2WO2B

Crystal structure of the epha4-ephrinb2 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
136
Chain Sequence
b'IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPHRIN TYPE-A RECEPTOR
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
total genus 29
structure length 136
sequence length 140
ec nomenclature
pdb deposition date 2009-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2wo2B00
2PP9A 3OMAB 4TXVB 1E5ZA 1ASQA 1V54B 2AVFA 4BDVB 4F2FA 1KCWA 3FYIB 1AZRA 4E9QA 1AZUA 4DP4X 2BP0B 3FT0A 3QPKA 1AS7A 1GY2A 2CCWA 1GW0A 3FSAA 3NJIA 2HXAA 2UXFA 4QLWA 2PLTA 1PY0A 3X1BA 4E9RA 1CC3A 3QJTB 4JHVA 2YAHA 3TBCA 3WNIA 3PLYA 3NSFA 1KYAA 5AZUA 2OJ1A 2MTAA 3QJRB 2JFCA 4GP5B 1NIEA 2WO3B 5B3SB 3EH4B 1TEGA 2XUWA 1BYOA 1JZIA 3PPSA 1J5DA 1NPNA 1IUZA 1JZFA 1MG2C 2IDFA 2ZWNA 1NTDA 1ZDSA 3CDZA 3FSVA 1XB3A 2ZONA 4KO7A 2B3IA 4A2HA 1OE3A 4KO6A 2HX7A 1AG6A 4G7QB 1WA0X 2GI0A 3N55A 3NJKA 4CSZA 5B1JA 3NYKA 3NJHA 4KO9A 3QJQB 2FJSA 2FQFA 1AAJA 1KDIA 4F2EA 4HCIA 4JHUA 5PAZA 1QNIA 1NWOA 1A8ZA 3AG3B 3ZIYA 2DWTA 5I26A 4G7RB 3CVBA 3WIAA 2IDSA 2BWDA 3TA4D 1WS8A 1OOWA 4KNSA 5I5IA 3FQ1A 2IDTA 1CUOA 3AY2A 3CG8A 3NP4A 4A2DA 1EHKB 1KCBA 4KOCA 4AKPA 2BP8B 5I5JA 5EHFA 1JVOA 3ABGA 3NT0A 4YSDA 2MRYA 2AZUA 2VN3A 1MDAA 4YVNA 2RACA 4E9WA 1E67A 7PAZA 3NSYA 5I6KA 2BW5A 4E9XA 1JXFA 1NIDA 4CSPA 2XV3A 2VSMB 1BYPA 4DP6X 1QLEB 1FA4A 3V9EA 3WNJA 2X88A 3SBRA 1EZLA 1NDTA 3DIVA 3T71A 2IWKA 2YQBA 3MBWB 4GP8B 3NJFA 3SBQA 3JT2A 3G5WA 2YAPA 1W6LA 3CZUB 4GXFA 1PLCA 3FPYA 1AACA 2B08A 4A2EA 3N2JA 2IH8A 2GB2A 1SF3A 1AANA 8PAZA 1XB6A 2XV2A 4YSUA 2VMJA 3NSCA 2W88A 4KO5A 3X1GA 4BWUA 3T6VA 4DP7X 3CVDA 3H4FA 2YAQA 3CDZB 1JZJA 3NJGA 4RH4A 2WSDA 2XWZA 5B7FA 1XMEB 5AKRA 3PAZA 2ZOOA 3UACA 1NICA 3S3BB 3PAVA 5I6PA 4G7SB 2NRDA 3IN0A 2I7SA 3FSZA 1A4AA 3QJVB 3TBBA 4DPBX 2E86A 2UXVA 4HIPA 3OQRA 2FT6A 1V55B 2JXMA 3UADA 2LLNA 3NSDA 3S3CB 1ASOA 2R7EB 1J9RA 4G72B 4Q89A 4E9TA 5D4IA 2OV0A 5I6NA 1AZBA 2DYRB 1A3ZA 3ZDWA 1OCZB 2PP7A 3QJSB 2IAAC 4P5SA 3MX0B 2BHFA 6PAZA 3TU6A 1URIA 1OF0A 3PXLA 6PCYA 1PNDA 2H47C 2QDWA 1GS6X 3FQYA 3AG1B 3C75A 4A2GA 3T6XA 1MZZA 1GS7A 3HEIB 3FYEB 1E30A 3HB3B 2VM4A 2EILB 2QT6A 4EF3A 1BXVA 1RZQA 3AW5A 1FWXA 1UATA 1KDJA 3NP3A 2I85A 1NIBA 1FFTB 3JTBA 1BEXA 2XX1A 2H5UA 2CALA 3IE9A 3IN2A 1MZYA 1ADWA 2YARA 2HRHA 1OCCB 1L9RA 2FWLB 1BQ5A 4YSQA 1RZPA 5IY5B 2BO0A 3DTUB 4HCGA 2FNWA 3T6ZA 2CAKA 7PCYA 3D12B 5E9NA 2GHZA 2FT7A 2BZ7A 1ZDQA 4PAZA 2R7EA 5I6OA 4W9ZA 1WA2X 3QQXA 3ERXA 4DPCX 3X1EA 1TKWA 2PCFA 2UXTA 2X87A 3T9WA 3KW8A 1RKRA 1WA1X 1M57B 2IH9A 1M56B 2IWFA 2FQGA 4KNTA 1ZPUA 1KBWA 1JZGA 4HHGA 2XU9A 9PCYA 4G71B 2XLLA 2I7OA 3WKPA 5ANHA 4UF7C 1M9WA 4BXVA 4HZ1A 1BXUA 2EINB 2VSKB 1BQRA 1SFHA 1NPJA 4YSAA 2DY2A 2YXWA 4M3HA 3U25A 1AZCA 3BVDB 4BWWA 3TASA 2EIJB 4F7KA 1CURA 1N70A 4WTQA 5B1KA 3X2QB 3FQ2A 4YSPA 3CVCA 2CJ3A 3WG7B 2FQEA 1ZIBA 1L9PA 5F7BA 3L45A 2EIMB 1PLBA 4KOBA 1JVLA 4AKQA 1WAEA 1L9TA 4YSEA 5A7EA 1IBYA 4AX3A 4P5RA 1IBZA 1X9UA 2FTAA 2PPFA 5PCYA 4GY4A 1SNRA 3UAEA 1ET7A 1JZHA 2BW4A 4FA7B 4A67A 1JXGA 2QPDB 1JOIA 3GDCA 1BAWA 1L9QA 2HLEB 4NERA 4E9VA 1AOZA 3IEAA 1DZ0A 3BQVA 1AZNA 4X4KA 2H3XC 2Q9OA 1PF3A 4DP9X 3ABLB 4BWTA 1SHWA 1X9RA 2Y1AA 4AZUA 1RCYA 1JXDA 2YXVA 2JKWA 2PP8A 3FU8A 2VW7A 2VW6A 3ASOB 3EF4A 1NZRA 2J5WA 1TU2A 1PAZA 1PCSA 4DP8X 4E9SA 4Q8BA 5B1JC 2Q5BA 3S3DB 1ET5A 2XV0A 3IBOA 4MFHA 2YAOA 1L9OA 4BK5C 2XYBA 1ET8A 2VM3A 2QDVA 3SBPA 1NIAA 2XX0A 1PZAA 2J56A 1J9SA 3H4HA 2XXFA 4AKOA 3WI9A 4YSCA 5TK4A 1SHXA 2GSMB 4NB7A 4YL4A 4E9YA 3UAAA 4ENZA 4A66A 2J57A 3AZUA 5I5MA 3ASNB 1AR1B 2CBPA 2YAFA 2ZXWB 1HFUA 2IWEA 4HAKA 1PLAA 1OCRB 4NAJA 1XB8A 3GXUB 2PCYA 3S8GB 1AS6A 2PPAA 5B7EA 1AG0A 4GP4B 1ID2A 4ZK8A 5B7MA 1A65A 2HX9A 3SQRA 5B1AB 2CUAA 1J5CA 1GR7A 1JZEA 1SDDB 4YSSA 2IDUA 3KW7A 2BWIA 4HALA 3EH5B 3FPXA 5D4HA 1GSKA 3PCYA 2GC4C 3UGEA 4DP0X 5B1BB 3EH3B 2DYSB 1PZCA 3AG2B 1SF5A 1NWPA 4YSOA 3DKHA 3X1FA 1GYCA 2EIKB 3NJJA 3X1NA 3ZBMA 2GC7C 3OMIB 2Y69B 2FQDA 4L0PB 1VLXA 4YSTA 2P80D 5F7AA 4DPAX 2W8CA 3GYRA 1A4BA 1CYWA 3EHBB 1J9TA 4FAAB 3S8FB 1OE1A 3AG4B 3FU7B 2AFNA 1BXAA 1NIFA 4BDVA 4N8UA 1E65A 4BXSV 3ABMB 3ABKB 4K9JA 2BP0A 3NJNA 3FSWA 3OD3A 1E5YA 1AQ8A 1GY1A 1SJMA 2DWSA 3FS9A 4JKNA 1PNCA 1KBVA 3RYMA 