 1YQ8A 2I74A 4NIGA 5HBAA 4AK3A 4UF0A 4JZRA 3H42B 4LORA 4S2DA 3Q8CA 2QE3A 4M3CB 4DEQA 5FWJA 2EXKA 2VQAA 3KVAA 2DU1A 1F9KA 4NAOA 1Z7S1 3WOGA 4B1MA 1ASJ2 4XF4A 1AXKA 2C1FA 2P1BA 5KC5A 3N7KA 1OA3A 1LTEA 2EALA 1VBC3 4BMBA 2DCJA 2VMDA 1WCSA 2CGNA 2HWB2 4QMAA 1O3RA 4LQRA 4AG4A 3PUAA 3SNMA 2VUJA 2CHHA 1JZ7A 3VD4A 3V64A 2XLFA 3M8LA 2RDNA 1SLLA 2XVLA 5JI7A 3R4SA 1QXPA 5C6CA 3L9JT 1OH4A 4FTSA 3AL6A 3ON7A 5E8AA 4MHUA 2AUYA 4XUQA 1M06G 4ASMB 4N8MA 4QXKA 5FZBA 1XOYA 3OJBA 5FP9A 3RYPA 3BB6A 4YGCA 5A7OA 4B7EA 5JXIA 2Z5WA 1HV1A 2E32A 1ONAA 4Q26A 3TYJA 1AXZA 1VE0A 3AZVA 2WZPP 2AREA 3ACFA 3IIAA 1DFQA 1AR81 1ZZBA 3KSCA 3M3IA 3VV1A 5FYHA 1D4M1 1Q8VA 1RUG1 1RVF2 4QHZA 1GZTA 4DS0A 3H1WA 1VBB2 3M70A 1AR93 2GAUA 3DUIA 4GMP3 2D3SA 1JYCA 4DY5A 3B01A 4FCAA 1C57A 3BKZA 4F3JA 4H2AA 3NRUA 1CJDA 4K3UA 5ANNA 3P6BA 4EN0A 4I09A 1XPWA 2WQZC 4K6BA 3TB0A 4LITA 5FPUA 1I5PA 3N7JA 1POV1 1R1A2 3K75B 3VDDB 1S0DA 4PBPA 3A21A 3K4DA 4KQ7A 4PIXA 3VL9A 3ACLA 2PHUA 1JOBA 1Y4WA 2K2SA 5JDBA 2WKKA 3WZ1A 4RGGA 2D6KA 4ZONA 2YPDA 1LENA 3HT1A 4NIIA 1GV9A 4E2GA 2GP5A 2V73A 1LHUA 4JTNA 1BMV2 4C1XA 2W87A 3H7JA 3O1RA 4YW1A 1GU3A 2VCMA 3HMYA 2VULA 4U2AA 1M4WA 4W6YA 1RUE1 4ET7A 3VBHB 2EXJA 4FQ4A 3M3CA 4I3GA 3CMGA 2BEOA 2BJSA 2ETEA 3VBHC 1CGPA 3GYDA 2ZGNA 4IETA 3ZYBA 2J1RA 1HQNA 4K20A 3J8F2 2R043 4Q0SA 2R062 3J4UH 3O14A 5FZHA 2R073 3ZLIA 4CUCA 1IPJA 3W5NA 1U5ZA 4BLIA 5A1FA 3VDDA 3WNKA 2C9KA 3B9IA 4A3ZA 3NKGA 4UBHA 1XYPA 4IXLA 5DDJ2 3WD5A 1J84A 4WVZA 1ODMA 1W6NB 2XVKA 5D21A 1W6MA 3MFAA 4UF0B 1W8FA 1QJFA 3N4MA 1REEA 5J09A 4URTA 1LHVA 2Y34A 1JN2P 2JB8A 4K8FA 5EYYA 2H6CA 1FPN2 1GUIA 4JHZA 3KCYA 2EAAA 4NHKA 5FY8A 3WW1A 3I3EA 2PELA 1W03A 3MIEA 1NE4A 5ABJA 5IK7A 4TN7A 3H8OA 5FK8A 2XPJA 1LGBA 1ODNA 2EAKA 5F5CA 2YV8A 1R1A1 1ND3C 2CGOA 1JTZX 3FZ3A 4FFGA 1G8WA 4O9GA 5FMCA 4HFSA 1FOD3 1PIV1 4OQ8A 3WQ1A 5LW9A 2GSYA 1HXS2 5IHRA 2RE9A 3GF6A 3VZJA 1IS3A 4IV3C
chains in the Genus database with same CATH topology
3C7GA 3LPFA 2ORXA 3IAQA 1UY1A 1US3A 2VQUA 1UY0A 3A22A 4DXSA 4DXRA 1SHWB 4UOJA 5HXMA 2WO1A 4A45A 3HNYM 3OBAA 4QX3A 3SKVA 3HNMA 1O8PA 5EJ1B 3I2FA 3OGSA 5IYYA 1JYNA 2WYSA 3BN6A 4QX2A 4JKMA 4YPJA 1NAEA 1PX3A 3EB7A 3SEPA 5DMYA 3WNOA 5C71A 2B9VA 1IQDC 4W4ZA 3LPGA 1O59A 1DLCA 3LEKA 2W9XA 4XUPA 1J83A 1UY3A 2EIDA 2BZDA 4MGQA 4QAWA 2W46A 4L0PA 3WF4A 1HN1A 2LS6A 4KMQA 4PF1A 2VZTA 5JXGA 3HJRA 1P8JA 4A41A 2BBAA 2W1UA 3WF2A 4CUBA 3HN3A 3CDZB 2W1WA 3LQCA 4BXSV 5B4XA 4CU6A 3CQOA 3VDBA 2W5FA 1UX7A 2Y8KA 4GWIA 2E33A 2VOTA 2EIBA 1H6XA 2VZPA 4KI5M 4A42A 5DPNA 5G05L 2J1VA 2WN2A 5F7UA 3T2QA 3T0AA 1EUTA 1W9TA 3MV11 4D8MA 2HYXA 3K4AA 4RN5A 2E31A 5FUIA 3DYPA 3C8XA 2C4XA 3SKJE 3HPNA 4E8CA 2RJ2A 4LHSA 1CX1A 4P08A 2RV9A 3LEIA 1XC6A 2W91A 4D0QA 1JZ3A 4BK5A 5A1AA 2VO5A 4JKKA 4QPWA 3DYOA 4QX0A 2XONA 1GNYA 3J7HA 1CZVA 2V5DA 4ZY9A 4OUEA 4MADA 3CZJA 3ETPA 1KEXA 2DDUA 1TG7A 2VZVA 1D7PM 2QQNA 2ZEYA 3IB3A 4CVUA 1F4AA 2W1QA 2QQJA 1UXXX 2WZEA 3I97A 2VM9A 3OEBA 4MO3M 4XUNA 5DQ0A 4XUTA 1OT5A 4OYUA 3LEGA 2W47A 4XUOA 5J1XA 3T0DA 2VR4A 2ZEWA 4E8DA 5CZKA 2LW8A 2X05A 1UYXA 1OD3A 1GMMA 3THDA 4A44A 4CU7A 3WNMA 3C7EA 3I2JA 1SDDB 3ZM8A 1W99A 2J1AA 2YC2A 3THCA 3WNNA 1UYYA 2QQOA 3VDCA 2YG0A 1K45A 5HPOA 1XNAA 1NKGA 2Z4FA 1T2XA 3MUZ1 3UNPA 1GOGA 4P02B 5JMOA 4QDRA 4MGSA 1WKYA 3MO4A 1WCQA 1YQ2A 2L9LA 3DYMA 1UZ0A 4DUVA 4UAPA 2WBKA 2Y6HA 1GOHA 3T2OA 2J1SA 2JKXA 4HG6B 4P00B 2W92A 2WO3A 3HNBM 4PT6A 4ZZ5A 5IFTA 5JR2A 3I2GA 3OB8A 4XVHA 1W9SA 2VTFA 5JXHA 4P5YA 1EUUA 3I2KA 3LE0A 2C26A 2YC4A 3D3AA 4GWJA 1JU4A 3SEEA 2E26A 2VZUA 1NX9A 3OGVA 4UI9L 1GQPA 1XNTA 3IDAA 3UETA 3K46A 3VD7A 2VCBA 5EJZB 1CIYA 1UYZA 5EIYB 1CZSA 4QB2A 2VJXA 4BJ0A 2W3JA 3T09A 1OF4A 3WF0A 3ACIA 3OG2A 2YB7A 5JXJA 1UMIA 4MOAA 2ORZA 2WO2A 4ZXEA 1L7QA 2J1UA 1W0NA 4ARYA 1JZ4A 4QB6A 3IIIA 3WSOA 4LPLA 3WF3A 2XHNA 2YFUA 3NNGA 3PUIA 5G04L 2KD7A 3AC0A 1ULOA 4PQQA 1PMJX 2VMFA 2CDOA 1UY4A 3ACGA 2J22A 2EIEA 4OMCA 3MV01 1ULPA 2VZ3A 2Y6JA 3I2HA 3I2IA 4QDSA 3I3BA 3WQBA 2ZEXA 1JU3A 1JZ8A 3OEAA 1KGYA 3ACHA 2WN3A 1LNSA 3T0BA 2HLEA 5CYYA 4M4PA 2Y6GA 2W1SA 1R64A 2VCCA 3I3DA 2QQMA 3U37A 3GDBA 3CIHA 4FI9A 2XOMA 5JUVA 5IJRA 2VMEA 1W8NA 3MUY1 3JXSA 3FL7A 4Z2AA 4ARXA 2BGOA 4QX1A 4QB1A 4A6OA 4BK4A 3E1F1 5LCWL 1UY2A 1W8OA 2JE8A 4A4AA 5IFPA 2RVAA 5LA2A 1K42A 1CZTA 1K3IA 4DXTA 3F2ZA 3C7FA 1JZ6A 4KWUA 3VD5A 4XZUG 3VDAA 4IUGA 2VMCA 5LA1A 4LKSA 3VD3A 5C70A 3T08A 4BDVB 4DUWA 2VZQA 2V4VA 2WQ8A 1US2A 3K77A 1JHJA 2BERA 2V72A 3IAPA 4W8JA 3NQHA 4GZ9A 2R7EB 4CUAA 1O8SA 3GGLA 1W9WA 3WNLA 3DECA 1JYXA 3HOBA 1K12A 2QQLA 1JI6A 2WUHA 3W5MA 4DEQA 2J1TA 1SG3A 3C7OA 3P1IA 2XQXA 2ZXQA 4M4RA 1PMHX 5DN2A 3GM8A 4OMDA 3FHQA 2YFZA 2DCJA 1DYOA 2VMDA 3FN9A 3GXUA 4LQRA 4AG4A 1UXZA 3NJVA 2QQIA 1JZ7A 3VD4A 2QBXA 2QQKA 1BHGA 1OH4A 2WAAA 3CZUA 4W50A 3ECQA 2VZRA 4XUQA 2WABA 2WAOA 3T2PA 4ZZ8A 5JXIA 2E32A 4DEVA 4RYDA 4XURA 1DP0A 4DUXA 5B4NA 2ID4A 2VZSA 2X10A 3ACFA 1JZ5A 2Y6KA 2Y64A 2VCAA 4QDQA 1JYVA 1JZ2A 3EYPA 4CU9A 3VD9A 2CDPA 3NRUA 3P6BA 2DCKA 1XPWA 2VL4A 1MPXA 3K4ZA 5LA0A 4TTGA 2J7MA 1I5PA 2ZEZA 3K75B 3A21A 3K4DA 4TXWA 1TVGA 3UESA 1GOFA 2PQSA 2OKXA 3PUHA 1OF3A 2W87A 1UMHA 1GU3A 4ET7A 2Y6LA 3A7QA 3WEZA 3A23A 3CMGA 1H6YA 2JD9A 1NUKA 2B4KA 2J1RA 2X09A 4CU8A 1UWWA 4AAXA 3WNPA 3FHAA 4CUCA 5I0DA 4JX0A 3W5NA 2VZ1A 4JKLA 3WNKA 2C9KA 2WZ8A 4A3ZA 3ABZA 3WF1A 1PX4A 1J84A 2JDAA 1JYWA 1RYYA 2BGPA 1L7RA 2J1EA 1GUIA 4JHZA 2W94A 3I3EA 3HEIA 2W95A 2WDBA 3OGRA 2VZOA 5C7GA 2VQTA 1F4HA 3CKHA 3NJXA 3C7HA 3BGAA 5IHRA 2EICA 4OZOA 3MBWA 2VC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7G A;  3LPF A;  2ORX A;  3IAQ A;  1UY1 A;  1US3 A;  2VQU A;  1UY0 A;  3A22 A;  4DXS A;  4DXR A;  1SHW B;  4UOJ A;  5HXM A;  2WO1 A;  4A45 A;  3HNY M;  3OBA A;  4QX3 A;  3SKV A;  3HNM A;  1O8P A;  5EJ1 B;  3I2F A;  3OGS A;  5IYY A;  1JYN A;  2WYS A;  3BN6 A;  4QX2 A;  4JKM A;  4YPJ A;  1NAE A;  1PX3 A;  3EB7 A;  3SEP A;  5DMY A;  3WNO A;  5C71 A;  2B9V A;  1IQD C;  4W4Z A;  3LPG A;  1O59 A;  1DLC A;  3LEK A;  2W9X A;  4XUP A;  1J83 A;  1UY3 A;  2EID A;  2BZD A;  4MGQ A;  4QAW A;  2W46 A;  4L0P A;  3WF4 A;  1HN1 A;  2LS6 A;  4KMQ A;  4PF1 A;  2VZT A;  5JXG A;  3HJR A;  1P8J A;  4A41 A;  2BBA A;  2W1U A;  3WF2 A;  4CUB A;  3HN3 A;  3CDZ B;  2W1W A;  3LQC A;  4BXS V;  5B4X A;  4CU6 A;  3CQO A;  3VDB A;  2W5F A;  1UX7 A;  2Y8K A;  4GWI A;  2E33 A;  2VOT A;  2EIB A;  1H6X A;  2VZP A;  4KI5 M;  4A42 A;  5DPN A;  5G05 L;  2J1V A;  2WN2 A;  5F7U A;  3T2Q A;  3T0A A;  1EUT A;  1W9T A;  3MV1 1;  4D8M A;  2HYX A;  3K4A A;  4RN5 A;  2E31 A;  5FUI A;  3DYP A;  3C8X A;  2C4X A;  3SKJ E;  3HPN A;  4E8C A;  2RJ2 A;  4LHS A;  1CX1 A;  4P08 A;  2RV9 A;  3LEI A;  1XC6 A;  2W91 A;  4D0Q A;  1JZ3 A;  4BK5 A;  5A1A A;  2VO5 A;  4JKK A;  4QPW A;  3DYO A;  4QX0 A;  2XON A;  1GNY A;  3J7H A;  1CZV A;  2V5D A;  4ZY9 A;  4OUE A;  4MAD A;  3CZJ A;  3ETP A;  1KEX A;  2DDU A;  1TG7 A;  2VZV A;  1D7P M;  2QQN A;  2ZEY A;  3IB3 A;  4CVU A;  1F4A A;  2W1Q A;  2QQJ A;  1UXX X;  2WZE A;  3I97 A;  2VM9 A;  3OEB A;  4MO3 M;  4XUN A;  5DQ0 A;  4XUT A;  1OT5 A;  4OYU A;  3LEG A;  2W47 A;  4XUO A;  5J1X A;  3T0D A;  2VR4 A;  2ZEW A;  4E8D A;  5CZK A;  2LW8 A;  2X05 A;  1UYX A;  1OD3 A;  1GMM A;  3THD A;  4A44 A;  4CU7 A;  3WNM A;  3C7E A;  3I2J A;  1SDD B;  3ZM8 A;  1W99 A;  2J1A A;  2YC2 A;  3THC A;  3WNN A;  1UYY A;  2QQO A;  3VDC A;  2YG0 A;  1K45 A;  5HPO A;  1XNA A;  1NKG A;  2Z4F A;  1T2X A;  3MUZ 1;  3UNP A;  1GOG A;  4P02 B;  5JMO A;  4QDR A;  4MGS A;  1WKY A;  3MO4 A;  1WCQ A;  1YQ2 A;  2L9L A;  3DYM A;  1UZ0 A;  4DUV A;  4UAP A;  2WBK A;  2Y6H A;  1GOH A;  3T2O A;  2J1S A;  2JKX A;  4HG6 B;  4P00 B;  2W92 A;  2WO3 A;  3HNB M;  4PT6 A;  4ZZ5 A;  5IFT A;  5JR2 A;  3I2G A;  3OB8 A;  4XVH A;  1W9S A;  2VTF A;  5JXH A;  4P5Y A;  1EUU A;  3I2K A;  3LE0 A;  2C26 A;  2YC4 A;  3D3A A;  4GWJ A;  1JU4 A;  3SEE A;  2E26 A;  2VZU A;  1NX9 A;  3OGV A;  4UI9 L;  1GQP A;  1XNT A;  3IDA A;  3UET A;  3K46 A;  3VD7 A;  2VCB A;  5EJZ B;  1CIY A;  1UYZ A;  5EIY B;  1CZS A;  4QB2 A;  2VJX A;  4BJ0 A;  2W3J A;  3T09 A;  1OF4 A;  3WF0 A;  3ACI A;  3OG2 A;  2YB7 A;  5JXJ A;  1UMI A;  4MOA A;  2ORZ A;  2WO2 A;  4ZXE A;  1L7Q A;  2J1U A;  1W0N A;  4ARY A;  1JZ4 A;  4QB6 A;  3III A;  3WSO A;  4LPL A;  3WF3 A;  2XHN A;  2YFU A;  3NNG A;  3PUI A;  5G04 L;  2KD7 A;  3AC0 A;  1ULO A;  4PQQ A;  1PMJ X;  2VMF A;  2CDO A;  1UY4 A;  3ACG A;  2J22 A;  2EIE A;  4OMC A;  3MV0 1;  1ULP A;  2VZ3 A;  2Y6J A;  3I2H A;  3I2I A;  4QDS A;  3I3B A;  3WQB A;  2ZEX A;  1JU3 A;  1JZ8 A;  3OEA A;  1KGY A;  3ACH A;  2WN3 A;  1LNS A;  3T0B A;  2HLE A;  5CYY A;  4M4P A;  2Y6G A;  2W1S A;  1R64 A;  2VCC A;  3I3D A;  2QQM A;  3U37 A;  3GDB A;  3CIH A;  4FI9 A;  2XOM A;  5JUV A;  5IJR A;  2VME A;  1W8N A;  3MUY 1;  3JXS A;  3FL7 A;  4Z2A A;  4ARX A;  2BGO A;  4QX1 A;  4QB1 A;  4A6O A;  4BK4 A;  3E1F 1;  5LCW L;  1UY2 A;  1W8O A;  2JE8 A;  4A4A A;  5IFP A;  2RVA A;  5LA2 A;  1K42 A;  1CZT A;  1K3I A;  4DXT A;  3F2Z A;  3C7F A;  1JZ6 A;  4KWU A;  3VD5 A;  4XZU G;  3VDA A;  4IUG A;  2VMC A;  5LA1 A;  4LKS A;  3VD3 A;  5C70 A;  3T08 A;  4BDV B;  4DUW A;  2VZQ A;  2V4V A;  2WQ8 A;  1US2 A;  3K77 A;  1JHJ A;  2BER A;  2V72 A;  3IAP A;  4W8J A;  3NQH A;  4GZ9 A;  2R7E B;  4CUA A;  1O8S A;  3GGL A;  1W9W A;  3WNL A;  3DEC A;  1JYX A;  3HOB A;  1K12 A;  2QQL A;  1JI6 A;  2WUH A;  3W5M A;  4DEQ A;  2J1T A;  1SG3 A;  3C7O A;  3P1I A;  2XQX A;  2ZXQ A;  4M4R A;  1PMH X;  5DN2 A;  3GM8 A;  4OMD A;  3FHQ A;  2YFZ A;  2DCJ A;  1DYO A;  2VMD A;  3FN9 A;  3GXU A;  4LQR A;  4AG4 A;  1UXZ A;  3NJV A;  2QQI A;  1JZ7 A;  3VD4 A;  2QBX A;  2QQK A;  1BHG A;  1OH4 A;  2WAA A;  3CZU A;  4W50 A;  3ECQ A;  2VZR A;  4XUQ A;  2WAB A;  2WAO A;  3T2P A;  4ZZ8 A;  5JXI A;  2E32 A;  4DEV A;  4RYD A;  4XUR A;  1DP0 A;  4DUX A;  5B4N A;  2ID4 A;  2VZS A;  2X10 A;  3ACF A;  1JZ5 A;  2Y6K A;  2Y64 A;  2VCA A;  4QDQ A;  1JYV A;  1JZ2 A;  3EYP A;  4CU9 A;  3VD9 A;  2CDP A;  3NRU A;  3P6B A;  2DCK A;  1XPW A;  2VL4 A;  1MPX A;  3K4Z A;  5LA0 A;  4TTG A;  2J7M A;  1I5P A;  2ZEZ A;  3K75 B;  3A21 A;  3K4D A;  4TXW A;  1TVG A;  3UES A;  1GOF A;  2PQS A;  2OKX A;  3PUH A;  1OF3 A;  2W87 A;  1UMH A;  1GU3 A;  4ET7 A;  2Y6L A;  3A7Q A;  3WEZ A;  3A23 A;  3CMG A;  1H6Y A;  2JD9 A;  1NUK A;  2B4K A;  2J1R A;  2X09 A;  4CU8 A;  1UWW A;  4AAX A;  3WNP A;  3FHA A;  4CUC A;  5I0D A;  4JX0 A;  3W5N A;  2VZ1 A;  4JKL A;  3WNK A;  2C9K A;  2WZ8 A;  4A3Z A;  3ABZ A;  3WF1 A;  1PX4 A;  1J84 A;  2JDA A;  1JYW A;  1RYY A;  2BGP A;  1L7R A;  2J1E A;  1GUI A;  4JHZ A;  2W94 A;  3I3E A;  3HEI A;  2W95 A;  2WDB A;  3OGR A;  2VZO A;  5C7G A;  2VQT A;  1F4H A;  3CKH A;  3NJX A;  3C7H A;  3BGA A;  5IHR A;  2EIC A;  4OZO A;  3MBW A;  2VC9 A; 
#chains in the Genus database with same CATH topology
 1XE0 A;  3N9N A;  3IAQ A;  4Y20 A;  1MS0 A;  2WA4 A;  5D8A C;  4LHK A;  1W6N A;  4D7Y A;  2GNM A;  4D69 A;  5FLI A;  1UY0 A;  3ZN5 A;  1YIF A;  4DXS A;  4DXR A;  5CIR A;  2R04 2;  3ZVX A;  1C5I A;  1VAL A;  3AZW A;  3HNM A;  1O8P A;  4AFA A;  1EV1 2;  2VQ0 A;  1ZA4 A;  4WM8 A;  4Y24 A;  5JSR A;  1QU0 A;  1UU6 A;  2R06 1;  4R9D A;  2WIN B;  1A3K A;  5DZE A;  2B9V A;  4N53 C;  1W8Z A;  4R9B A;  4HVR A;  4K9S A;  2VTX A;  2EXH A;  3VZK A;  3RNS A;  5BNN C;  5I91 A;  4XUP A;  4A3X A;  2D44 A;  1JXN A;  2XB6 C;  2EID A;  1MZF A;  3VZM A;  1KD7 A;  4PJY A;  4ASK A;  4FAG A;  2W46 A;  4LO4 B;  2B9U A;  3WLU A;  5F6L B;  1FNY A;  1HN1 A;  4KMQ A;  2JDZ A;  1ZZ8 A;  4UFI A;  4FFI A;  1JYN A;  1FI2 A;  3B7M A;  3ZFF A;  4J6G A;  4BXF A;  1ZNP A;  4QKF A;  2W1U A;  5ACA 1;  1TMF 2;  3HN3 A;  4LBL A;  1VLN A;  3OGJ A;  2QJV A;  2XLG A;  3EBR A;  4AI1 A;  5FAX A;  1OKQ A;  2YU1 A;  4MGI E;  1RXF A;  4XMA A;  4NHM A;  2VW0 A;  4CA9 A;  4CU6 A;  5E16 A;  5A32 A;  4CXY A;  2W39 A;  2WL1 A;  2AEY A;  5FRA A;  1ZA7 A;  4Z82 A;  4GMP 1;  1FV3 A;  5FV3 A;  1AYM 3;  2XQR A;  2WZR 2;  3JD7 1;  3N9O A;  1ACC A;  4HKO A;  3PTY A;  4RQP B;  3EHK A;  1F35 A;  4B4P A;  1JHN A;  1YUD A;  2R16 A;  3CJI A;  1MQT C;  1ULF A;  1BEV 2;  3AM2 A;  4KI5 M;  2B7Y A;  1O6U A;  4RL7 A;  5I0R A;  3KT1 A;  5G05 L;  1O91 A;  5C3S A;  1UZW A;  1R08 2;  3POB A;  2BRT A;  4OHV A;  4QKD A;  1EUT A;  4KL1 A;  5L73 A;  2P4E A;  2E31 A;  4FPH A;  3FX3 A;  3N9M A;  4Q4V 3;  4CXW A;  1ZBA 1;  4KH9 A;  4CP0 A;  5FPL A;  1WW4 A;  4G4F A;  3ZKY A;  4B1L A;  3LEI A;  4AI3 A;  2NQY A;  1PO1 3;  2MEV 3;  5A70 A;  5JOW A;  2V4A A;  4D0Q A;  1JZ3 A;  4BK5 A;  3O1T A;  3R05 A;  1BQP A;  3GCW A;  4Z8B A;  2FCU A;  4KBZ A;  3M3Q A;  1SMV A;  3ZXL A;  4AYU A;  4AED C;  4CDX A;  2ZCW A;  4AGR A;  2FZ2 A;  3N3H A;  4G9S B;  4DIQ A;  1ZRI A;  3AP5 A;  1HRI 2;  2BFU S;  5GKA C;  5ACA 2;  1OBN A;  4HON A;  2GND A;  4MAD A;  5FZ4 A;  5CFC C;  4TSV A;  4RSU A;  2PHD A;  3ETP A;  1YLL A;  1HB1 A;  4CDX C;  2DDU A;  2FDJ A;  3TEZ A;  1QH7 A;  1TG7 A;  4I30 A;  1VAK A;  2PA7 A;  1UZZ A;  2VZV A;  2PHF A;  3LEM A;  3DXT A;  1QJX 3;  2VXR A;  2Z42 A;  3URF A;  1O3S A;  5FZ6 A;  3JUU A;  3KD4 A;  4GH4 B;  3FE5 A;  4HZF A;  1RUC 1;  3Q8E A;  2AR6 A;  3HQR A;  1JW6 A;  5KXB A;  3VL8 A;  2VUC A;  1RUJ 2;  4DPN A;  1FPN 1;  4NRO A;  2Z69 A;  3TN9 3;  5CKQ A;  5DQ0 A;  2JEN A;  3JB8 A;  1YFW A;  2QDN A;  1E5I A;  1ULC A;  2Y6F A;  4NJ4 A;  3WDY A;  5FZ0 A;  4XUO A;  3MLK A;  4Z1V A;  5C3Q A;  5F5I A;  1H2K A;  2CAV A;  1KQR A;  2XWJ B;  4YW4 A;  3IKW A;  1S0B A;  2ZEW A;  5CZK A;  1VAV A;  3CU7 A;  3RZG A;  1QDO A;  1GMM A;  1K5M B;  4AI0 A;  5ABJ C;  1ZRE A;  4CU7 A;  1C4R A;  1QJZ A;  4CEW A;  2IZW A;  2D97 A;  3C7E A;  4AFD A;  3I2J A;  5BNO C;  1SDD B;  3ZXJ A;  4ITC A;  1H8V A;  3S30 A;  4EWD A;  1BMV 1;  4AVS A;  3RZK A;  5A7W B;  1W6P B;  5AVA A;  2VVF A;  1QY4 A;  3OY8 A;  5IAT A;  4BZ4 