1HAUA 3UABA 5FC9A 2TSAA 1SDDA 1IC0A 5I6MA 2QPEB 4DP1X 3T6WA 2VW4A 4YVUA 2YAEA 2IDQA 1OCOB 2HRGA 2PPCA 2XVBA 3OM3B 4KNUA 1WS7A 4UAHA 1ZIAA 3V9CA 1ASPA 2PPDA 1KGYE 2DV6A 2FT8A 2HZHA 1B3IA 2N0MA 2UX7A 4PCYA 1PZBA 4HCFA 1QHQA 3FU9A 1ETJA 1W8EA 5D4JA 4A68A 4DP5X 1L9SA 5I6LA 2TSBA 1PMYA 2BZCA 1AS8A 1ILSA 1GS8A 2GIMA 1AIZA 3NJMA 4WKXA 3H56A 3FU7A 3NJLA 5TK2A 2UX6A 3QJUB 5AFAA 2OCCB 2YAMA 4A2FA 2UXGA 1J9QA 1F56A 4UANA 1MG3C 4G70B 1OE2A 4YSRA 1W6WA 2P80A 1CYXA 3WKQA 4M4RB 1IKOP 1TEFA 5I28A 1YLBB 1HAWA 4AI7A 4HHWA 1JERA 2AZAA 1V10A 1OV8A 2PPEA 3OMNB 2BP8A 1ILUA 2A3TA 3PAUA 4W1TA 2HX8A 2J55A 3ZX1A 1ZV2A 2XXGA 1SFDA 4GYBA 2AANA 1T5KA 2GBAA 2WO2B 4N4YB 1BQKA 1R1CA 4DP2X 1NINA 1I53A 1KV7A 4QKTA 1A4CA 5LDUA 1N68A 1DYZA
chains in the Genus database with same CATH superfamily
2PP9A 4UTBA 1E5ZA 2J1XA 4YXLL 5FO2A 4LSPH 4QT5B 2YPVL 2IEPA 1JZ8A 4OFDA 4M3KB 5IB5B 3F5WB 2WLHA 1TETH 1AZUA 1GZPB 4HD9A 4XVSL 1J12A 3PHQA 4GW1B 4XMKH 3QZMA 1TZIB 3L2MA 3SY0A 4OH2A 4K2UL 5AW9B 3GBLA 2DAVA 4QAWA 5JHLL 3LRLA 2VDML 1GZQA 3FTUA 1G7IA 4Q6IB 1KJ2A 3MLZH 5EPMB 3VGDA 4Z3JA 1E2WA 4F1ZA 1A9VA 4OZ4A 5HVFB 4M4RA 5T8IA 1MW1A 3SGDI 2F7OA 3EYOA 5K9KB 3C60C 4OI7A 2AQ3A 3BXNB 5L4JA 5EU4B 5GRXG 1YNTB 2NDFA 3HPJB 1IUZA 3P4MA 4UYPA 3MRLB 4IMKC 4PWHA 1S6NA 5FDWB 3D0VB 3FSVA 4ZX6A 1KJ3H 2XTJD 1DE4A 4HSCX 4KO6A 2DWEA 2HFGL 5DC2A 2WOYA 3OKDA 1XTLA 3OKYA 3JWDC 2XVLA 3N55A 5CMAB 3SPVB 2VH5H 5IJDC 1DVFD 1QASA 3QJQB 2ZAGA 1G1CA 3L81A 1RMFH 3HE6D 4Q4EA 2OFQA 2XTSA 1I1FA 1AQKH 2YMOA 3MLSH 1X5YA 1E4WH 4N87A 3MRIA 1IAKA 1CK0H 4FJ6A 5HYSA 2NNRA 4KC3B 3UMTA 4H8UA 5LB1A 1JWMB 1OL0A 3I02B 3MMEB 4G6ML 4IU2B 3W11C 3ZIYA 3DUUA 4ACPA 2VR8A 3KPOB 2GJRA 4Q9QL 5CEZL 4U6TA 4LE8A 3WE6B 3U2SA 3GTVA 5LXVA 2DBJA 3T8XB 1IC7L 2A0LD 2OI9B 4M5TA 5ALBL 5CSZB 3RQ3A 5JPNB 2JKRM 2CGYA 4A7UA 3WUZA 4ZFGL 4S1QH 3MKKA 1FZMB 3NT0A 4F2ME 4FCHA 3F6JA 4YVNA 3N85H 4LFHD 5CJQL 4XO4A 1CFQB 1KCLA 2ZXGA 3TJHC 2RMNA 4M1DH 4YHKL 2GFBB 4E9XA 2C1PA 4IOIA 4QXVA 2GK0A 3U7YH 1QLFB 2C9VA 2AJXH 3DBSA 4TPRH 1BYPA 4UTCA 5IB1B 1QLEB 5I8EB 3C60A 4PJ7B 3IT8D 1OTTD 4NUQA 1CXFA 3KCPA 4PG9A 5H4YA 2V9UA 3LZOA 1F02I 2N7BA 3K1DA 4RFNB 1MXDA 2XG4B 4YWGL 1O7DC 2IPKA 2RD0A 4HUUA 1DSFL 1D5XB 4JHAH 2Q8AL 2B08A 2EDMA 32C2A 3W56A 1L5GA 1N5AA 2V7NA 2FO4B 4S1DC 5TQ2H 5AZ2H 5A16A 1CGUA 4X7TA 4DJMA 3VGBA 3T0XA 2W88A 1XVSA 4WV1A 3ARZA 1IFHL 4HX1A 3FB5B 1W9XA 3GUFA 2WMPA 3WY3A 2C3XA 2G30A 3CUPA 4G43B 4XP6H 4V11A 1JXKA 3C8KB 1UWEH 4JZJC 5HJGA 2VABA 1SUJA 5C6TL 5H2BA 4NQSA 5L2KD 3KJ4B 4WGWB 2JB5H 4N6QA 3VWJD 2H1PL 3TO2A 4XZ4A 3IN0A 4L9LB 3QDJB 2EUWA 1IRAY 3GSNA 4GO8A 4Y4KA 4F20A 4DPBX 4R96B 2Y06L 3MCYA 3OQRA 1P7BA 1G7LB 1QRNA 4D3CL 3N44F 1V55B 3U9UA 1HILB 5IW6A 3JV4B 1SDYA 2P7TA 3IGKA 3FTVA 1DVXA 3ZTJH 1IGML 3F3HA 1P2CA 1YEKH 2DMHA 5AB9A 1TKWB 4YHPB 2GUOB 3OR7A 1J8HD 4KI5F 4MS8C 5AQ0A 2VSCA 3TU6A 3L3DB 3NAAH 3NDYE 1QRNE 1ZT4A 3HB3B 2AEOA 2XZCH 2ZWLT 4PM1A 5ESQA 1MHEA 1BXVA 5EU7C 3NIFB 1G7JB 2ORBL 4IMLB 4PJBF 5FDYA 1QTSA 1Q9OB 1WF5A 5CLTA 2XX1A 3JWNH 4Z3TA 5BUPA 5KYXB 4PBWD 5DJAB 3U4BH 2LR4A 4OD2A 2EC8A 5EZJA 4G6KL 1DDHB 2HFFA 1BQHG 3WIFB 3MJ9L 1IKNA 1O7DE 1WGOA 4IJ3C 1U58B 4TF4A 2XICA 1CLOL 2PO6A 1JHTA 5IV2A 2N59A 1XSJA 4JZJA 4FNLL 1ZA3A 4F24A 2IPTH 1SN2A 2CJSA 3MR9B 5C70A 1PLGH 2FD6H 2CPUA 2J25A 4N0YL 3ERXA 5D7LE 2QGCA 5HDBE 3EGSB 3FTGA 1XBDA 4MVBC 4ZTPL 4N2EA 3L3GB 1OGPA 3VXRE 3QORB 4FTVA 5HHQB 1VCBC 1BZ9A 1BVLB 3GJFK 3QZWA 5IVXA 2IWFA 4KWUA 1XL6A 4YHYB 2NY0C 4LCIH 4G1EB 1X5HA 4ABWA 3HBZA 4PU2A 2VLLA 2XU9A 4X99B 3EAKA 4JPKL 5IEHA 1D7DA 2NR6C 2FUQA 4FXGC 5ANHA 1M9WA 2HG0A 3SE4C 4QYOA 3BDXA 1UOVA 4V1DA 3ZTNL 3B1UA 3LEVH 5F7DA 4DKAA 1NPJA 3BPLC 3B9DA 4ES8A 4FTVE 4NZUH 1KPVB 1MFAL 2XXMB 3SDDB 4XMPH 5JIPA 3Q6FB 2IAMD 3QP3A 4XMLH 2EIJB 5GGSA 5JA8B 4OJFL 5H4ZA 3CZFA 3SKOB 1S5HA 5IF0B 5C0RL 3TYFA 4OZHB 2J1YA 4HIXL 1AP2B 3HS0C 2CBQA 2R0LL 3L45A 4B97A 4O2EA 1NAMH 4HG4J 4V1DE 4HUVA 2Z34A 4HOZA 3D2UA 4QTHA 1T0NB 3UP1A 2P8LB 2GKIA 3FB7A 4JN2B 3F7KA 5KYYB 4TNFA 3AU1B 3CWGA 3BH8B 4OIFA 5J06A 5DC4B 1QD0A 3TCLB 4MHHG 2ZZUT 5EU7E 2A5UA 4AYFB 1WJ3A 1DZ0A 2WO4A 3VU1A 3WDJA 1JN6A 4AYGA 4NO2B 2H3XC 1RP8A 2W9LA 3GS7A 3IRCA 1F0LA 4BWTA 2UYLA 2Y1AA 4A63A 4MAYC 4UV7L 4PJ5E 