A;  1RUF 2;  4FQZ A;  2QQO A;  4NR1 A;  3ZIW A;  2WNU A;  2VNV A;  4DRR A;  5IWF A;  4L99 A;  3DPR C;  5FRE A;  2VNR A;  2XBO 2;  5JWP A;  4XAA A;  2PFW A;  1T2X A;  5C33 A;  2FDK A;  3AMM A;  3IMN A;  3KV6 A;  5BNQ A;  4IEO A;  2ZX0 A;  1GWM A;  3CHX A;  5IVB A;  3UGG A;  4P02 B;  1RIT A;  1PMI A;  3JZV A;  4GAZ A;  3U0Z A;  1HX6 A;  1X8E A;  1VBC 1;  4MGS A;  1CWP A;  1QJY 1;  4CRQ A;  4DUV A;  4UAP A;  2WBK A;  1MVE A;  1DIW A;  2VE1 A;  1Y3T A;  3W58 A;  2NLR A;  2ILM A;  1TQ5 A;  1SPP B;  2VGD A;  5IFT A;  3SCG A;  1W28 A;  4AED A;  1KXG A;  3BIE A;  3VBR A;  1W9S A;  4EE2 A;  5JXH A;  4P5Y A;  1FNZ A;  2QQP A;  3FFQ A;  1EUU A;  5FMB A;  2C26 A;  3D3A A;  3UL2 A;  1AVB A;  2VMH A;  3SEE A;  3RI9 A;  2JDY A;  3WDT A;  5D1I A;  4UW3 A;  3AP7 A;  4R4X A;  1ZX5 A;  2RR1 1;  3IT8 A;  1CD3 G;  2N7G A;  5F32 A;  1BK0 A;  4WM7 B;  4F83 A;  3PL0 A;  2EA7 A;  1UPS A;  3Q8F A;  2VMG A;  3ZMO A;  5EFU A;  1HRV 2;  3ZSE A;  1W2A X;  4CP9 B;  3K46 A;  5L9B A;  5KHH A;  2WNU B;  2HWF 1;  2BP6 A;  4CDU C;  3I4I A;  4AED B;  5GZD A;  5A33 A;  2KA3 A;  4O65 A;  1VR3 A;  2VAU A;  1YRZ A;  5T5O A;  1XSQ A;  1Y43 B;  2LRP A;  4FO9 A;  4I02 A;  3LB9 A;  2DF7 A;  2W3J A;  2FDF A;  2JEM A;  5L36 A;  2A6Y A;  2OA2 A;  1O3T A;  3ACI A;  1QJX 2;  3OG2 A;  2YB7 A;  3CEW A;  1J3R A;  1IS4 A;  2GME A;  1DZT A;  2WFF 1;  4LLF A;  4NPL A;  1CX4 A;  5FOJ B;  1LHN A;  1UAI A;  4MOA A;  1YJL A;  5LWB A;  1CAX B;  2BFU L;  3UKT A;  5JOX A;  2CGP A;  3VBS A;  4CDQ A;  5LZ6 A;  4KWL A;  3TEY A;  2JDU A;  1F5F A;  4QB6 A;  3CO2 A;  1Q8O A;  1LB2 A;  1QJY 3;  4I0A A;  1ULG A;  4BQ5 A;  3I49 A;  4WBB A;  2YFU A;  2J42 A;  4V1P A;  1IPS A;  5F37 A;  3KF5 A;  1ULO A;  1QJU 3;  4JRL A;  4PQQ A;  4AVB A;  1MS8 A;  5HI0 A;  3WR0 A;  4Y3O A;  5APA A;  2W2I A;  4LKD A;  5E6H A;  1AR8 2;  1HB2 A;  2PAM A;  1UY4 A;  2VMF A;  4CPB D;  3AYD A;  1AX1 A;  4M01 A;  4XAC A;  1YI7 A;  4MVT A;  5FPB A;  1S0E A;  2VZ3 A;  3B94 A;  1JOJ A;  5DAW A;  1UL9 A;  1CJP A;  2BYV E;  2BOI A;  3WQB A;  3OEA A;  4TZD A;  4W6W A;  3MID A;  1V9U 3;  4Y4Y A;  1SZB A;  4AHY A;  3U4S A;  2JIG A;  2KXL A;  3T0B A;  1EAH 1;  5CYY A;  1AR9 2;  2P6H A;  1OA4 A;  3H9A A;  5JIA A;  4CEY C;  4YGD A;  4AHZ A;  3F95 A;  4H7M A;  1UZY A;  4GB3 3;  5FTT C;  3U37 A;  4KGQ A;  3VBS B;  4BQ1 A;  3CIH A;  4WVW A;  2B5H A;  4Q8L A;  5GLV A;  5A1L A;  4YZ3 A;  2G9F A;  4QM9 A;  2VVD A;  1H9P A;  2VME A;  4XF3 A;  3MUY 1;  5ACA 3;  3JXS A;  3KHC A;  2DFB A;  4GH4 A;  2BGO A;  4PLO A;  3Q8A A;  5KC6 A;  2IWG B;  2A6V A;  1R09 3;  3LFI A;  4A6O A;  5LCW L;  3BTZ A;  2P3Y A;  5IVC A;  1UY2 A;  5DAP A;  2A6Z A;  3RMY A;  5IFP A;  4CDU A;  4HMZ A;  5CU1 A;  3OBR A;  3WXP A;  5ISL A;  4R52 A;  2ZMK A;  4XJU A;  4XDP A;  2VBP A;  1NA1 C;  1OC1 A;  3C7F A;  1V6J A;  3IPV A;  1O5U A;  4KWU A;  1DGR N;  2BW8 A;  1O7F A;  2RJL A;  4I0B A;  3VDA A;  3OSD A;  1OI6 A;  2DVA A;  3NAP C;  1C8N A;  5A80 A;  3RJ2 X;  3P3P A;  1EP0 A;  4QXC A;  1PVC 1;  2ZJC A;  4AOC A;  3CJX A;  2QCS B;  2RMU 2;  4XPV A;  4BDV B;  4XMI A;  4E4Z A;  5GZE A;  4HK8 A;  2VZQ A;  2O0O A;  3WCR A;  2B45 X;  2BER A;  2V72 A;  2XUE A;  4XDQ A;  4W8J A;  4MXV A;  4IE4 A;  5A6X A;  3P5B A;  5FJH A;  2P3J A;  4LLO A;  3KWV A;  1A78 A;  2D5H A;  2YZ4 A;  3HBK A;  4YRD A;  3HOB A;  1K12 A;  2LRO A;  3P3N A;  2Q8C A;  3VDD C;  5GZC A;  5K0U B;  2K46 A;  3MYX A;  1IS6 A;  3NV2 A;  4KU8 A;  3W5M A;  2O14 A;  3MIF A;  2J1T A;  1C28 A;  1V6M A;  1LGN A;  4QD2 A;  5FP7 A;  4IE0 A;  3B69 A;  3IM0 A;  3A0N A;  3P1I A;  5A6Z A;  2BBV A;  4XF0 A;  1PK6 A;  4QHO A;  3WW2 A;  3FHQ A;  5KHK A;  2ZKN A;  4H55 A;  1H2L A;  1UOF A;  4GWM A;  4YW5 A;  1GYK A;  1UXZ A;  2CWM A;  3BTY A;  3EQE A;  4JGY A;  4QX7 A;  3WUC A;  3J9S A;  1W3X A;  2EVX A;  2GU9 A;  3WP3 A;  4GKX A;  1X8M A;  4NN0 A;  3UT0 A;  4LO8 A;  1LCL A;  2RS5 1;  1CAW A;  4LMF A;  4Y26 A;  1S0I A;  1IKP A;  4YW7 A;  2PHR A;  4QQ2 A;  4QKB A;  3CZU A;  3T1L A;  2VZR A;  2WAO A;  4COU A;  1TME 1;  4FSJ A;  1JBC A;  4LBM A;  1Q3E A;  1Q43 A;  1GP4 A;  4MGK E;  4IGO A;  1MS4 A;  2PYT A;  4UYB A;  1YQ5 A;  4XFC A;  1TME 2;  2TEP A;  5B4N A;  2ID4 A;  4Q4V 2;  1LES A;  3RJR A;  3ZYI B;  3S7I A;  4YM2 A;  3T30 A;  2B39 A;  2WS9 3;  3M3O A;  3AK0 A;  4XTM A;  3ILF A;  2DVB A;  2Y64 A;  1PVC 3;  4FT8 A;  2R0H A;  3EYP A;  1AZD A;  4FFF A;  2VW1 A;  1HB3 A;  1EV1 3;  2DUO A;  1D4M 3;  2A73 B;  3BOP A;  1N1S A;  2ZGM A;  4XBL A;  2QDR A;  4CU9 A;  2RS3 3;  4L9B A;  4WM8 B;  1QIQ A;  3D8C A;  2CDP A;  1GR3 A;  2RDS A;  1Q8Q A;  2PLV 1;  3HQU A;  3H8R A;  5C5U A;  1LOA A;  2NMN A;  4JDO A;  2O1Q A;  2OII A;  2MHF A;  1MPX A;  1X9T A;  4LR4 A;  3J7L A;  2J7M A;  2CAU A;  2PLV 2;  2WS9 1;  3IBM A;  4I01 A;  3ZFG C;  2Q5T A;  3OUI A;  5I93 A;  3VB9 A;  4COV A;  4QX5 A;  5K0U C;  1TVG A;  4GAL A;  4V2W A;  1LEC A;  1GOF A;  2QZ3 A;  4FVV A;  2GZW A;  2VVE A;  5KHJ A;  4J1W A;  3ZXF A;  1W2T A;  1E5H A;  2PHT A;  1H30 A;  4WZF A;  4UFL A;  3ROU A;  5K0U A;  1NZI A;  4BQX A;  5IVF A;  1W06 A;  1OF3 A;  1UMH A;  2HWB 3;  2WNO A;  3NNL A;  5LA9 A;  1RUJ 3;  2RS5 3;  3POS A;  2E6V A;  3GHN A;  1VAM A;  4JGZ B;  3S7E A;  4FXK B;  2YPJ A;  3WEZ A;  2B46 X;  1WBF A;  2JD9 A;  5I8S A;  3VBF C;  2DWR A;  1AR9 1;  1OQE A;  1NYW A;  1LOE A;  3LSD A;  4CU8 A;  5A6Q A;  1AYN 2;  5F5A A;  4UWD A;  5A3P A;  1MQT A;  5I0D A;  4OHX A;  1CES A;  2G9Z A;  1UOB A;  1LOB A;  1I9R A;  3KF3 A;  4XTP A;  2WZ8 A;  3CL1 A;  2BUK A;  2TUN A;  4YVW C;  5JZG B;  3SMH A;  2HWF 2;  4LA3 A;  1J1T A;  1SBF A;  1PZ7 A;  4XXP A;  4DQA A;  1BLZ A;  3J7N A;  1QJU 2;  3CLP A;  1W9F A;  1DGR A;  3VBO B;  3N9P A;  5T54 A;  3ZXE A;  4NID A;  1YQ6 A;  1WLD A;  2QQU A;  3HEI A;  4A2U A;  4GKY A;  4OUM A;  3MHZ A;  3FFZ A;  3OGR A;  3USU A;  3VHP A;  2ENR A;  4CCN A;  1ALY A;  1PGW 2;  1STM A;  2VZO A;  4CUG A;  5C7G A;  1NCQ C;  5H9Q A;  2ZHL A;  3E6D A;  2VOV A;  5DG1 A;  3O0X A;  4O7X A;  4RS5 C;  3NJX A;  4CCK A;  3BU7 A;  3BGA A;  3U10 A;  2Z79 A;  4HET A;  3VLB B;  1MAC A;  3VHN A;  4AWD A;  3AX4 A;  2JIJ A;  1FYU A;  1ZBE 3;  3VZO A;  2A3W A;  1TMF 1;  1UY1 A;  2JXA A;  4MYE A;  5JZG A;  3MEP A;  1US3 A;  5LBE A;  4AGG A;  3S57 A;  5CNA A;  1KJL A;  1XRU A;  4CCD A;  3GBW A;  4UOJ A;  1AR6 3;  4YLZ A;  2WO1 A;  3ZIX A;  1A8D A;  1MQT B;  3SKV A;  3VHO A;  5EJ1 B;  3PHM A;  5GLZ A;  1RUI 3;  5HCH A;  3EB7 A;  1RTV A;  1PX3 A;  4YW6 A;  1W90 A;  3N9L A;  4PQ9 A;  2WLQ A;  3I8T A;  1XYO A;  5A3L A;  1YCI A;  3B00 A;  5FPZ A;  4H3W A;  3AXE A;  2BWC A;  4IEQ A;  4NAM A;  3LPG A;  2R32 A;  4FOQ A;  1VBB 1;  2YDE A;  1DLC A;  1EAH 2;  1ULD A;  2E63 A;  4FPO B;  3THT A;  1RUF 3;  1ZYB A;  1J83 A;  1Z78 A;  4MV2 A;  1UY3 A;  2OPW A;  3LDR A;  4PIZ A;  4TLG A;  3ZXG A;  4AVV A;  1G9A A;  2VPV A;  4JHT A;  1NOV A;  5F8P A;  4D7T A;  4MGQ A;  4QAW A;  1TNR A;  3DPR A;  4L0P A;  3ZFG B;  4HL0 A;  3WHU A;  2XXZ A;  5IYY A;  1AR7 2;  2ZAC A;  2PQQ A;  4A41 A;  4NOT A;  2TBV A;  3WF2 A;  4CUB A;  1IQA A;  1EYB A;  2AGS A;  4ISQ A;  1WD3 A;  2W1W A;  3LQC A;  2XKO A;  1GNH A;  4Q27 A;  1VBC 2;  3MIB A;  3QCW A;  3AKP A;  3CJI B;  1TEI A;  3H7Y A;  5B4X A;  1C1F A;  5IVE A;  4Q4W 1;  3S0M A;  4N53 B;  4EZ4 A;  2UYB A;  2ZGL A;  1RJ7 A;  1TNF A;  2D43 A;  4QGL A;  4Q0P A;  1G9F A;  4R9C A;  2E33 A;  2VOT A;  1VBA 3;  1AXY A;  1KFX L;  2JDK A;  3B5L B;  2ZGR A;  5A3T A;  1RUI 2;  4XQ4 A;  4P9L A;  3BOD A;  5CIS A;  4HVO A;  1LOG A;  1V6L A;  4XJ9 A;  4A42 A;  4FPG A;  2BQP A;  2ARB A;  4NIA A;  5K8S A;  3T0A A;  4AHX A;  3ES1 A;  3MV1 1;  2HYX A;  2ZAH A;  2WS9 2;  3OYW B;  5JCT A;  3ZFF B;  4N9H A;  4Y5Z 0;  1I6X A;  3R4D B;  2XHK A;  3C8X A;  4E8C A;  4E2Q A;  5SV5 A;  1H4H A;  5CFC B;  2Z2S B;  3M3E A;  2RV9 A;  3SCH A;  5FYB A;  4YG6 A;  4BM8 A;  3SQO A;  1XC6 A;  4P9G A;  4NHY A;  4FTE A;  2W91 A;  2IFW A;  2W08 A;  3K48 A;  1HW5 A;  4P9J A;  4F7Z A;  3DEM A;  5A1A A;  3PUS A;  5FYV A;  3LCP A;  3NWK A;  4MUV A;  4XAB A;  3O1O A;  3TBD A;  3USS A;  2MEV 1;  5T3N A;  4QPW A;  1W3V A;  1GP5 A;  1PZ9 A;  3BTX A;  2YGM A;  1Y9Q A;  2XON A;  4CEW C;  1X82 A;  4A6S A;  3KV9 A;  3MF6 A;  5FMD A;  1COV 1;  4DO0 A;  5FQ0 A;  4PF5 A;  1AYN 1;  1Z7S 2;  2X29 A;  2HWE 2;  5LBF A;  2P3I A;  3VBU B;  4ZHN A;  3JQW A;  2QTW B;  1KEX A;  1ENQ A;  2JG8 A;  4QXH A;  3PIJ A;  2CYF A;  1D7P M;  1IHM A;  2QQN A;  3GZE A;  1DZR A;  3PVN A;  4AQ6 A;  2RHP A;  3IB3 A;  4Q0V A;  4F8A A;  2C9A A;  3MLL A;  5KXD A;  1CPM A;  1WGP A;  2AH2 A;  4DXZ A;  3DKQ A;  1F4A A;  4Q4V 1;  3E5U A;  1VBA 1;  4Y1U A;  1UXX X;  1F5J A;  3M7A A;  1D0G A;  4CDQ B;  2WZE A;  2O8Q A;  3PDQ A;  2VM9 A;  4LXL A;  5BYN A;  3LOB A;  3OEB A;  4AVC A;  5FP3 A;  1POV 0;  5L19 A;  1REF A;  4OYU A;  2FD8 A;  1DCS A;  2Q8E A;  4D6R A;  5GLT A;  3T0D A;  5J96 B;  4L2N A;  4LT5 A;  1N3Q A;  1OSG A;  1U5I A;  4EWA A;  3RG0 A;  2AYH A;  4E8D A;  1DGW X;  1OLM E;  1W8H A;  1G9D A;  2JG8 B;  5DAX A;  4Y33 A;  5CFD A;  3OUJ A;  5F3E A;  3EO6 A;  3N7M A;  1UYX A;  1H1I A;  5T5P A;  2X05 A;  3K2O A;  4A44 A;  4S2F A;  1ZZ7 A;  2AEZ A;  3WNM A;  1RUD 1;  3LF7 A;  4YM0 A;  2ZBJ A;  3N35 A;  5EZW A;  2Y60 A;  5EYX A;  2WNV B;  3QOP A;  1W99 A;  2EF6 A;  4QHB A;  2YC2 A;  4TYS A;  3WNN A;  3U4X A;  4Q8K A;  3HD8 B;  4XET A;  4EV0 A;  2R06 3;  5D2A A;  5HPO A;  1K45 A;  1W2U A;  1XNA A;  3JD7 2;  5HCB A;  4HPK B;  3ZOI A;  2IVI B;  4AGV A;  2QUO A;  1V6I A;  1NKG A;  1XB9 A;  2WFP A;  1D4M 2;  3TNP B;  4SBV A;  3VKN A;  1GOG A;  1YNA A;  3GHM A;  1F8V A;  3SIS A;  1SFN A;  4W6X A;  1X50 A;  4MET A;  4XF1 A;  2D6N A;  1FXZ A;  3LA2 A;  3TEW A;  4QDR A;  4QU2 A;  1XQN A;  2Q1F A;  4MX3 A;  3MO4 A;  2XKP A;  5FY0 A;  3R0R A;  4HLT A;  1IZ3 A;  1VBB 3;  3CF6 E;  1E5S A;  1QWR A;  2JKX A;  4BHP A;  5F5Q A;  2R07 1;  4N9I A;  3O1P A;  2W92 A;  2WO3 A;  1K5M A;  1QHD A;  2WC2 A;  3BTA A;  4LUM A;  4XF9 A;  5AVP A;  5A3W A;  3MPP G;  1GZC A;  2VXJ A;  1AJO A;  5K4L A;  1AL0 G;  4GA9 A;  1UD1 A;  5CB7 A;  3OB8 A;  3IDC B;  1PNF A;  4IES A;  4L8Q A;  4XJW A;  5FBZ A;  5FR3 A;  1RMU 1;  3B3Q E;  2HWB 1;  3AKR A;  2I2S A;  4YVS C;  5FWE A;  3I2K A;  4JGZ C;  1UQX A;  4XZP A;  2UUR A;  2XBO 1;  5A7P A;  3U14 A;  1X33 A;  1RMU 2;  5IW0 A;  5CFD C;  1OXC A;  4D6S A;  1LOF C;  2WJS A;  2ZGP A;  5FK7 A;  1NX9 A;  1X7N A;  5FY9 A;  3LIG A;  4P5H A;  4Q4Y 3;  1VBD 2;  3ZYF A;  3AJY A;  2D3P A;  1NLR A;  2BNM A;  3ASI A;  4LUK A;  3W20 A;  3OGV A;  3VBU C;  1WW5 A;  5A7W A;  4L11 A;  1WCU A;  1GQP A;  5CG8 A;  1S0F A;  4COY A;  3VD7 A;  4BPZ A;  4AFB A;  5JLV A;  5KR7 A;  4Q0Q A;  5EJZ B;  5GM0 A;  1PIV 3;  3HWJ A;  1CIY A;  2WO7 A;  1BCX A;  1MEC 1;  5FKC A;  4BIF A;  1UYZ A;  2VBB A;  2P3K A;  2ZS6 B;  4NRP A;  2WSU A;  1OUR A;  2X5I A;  2ZHM A;  3WX5 A;  1CZS A;  4QB2 A;  2XML A;  2GP3 A;  4XBN A;  3DKW A;  1UO9 A;  3FC0 A;  5L7O B;  5FZ8 A;  4M0H A;  3WF0 A;  1OPO A;  2ZML A;  5LAT A;  1U0A A;  3SLI A;  1AL2 1;  4AI9 A;  1AJK A;  4YVW B;  1SFP A;  1BYH A;  1SQ4 A;  1L7Q A;  1VBD 3;  4MGZ E;  4K1Z A;  2Q4S A;  4TLF A;  3ZDS A;  5FZA A;  3ZYG A;  4ASL A;  5DZG A;  1OD5 A;  1CON A;  4CTE A;  4CDW C;  4JVA A;  1QEX A;  1AR7 3;  3NNG A;  3PUI A;  2H0B A;  1BEV 1;  3MFC A;  5L9R A;  3OGG A;  3NV3 A;  4LO7 A;  4OHY A;  1GLH A;  1YFY A;  3VBF A;  3ZXK A;  3VBO A;  2ZX2 A;  3NMB A;  1TMF 3;  1RMU 3;  1ZRC A;  4LO5 B;  3HAG A;  4CCJ A;  4CCM A;  1C8M 1;  1H8T A;  2XGX A;  2CDO A;  4LE4 A;  1YYN A;  4Z92 B;  4YZ4 A;  3ACG A;  3CJI C;  3LA7 A;  2J22 A;  4CDX B;  3LIH A;  4IW3 A;  4XJ8 A;  2F17 A;  5DZF A;  3T4V A;  2D6L X;  4COZ A;  4IEW A;  3I2D A;  2R1D A;  1AHS A;  2HH9 A;  2QQW A;  1AR7 1;  1YXW A;  2HLE A;  2IXJ A;  3OD0 A;  1GAN A;  4QPI A;  2DV9 A;  4ZU4 A;  2W1S A;  2B42 B;  4XFA A;  3I3D A;  2R04 1;  4AEK A;  5IAX A;  1XNB A;  2D40 A;  2FDH A;  4IND A;  4JQT A;  1RGS A;  5FZG A;  1MVQ A;  4I3P A;  1Z0H A;  2VOW A;  2DVD A;  2YBP A;  5JZG C;  2YHJ A;  4BH9 A;  3AZX A;  1DGW A;  2XWB B;  4OI0 A;  4WM8 C;  4ARX A;  2CWS A;  1OUS A;  2WT2 A;  3UKV A;  3NAP A;  4YZ2 A;  3KM5 A;  3E1F 1;  1D2S A;  4IEP A;  2IVJ A;  1CR7 A;  1W8O A;  2Y0O A;  4A4A A;  3QLQ A;  1DZQ A;  5BNN B;  1IG0 A;  4IEY A;  1DGL A;  3SXW A;  4CP9 A;  3PME A;  2XJV A;  2LTN A;  1CZT A;  3F2Z A;  4LBN A;  4YFW A;  3NAP B;  5FO8 B;  3UJQ A;  4B3N A;  4AVT A;  1Q8S A;  4GWN A;  1R1A 3;  4MGY E;  4DOU A;  4NIH A;  1A6C A;  2VMC A;  1V70 A;  3T2T A;  1GWK A;  4LKS A;  4Y1Y A;  3AP6 A;  2QKD A;  2DCZ A;  2E9Q A;  5KHG A;  4LO6 B;  3OF1 A;  1EAH 3;  1Y7B A;  4DUW A;  3D82 A;  1WMD A;  2WA3 A;  2V4V A;  3ZKU A;  1CAV A;  3K77 A;  3IAP A;  1FMD 1;  3A4U A;  3POF A;  5FXV A;  5D8A A;  1B35 C;  2PMW B;  1DQ5 A;  1WLT A;  3D6E A;  4UFM A;  2FMD A;  3D0S A;  3GGL A;  4AFC A;  5HCA A;  2OXB A;  2FDG A;  3DEC A;  1JYX A;  1WCK A;  2QFE A;  2QQL A;  4IEV A;  4WV8 A;  2YXS A;  3LAG A;  1HRV 1;  1VMF A;  3W59 A;  1GFF 2;  3GJB A;  5LK5 A;  4DZG A;  2JIC A;  3IMM A;  4RHV 2;  2GN7 A;  5LEK A;  1SG3 A;  3VBO C;  2CL2 A;  4E4S A;  1LUL A;  5FPA A;  1H8T C;  2ZTN A;  3SH3 A;  3JB4 C;  2OX0 A;  2XQX A;  1W0P A;  3BCW A;  4K7J A;  1ZRR A;  5DN2 A;  3PJY A;  4OMD A;  1QOS A;  3UK9 A;  1ZBE 2;  2DU0 A;  3FN9 A;  3GXU A;  2RJK A;  3NV4 A;  1NY7 2;  2XBO 3;  5FZO A;  4OQ9 A;  2P5B A;  1WME A;  1ZBA 2;  3ZN6 B;  2LM3 A;  3ZFE C;  5ABJ B;  4ZS3 A;  1VRH 1;  2QQK A;  3VBH A;  4Q4X 2;  5FUP A;  2WWJ A;  3K3N A;  1J58 A;  1U5Y A;  4X6R B;  5BNP A;  3O5S A;  4QGN A;  1OHF A;  3WW3 A;  4RS5 B;  3RYR A;  4W50 A;  3ECQ A;  4A7Y A;  5FXX A;  5C4W B;  5K9Y A;  1BBT 1;  1J59 A;  1SBD A;  1W6M B;  4LIU A;  