1E6JH 1OARH 5CCGE 1NEUA 3SO3C 2EUXA 4B9KC 4FNPA 3W9EA 2J5WA 3KWVA 3VD4A 3F7LA 4WWKA 4WQOA 2Z8RA 5F6HJ 3O2DL 3CZEA 3O45A 4Q8BA 3WL9A 2G60L 5ITBL 3MXWH 3VXSD 1H19A 4KVCL 4W68A 1CE1H 3SOBH 1IVLA 2QDVA 3N9GH 2CLVB 3UO1H 1E9PB 1IZJA 4P4KB 4YFDB 4PI2A 3HAEH 3G6DH 1U6AL 1OLLA 4JJOA 3CFDB 3TOPA 2ADIB 5DHDA 4XCEA 3ZE2E 3CZGA 2EDEA 3TNNB 1SHXA 2TAAA 4BELD 1WUZA 4H0LC 3UAAA 3W0WA 5EU5A 2BVQB 4P46C 1V3LA 3FQWB 3ASNB 3PY9A 3D51A 3NTCL 2PXYB 2ZYHA 4AVIA 1X9QA 4J8RB 2ARJB 3MDJA 3LNFA 1VEPA 1YN7B 4XBGA 4Y9EA 3MNWB 3T4AC 3O3BA 3CSGA 4DTGH 3GMRA 4TSBH 2CXGA 5DEGA 4YXHH 2IO5A 4JMNA 5I75B 3W0WE 3IMTA 3R06B 1MRDH 5CZKA 5C0ND 2H32B 2C9SA 3JZ7A 5C0GB 3QUXB 5EF1A 1FNGB 3L4XA 1SDDB 3QCTH 2OK0H 5KVFL 2CHNA 2IDUA 4N8CL 1OAQL 3RWFA 3MCLH 4LLMB 4GKLA 3T2NL 4PCKA 3D1MC 4XI5C 4DP0X 1KFGA 3I75B 1F86A 2DYSB 4OFQA 5EG6C 3ME0B 3GHEL 2DH3A 2ZWYA 2OXHB 4ZOAA 1NBVH 5B39A 3BWUC 3FOMB 1J0KA 4LLWA 3GFUA 5AVTB 1DVFC 2DICA 1E2ZA 1DJSA 4GJTB 4NKIH 2HH0L 3HE6C 2OTWB 5EN2A 4R7DA 1EERB 4L0ZA 2ICEC 3QIWB 2B9AA 2YSSB 2MPVA 1JUFA 4X98A 1P84K 5L9DL 2RJMA 4XPFH 5HHOD 2VZSA 4S0SD 1JNJA 2RH0A 4A7TA 1KJ2L 3LHAA 5DO8A 5SWSA 5KAQG 2WNWA 4M1GL 4LLAA 1FRGL 2P5EA 4P46A 4OLZL 3D85D 3UTQB 1EXGA 2ZQKA 4PTUA 1JPSH 3ARED 5EIIG 4PJCA 3UABA 2C7UA 2O1AA 3RDTD 3I3DA 1ACZA 3GB7A 4FG6C 3T3ME 4DOHB 1WICA 4KJYA 4AV0A 1DO5A 2OSXA 4UTAA 3T4AA 3Q9QA 2GUYA 3BLKA 3VNYA 1AOHA 1IFGA 1JRHH 4KNQA 5KN5A 4PJEF 1T7VA 2HRGA 1GVIA 4QNPE 1L3NA 1YMME 2P5EE 1WS7A 4MJ5A 1O6VA 2FJGA 5JO5B 4CBPA 4L1HA 2D0FA 2ENYA 1F90L 2HH0H 5AW7B 3K0YA 4HUNB 4N6RA 1PZBA 2GCYB 4K7PL 1JZ7A 1RVFL 4NM4L 3WELA 1G6RB 1WQVT 3HI6H 4U33A 3ECVA 1OTTC 3NCMA 1L9SA 5EU3B 3J27A 2XWJB 2GSGA 2XKNA 4NQEB 3RWGB 4N8VA 1ERNA 4HUKB 2QSCH 1OSPH 1OWWA 1ILSA 5FFOA 3FOLA 4YUEH 1TMQA 3IXAB 4M1GH 3PPEA 3HIZA 1A47A 4OLZH 2UZXB 5AVYB 1IC5H 4MNHB 2WTPA 2UXGA 4JX0A 2G4GA 1MG3C 3IU4L 2WSPA 1DVFA 4AIZB 1H8OA 4MB4A 4CVXB 2P80A 1PIGA 2JVUA 3HE6A 1TEFA 3KLAB 2H4EA 4AI7A 4HKXA 1YMHB 1LVEA 4YAQB 4ZTOH 1YNKH 2MQGA 3WDIA 5IMOB 4QRUB 1G5GA 1U8CA 1ILUA 3IM1A 1SQ2N 3US9A 1X3DA 3ILEA 5GIRB 5C07D 1T03H 1NJ9A 1HHHA 1RVFH 1FAIL 3Q2CA 3BP4B 3HE7C 1Z32X 2WO2B 3I85A 3PDOA 5DUBB 3VWJC 4BRVA 4Z7NF 1M2OA 1M05A 2FB4H 1NINA 1I53A 1CGTA 1L7IL 4ZMXA 4YDIL 3AS2A 1M71A 3IDGA 3L5XL 1KCWA 1RZ8B 3U9PH 1HHIB 1XH1A 2YN3A 4O02H 3IU4H 4EKJA 2NTFA 3UG4A 2BP0B 2YQGA 1GY2A 2GW5A 2WLIB 2V0AA 1H9VA 3SE3A 5AVUB 2GJZA 2H6PA 3BAWA 4X6BB 4Y9GA 4FP8H 1ROWA 4KY2A 3OF6D 3TS8A 4H88H 1JPTL 3QJZA 2OJ1A 4FQ1H 4NM8L 3BD3A 2IWGA 2AK1L 25C8H 2XY2A 3GNML 2YQ2A 3N0AA 4GP5B 4TUOB 1LEKB 4A38A 1TEGA 4ZUWB 1YZZA 4ONHA 1EZUA 2QV4A 5KVDL 4IBQA 4Y5VB 4QRAA 2OYKA 3TIDA 2DKUA 1NAKL 2FVNA 4JAMB 4EQ3A 2VR7A 4K5OA 4A2HA 5CZVL 4R4FL 5E2VH 4OLYH 3TH2T 1MI5B 4NKQB 4PP2A 5ADOL 1NMAH 2DLEA 1QQDA 2H0FA 3JVGC 4QR7A 4WI7A 3ZKXC 5IOPB 2EXTA 4CAGA 4EZLA 4JVWA 3ULVF 3ROOA 5AWNH 3EXJA 2YXMA 5DRNA 4O4YL 1COBA 1RJCA 4MA7H 1I9IL 1KF9B 4K3JL 4XN5A 5C2BL 1N0XH 1NUFA 3ZYOA 4PG2A 5I71C 4R5TA 1DBAH 1H3XA 2ZKHL 4Y4HD 5ICZB 5CGTA 5L2KA 4QHKJ 3ZR5A 3VDBA 3VWJA 2MNJB 4QHUA 2YEZA 3TA4D 4G8FA 2D7OA 4HGKC 5CD3A 4BQ6A 4L4TB 1UQSA 1AXIB 3S0PA 2ZOWA 3KEHA 5FCUH 4PUBH 4LF3A 1S9XB 1KCBA 2B1OA 2R9HC 4YHZH 2NY2B 4MDRA 4IS6A 3HCVA 2EYSB 3HFFA 3Q8FA 2VISA 1JVOA 4BFRA 4K8RD 2Y36L 3UEQA 2GHWB 2OP4H 2VN3A 4J3OH 3V8OA 3ZLQC 4OLVL 1J8HA 5HVGB 3K6FA 1YQVH 2NY7L 3O9WB 4G6JL 1BSIA 1KYOK 2NY4D 2P46B 5E4AA 1HIMH 1C08A 2VXQA 3K4AA 4RIRB 3RIFF 4TSAL 1FIGH 5EZOH 4DQOH 2NNCA 5I8CA 4P49A 3FUFA 2WAQA 2ZKHH 1LMIA 3ARPA 3KL3A 3O0RL 4ZFOL 2YGNA 4ZFFB 5CLXA 3GF8A 3QEQB 2I9TB 1G1YA 1I1CA 5DJZB 3VXTB 2EXWD 1U3HD 3HBQA 4IQHA 4RMTA 3WXVH 2YAPA 4K9EC 4X80L 1NCBL 4Y1AD 3S88L 4UT6A 43C9B 4BZ2A 2CH8A 4W9EC 5D1XB 3CXDL 4IJTA 4NHUB 1FE8H 2XVKA 3OKLB 3MUHL 3WY4A 5IQ7L 3ZE0B 1L0QA 1ACYL 1QVOB 4YSUA 2CO6B 3MACL 3NCBB 4HSAC 4OF7A 1MHPL 2WWMD 1DBJH 1EFXB 3HHMA 4HD5A 2YC1B 4U4BA 3SDAB 4QJ5B 5DZOA 3P02A 4X9GA 5JYMA 1HCVA 2X1OA 2DWDA 1MREL 3OKMA 2VDPH 4RMUA 4ZX4A 3ZR6A 3MN8A 3I6GA 3N1FC 3CFTA 3US0A 4MXWL 4TQIA 2AP2A 4OQ1A 4APQC 1WRFA 3PU7A 3VFNB 1FVDA 4DN3L 5AVQB 4P8QA 2P5WD 4ZSOB 2F7QA 4NT6A 4LLDB 4U7MA 3ESPA 4H25B 1UB6B 2E86A 4X80H 2DLGA 1A7RH 4OU3A 1AHKA 1R3KA 3OSVA 2JXMA 2CMRL 3L17A 3ARGC 3NSDA 