1JUI A;  3U78 A;  3T2P A;  2AAC A;  1U5X A;  4QPY A;  3ZFG A;  4ATE A;  3BPZ A;  4RHV 3;  2P34 A;  1RUD 3;  4YGB A;  4RYD A;  4DUX A;  1GQH A;  2CU5 A;  3RQ0 A;  4FPL A;  2X10 A;  1JZ5 A;  4Y22 B;  4I2O A;  3W21 A;  4NPM A;  2Y6K A;  5A6Y A;  2D3R A;  1WWY A;  2BVV A;  2VCA A;  3V0A A;  1HJG A;  1DQ1 A;  1XND A;  3KT7 A;  4U36 A;  2HWD 2;  4LJH A;  1DQ2 A;  2NMO A;  3E5X A;  2BNN A;  2VMI A;  5DUV A;  5F39 A;  1UW8 A;  4ES9 A;  2D6O X;  1KIT A;  4LK6 A;  3AFG A;  2RMU 3;  1VMJ A;  3DCQ A;  5BNP B;  1DQ6 A;  3VD9 A;  1S55 A;  1ZRD A;  3AJZ A;  5FMO L;  2VNO A;  4XW3 A;  3USU B;  3ZXA C;  5FPX A;  2F6B A;  2A5Z A;  1W8U A;  3K4Z A;  4PDW A;  2BU9 A;  4Y1V A;  5LA0 A;  4UW5 A;  1Q5O A;  2ZEZ A;  4CDU B;  2WII B;  4LHL A;  3DL3 A;  1W9Y A;  1DYK A;  4TXW A;  4XJA A;  1RC6 A;  1WW6 A;  3UYJ A;  3UES A;  3VZN A;  5AC9 1;  2E7T A;  2DBI A;  1JUH A;  1MS5 A;  1UKR A;  5EHD A;  5KWR A;  1PZ8 A;  3DN7 A;  5FYS A;  1QOT A;  1HXS 3;  1S2B A;  1V9U 1;  1XBF A;  1POQ A;  4N90 A;  2OKX A;  4YAR A;  3PUH A;  1GZW B;  1F31 A;  4IDZ A;  3ZMN A;  3ZYR A;  1OVP A;  5FZK A;  2OS2 A;  4YG3 A;  1QH6 A;  1ZZ9 A;  4QX8 A;  1DLL A;  2P6C A;  4LOS A;  1BK1 A;  1UKG A;  3MLJ A;  2DFC A;  2HWC 2;  3WUD A;  1AF9 A;  4K8R B;  4DB5 A;  3O1M A;  1O3Q A;  1N3O A;  1NA1 A;  1QQP 1;  2JKB A;  4BIO A;  2DUR A;  2W0X A;  2B4K A;  5FZ9 A;  1ST8 A;  2R30 A;  5FZM A;  2HWC 1;  2X09 A;  3HVD A;  4AR2 A;  1UWW A;  1VBE 3;  3EMR A;  5C8C A;  3RZJ A;  2Y33 A;  3NVC A;  4FPJ A;  2WWU A;  5DUW A;  4JX0 A;  1R09 1;  4YG0 A;  4R4Z A;  3M1H A;  3ZDV A;  2R1B A;  3ABZ A;  3WP5 A;  2HWD 1;  1PX4 A;  1WMX A;  2YGL A;  4HN1 A;  5JI9 A;  3I2O A;  4MGT A;  4AE2 A;  3N36 A;  1SBE A;  1F15 A;  4LBK A;  3AFK A;  2ZGU A;  3MW4 A;  4GMP 0;  2BGP A;  2G19 A;  4BB3 A;  4MG2 A;  1XU1 A;  3AMH A;  4C8D A;  2A1X A;  3APB A;  3KHB A;  2W94 A;  2D6P A;  2ZAA A;  3TN9 1;  2YUE A;  2ZGO A;  2FCT A;  2HBU A;  2WDB A;  5F2S A;  1KJR A;  1SLA A;  1QNY A;  4KU7 A;  4FP3 A;  4M3C E;  1GIC A;  4LK7 A;  4Q4Y 2;  1F4H A;  2SLI A;  1XXN A;  4LUL A;  2VNG A;  4MSV A;  3CKH A;  4AEM A;  4YZ1 A;  3C7H A;  4JRA A;  4WM7 C;  3WP4 A;  2WWS A;  4HSL A;  1NXM A;  2A7A A;  1ZZC A;  3NNF A;  2VC9 A;  3AYE A;  3MIH A;  1UOG A;  4YSF A;  3KCX A;  2ORX A;  2OVU A;  2WZR 1;  4YVS B;  1G9C A;  3H1M A;  4CSW A;  1S2E A;  3OUH A;  3IDE A;  1QF3 A;  3A22 A;  1N1V A;  1TE1 B;  2MPF A;  1JMU B;  1SHW B;  5HXM A;  4GB3 2;  1UN1 A;  5J7M A;  4A45 A;  2GAL A;  1VBA 2;  2R6Q A;  2ARA A;  1PO2 1;  3LD8 A;  4Q4W 3;  1VPH A;  1BEV 3;  3E97 A;  3I2F A;  2WFF 2;  3OGS A;  2VUD A;  1TZO A;  2WYS A;  4QX2 A;  4Y5T A;  4DFS A;  1GNZ A;  4M00 A;  5LY2 A;  1YEW A;  3NST A;  5A32 B;  4FP2 A;  4ONU A;  5DMY A;  4N53 A;  4AVA A;  4WVV A;  3FMG A;  2YRO A;  5C71 A;  4BE3 A;  1RUH 2;  2UU8 A;  1IOA A;  1NY7 1;  2CNA A;  3BOW A;  1H9W A;  3LEK A;  5FZC A;  2CTV A;  4YWA A;  3AL5 A;  4PI0 A;  4YM3 A;  4IL7 A;  2JDN A;  5BNN A;  4QPI C;  1VMH A;  3WDW A;  1AYM 1;  2XL9 A;  5GLU A;  2VU9 A;  1UZV A;  1SCS A;  3WF4 A;  4RS5 A;  3ZYH A;  4PF1 A;  4N7U A;  5HV0 A;  2D93 A;  4QT6 A;  1U12 A;  1YIP A;  1V00 A;  1VB2 A;  4C0H A;  1CAV B;  3WNL A;  5C9A B;  5AC9 3;  2ZA9 A;  4KBB A;  5EWS A;  4IER A;  4TWT A;  3D4K A;  4WM7 A;  2PLV 3;  5HV4 A;  4JGY B;  1C1L A;  1UF2 C;  3MIC A;  3WP6 A;  4BLJ A;  4RFT 0;  3CQO A;  2W5F A;  2Y8K A;  4QXB A;  5JR2 A;  2GH2 A;  4AI2 A;  4IE5 A;  5FXW A;  3GZT B;  4AAP A;  1H4G A;  4PI2 A;  2ZHK A;  4OLL A;  1QQP 3;  3MGU A;  1H6X A;  2QVS B;  2ZGQ A;  4C0B A;  5KXC A;  2VZP A;  3ALQ A;  5DPN A;  1H0B A;  4AXO A;  3FUQ A;  3QH7 A;  4Y22 A;  4H7L A;  2BDR A;  4FPF A;  4RQP C;  3T2Q A;  1W9T A;  4GXL A;  2XJU A;  4MLO A;  2GDF A;  5FYT A;  4D8M A;  3B9C A;  4RN5 A;  4XIL A;  3MPB A;  2FQP A;  3SKJ E;  1FOD 2;  1W05 A;  4LHS A;  1CX1 A;  4XE9 A;  1YFU A;  3NKT A;  4JQR A;  4L92 A;  4P08 A;  1W0O A;  3NJZ A;  1OLQ A;  2HWE 1;  4P14 A;  1QJX 1;  2D98 A;  2GC2 A;  3ELN A;  4DY3 A;  3QD6 A;  4Q4X 1;  4UFK A;  3ZPO A;  1OFS A;  2ZPX A;  3LDK A;  2XVG A;  5FJK A;  4QQL A;  4DMI A;  1IGO A;  2NP0 A;  3S6P A;  1ASJ 3;  1G6N A;  2D7F A;  3DYO A;  3OD4 A;  2RM2 3;  3ZPY A;  1VB4 A;  1HJF A;  1OPM A;  4QX0 A;  1ZRF A;  3J7H A;  2PAE A;  4UXA A;  1DG6 A;  3ME2 A;  1CZV A;  1H2M A;  1YQC A;  4GUL A;  2V5D A;  3PTR B;  3OYW A;  3WQ7 A;  5L9V A;  3J8F 1;  1LED A;  3ZSM A;  1CAU B;  1OVS A;  1LHO A;  1UYP A;  3CZJ A;  3LOI A;  3RVH A;  4C1W A;  4M3C A;  4EN8 B;  1WMF A;  2JWP A;  1B35 B;  1DYP A;  1AL2 2;  4HVQ A;  3ZSL A;  1BKZ A;  4FAH A;  3ORJ A;  3ENR A;  2QQV A;  1AYM 2;  4Y5S A;  5H9P A;  4BOW A;  1HQW A;  4B29 A;  4BQ2 A;  1ZM1 A;  2MNG A;  3WVJ A;  3JD7 3;  2WRA A;  3RDI A;  4CPB A;  2QQJ A;  3NV1 A;  3KVB A;  4IEX A;  1NA1 B;  3LSE A;  5F2W A;  2RS3 2;  1QDC A;  1OOP C;  3I97 A;  1NQJ A;  1RIR A;  4LBJ A;  4ZS2 A;  5F3G A;  4YW3 A;  4AZZ A;  3SH4 A;  4XUN A;  5BV6 A;  1FX5 A;  1G86 A;  4XFH A;  2WSV A;  4CDW A;  5EQU A;  2BVB A;  3LEG A;  1RVF 3;  5J1X A;  1V0A A;  5JPN B;  1NE6 A;  2RS5 2;  3FLR A;  3AVS A;  2LW8 A;  1NT0 A;  4FBF A;  1FOD 1;  5C3O A;  4LBQ B;  3RMX A;  5IK5 A;  1OD3 A;  1PO1 2;  3THD A;  5FYZ A;  4PIY A;  3DPR B;  1SEF A;  3CNA A;  5ERL A;  2K0G A;  3HR9 A;  3DXU A;  4XDO A;  3ZM8 A;  5IK8 A;  5EXO A;  5TSW A;  2C5D A;  3HN1 A;  2UY9 A;  3SHR A;  5A33 B;  1UYY A;  5FQ0 B;  1WCD J;  5FPV A;  4XHB A;  3VDC A;  1JH5 A;  3L2H A;  4UFH A;  4J25 A;  2WNU C;  4YW2 A;  2AEN A;  4R9A A;  5BNO B;  1XSR A;  3MUZ 1;  1N1T A;  2ET1 A;  2UYA A;  4FPE A;  5E89 A;  2RDR A;  3BIW E;  1URX A;  5F3I A;  3UNP A;  1JYI A;  5JMO A;  4SLI A;  1UU5 A;  3AZZ A;  5IVJ A;  1IPK A;  2F4L A;  4OHW A;  1WKY A;  3VZL A;  3V0A B;  4Z07 A;  1WCQ A;  1YQ2 A;  3AVR A;  3DYM A;  1UZ0 A;  2LUW A;  4KGG A;  4NE9 A;  2Y6H A;  2NN8 A;  1RUD 2;  2VY0 A;  1V6N A;  3WDX A;  4MXW B;  1VRH 3;  1W6O B;  5DG2 A;  4P00 B;  4CCC A;  5DUU A;  1SLT A;  4D6Q A;  1UPI A;  3I2G A;  1HRV 3;  2IUW A;  4ZU7 A;  3QBQ A;  4XVH A;  5H9R A;  2VTF A;  1PHM A;  1NCR A;  3KCC A;  5T50 A;  3GJA A;  1SAC A;  1WLC A;  4Q4Y 1;  2YC4 A;  5I8T A;  3BUC A;  3JU9 A;  4GWJ A;  4DRV A;  2OW4 A;  4HOO A;  2B8M A;  3D5O A;  2ES3 A;  3UKN A;  3ZN6 A;  3RZL A;  5BXX A;  3X29 B;  1OA2 A;  5FYM A;  4JDN A;  1QMJ A;  3MF9 A;  2FMY A;  2WQ4 A;  3WQ0 A;  4BQW A;  2XL7 A;  3U11 A;  3IDA A;  1EPZ A;  3UET A;  3DGT A;  4ORF A;  4OVE A;  2VCB A;  1RJ8 A;  2QNK A;  1NLS A;  1WW7 A;  4IV3 A;  1W6O A;  2NM1 A;  5FLJ A;  5FMO S;  3UV9 A;  1UX6 A;  5EIY B;  2VOK A;  1FAY A;  4H14 A;  1QJU 1;  2I07 B;  4Q5O A;  4YVS A;  3BYW A;  3LWC A;  2CY6 A;  5C8W A;  2XH6 A;  3J8F 3;  4Y1Z A;  5FY4 A;  1RUN A;  5J36 A;  2RDQ A;  1AR6 2;  1EV1 1;  2UWC A;  3ZSK A;  1XYN A;  2Y38 A;  4AFM A;  2BNO A;  5BNP C;  4NWV A;  1XU2 A;  2XLA A;  1K5M C;  2GC0 A;  4QWN A;  5E88 A;  5LBB A;  4K40 A;  3WG3 A;  2OUH A;  4E9K A;  1QQP 2;  1X36 A;  3RZZ A;  2CV6 A;  3AXD A;  4BME A;  3M4F A;  2GMM A;  4ZXE A;  3EXU A;  2J1U A;  1W0N A;  2Q1Z B;  2IC1 A;  1FT9 A;  3KT4 A;  1D4V B;  1JZ4 A;  2ZZJ A;  3AB0 A;  3C3V A;  3WSO A;  4FFH A;  4LPL A;  5FYC A;  5IUQ A;  5EP9 A;  5FP4 A;  4RD7 A;  3E6B A;  4P9W A;  5FP8 A;  1W6P A;  5G04 L;  5FOB B;  2KD7 A;  1FPN 3;  3NL1 A;  3AC0 A;  3ZFE A;  3PUR A;  1WUV A;  4LEJ A;  5JSO A;  5LRS A;  2IXI A;  2JDP A;  4N7I A;  3IN9 A;  2DVG A;  5FZ7 A;  4ZU5 A;  4QPG B;  4N43 C;  4LBQ A;  2NYY A;  3MI8 A;  2YU2 A;  2IFR A;  3BU0 A;  4KG8 A;  1UOJ A;  5JSP A;  2Y6J A;  1PM7 A;  3N7L A;  2EIG A;  4Z2W A;  1WA4 A;  3I3B A;  2RS1 3;  3KLS A;  1D2Q A;  3WV6 A;  4A7Z A;  1KGY A;  5B2G B;  4IV1 A;  5IVY A;  1OQD A;  2DCY A;  4LNV A;  4XXA A;  3AKS A;  3KB5 A;  2PN5 A;  5LAS A;  3CBN A;  5C9A C;  4M4P A;  2TNF A;  3PMS A;  1MS3 A;  2Y6G A;  4MZU A;  1R64 A;  5BY5 A;  1MZ5 A;  5T52 A;  1HXS 1;  3GNE A;  5T5L A;  5JIU A;  2QQM A;  2DTY A;  2XJT A;  1Q8P A;  1DU3 D;  4FOV A;  2PHL A;  1COV 2;  3EJK A;  3GDB A;  3I7D A;  3B93 A;  2ZAB A;  3MW3 A;  2HEY F;  1W2N A;  1LJ7 A;  1PNG A;  3FUO A;  1O5L A;  1GQG A;  5IJR A;  3POY A;  2OQ6 A;  2DCT A;  4LOT A;  1W8N A;  4Z2A A;  2GNT A;  1V9U 2;  4DIN B;  2VTX J;  1AR8 3;  4BK4 A;  1XJA A;  5DXD A;  4FXG B;  3ZSJ A;  1MZE A;  2JE8 A;  4Q0U A;  2BPA 2;  3LDB A;  1K42 A;  1NXD 1;  1KDK A;  3WHT A;  2RG4 A;  5FZD A;  2ZX1 A;  4G3Y C;  2GMP A;  1FAT A;  1MS1 A;  1QXJ A;  1PVX A;  2HJI A;  4YM1 A;  2A3Y A;  2I45 A;  3FLT A;  4XJZ A;  3RZH A;  1HLC A;  1S0G A;  3WW4 A;  1QGL A;  2XR4 A;  4HKW A;  3VD3 A;  5JMC A;  3PIG A;  4URA A;  5C70 A;  3T08 A;  1ASJ 1;  2C24 A;  2WLP A;  2WNE A;  4WVM A;  2WQ8 A;  1US2 A;  4MHR A;  1JHJ A;  4XFI A;  5FZ3 A;  3RRD A;  3VKF C;  5GAL A;  1HKD A;  5KXE A;  1D0H A;  4C90 A;  1IKQ A;  1VJ2 A;  2R7E B;  3KS7 A;  4CUA A;  1O8S A;  1OKO A;  2VH9 A;  5DUX A;  4AQS A;  4AEJ A;  5L7O A;  1KS4 A;  1LGC A;  1JI6 A;  1ND2 B;  2HWE 3;  2HWF 3;  3PNA A;  4N43 A;  2P17 A;  3ST7 A;  2WUH A;  1GWL A;  1N3P A;  2C0Z A;  1PM4 A;  2FHR A;  2HEV F;  2WZR 3;  1W8W A;  2ET7 A;  3OPZ A;  3OBT A;  1C3H A;  1XNC A;  3PJQ A;  4E2S A;  5CAD A;  5K7P A;  3SCF A;  3T1M A;  1RUI 1;  2ZKL A;  1N47 A;  1OUX A;  2OZ6 A;  5EPA A;  3C7O A;  3W9A A;  3I3M A;  3I59 A;  2ZXQ A;  1G7Y A;  2JEC A;  1PMH X;  1S0J A;  3H3Z A;  4M4R A;  3BPS A;  5JAX A;  3GM8 A;  5LRR A;  1GZ9 A;  3AKT A;  3H50 A;  4RGK A;  2JG9 B;  2YFZ A;  1DYO A;  3ETQ A;  2P2K A;  3NJV A;  4RGA A;  4KWK A;  1VBE 1;  2QQI A;  5C3P A;  3OBZ A;  1IS5 A;  1RVF 1;  2QBX A;  4LHN A;  3T4H B;  2ZX4 A;  4E4H A;  2DTW A;  1BHG A;  3VKO A;  2A6W A;  2WAA A;  4RR3 A;  3ZN4 A;  4CP2 A;  5M0T A;  2FCV A;  4LIV A;  2WAB A;  5J48 A;  2PTM A;  3NW4 A;  1NCR B;  4HN0 A;  4IGP A;  4ZZ8 A;  3OOX A;  1R08 3;  4PCR A;  2ZGK A;  3UJO A;  4DEV A;  4XUR A;  1DP0 A;  4JAA A;  3E5Q A;  4HXC A;  1YWK A;  5FCC A;  2VZS A;  4OHZ A;  3AP9 A;  5F1R A;  2ZMN A;  4Y20 B;  2PHX A;  5D8A B;  2Q0A A;  4QDQ A;  3ES4 A;  4XAE A;  1JYV A;  1JZ2 A;  1RUH 1;  1VBD 1;  2WFF 3;  1KS5 A;  3RFR A;  4EZH A;  1DQ0 A;  1BBT 2;  2G4I A;  5C8C C;  3AP4 A;  4NPR A;  4HSJ A;  4OFG A;  2JE9 A;  1LOF A;  2DCK A;  4XQW A;  2WR9 A;  3VUO A;  1YI9 A;  4Q4W 2;  5FY7 A;  5DDJ 1;  1CPN A;  3E6C C;  5CKN A;  4X8N A;  2VL4 A;  3DF0 A;  1H2N A;  3JQX A;  1SLI A;  4TTG A;  2YBK A;  4XYX A;  4UFJ A;  4NWW A;  4OZX A;  4XCB A;  3SH5 A;  1ND2 C;  1QOO A;  4BIS A;  4EWE A;  4EN9 B;  2XUM A;  2PQS A;  2BOJ A;  1BXH A;  4NUB A;  3GAL A;  5IT6 A;  3K3O A;  2HBT A;  3VKM A;  3AZY A;  3AMP A;  1ND2 A;  4N43 B;  2Q8D A;  1LOD A;  3ZYP A;  4NHX A;  4FPC A;  3WDU A;  4QQH A;  2QZ2 A;  2VW2 A;  1R1Z A;  3VHR A;  2Y6L A;  3A7Q A;  4LTA A;  3A23 A;  1ULE A;  3POW A;  4UW6 A;  5FYY A;  3RWK X;  2ARC A;  1H6Y A;  1NUK A;  1OMI A;  4EN7 B;  2ATF A;  2UWA A;  5FBJ A;  5C4W C;  1COV 3;  3GBF A;  4B7K A;  4HT1 T;  3RI8 A;  3QH6 A;  3ZXD A;  4RA0 A;  3VKL A;  4AAX A;  4P9X A;  1KDM A;  3WNP A;  3FHA A;  3OTF A;  1RUO A;  2BWA A;  1O4Z A;  2BGC A;  4FOW A;  5I0S A;  1LKN A;  2K9Z A;  2VZ1 A;  5JPM B;  2DVF A;  3H3U A;  4JKL A;  1B35 A;  4HAN A;  4HBN A;  2VOX A;  4XHX A;  3WF1 A;  3O1U A;  1LR5 A;  4P9Y A;  2IXL A;  2A71 A;  2JDA A;  1RUE 2;  3T3Y A;  4ES8 A;  1JYW A;  2RS1 2;  1C8M 2;  2GNB A;  2RM2 2;  1RYY A;  3OPT A;  4OUL A;  4AHW A;  4ERO A;  4EQV A;  1UIJ A;  1GBG A;  1Y9M A;  3MDP A;  3THP A;  1NCQ B;  1L7R A;  2J1E A;  1LOC A;  2DBN A;  2JDH A;  1UCX A;  4FOY A;  5FY1 A;  5DAB A;  1MS9 A;  5A3N A;  1DDL A;  1RL3 A;  2GN3 A;  4LA2 A;  2W95 A;  2BTV C;  4QPI B;  3LA3 A;  3GCX A;  4RFR B;  5F9T A;  3GZA A;  4FTB A;  2G9G A;  1A8M A;  2VQT A;  2WYF A;  2IXC A;  4COW A;  4AF9 A;  2HEW F;  4JDM A;  3H0O A;  3H8U A;  2C6S A;  1CVN A;  4LBQ D;  4S2H A;  1HN0 A;  5FZI A;  2Q1M A;  5KHI A;  1GP6 A;  1QJE A;  3ZFF C;  5JOZ A;  2EIC A;  4OZO A;  4D7S A;  2XDV A;  4UBG A;  3C7G A;  3LPF A;  4IV1 B;  1AX2 A;  4BQY A;  2Q8O A;  3PVE A;  1L3J A;  1LHW A;  2W68 A;  5LB6 A;  1PO2 3;  1NZC A;  3ITQ A;  4PDW B;  2H6B A;  2VQU A;  4ZKT B;  4OCT A;  3PUQ A;  1LU2 A;  1RUJ 1;  4QQP A;  5JVV A;  1MEC 2;  2PAK A;  2XJQ A;  2ZGS A;  3HNY M;  3NJY A;  2LAL A;  3OBA A;  4QX3 A;  3KMH A;  5FYU A;  4WVM B;  3V0B B;  1I3H A;  1RUG 2;  3A0K A;  3AMN A;  3BN6 A;  4GH4 C;  4JKM A;  4YPJ A;  3ZX7 A;  1LAJ A;  1NAE A;  3JBG 3;  4BQ4 A;  2JG9 A;  4X8P A;  5CVR A;  3QAC A;  3SEP A;  3POG A;  3Q8B A;  4HK9 A;  1PK6 B;  4NO4 A;  3SIT A;  2P37 A;  3WNO A;  1FMD 2;  1S4C A;  3FBM A;  4EYU A;  5A3O A;  1IQD C;  4W4Z A;  1O59 A;  4O9E A;  3VBR C;  4GJY A;  3OPW A;  5C3R A;  2JG9 C;  1ND3 B;  5FUN A;  4JGY C;  2W9X A;  4IE7 A;  3HBZ A;  3WT3 A;  1T6G C;  2PHW A;  3KZ4 C;  2RS1 1;  5C9A A;  2BZD A;  2R49 A;  5FXZ A;  1JOP A;  2X5I B;  1LRH A;  1PO2 2;  4V2V A;  2UY8 A;  4CEW B;  1PGS A;  3K51 A;  1TME 3;  1ENR A;  1W04 A;  4O61 A;  3H8X A;  2LS6 A;  4OI2 A;  5FZ1 A;  1GKB A;  1RUC 3;  2W52 A;  2VZT A;  1AX0 A;  4PLN A;  5A7Q A;  3MIG A;  5JXG A;  3O1V A;  3HJR A;  5AFB A;  1P8J A;  3M2M A;  3FJS A;  4XFB A;  4EJR A;  4QM8 A;  1I5Z A;  2IXK A;  2BBA A;  4EN6 B;  1SFY A;  3J26 N;  1W2O A;  3KQR A;  1SLB A;  2HKX A;  3CDZ B;  5DAV A;  1G9B A;  3SC7 X;  4BXS V;  1VRH 2;  4QQO A;  3IDB B;  4ZPI A;  4GB3 1;  5DAQ A;  1BBT 3;  3ILR A;  3TEX A;  3RSJ A;  3HIF A;  5IVV A;  1NCQ A;  3VDB A;  1H1A A;  1UX7 A;  1YO8 A;  1DF0 A;  1ZBE 1;  4GWI A;  4NRQ A;  5CAZ A;  4XCA A;  4BYY A;  1MEC 3;  2EIB A;  5GZF A;  3V0B A;  2WNV A;  4JCK A;  4P9I A;  1L7L A;  1MZ6 A;  1OLR A;  1RUG 3;  1POV 3;  2KR2 A;  4GJZ A;  4IEZ A;  4Q1P A;  4XEZ A;  3NO8 A;  4CDQ C;  1LU1 A;  5A7S A;  3R6S A;  4XFF A;  1AUY A;  2J1V A;  2WN2 A;  4GD4 A;  