4NO0D 3FO1B 3ZDYF 1DLHA 4MLIA 2J73A 2VO5A 4HUXA 3N0PB 2BSSB 2ATPB 3FRUA 5I1LB 1MNNA 1ACYH 1DBBL 3RVUC 4HZLA 4GS7C 3JV5A 1XR8B 2VR9A 3R19A 4P5SA 3MX0B 2IAMA 3GM0A 2B20A 2EEDA 4PJ8B 2W9EL 4L3AA 2ZJSL 2KLRA 4LSVH 4N0UE 5MI0B 1KELH 5CGMA 3F7QA 4NO5B 4Y2DB 2L7EA 3AG1B 3AJ7A 3C75A 4A2GA 1GS7A 1NMBL 2CK0H 4KQ4H 5KSUA 3AW5A 3GPEA 5B38A 1FWXA 2MPAH 1KDJA 3CK0H 4WDIB 2FHFA 4H1LG 3MUY1 1BDYA 4FOMA 5DUPH 1HH6A 1Y1UA 4JGJA 1HNYA 2VGLM 1TJIH 4ONFH 5T5FH 2YK1L 2CM5A 2O6CA 3MA9H 5ACMA 5KSBE 1LK3H 4H0HB 4NRYB 1OEZW 3TVMD 2BSDA 4TUJB 3E8UH 3QZBA 3MLVL 2NYYD 3QISA 5E2TH 1YJDC 1T22A 2CCLA 2BZ7A 2NNAB 4FXTA 4MJ4A 5LBVA 4R0LA 2UY7A 3L1OL 3UBXB 2NY6B 2E6PA 3VI3A 2YPLA 1F6FB 3LQAH 5GS0C 1PL3A 3VXSA 5A43C 3KW8A 3N43B 3V4PA 4HKZB 2R2EB 3O3EA 3EJZD 1P1VA 4NKOB 4WU7B 4BK8A 2OMVA 4KAQL 3GMQA 5F97E 2VDNL 3QO1B 1FNAA 3OKEB 3S4SB 2BM3A 3GMPB 5INDA 1HQRB 4Q6YA 4JQVC 5DQ9B 3VTAA 5J4MA 2KKQA 1C5BL 2V6HA 3IGAA 2IH1B 3RAJH 5D7HA 4P3WA 2A4EA 4GW4B 1P4LB 3WUWG 1LO0H 1CCZA 5DEFA 4ALAH 4I18C 3ILDA 2JH2A 3LTVA 12E8H 3LN4A 3T65A 2EH7L 4GW5B 4QCIA 2DS4A 1JGDB 1J11A 1XIWD 2L4OA 1S9WA 3DOHA 4FLRA 3IDJA 3FQXA 5JMRA 2DTMH 2ZPKL 1VIWA 4KFZC 5CBAB 5JORB 3KLHD 1VKXA 4TQEL 1CR9H 4X7CC 3SGKA 4XO3A 3SKJH 2EDWA 5E4OA 2H26A 4I1PA 4G1MA 3KDMA 5F7NC 4ZX5A 3OKNB 1L9QA 3QDGE 4G3YH 2HLFD 4OF0A 2BK8A 3OGCA 3MLYH 4ZD3H 3K6SB 1U42A 2LLLA 4PY7A 4RMWA 4YX2H 4PS4L 3ZVVA 4Z7WE 1GGTA 4W4NA 5EBWB 4PRHE 1X9RA 4GSRA 4JHWH 4DEUA 5F8QC 2JKJA 4K15A 3CFJB 1HQ4A 2HYMA 4N2HA 4CA4A 1E4JA 2XIIA 3GRBA 3EADA 3RGVA 5AD0B 1MFBH 3ATEA 4WSKA 1IEBB 1E28A 5E1HB 5I18H 1XCQB 4PMEA 5D1ZD 1G4MA 1UGKA 3GMMB 4G9FE 1JI1A 2XQBH 3C2AH 2DIEA 4WNJA 1L9OA 2D31A 5JNYB 4UBDD 1X7SA 1MNUL 1INQB 4J1UB 1YEDA 4RWYL 4Z7UB 4NNPH 2RFXA 3H4HA 2ATKA 2A99A 3RX7A 3L3KA 4LCYA 1J05A 4YSCA 5EOTA 3NIDB 4L5FE 3F00A 4TRPH 3AREA 4E9YA 4LVNB 3QWNA 1KJVB 1KTLA 3RDTA 4PJDA 1AR1B 2IBBA 2YAFA 5D7KD 3KM2A 3DHUA 3X13B 1DUZB 4H1LB 5HHOE 2G9HA 3NFPB 4HAKA 1I8IA 3G6AB 3SKNA 4JJ5A 1I7ZB 4PWKA 3H3BC 4BEIA 1JCVA 2WNKA 1HU8A 4GP4B 1ECYA 2DQHH 3BWZA 4I3SL 3DLQR 4P2OB 1TZHA 2Y22A 5B7MA 1UXWA 2HX9A 3LRHA 4PJDE 3UEZA 2F5BH 1ZLSL 4TOYL 4FQQB 3DYMA 4OD3H 3V6OC 4CMHB 1D5MB 4M56A 4JE4B 1SDAB 1OPGH 1ZWIA 1Q0YH 5EWIH 1DANT 1RZGA 4KH2A 1SN0A 3PCYA 4HSQA 3STLA 5DTFB 2EVIA 1ZEAH 5I76A 4C8XA 3WFCH 1OY3B 3VXNB 1PZCA 4PW3A 1YYCA 3ARVA 4AEEA 5AOLA 1PQZA 1Q9WB 1C7SA 2GC7C 4U6XA 2FQDA 4IEFB 1LO5A 3C08L 4LRIC 1HS6A 2KERA 3IFPA 1FYTA 3VFWB 1CYWA 1YY8A 1QSFB 3S8FB 2BJML 1OE1A 5ANMB 4LBEA 1WFUA 3F2LA 4NQCD 4P4RB 4BDVA 4LKCB 5TFSH 2XWTB 2Y1ZA 1KGJA 2ID5A 5DMKA 2FLBT 2EDTA 2X9XA 5CGBA 2XZQL 1BD2B 3E0GA 1S3KL 4JKNA 1AD9B 2Y5QA 3L9EA 1RZ7L 5IEKA 3H1ZA 2EXYC 1G9EA 5G4OA 2CLRB 2L8AA 2I24N 3UTOA 1KCSL 2NW3A 5JXAH 2ZOTA 2HJFA 2UZPA 4XPAH 3MRDA 3NIGE 5C07E 3MQIA 3TF4A 1HHJA 4EDXB 1FNEB 4L8BA 4YVUA 5G5DA 3VFGL 2A9BA 1KENL 2YAEA 3OM3B 1ND0B 3KVPA 4N0RA 3EJRA 2IAND 4N1EA 1ASPA 3ZYZA 3JTTA 3IFNL 3OF6A 1J1XH 4Z1PA 4WTZG 2BRRL 3FU9A 1ETJA 4F9LC 4PS7A 3ZDXE 5LXGL 3DO3A 2XFXB 4BZ1A 4TN9A 4ZPTA 4ZUSB 1U3HC 4YBQD 1S8DA 2XZQH 1KLFA 1KBBA 3Q2WA 3CCHA 5D70L 1F56A 1CD9B 1CICB 2LE9A 1Q94B 4R3SA 4B7LA 4LRIA 1GHFL 3U82B 2W65B 3LXUX 4FQCH 4QOKD 2DJMA 3RWHB 1YLBB 2X2JA 3BI9X 4R2GD 1T66C 4Y9FA 3IJ8A 1B4TA 4DKTA 3IWVA 4XAWH 4I9WD 5JIMA 3BUYA 4K94L 4Y4HA 2BP8A 4LCWD 1B6UA 1LYQA 2J55A 4IKNA 3IFNH 3SYCA 3HI1B 1GSMA 5J6GA 4HS6B 1XXFC 2BRRH 2VXQL 3SKMB 2A74C 2ADYA 3KL0A 4N4YB 2R2BB 3DGCR 1L9MA 2EXSA 2PW2A 2VLRD 4LHJB 2X4PA 1TO4A 2VXTH 4XNUL 3V0GA 2FEDD 3IKCB 4H40A 2AABL 1ZE3H 2XN9B 3QQDA 4IYKA 4UT6L 3KPSB 3KBFA 5KBLA 2C4FT 4DGIH 4WHCA 1AS7A 2VO8A 5ECGA 2PLTA 4G5ZH 1IAIH 4I77H 1CFTB 1N3NA 4L1LA 5AVRB 5T1LB 2JCWA 4UB0H 1X5AA 1PDKA 4WKZA 5FWRA 4WFHE 4PJIA 3WY1A 2BSRA 3NSFA 3VCLB 2AKRA 1KTDB 3UPAA 3WO4B 2WQXA 5C9JB 4Y1AA 2QLYA 4U2ZA 5EUKB 3ARBC 4FZ8H 3SD5A 2YGQA 4FI6A 3MBEC 3QWOA 1A9EB 2ZONA 1KGUA 1M7IB 2VN7A 3QCVL 3DHPA 1E9QB 3KYMA 3CBJB 3PP4L 3AM8A 4PJIE 3ZE2F 3KWTA 4WUKL 1M7XA 4DGWC 5FHBH 1SJHB 2OM5A 1YSOA 4OCYH 2NY1D 1UJTA 3EOYG 3ULSB 3H8NA 3L3IB 1OP3K 3TVMC 4GRWH 3WEOA 3D6GA 4QRPE 4Y1AE 4DVRH 2FBRA 4Z0XA 4C47A 4JKLA 2B14A 3BHBA 2NYYC 3JWNG 5SX4I 2EADA 1KACB 3IJSA 1YY9D 5E9DD 5DJYB 4ZAKB 5SWZB 2A74A 2DQUL 2AVGA 