1CAU A;  4IV1 C;  3VN4 A;  4CCO A;  3GZU C;  4CYD A;  5F7U A;  1AL2 3;  2AZ5 A;  3NNJ A;  5F3C A;  1O4Y A;  3PVO A;  2JJ6 A;  3JBG 1;  1S1A A;  3K4A A;  5FY5 A;  2WT0 A;  3DYP A;  5FUI A;  3ZFE B;  2ZX3 A;  2C4X A;  3HPN A;  3NNM A;  1VBE 2;  4IV3 B;  2RJ2 A;  1RB8 G;  3UGH A;  5KBF A;  4XQD A;  2UWB A;  4Q4X 3;  4C91 A;  3O1S A;  2X8K A;  3JCI A;  4D94 A;  5L7O C;  4RR3 B;  1MR5 A;  4Q29 A;  1E5R A;  3PU3 A;  1RIN A;  2EXI A;  2O8O A;  3LKJ A;  1RHI 3;  1XNK A;  2IXH A;  2VO5 A;  3TNQ A;  1RHI 2;  4LBO A;  2XJP A;  5LY1 A;  1BVV A;  2VUA A;  2YMZ A;  4JKK A;  3H1Y A;  5FDB A;  4BCU A;  2KM2 A;  4PHZ A;  3I54 A;  1QXR A;  1GNY A;  4S2G A;  3VGI A;  1YFX A;  4B4Q A;  4ZY9 A;  1VIW B;  4OUE A;  4QPG A;  3MBW A;  1Y9G A;  2OYZ A;  2FBE A;  3C2U A;  3POJ A;  4IGQ A;  1EPW A;  1W6Q A;  2YBS A;  5I0U A;  1DHK B;  5I8Y A;  1RUE 3;  2ZEY A;  3KQ4 B;  3HQX A;  1PGL 2;  3INA A;  4ZXK A;  3U75 A;  4I0W B;  2ERF A;  2A6X A;  4CVU A;  2OZJ A;  5CA6 A;  2W1Q A;  5H9S A;  1HB4 A;  3WY6 A;  3VBF B;  3TWI A;  3O7O A;  5LBC A;  5FZF A;  3RPQ A;  3WG4 A;  2JD4 A;  3WCS A;  3BI3 A;  1BJQ A;  1CAX A;  1NLQ A;  3BVC A;  2GC3 A;  2ZHN A;  4JGZ A;  4PLM A;  4M0N A;  5EJ3 A;  3LZZ A;  4MO3 M;  5FIX A;  4CCE A;  4XC9 A;  2YY1 A;  5I0T A;  1XE8 A;  4XUT A;  1DBN A;  1OT5 A;  1V6O A;  1YHF A;  4D3W A;  1WBL A;  2W47 A;  1E57 A;  1PVC 2;  4KNC A;  4CE8 A;  5ANQ A;  4B8E A;  2NPI A;  4AI8 A;  1ENS A;  2FZ1 A;  3WDV A;  2VR4 A;  2DUQ A;  4FPY A;  4NMI A;  1J1L A;  2FDI A;  1HIX A;  1W6Q B;  3KGZ A;  5CFC A;  2ZZQ A;  4E27 A;  5CKM A;  3AYA A;  1W39 A;  1W8T A;  1SPP A;  5F6K A;  5BUV A;  5GZG A;  4LKE A;  3OCP A;  2ZGT A;  4NHL A;  2X53 S;  4XOG A;  1RUC 2;  4Y1X A;  1B09 A;  1V6K A;  4DNY A;  1H8T B;  1HQL A;  1YC6 1;  2V5Y A;  2Q30 A;  1HDK A;  1LEM A;  2VEC A;  2J1A A;  3ZR5 A;  4YZ5 A;  3THC A;  1OH3 A;  1RHI 1;  1OOP A;  1A34 A;  2Y0I A;  2A75 A;  2YG0 A;  1OLM A;  4CEY B;  5FFO C;  3JBG 2;  3TAY A;  1UNB A;  3LFM A;  4RR3 C;  2JB4 A;  3B02 A;  5BPX A;  2JX9 A;  2Z4F A;  5JR7 B;  3ZO0 B;  1QKQ A;  5JOY A;  1SCR A;  1FMD 3;  3I59 B;  1UIK A;  1RXG A;  1PO1 1;  3U1X A;  1H1M A;  2E7Q A;  3WNX A;  1N1Y A;  3OY8 B;  3VBR B;  3FBY A;  4YNI A;  2XJR A;  2JG8 C;  3I3Q A;  2DYC A;  1ZZ6 A;  2L9L A;  3TOJ A;  1PK6 C;  3T2O A;  1BZW A;  1GOH A;  2J1S A;  2BV4 A;  4QPG C;  4HKL A;  2OUJ A;  1GZW A;  4HG6 B;  5A3U A;  4PT6 A;  4ZZ5 A;  1RUF 1;  3HNB M;  4JTO A;  4LE3 A;  3V56 A;  1X9P A;  4ISR A;  2GC1 A;  4GQ7 A;  1SLC A;  4IEU A;  3ZYJ B;  2DUP A;  5GJ6 A;  4Q1R A;  5C5T A;  3AMQ A;  2RR1 3;  3LE0 A;  1UU4 A;  4PDW C;  1R08 1;  1OQ1 A;  5FO7 B;  3WG1 A;  2NZ9 A;  1JU4 A;  1CAW B;  3O0W A;  4IQP A;  2E26 A;  5FLH A;  2VZU A;  1QJY 2;  4CXX A;  5CEH A;  1QNW A;  2YYO A;  3IPV B;  4BU2 A;  2VG9 A;  4CZS A;  2JDM A;  3U07 A;  2V09 A;  4WZC A;  5AFE A;  4UI9 L;  1C5H A;  1RUH 3;  3POI A;  1XNT A;  1EY2 A;  3BAL A;  1CQ9 A;  5J98 B;  2ADE A;  1APN A;  4NRM A;  4UT5 A;  4CP1 A;  2E53 A;  3KGL A;  2ARX A;  1UMZ A;  4JC1 A;  1JOD A;  1VP6 A;  3IWZ A;  3L2Y A;  2G1M A;  4OI4 A;  5CG9 A;  1R09 2;  2VJX A;  4YYO A;  3WG2 A;  1Z7S 3;  4GIQ A;  4UW4 A;  4AQT A;  3LGR A;  4BJ0 A;  5LK7 B;  3T09 A;  3RZM A;  1AYN 3;  1OF4 A;  2XG3 A;  2F4P A;  4W65 A;  2SBA A;  1ND3 A;  5T5J A;  5JXJ A;  1UMI A;  5C8C B;  5FZL A;  3RS6 A;  1VRB A;  2ORZ A;  2WO2 A;  4E4D X;  5CFD B;  1KFU L;  3MZH A;  3FLP A;  4KWJ A;  3PVB B;  1PIV 2;  1HRI 3;  4ARY A;  2D5F A;  5EV7 A;  2Y26 A;  3UGF A;  3III A;  4OUS A;  4MH0 E;  3IZO A;  5A3M A;  3RWN A;  1OOP B;  4XFG A;  3TRS B;  1ZVF A;  4B4R A;  3WF3 A;  5IK4 A;  2XHN A;  4HPK A;  4CEY A;  4AQ2 A;  1O4T A;  5FZE A;  3KV4 A;  3PLQ A;  4BQ3 A;  5E1R A;  1JYT A;  3AYC A;  4RHV 1;  4BWO A;  1AR6 1;  4QKN A;  5CBL A;  1KRI A;  2PXJ A;  1IG3 A;  2A70 A;  5AC9 2;  4QGM A;  4YGE A;  1F2N A;  1PMJ X;  1GSL A;  5GLW A;  2E7A A;  3ILN A;  5FYI A;  4OI1 A;  4M3C F;  4LKF A;  4QU1 A;  2EIE A;  1OFN A;  1CIW A;  4OMC A;  5DDJ 3;  4YFZ A;  2ZOE B;  1Q56 A;  3FHI B;  1ULP A;  3MV0 1;  5T55 A;  1K5J A;  3I2H A;  3I2I A;  1NG0 A;  3AKQ A;  3O12 A;  4MXW A;  4QDS A;  1CN1 A;  2A3X A;  3H3L A;  5IAV A;  2OQ7 A;  1JU3 A;  2ZEX A;  4PBO A;  2R07 2;  4RQP A;  1JZ8 A;  3S5A A;  3KV5 A;  2H0V A;  1DQ4 A;  2RMU 1;  4Y4R A;  3ACH A;  1WA6 X;  2WN3 A;  1LNS A;  2XJS A;  2RM2 1;  4R8H A;  4XIO A;  3VBS C;  1PGL 1;  2JE7 A;  3O0V A;  3RYK A;  3V65 A;  2D6M A;  2R0F A;  2WNV C;  1FV2 A;  4K21 A;  2VCC A;  2VD7 A;  1J3Q A;  2HWC 3;  3RGB A;  3POE A;  4ATF A;  5BNO A;  2HYK A;  3ZR6 A;  1T6B X;  2X5I C;  3GBG A;  4FI9 A;  4XIK A;  3Q9O A;  1PGW 1;  2XOM A;  4AW7 A;  5JUV A;  1YJK A;  2E51 A;  2HWD 3;  4L97 A;  1XE7 A;  3FL7 A;  5J3U A;  1WLW A;  5SV8 A;  4QX1 A;  2YC0 A;  5HCF A;  4JV4 A;  4QB1 A;  3FWE A;  2VBD A;  1WZX A;  2ADD A;  1JS9 A;  1ENX A;  3WIN E;  3DV8 A;  3VBU A;  1SDW A;  2WT1 A;  5A7N A;  1HRI 1;  2RVA A;  5HXV A;  4K1Y A;  5LA2 A;  5C4W A;  5FO9 B;  2OPK A;  3R4U A;  1K3I A;  3J7M A;  3N9Q A;  4DXT A;  1RED A;  4FPK A;  5LEJ A;  1S0C A;  2RS3 1;  1JZ6 A;  4AL9 A;  2MEV 2;  3VD5 A;  4XZU G;  1S2K A;  3ATG A;  3G7D A;  3PU8 A;  4IUG A;  4IE6 A;  4NVP A;  4CCL A;  4X6Q B;  4A7K A;  5FZO B;  5LA1 A;  4BA6 A;  4CDW B;  1NCR C;  4J1X A;  1BVP 1;  2CSG A;  5FKB A;  1ZBA 3;  1J3P A;  2AC1 A;  1C8M 3;  3D0J A;  1NQD A;  3TN9 2;  2RR1 2;  4KG0 A;  4XBQ A;  3G6J B;  3NQH A;  3HT2 A;  4GZ9 A;  4YVW A;  1HV0 A;  3MW2 A;  4Q2F A;  1WD4 A;  2OT7 A;  3S5Q A;  1W9W A;  5J37 A;  2GH8 A;  1I1E A;  1YQ8 A;  2I74 A;  4NIG A;  5HBA A;  4AK3 A;  4UF0 A;  4JZR A;  3H42 B;  4LOR A;  4S2D A;  3Q8C A;  2QE3 A;  4M3C B;  4DEQ A;  5FWJ A;  2EXK A;  2VQA A;  3KVA A;  2DU1 A;  1F9K A;  4NAO A;  1Z7S 1;  3WOG A;  4B1M A;  1ASJ 2;  4XF4 A;  1AXK A;  2C1F A;  2P1B A;  5KC5 A;  3N7K A;  1OA3 A;  1LTE A;  2EAL A;  1VBC 3;  4BMB A;  2DCJ A;  2VMD A;  1WCS A;  2CGN A;  2HWB 2;  4QMA A;  1O3R A;  4LQR A;  4AG4 A;  3PUA A;  3SNM A;  2VUJ A;  2CHH A;  1JZ7 A;  3VD4 A;  3V64 A;  2XLF A;  3M8L A;  2RDN A;  1SLL A;  2XVL A;  5JI7 A;  3R4S A;  1QXP A;  5C6C A;  3L9J T;  1OH4 A;  4FTS A;  3AL6 A;  3ON7 A;  5E8A A;  4MHU A;  2AUY A;  4XUQ A;  1M06 G;  4ASM B;  4N8M A;  4QXK A;  5FZB A;  1XOY A;  3OJB A;  5FP9 A;  3RYP A;  3BB6 A;  4YGC A;  5A7O A;  4B7E A;  5JXI A;  2Z5W A;  1HV1 A;  2E32 A;  1ONA A;  4Q26 A;  3TYJ A;  1AXZ A;  1VE0 A;  3AZV A;  2WZP P;  2ARE A;  3ACF A;  3IIA A;  1DFQ A;  1AR8 1;  1ZZB A;  3KSC A;  3M3I A;  3VV1 A;  5FYH A;  1D4M 1;  1Q8V A;  1RUG 1;  1RVF 2;  4QHZ A;  1GZT A;  4DS0 A;  3H1W A;  1VBB 2;  3M70 A;  1AR9 3;  2GAU A;  3DUI A;  4GMP 3;  2D3S A;  1JYC A;  4DY5 A;  3B01 A;  4FCA A;  1C57 A;  3BKZ A;  4F3J A;  4H2A A;  3NRU A;  1CJD A;  4K3U A;  5ANN A;  3P6B A;  4EN0 A;  4I09 A;  1XPW A;  2WQZ C;  4K6B A;  3TB0 