4GEJA 4AYEC 3TBTA 4XX5A 3VI4F 2P5WA 1I8AA 2VDMB 1UWGL 1S3RA 1ZCRA 5ILTH 1PZSA 5DFAA 4PBXA 3ZMNA 1MHCB 4E5XB 3EJZC 4XXWC 3ZQXA 4S1SH 4HJGA 5DJ8B 1TQUA 2VOTA 4NO0A 2QZQA 5EHFA 2NCEA 3WNLA 3VU2A 3BQUD 4V2CB 3BYTA 4NQDE 3PP4H 4M6ML 5CIPA 4HC1L 43CAB 2O5XL 3EGXB 3KGSA 5T3XH 4X6FA 2GABA 1P4BH 4HFWA 1ZJAA 1U93B 4Z0BL 1NIDA 4OI9A 5KBDA 1U8JB 2VAJA 1E4XI 3OG4B 1RK1A 4GKNA 1I8MB 2A83A 4D8PB 3HPLA 1B4LA 4YQXH 1NDTA 3FT9A 3DIVA 3DX7B 5EUOB 2DQUH 1RSFA 1MHHB 4NKDA 2NXZD 5MEPA 4GRLB 4EBQH 3FUIA 2W60A 5GSRA 2CWRA 5DFVD 1EHXA 3ALXA 1U91B 3QIUD 4QHPA 3LKNA 4L8SA 3KJ6H 3KLHC 4QRTB 1KXVA 4LEXH 2FEEI 2FYYA 1LEGB 2GB2A 3QA3A 3QGVA 3M1CA 4HWZB 3UMNA 4JPVL 1JFQH 2H6OA 4HVBA 2BNUA 1FO0A 3F12A 1UZ6E 5HJDA 5HI5C 1RZFL 3DMMB 4Z6AT 5I17B 2HLFC 1SJXA 3OB0K 3PQYD 3T6QC 4AGOA 5FA3B 1IGIL 2PTUA 3B9EA 1IGYB 3SE6A 3WJMB 1K4CB 8FABB 5IMKB 2EEXA 1NBYB 1I3GL 3MI6A 4OCXH 1WZLA 5I5RA 5MEND 1AVAA 2Z4QB 3V4VL 5A6IA 2WKOF 5KVEE 5IHLB 4QNPF 2OMBA 2N1TE 2IOIA 4OF3A 1OGAE 1MCBA 5AZEL 4KY1L 1OCWH 1KBGL 5D1ZC 2RCSL 1IM9B 3UDWA 4MZ2A 3N3EA 1HL5A 4TVPH 4UBDC 2P5PA 3HRPA 3UADA 1TDQA 2AJ3A 4PLNC 5J6HB 1QPPA 4BFFA 2VDRH 1YYLH 5GRUH 3LH8A 1QFWH 2IQ9L 1KGCD 2BSTA 1TCRB 2E9JA 5E00A 1MJ7L 3F7YB 3ZO0A 4MAUH 1EMTL 4YXKL 1BFVL 3KPRB 1NC2B 1R33A 2WBJB 2IMNA 6PCYA 1NGXA 5DI8A 3PL6C 5CZRA 1CLZH 1VGKB 3HAEG 3QPXL 3B7UX 4GQRA 1KNOA 5EO9A 2OL3L 5TJWK 1XIWA 3QDHA 4Z7VE 4WTWA 1L4IA 1SXBA 1O7SA 2XRAH 5B21A 1WEJL 2CALA 3UTSB 3IN2A 2HP4A 1KEML 5DWUH 3GGWB 5C0DA 4J6RH 3SJVD 2YARA 3B2MA 1KBGH 3D4YA 3QQ9D 1EK3A 1HVXA 3LS4L 2D0GA 4IDJH 5MEQB 2MCPH 1ESOA 2BPBA 1RHFA 2NLJA 2VIRA 3DTUB 3QHZL 4UQCA 4PRID 2PCPA 1JG9A 2Z0BA 2FT7A 4NJ9H 1FZKA 1SJVA 3OZ9H 5I16B 5HHPA 4XPGL 2MOVA 4U7SA 4YXKH 2YWZA 4YGVB 1IT9L 1PYWA 1INEH 1WD9A 1XSKA 2HRPH 4GT0A 1BJ1H 4OV6F 2YKLH 4TLTA 1S7VA 3WIHA 5F1KC 1QX1A 2PCFA 4LLUB 1R3HB 5D1ZA 2P24B 2OQJA 4Z78B 1ZGLM 1GKOA 2XIDA 4OKVA 4X0KB 1JZGA 5F7EL 3ARFB 2CKBL 1CLCA 4YDMA 4LQFL 1RZKC 1HKLL 1KEMH 2FBJH 4NN6C 4IRZH 2W9DL 4HZ1A 1OT2A 1CI3M 4WO4C 5K39B 1SZNA 4L0YA 3MOBH 3TPKA 1XGYH 3NGBB 2SEBA 2A1WL 1UUSA 5GJTL 5E5LA 3K5RA 4NN7C 1LEIB 2J88H 5JIQA 1T1ZB 1JV2A 4M9PA 4L8CB 2WCGA 5D6CB 5T1KB 5CLWA 5I1GL 4QHLA 3EGDB 4P59H 4XP4H 1MCFA 1OGSA 1IU1A 2FRGP 3LKPB 2QBWA 2G2NA 5A7EA 4JN1L 1YN6A 1IBZA 4UUJA 5IBTH 3KLDA 3HRZC 4ZUTA 4LASH 2APVA 4LKXA 1JZHA 3TBSB 2CKBH 2HT3C 4MJ6B 3LIZH 1W16A 4B9JA 4KZDH 2HLEB 4M7JL 3D08A 3GJFA 2W91A 3S96A 5J12B 2WK2A 3E3QC 3EFFA 5D7IF 4AMKL 2QKIA 2AJYH 3L3HA 3CIQA 3EYUH 4PRPE 2NX5B 2A1WH 1JBJA 5GJTH 4GLRH 3BEWB 1H15B 2CHDA 4XNZB 5DS8B 3HC0B 5F0LB 3LNDA 4J3TA 4CVZA 4LSSL 4Q74A 4UAOB 4B95C 3WTYA 3WTVA 3EJPA 4E9SA 1CL7I 5F72S 5T5NG 1DJWA 1DO6A 5JZ7D 3ZQ9A 4FHKA 1T7ZA 1B0IA 4NQCA 5FW6A 1NIAA 4EIBA 3CIAA 4J3UA 1DFXA 4MXVF 1TCMA 5FGRA 2M2DA 5BXFB 1J9SA 3RFZC 3V6ZB 5B3JE 1NGZA 3ZZ1A 3BKCL 3IFOA 5BS0B 5I0VA 4ZUVA 3GDBA 1MY5A 3QH3A 1U8OA 3BP5B 5KWYC 4HCRA 4PBDA 1KZYA 1A1MB 4OFYD 5DD1H 3RL1A 5EZPA 2Y24A 1KIQA 5K5YA 1OCRB 3NZSA 3VFUA 4RGNC 1A5FL 4ZQKB 2IANA 3LQZA 2DDQH 3H7BB 2HWZH 1HXYB 3EUUA 2NXYC 5D1ZI 3HRZA 2C9AA 1CE6B 3UTZB 2FSDA 2YUXA 3H9SD 1EGJA 1T89C 1SEQL 1KLUA 3QDMD 5FKAB 2NUTA 3W1ZA 1E4XL 5I1IH 4LAQL 2A4ZA 3V0EA 4WW2B 3CVHH 4YSSA 4XWOD 2WY3B 1T7WA 5D4HA 3D25B 1GSKA 2BVYA 4MCNA 1KC5H 4EPSA 2IANE 3U1QA 3KPLB 2IGFH 3UGEA 5JPMC 1X5JA 5AVVB 1X5IA 3GSWA 4BYHA 1WV7T 3P9MB 2NY5L 4MA1B 1AXSB 1ZSHA 1G7PA 2R1XA 1P1ZA 5JIDA 1HX0A 1MFUA 2EDHA 3X14A 4ACTA 3W38A 2BNQB 5HVHC 4QOKA 4MB1A 3E3QE 2BOLA 4KH9A 4XNQA 4WK4B 2DQTL 2ZCLH 5DJ2B 2NY1C 4K8RL 5BCAA 1W91A 2DN7A 5KYWB 3JTSB 4LCWA 1J9TA 3B5GA 3AWGA 3RUGE 1FZJA 1N2RB 2ZX7A 1YEFL 1ZSDB 1ZJBA 4XBMA 1F13A 3E2HB 4R6UA 5TD4A 2WZPD 4OUUA 4FQXC 3EBIA 1KFAL 5KBMA 3GK8L 2ESVB 4HYTB 4FNRA 4V33A 5FO7B 3UCRA 1GY1A 2VLRA 1O5DT 4KV5E 4OD1H 4PGEB 5DHVH 1X7QB 1PPIA 3DWTA 4Y4FA 3HNVH 3RYMA 4I9WE 4FFZA 4AK2A 1UACH 2G3XA 1Q9LB 1BBDH 4XZUA 5T1DH 5KSBF 1JMZA 3EG9A 3B6SA 4B9FA 3IJYB 2IDQA 5KZCB 3VD7A 2VLRE 3CZLA 4TV3A 2JTYA 2VITB 1YO4A 2CBMA 3EBHA 2N0MA 4PCYA 1CXEA 2DQDL 3MAWA 3V0VB 4NCC1 5IGXL 2XPGA 3CNKA 4WI6A 1P69B 4H8WH 4PTTB 5I6LA 1NGQH 3JWOL 4XNYH 1CI5A 3VGFA 1GYUA 4J3OG 5GXBB 3PHQB 5F7WC 3SY0B 4WKXA 1DFBH 1ETB1 1SVCP 2RIKA 1GZQB 1G7IB 3I9IA 1KJ2B 