A;  4LIT A;  5FPU A;  1I5P A;  3N7J A;  1POV 1;  1R1A 2;  3K75 B;  3VDD B;  1S0D A;  4PBP A;  3A21 A;  3K4D A;  4KQ7 A;  4PIX A;  3VL9 A;  3ACL A;  2PHU A;  1JOB A;  1Y4W A;  2K2S A;  5JDB A;  2WKK A;  3WZ1 A;  4RGG A;  2D6K A;  4ZON A;  2YPD A;  1LEN A;  3HT1 A;  4NII A;  1GV9 A;  4E2G A;  2GP5 A;  2V73 A;  1LHU A;  4JTN A;  1BMV 2;  4C1X A;  2W87 A;  3H7J A;  3O1R A;  4YW1 A;  1GU3 A;  2VCM A;  3HMY A;  2VUL A;  4U2A A;  1M4W A;  4W6Y A;  1RUE 1;  4ET7 A;  3VBH B;  2EXJ A;  4FQ4 A;  3M3C A;  4I3G A;  3CMG A;  2BEO A;  2BJS A;  2ETE A;  3VBH C;  1CGP A;  3GYD A;  2ZGN A;  4IET A;  3ZYB A;  2J1R A;  1HQN A;  4K20 A;  3J8F 2;  2R04 3;  4Q0S A;  2R06 2;  3J4U H;  3O14 A;  5FZH A;  2R07 3;  3ZLI A;  4CUC A;  1IPJ A;  3W5N A;  1U5Z A;  4BLI A;  5A1F A;  3VDD A;  3WNK A;  2C9K A;  3B9I A;  4A3Z A;  3NKG A;  4UBH A;  1XYP A;  4IXL A;  5DDJ 2;  3WD5 A;  1J84 A;  4WVZ A;  1ODM A;  1W6N B;  2XVK A;  5D21 A;  1W6M A;  3MFA A;  4UF0 B;  1W8F A;  1QJF A;  3N4M A;  1REE A;  5J09 A;  4URT A;  1LHV A;  2Y34 A;  1JN2 P;  2JB8 A;  4K8F A;  5EYY A;  2H6C A;  1FPN 2;  1GUI A;  4JHZ A;  3KCY A;  2EAA A;  4NHK A;  5FY8 A;  3WW1 A;  3I3E A;  2PEL A;  1W03 A;  3MIE A;  1NE4 A;  5ABJ A;  5IK7 A;  4TN7 A;  3H8O A;  5FK8 A;  2XPJ A;  1LGB A;  1ODN A;  2EAK A;  5F5C A;  2YV8 A;  1R1A 1;  1ND3 C;  2CGO A;  1JTZ X;  3FZ3 A;  4FFG A;  1G8W A;  4O9G A;  5FMC A;  4HFS A;  1FOD 3;  1PIV 1;  4OQ8 A;  3WQ1 A;  5LW9 A;  2GSY A;  1HXS 2;  5IHR A;  2RE9 A;  3GF6 A;  3VZJ A;  1IS3 A;  4IV3 C; 
#chains in the Genus database with same CATH homology
 3C7G A;  3LPF A;  2ORX A;  3IAQ A;  1UY1 A;  1US3 A;  2VQU A;  1UY0 A;  3A22 A;  4DXS A;  4DXR A;  1SHW B;  4UOJ A;  5HXM A;  2WO1 A;  4A45 A;  3HNY M;  3OBA A;  4QX3 A;  3SKV A;  3HNM A;  1O8P A;  5EJ1 B;  3I2F A;  3OGS A;  5IYY A;  1JYN A;  2WYS A;  3BN6 A;  4QX2 A;  4JKM A;  4YPJ A;  1NAE A;  1PX3 A;  3EB7 A;  3SEP A;  5DMY A;  3WNO A;  5C71 A;  2B9V A;  1IQD C;  4W4Z A;  3LPG A;  1O59 A;  1DLC A;  3LEK A;  2W9X A;  4XUP A;  1J83 A;  1UY3 A;  2EID A;  2BZD A;  4MGQ A;  4QAW A;  2W46 A;  4L0P A;  3WF4 A;  1HN1 A;  2LS6 A;  4KMQ A;  4PF1 A;  2VZT A;  5JXG A;  3HJR A;  1P8J A;  4A41 A;  2BBA A;  2W1U A;  3WF2 A;  4CUB A;  3HN3 A;  3CDZ B;  2W1W A;  3LQC A;  4BXS V;  5B4X A;  4CU6 A;  3CQO A;  3VDB A;  2W5F A;  1UX7 A;  2Y8K A;  4GWI A;  2E33 A;  2VOT A;  2EIB A;  1H6X A;  2VZP A;  4KI5 M;  4A42 A;  5DPN A;  5G05 L;  2J1V A;  2WN2 A;  5F7U A;  3T2Q A;  3T0A A;  1EUT A;  1W9T A;  3MV1 1;  4D8M A;  2HYX A;  3K4A A;  4RN5 A;  2E31 A;  5FUI A;  3DYP A;  3C8X A;  2C4X A;  3SKJ E;  3HPN A;  4E8C A;  2RJ2 A;  4LHS A;  1CX1 A;  4P08 A;  2RV9 A;  3LEI A;  1XC6 A;  2W91 A;  4D0Q A;  1JZ3 A;  4BK5 A;  5A1A A;  2VO5 A;  4JKK A;  4QPW A;  3DYO A;  4QX0 A;  2XON A;  1GNY A;  3J7H A;  1CZV A;  2V5D A;  4ZY9 A;  4OUE A;  4MAD A;  3CZJ A;  3ETP A;  1KEX A;  2DDU A;  1TG7 A;  2VZV A;  1D7P M;  2QQN A;  2ZEY A;  3IB3 A;  4CVU A;  1F4A A;  2W1Q A;  2QQJ A;  1UXX X;  2WZE A;  3I97 A;  2VM9 A;  3OEB A;  4MO3 M;  4XUN A;  5DQ0 A;  4XUT A;  1OT5 A;  4OYU A;  3LEG A;  2W47 A;  4XUO A;  5J1X A;  3T0D A;  2VR4 A;  2ZEW A;  4E8D A;  5CZK A;  2LW8 A;  2X05 A;  1UYX A;  1OD3 A;  1GMM A;  3THD A;  4A44 A;  4CU7 A;  3WNM A;  3C7E A;  3I2J A;  1SDD B;  3ZM8 A;  1W99 A;  2J1A A;  2YC2 A;  3THC A;  3WNN A;  1UYY A;  2QQO A;  3VDC A;  2YG0 A;  1K45 A;  5HPO A;  1XNA A;  1NKG A;  2Z4F A;  1T2X A;  3MUZ 1;  3UNP A;  1GOG A;  4P02 B;  5JMO A;  4QDR A;  4MGS A;  1WKY A;  3MO4 A;  1WCQ A;  1YQ2 A;  2L9L A;  3DYM A;  1UZ0 A;  4DUV A;  4UAP A;  2WBK A;  2Y6H A;  1GOH A;  3T2O A;  2J1S A;  2JKX A;  4HG6 B;  4P00 B;  2W92 A;  2WO3 A;  3HNB M;  4PT6 A;  4ZZ5 A;  5IFT A;  5JR2 A;  3I2G A;  3OB8 A;  4XVH A;  1W9S A;  2VTF A;  5JXH A;  4P5Y A;  1EUU A;  3I2K A;  3LE0 A;  2C26 A;  2YC4 A;  3D3A A;  4GWJ A;  1JU4 A;  3SEE A;  2E26 A;  2VZU A;  1NX9 A;  3OGV A;  4UI9 L;  1GQP A;  1XNT A;  3IDA A;  3UET A;  3K46 A;  3VD7 A;  2VCB A;  5EJZ B;  1CIY A;  1UYZ A;  5EIY B;  1CZS A;  4QB2 A;  2VJX A;  4BJ0 A;  2W3J A;  3T09 A;  1OF4 A;  3WF0 A;  3ACI A;  3OG2 A;  2YB7 A;  5JXJ A;  1UMI A;  4MOA A;  2ORZ A;  2WO2 A;  4ZXE A;  1L7Q A;  2J1U A;  1W0N A;  4ARY A;  1JZ4 A;  4QB6 A;  3III A;  3WSO A;  4LPL A;  3WF3 A;  2XHN A;  2YFU A;  3NNG A;  3PUI A;  5G04 L;  2KD7 A;  3AC0 A;  1ULO A;  4PQQ A;  1PMJ X;  2VMF A;  2CDO A;  1UY4 A;  3ACG A;  2J22 A;  2EIE A;  4OMC A;  3MV0 1;  1ULP A;  2VZ3 A;  2Y6J A;  3I2H A;  3I2I A;  4QDS A;  3I3B A;  3WQB A;  2ZEX A;  1JU3 A;  1JZ8 A;  3OEA A;  1KGY A;  3ACH A;  2WN3 A;  1LNS A;  3T0B A;  2HLE A;  5CYY A;  4M4P A;  2Y6G A;  2W1S A;  1R64 A;  2VCC A;  3I3D A;  2QQM A;  3U37 A;  3GDB A;  3CIH A;  4FI9 A;  2XOM A;  5JUV A;  5IJR A;  2VME A;  1W8N A;  3MUY 1;  3JXS A;  3FL7 A;  4Z2A A;  4ARX A;  2BGO A;  4QX1 A;  4QB1 A;  4A6O A;  4BK4 A;  3E1F 1;  5LCW L;  1UY2 A;  1W8O A;  2JE8 A;  4A4A A;  5IFP A;  2RVA A;  5LA2 A;  1K42 A;  1CZT A;  1K3I A;  4DXT A;  3F2Z A;  3C7F A;  1JZ6 A;  4KWU A;  3VD5 A;  4XZU G;  3VDA A;  4IUG A;  2VMC A;  5LA1 A;  4LKS A;  3VD3 A;  5C70 A;  3T08 A;  4BDV B;  4DUW A;  2VZQ A;  2V4V A;  2WQ8 A;  1US2 A;  3K77 A;  1JHJ A;  2BER A;  2V72 A;  3IAP A;  4W8J A;  3NQH A;  4GZ9 A;  2R7E B;  4CUA A;  1O8S A;  3GGL A;  1W9W A;  3WNL A;  3DEC A;  1JYX A;  3HOB A;  1K12 A;  2QQL A;  1JI6 A;  2WUH A;  3W5M A;  4DEQ A;  2J1T A;  1SG3 A;  3C7O A;  3P1I A;  2XQX A;  2ZXQ A;  4M4R A;  1PMH X;  5DN2 A;  3GM8 A;  4OMD A;  3FHQ A;  2YFZ A;  2DCJ A;  1DYO A;  2VMD A;  3FN9 A;  3GXU A;  4LQR A;  4AG4 A;  1UXZ A;  3NJV A;  2QQI A;  1JZ7 A;  3VD4 A;  2QBX A;  2QQK A;  1BHG A;  1OH4 A;  2WAA A;  3CZU A;  4W50 A;  3ECQ A;  2VZR A;  4XUQ A;  2WAB A;  2WAO A;  3T2P A;  4ZZ8 A;  5JXI A;  2E32 A;  4DEV A;  4RYD A;  4XUR A;  1DP0 A;  4DUX A;  5B4N A;  2ID4 A;  2VZS A;  2X10 A;  3ACF A;  1JZ5 A;  2Y6K A;  2Y64 A;  2VCA A;  4QDQ A;  1JYV A;  1JZ2 A;  3EYP A;  4CU9 A;  3VD9 A;  2CDP A;  3NRU A;  3P6B A;  2DCK A;  1XPW A;  2VL4 A;  1MPX A;  3K4Z A;  5LA0 A;  4TTG A;  2J7M A;  1I5P A;  2ZEZ A;  3K75 B;  3A21 A;  3K4D A;  4TXW A;  1TVG A;  3UES A;  1GOF A;  2PQS A;  2OKX A;  3PUH A;  1OF3 A;  2W87 A;  1UMH A;  1GU3 A;  4ET7 A;  2Y6L A;  3A7Q A;  3WEZ A;  3A23 A;  3CMG A;  1H6Y A;  2JD9 A;  1NUK A;  2B4K A;  2J1R A;  2X09 A;  4CU8 A;  1UWW A;  4AAX A;  3WNP A;  3FHA A;  4CUC A;  5I0D A;  4JX0 A;  3W5N A;  2VZ1 A;  4JKL A;  3WNK A;  2C9K A;  2WZ8 A;  4A3Z A;  3ABZ A;  3WF1 A;  1PX4 A;  1J84 A;  2JDA A;  1JYW A;  1RYY A;  2BGP A;  1L7R A;  2J1E A;  1GUI A;  4JHZ A;  2W94 A;  3I3E A;  3HEI A;  2W95 A;  2WDB A;  3OGR A;  2VZO A;  5C7G A;  2VQT A;  1F4H A;  3CKH A;  3NJX A;  3C7H A;  3BGA A;  5IHR A;  2EIC A;  4OZO A;  3MBW A;  2VC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...