1DBKL 5L4FA 2WLMA 1UCTA 2P49B 3S6CA 3O6FC 5FW7A 5GGUB 3UJTL 4M4RB 5JW4N 4ATWA 4M62H 2EO9A 2WZ0A 4AGLA 2J43A 5AW8B 4IGBA 4OJCA 3AT8A 2WNGA 5D2LA 4JDZA 1V10A 1UASA 5AAWA 5E9DA 4DPRA 1DL7L 1CQKA 3ZL2A 3X12A 4NFCA 2E6QA 2HAZA 2HUHA 1AO7E 1D7CA 2ZG3A 3SGEI 3AS3A 1DE4B 2DWEB 1C5DA 4PV1C 5FKPA 3KGTA 3OKDB 3CX5J 1KBPA 1EUUA 4AEHL 5A2LH 4JFZL 4PLJD 1XEDA 4POZD 5E2JA 3BFWA 5JOFB 4N25A 4HEMA 1AGFA 1CB4A 2JIXA 1DYZA 5E9DE 5F71A 2X4OA 1IAKB 4MQSB 1ASQA 5L88H 3BQUA 1NL0H 1PG7H 1WYJA 1EBAA 3QFDA 5HYSB 1X5KA 4W9DC 1G9HA 1OHZA 1E90A 4H5SA 1IQWH 3DUUB 3PUCA 4Z7WF 1QKZL 1KCRL 4UOJA 3ZYJA 3B2PA 1MRCH 3U2SB 3T2QA 4NFDA 4HEME 4NN5C 2FO1A 5C92A 1QATA 1ZTXH 1GYAA 5AZUA 2W59A 2CU9A 1SJEA 4J3VA 2HVKA 3RVTC 4E0RA 1GZHC 2XUWA 4YZFE 2MH4A 2ADJA 4FF9A 2W81C 2XN2A 3QIUA 5EEXA 3ARSA 1RIUH 4JZOA 2EUVA 2GJ6D 4KZCA 4ORZC 1IC1A 1UM5L 4LPVA 2D9QB 5FK9A 1V3KA 2C1PB 4LL9A 3GRWL 5C8JB 1TF4A 2EECA 2GK0B 3WEAA 5JR1L 1AG6A 4DO5A 1LO3L 3DVNA 4ELMA 4X6EA 3HKZA 4ADIA 2JK5A 5E56A 1XGQB 3LPFA 4KO9A 4PQXA 4Y2OB 5FUOH 2J12B 1OP9A 1TG8A 2WQWA 3RNKA 1VESA 2YMXL 3PQYA 2DQ6A 1HI6A 5E23A 2IPKB 4FXKC 3UJJL 1A7PL 4L3FA 1FNSH 1FORL 4HUUB 4XC3L 4K3GA 1I1AB 3U7WL 4H7VA 1MW3A 5EIQA 1HWWA 2BFGA 2G0LA 2K78A 5MENA 5CN2A 3ULVH 2YD9A 4YEFA 4A1RA 5ETUB 4AQAA 32C2B 1N5AB 4ELME 3D2TA 1U8KA 1C5CH 4X9BA 1T6VN 1KY7A 3L48A 4X7TB 3RWCA 4XMUA 2DKSA 3AB0B 3PQYE 1CS6A 4DKEL 4WNQA 4OZIF 4PGZA 4WV1B 2ZUTA 4BFIA 2EKJA 2F19H 3P0GB 1OTSC 2LTQB 3RPKA 3CUPB 5IR1A 4DN4L 4G8IA 4OGYH 3JQOB 2R69A 2AZUA 4AVJA 2VABB 4NXKA 5H2BB 1NKGA 4TVSa 4FYSA 2E56A 3IAPA 3G6JB 4WW1A 3TO2B 2YMXH 5IT2H 1E40A 5EC1A 4WVRA 2A9MH 4Y4KB 2DQJL 5CILH 3II1A 5AOKA 1OB0A 4FQLH 3U48A 3U9UB 2IWKA 2OW7A 1D5RA 5LBSH 5TDOA 5DK3A 5FYJH 1KGCE 3KM1A 3IF1A 4G8GE 1O7VA 5JIHA 3VB8A 1P2CB 3VO0A 2XVGA 3SJVA 1DQIA 1N64H 3OR7B 4OF8A 1P7KA 3G08B 1N8OE 5FUZH 4DKEH 3CLEL 1I3RA 4PB0L 2V33A 4R4NC 1UT9A 4JB9L 1N19A 1XGUA 1HTYA 1EQWA 3LS5L 5C7XL 4PRIA 1NCTA 5T1MA 1U36A 5DJ6A 5ESQB 4MCYA 3CSFA 1MHEB 5K59E 3NACH 1UA6L 1IGFH 3CVDA 3SJVE 3NIGF 3C6LB 4KUZH 4TNVK 5J9PA 1A21A 5I1AA 3O0LA 5ABDE 4BCXA 4QGTA 1UADC 2X3BA 4OD2B 3DRQA 3TH3T 3AXLA 3QNZB 4AYMC 4HLJA 2CD0A 5I8OH 3VFMB 1QBBA 4UIMB 1IIKA 2R1YA 4LK4A 5C3TA 5GRJH 4DVBB 3NCEB 2PO6B 1JHTB 2WXMA 2BIIA 3UXFA 5HY9B 5JW4Q 2OULB 4HGMA 4QHMA 2IPUK 5JZ7C 4PRAA 5DXWA 4ZFOB 5AKVA 3AQDA 4KJPC 2HMID 2BP3A 5DFWH 3HB3D 2FWOA 3KH3A 3VFPA 2LGNA 4N2FA 2OSLA 1TTRA 4RRPM 4R4BB 5BVPL 3QZWB 1KIUA 5IVXB 1Z7JA 4F8OA 3PXLA 3KXFA 3DXAE 1HHKA 1Z9SA 4KTDL 3MNVA 4H26B 1JF6A 5DT1L 2VLKD 3VUAA 3WJJC 4EF3A 4KUCD 5DD0H 5I9QC 1GGBH 2I85A 1NIBA 2VKXA 4FNTA 3JTBA 1HSBA 2KZWA 3NH7H 3GXPA 1FN4A 2Y6SD 1I8KA 1ZV5A 1IBHA 2M8XA 3CZFB 4S2SB 1PG7X 2O5YH 1S5HB 3AMKA 1UM4H 3NCXA 3QUKB 3W2DH 3TYFB 1VFAA 2C3VA 3QORD 3DIDA 4D9LH 4ZS7L 4O2EB 7PCYA 3D0LA 4HUVB 1CU4L 3GSRA 4X6CF 4ODWB 3D2UB 1LDSA 1Y18A 4P07A 4QTHB 4PJ9C 4O5LH 2JV6A 2X12A 5E7FA 1P4IH 2B2XL 5DQJA 1TZOA 3ULUH 5E70A 4HCRL 5IJBC 3TFBA 3KR3L 4B41A 1J0JA 3T9WA 5JLZB 4KZEH 3HUJF 3I9PA 1RK0A 2KC0A 4PJXB 4KKCC 4JY5H 2DH2A 3SDDD 1O75A 2Z3FA 2LLGA 1MCHA 4PBVC 5E2WL 5GGRY 4MASA 4R83A 3UTPD 3DPDA 4PW4A 4DKFL 5JQIB 3S9DB 3VMPA 1KIPA 1AMXA 1P84J 3MRHA 5TE6L 5MP6L 2E7BA 4UTBH 2HVJA 4WWKB 3QQ4A 2QQLL 3O45B 2DL9A 2YXWA 1JWUA 4XVJL 3K7UA 5CXPA 4ZW8A 3WL9B 3T4YA 2O4EA 3CXHK 3KYNB 4PS8A 4OFYA 3GI9H 1SXAA 2O5NA 3K71A 1JNLH 1MAMH 3VG0L 3NCCB 4YSPA 2ADGA 1FBIL 1D9KD 3D39E 1WDAA 3STZB 4E41D 3GKWL 3GEWB 4YDVA 4BHUA 5AG9A 3H9SA 1TJHL 1JTPA 5AOZA 2FTAA 3TEUA 3U0PA 2AGJH 1J0HA 3W0WB 4XCNA 1O6SB 5EU5B 3QDMA 5E08L 1B2WL 1BLNB 3FTSA 1LMKA 3CZNA 2NNFA 1Q72H 1UEMA 3HOGA 5F9OL 1MVFA 1EVTC 2XWBA 1IGTA 3M6DA 1MW2A 4NERA 3UBHA 5BMFL 1QR1A 2EDJA 1FG2A 4XBGB 2R4RL 4ZTEA 2VDNB 2E27L 2PYED 3O3BB 3ARQA 3BIKA 3QYCA 2PWGA 1BZQK 2B4CL 2HLAA 2OX5B 2BINA 4XXDB 5DEGB 5HI3D 4JO4H 4X6DA 2P45B 2RALA 3QDME 1NCCL 4P4KD 1YYMH 3PWPD 4ZFQA 3MXVL 3DTDA 3L9RB 5DUMH 4BV1A 1UXSB 5ENWA 3TH4T 3ZHFA 1DJYA 2X4TA 4AQ1C 2ENQA 2NW2A 5IFAL 4FHBD 2IXQB 2JMRA 1Z6JT 4X2UA 3KMDA 1OW0C 2VM3A 3RBGA 2PXYD 1XR9A 4JG1L 3H2QA 3MLTA 4NBYB 4OQTL 1KXTA 4AGMA 3M86A 3JWDL 2X44D 1FVCB 5JUEH 1MCOL 1HL9A 2XXFA 4OTXL 5B39B 3T1WA 1U8LA 3WFZA 1BAFH 1XSOA 5F7YC 2IV9A 4G8EB 3X11B 5EB9A 3ZL4H 2JJTC 5A1AA 1Z66A 4H2AA 3BMWA 2B16A 4R7DB 4Q6IC 3ELQA 3QUXD 4NXSA 5K1NA 2XBZA 4XRCA 3UJIH 1VZIA 1BLIA 3V5KA 4LGRB 4OZFB 4OLWL 2VXUH 5D6DA 4Y5YB 4NZ8A 5SWSB 4D9QD 3U79A 2Y7MA 1DQVA 5H35A 4JPIB 4H2CA 2V5SA 3X3FL 4PTUB 2OZNA 1ZY9A 2WVVB 5IQ9A 3SQRA 5IB2A 4PJCB 5HYJB 1DVZA 4HBCH 3GB7B 3FTZA 4KJYB 2Y7LA 1KLGA 2C1OA 3DTXA 4YPGA 5FA4A 4XHJC 2LAGB 3QUMH 2C4XA 5KN5B 1W8NA 2VDQL 5E8OB 2DI7A 5F70A 4JFYA 3LMJL 3TX4A 1G87A 3QIWD 4MJ5B 2FJGB 5BV7L 1PX3A 4TTDC 2E7DA 1A4JA 5GRVK 3AU0A 1VLXA 2NT0A 4C54A 5IROD 2GSGB 3HMXH 2FX9L 4OLWH 3AWEA 2V2WB 3CHXA 1XGRA 4BHUI 1MWAA 3FOLB 4B9GA 2OI9C 2XTJB 3TYGL 4ZMZA 1KJMA 1D6EA 5JPNC 3S97C 2P3YA 5FHAL 2H2PD 3GSNH 4UV4H 1KPUA 1GZPA 1VGEH 4GW1A 4Z7VF 1V7NL 2BXYA 1E5YA 5LLIC 1EHNA 3EF7A 3MV01 5DVMA 2HPTA 3A4EA 1N5YH 4HKXB 1A3LL 1RLWA 5FC9A 4PGBA 4AUUA 4KPHL 5EBLA 1S78C 5IHZB 1U8CB 1DBMH 1I7RB 1INDH 4RMBA 2YSTA 3HC4H 1NANI 5ERWB 1KCVL 3KPQB 5EU4A 1NJ9B 4RFNC 1N6VA 1PW3A 4KNUA 1A14H 1JPFA 3QNYA 1J1OH 4Z7QB 5I0DA 3P0VH 2NZ1A 3FONA 1I1RA 4JR9L 5FDWA 4UNTA 1M7DB 3PDOB 4JUSA 3IFLH 1KZQA 1EUTA 3N41B 1BF2A 4JKKA 3G7TA 4HCFA 1QHQA 2WM0A 4KX9A 3V0DA 3HZKB 3QEGL 5CMAA 3SPVA 3S35L 4CVUA 5BNXD 5JW4R 3RTQB 15C8L 4OCMC 3IDGB 2R0KH 2J1WA 1U8MB 4KQ0A 1R19A 3BAEH 2WIIA 4NZTL 4AIOA 2GJ6A 3V95A 5IHUH 1OD9A 3O6LH 3FU7A 2BNRB 5LWYL 3B7RL 5AFAA 1XBRA 2J71A 5E2UL 2CXKA 4M00A 2ZOLB 3ATAA 2GJZB 3I02A 4KPHH 1LWHA 5ISZD 4YSRA 4X9HA 1H3WM 3PG2A 2PTTB 4J7RA 5G55A 3KJ4C 2F74A 2J6EA 5AVWB 4G2AA 3T8XA 1G9MC 1Z5YD 3FSOA 4L9LC 2BY1A 2R69L 2JELH 4JFWA 4Q9RL 2BC4A 4ZPVA 4JR9H 4XO9A 3TIDB 3H42L 4YHML 5JQ6L 4GRMB 1FZMA 4JL1A 3LPPA 1QQDB 3TN0B 15C8H 4AC2A 1OLZA 2H9GA 1BQKA 4UNVA 1LJMA 5A6LA 1RUPL 1QP1A 4I0KA 5DRNB 5CEYA 4UIKL 3V79C 4EUPB 4NZTH 5I8EA 3OMAB 2VUOA 5LWYH 5HPMB 1JF1B 1U41A 3NJVA 2VC2B 2XG4A 2QVKA 4GIOA 1PZDA 3L1FA 1F8TH 2LOEA 2BSCA 4DP4X 5L2KB 2VMEA 5EC2B 2HMIC 4ZMNA 1ZGLB 5AYQA 4P5MB 4KRPB 4JM4H 4QHUB 2OYLA 4Z7OF 2DIJA 5D2NB 4G8FB 3US1A 3VXOA 4BCYA 3Q7JA 4NBZB 3S5LG 4LOEA 3SZ6A 1MI5D 3LJ3A 2WQAA 4ODXB 4JKMA 4PJ7E 2Q3AA 3ZTCC 4PJHA 4IS6B 3HCVB 2VISB 3WMPA 3BKJH 4CJ0A 2WYZA 4ERSH 2AQ1A 1J5DA 2XOTA 1GIGH 3O2VH 3EHBD 4JQXC 4XC1H 3INUL 1J8HB 1WFIA 2FSEB 4G43A 3TBVB 4DO6A 2ARWA 2ZX9A 6FABH 2ZUQB 4JHBA 1OE3A 5CUSL 1KYUA 1X9LA 2CDGB 1GL4B 2Y6SC 3NZHH 4EIGB 5SX5H 1D5IH 5JDJA 3R1GH 1WA0X 4PH8A 4WO0A 5B1JA 5IB3B 2K7PA 5I8CB 4X5RA 1KYFA 1UWXH 1ONQA 3ZPDA 3QORC 5IIEB 4L4TD 4NZFA 3RVVC 4R96A 5HVWA 1YEIL 4AYSA 4QLRA 1I7TA 1CDYA 1G7LA 2VM9A 3P77B 4JFDA 5F2FA 4YHYC 1NWOA 4J23A 2NY2D 3JV4A 4CKVX 4OIBA 3VE0A 3WS6A 1N0LA 1PFOA 2BHUA 3WN6A 1OOAA 5GGTA 5D7SH 3EOTH 5DD3H 5I26A 1BZEA 3WIAA 1DQJB 3CMOL 2V3EA 5HYEA 1IGCH 1OOWA 3QDJE 5AKSA 5C08A 5DMYA 3O9WD 1LO2L 1SLWA 1EHAA 3AWFA 1WZ1L 2DBLL 1U95A 4MKMA 2BSED 5J89A 5DA4A 5LO7A 2Z0UA 3II2A 1K8IB 1XFPA 3BLBA 2YRPA 4B6ZA 1OAUL 1G7JA 4H44C 3RB7A 4LSQH 4UWQB 4KXCA 4ZOEA 1Q9OA 3D30A 4JO1L 3GO1H 1O0VA 7PAZA 4NO3B 5KYXA 2R4SL 1FVDB 1DSWA 3G9AB 2FE0A 3APMA 5D1XD 1EHLL 1H0DA 1DDHA 3FQ4A 1TNMA 3WIFA 1EZLA 2VLKA 4N2CA 2JXMB 5EFIA 4GP8B 1LDPL 4JVUA 2AXJA 2DZEA 4M7KH 4NYLB 5T3ZD 4GUQA 3NIFE 5GGVL 4P23B 4M5ZH 1EFXD 2F7IA 3RUGF 2C5DC 3VWKD 2VMDA 4X7SL 1REIA 3BIAX 2A9AA 2IAMB 1LO2H 4H8PA 4S1RH 4N90D 1MUJB 2WUCH 1BGXL 2G2PA 3EGSA 3VD9A 1T83C 4DGYL 3L3GA 2YS4A 3QORA 5HHQA 2ICWA 2YFNA 1TR7A 4QRQA 1BVLA 3RZCD 1F3DH 1CZ8H 1WBXA 4J6IA 1S5IH 1RV6X 5B38B 4G1EA 3Q8AA 1XH3B 3H54A 1CYGA 4K23L 4K5LA 5HJBA 2VTFA 3D87B 2ZCHL 3IDMB 2FX7L 1FSKB 1HH6B 1MH5B 3RVWC 5AOMA 4OBRA 3MLUL 3T2PA 4M48H 4MQXC 2FJUB 3HBPA 4NZRH 2AJUL 5L2JA 4DUWA 2QQKL 1KPVA 4LSTL 5TGBB 3SDDA 4AJ0A 5DJDA 3FNKA 2IQAB 1FFQA 2B1HL 3Q6FA 3OTTA 1IFRA 1N26A 3ESMA 3LHPH 4PD4K 5A6MA 3SKOA 5D5MA 4WWID 4ES9A 4FFYA 1RULL 2JLLA 2PXYC 1RFDL 2YPKB 1AP2A 4R0LB 4LPYA 2CGRL 2UY7B 4PFEA 4DW2H 4ADJA 3PDGA 2IFFL 5TE4H 1NCWH 5JIIA 3VI3B 3A3YB 2YPLB 4Q89A 2J2ZB 3MRFA 1OAKH 4ILDA 2P8LA 2AV1B 3TO4A 1OCZB 5CD5D 4UTAH 3NFNA 1JGEA 3VXSB 1BXXA 4OVVA 1Z9LA 4YFLI 2O5ZL 1SY6H 5I75C 2ZOUA 3AU1A 4XVUC 2OMVB 3BH8A 3UTPE 3GMQB 1D9KA 5D5ME 5K69A 2LV4A 3TCLA 3QUXC 4E41A 4QRRD 4AOFA 1QFUL 2EILB 5INDB 2O93L 3LDBB 3QEUA 5IFHL 1T0MA 2AXFB 2R56H 3CH8A 1DQLL 3IE9A 5D7JB 3V4VB 2QGBA 4AENA 3HW7A 5KOMC 3B2UC 1EO8L 2NPLX 3KG5A 3MHZA 4BINA 5JHDD 2NY6D 3ASWA 4QO1A 2I32A 4H8HA 5DEFB 5K9JH 2JSFA 4MA3A 5KG9B 4IIZA 3T65B 4YJZL 2PYEA 2P26A 3LRMA 4HT1H 4QCIB 5E9NA 3RURA 4RCAA 1M6UA 1Y7VA 1FDLL 1E9PA 2B77A 3QRLA 1ZVHA 3FQXB 3PWPA 3QIWC 4P4KA 4JO2L 1NFDF 4DEPB 4ELDA 5I6OA 3CFDA 1VKXB 4JNXA 5LBGA 2JCCA 2H26B 4N28A 3UGUA 4G1MB 5AOJA 3IDIA 3TNNA 4A39A 1Z1WA 4HLZH 1D5ZA 2WPGA 4YBLB 1OQOA 2WQUA 1Q9KA 3TM6A 1CGXA 4KKBD 3MRMA 3OGCB 2D03L 5IROC 3P30H 1DVYA 1OO2A 4HOWA 4J8RA 4PY7B 9PCYA 2ARJA 1XCTA 4G71B 1HL8A 2OL3B 3VFOB 3APNA 4PSPA 4QKXB 1CF8H 1ETA1 2VSKB 3AUVA 1C1EL 1VA9A 3RGVB 4YSAA 1ZLUH 1KT2A 1O5PA 1BW8A 2ICWI 3R06A 3RI5F 1E28B 1BEYL 2H32A 2V9QA 1FH5L 2BP5M 1CGSL 1FNGA 3L08A 2D31B 3RJQB 1GCYA 4ABUA 4M5YH 4HWEH 1DZBA 3FU5A 3GHBH 4TQHA 1OM3H 2ED7A 2RB8A 1TZGH 4OLUL 2RFXB 2ATKB 4LLMA 3MROA 1NCUA 1WAEA 1Y1DA 1J05B 3CFCH 4UQDA 2KLTA 1N4XL 4OGXL 1AY1L 2ZXDA 4PV8B 3I75A 3AREB 3ME0A 4KI1A 5CBEA 3UC2A 1J10A 3E9UA 1KTLB 3RDTB 1V7MH 5DD6B 1ET7A 2OXHA 1DP0A 1GGCL 3FHAA 1DCLA 4QXGH 3FOMA 1MWAL 3OWEA 1BAWA 2G9HB 1P5VB 2VDKL 3P2BA 1I8IB 4QI3A 2LU4A 4ORGA 3SKNB 4JJ5B 3SGJC 3E6FA 4D9QE 2F53D 4R7LA 3SDXF 2PR4L 3R0NA 3QIWA 2YSSA 3QCUL 4TSCH 3OLIA 3NRQA 1J8RA 3BN9D 1UXWB 2E76C 2QSTA 2PP8A 4LCVA 4RRPG 1XSIA 1B0GB 1HCYA 1QA9A 1BF8A 4UDTA 5FYKU 1PAZA 5GHWL 5IROA 1ZWIB 2Y23A 3S36L 2OJEA 3NQIA 2XV0A 2FGWH 1DUYA 2ZTBA 3VA6A 1NSNH 2QZ5A 3WJLC 3ZIMA 5I76B 1ETZB 3QJOA 3H53A 4MJIB 3CN2A 3GS0A 4N9OB 3CN1A 3OAZH 4Y19D 3FULA 1KWGA 4D0CA 1NH6A 4U6XB 3S37L 3QJFA 1LO5B 4XMXA 3O6KL 3IFPB 1FYTB 4P2OD 1JIBA 3K2UH 4GQPH 4BKLA 2E9WA 1MOEA 1G6RA 4DOHE 3QWQB 1ULVA 3P9WB 2J21A 4IDLA 2W5PA 4KDTC 4LBEB 1QACA 4TQPA 3TP4A 2XWJA 4YO0A 4NAJA 1CXHA 4BBWA 4B9PA 1YG9A 2XC8A 5J5EA 1KG0A 4Y5VC 1OSZA 2IH3A 1ROCA 1LK2B 3QUYB 3ZKMC 5AG8A 3GKZA 1OP4A 4AIZA 5F1NA 3WKNA 1DLFL 2AJSL 1H8SA 4BZ2H 2YA2A 5A3ID 3KLAA 3KW7A 4Z3IA 3AQYA 1HHJB 3E9TA 1PSKL 3LZQA 3M1OA 4NQEE 4L8BB 5G5DB 1Z9MA 3T8MA 4QRUA 3V4UL 3IETB 2WXQA 5KVGL 2K6ZA 1I9JH 1LL1A 1WPCA 3FUKA 3JTTB 5HD8D 5GIRA 5ISZA 2V4LA 4F15B 2P43B 3CQQA 3MUJA 5KW9H 3FL7A 4PJGF 4UINH 3NJJA 3X1NA 3BP4A 3DHJA 3EDEA 4RAVA 5DUBA 1A6ZB 1CO1A 1F00I 4OIIH 3BSHA 5A2CA 5M94B 1QWHA 4ENEC 4G6FD 4K9EL 1QZ1A 1DQDH 5DJCB 1KLFB 2YD4A 1KB5L 3FH5A 1HHIA 3FC8A 4WY7L 5FX3A 3B5TA 3LZLA 2BP0A 2AJSH 3OD3A 1H9DA 5B1CA 3PWJA 2WLIA 1RSYA 3O9WC 4WUUD 4AV5A 3GIZH 3ZE1F 3CSBA 4HWBA 4Y4HB 3EOBA 4L1DA 4W9LC 4DP1X 2PMZA 4QMEA 1IMHC 3KAAA 3L5WB 4BFBD 4ODVL 2CUHA 4LO9A 4MCZB 1QEXA 2NDGA 4Y5VA 5GGQL 3IXTA 4JAMA 3J07A 3LEYH 3FU6A 4K9EH 1B3IA 1MI5A 3O2WL 3IMBA 3HG2A 5D1XC 2E46A 2ZKXA 5IOPA 2DLFH 2Z6FA 2I5YL 4P2RD 3PAYA 1B9KA 3MOAH 4GAGH 3VSTA 4GFTB 4CDHA 5AENA 4JFUA 3T0VA 5GZND 1TQBB 1MJ8H 4PJEB 1BVNP 1AIZA 3VWKC 1MFNA 3DJZA 4KHXH 3SDAC 4XBPB 3RFRA 4OJDH 2NZ9D 4JPWL 1MIEH 4NGHL 1N3NB 5DYFA 1MI5E 5EIIA 2GEEA 5E4IA 4V2BA 4WKZB 2JJSC 1JGUL 3P4NA 5CJ5A 1DQMH 1CYXA 2AKRB 2NQ3A 5D96C 1IKOP 3ALWA 1YECH 1DVUA 3N1QC 4L4TA 1LHZA 3MC0A 3Q2LA 2OMXA 4YHNB 5CN3A 1FGNL 2G5UA 3FHQA 1OV8A 1S9XA 1W0YT 4XHQA 1NGPL 1YEHL 1DN2A 5HHVH 3QWOB 3V4PH 2HT2D 1E9OB 3KPSD 3QFJD 4GMTH 3I3EA 2IBGA 2VDLL 1F2QA 2VDOL 3SKMA 3O9WA 4M8RA 1MFEL 3TT1H 4L4TE 1B0RB 2E5EA 4RIRA 1A6WH 1B3JA 2BSEA 2HA1A 2RBLA 4AJWA 1RUAL 4PJ8C 1CDGA 3BHBB 5MI0C 3WD5L 1OPOA 2J3SA 3IJSB 2ZUYA 4Y2DC 4QUOA 3IJEA 3RHWK 4KKRA 4LHUB 4ZFFA 2BWQA 2X9WA 4GG8A 3TBTB 3Q1EA 5GS0L 4F57L 1GRWA 5B8CA 2EDNA 4HIEB 5IM7A 3NJIA 3SE9H 1XF3A 5CD5C 2P5WB 4Z7NB 2ZX6A 2E4TA 5D1XA 5J1TC 4NHUA 3I6KB 3LH2L 2QR0A 1UCBH 4JM2D 4JRWA 4HJGB 1KYAA 3HTLX 4NO0B 1Q0XH 4LNVA 3VGGA 3FW6A 4ODSH 1H3TA 3BIBX 4P9ML 3VWKA 2YC1A 2E9GA 4HIIB 1VSCA 5CIPB 4OB5L 1JZFA 3KLLA 1HZLA 1F4AA 4X6FB 1RERA 4HFWB 5D1XE 4ZAKD 1YJDH 5SWZD 2EIZA 1H3PH 2A83B 2NY6C 3ZE0E 4F8TA 5AW3B 4M6NH 3S2CA 3RZCA 2FIRT 3MRNA 3RU8L 4ZSOA 3OKKA 1KDIA 4LLDA 4NKDB 3L5JA 4H25A 4MS6A 1GYWA 1UB6A 5G4NA 5MEPB 2O6PA 5GSRB 5BZDB 1QNIA 3FUJA 4HMCA 5KJRL 4L5FH 5BO0D 1MCWW 3NA9L 3FO1A 4L8SB 3VVVA 3WHXA 2MOGA 1WWAX 3QA3B 2R39A 2ATPA 3CVBA 2K6YA 3H2PA 2BNUB 1XR8A 3ECBA 4K7FB 5GGSY 1YPZA 4XCCL 4ZSOE 4U6YA 4GAFB 1GGYA 4NO5A 2QL1A 6TAAA 4CL7A 3SBWA 3ZXAC 1MSPA 1BWMA 4X8GA 3ABGA 4R8WH 5ALCH 1W72L 1KN4L 4YHOL 4JDTL 2MRYA 3VG9B 2WWOA 1ZANH 3S3JA 4XR8C 3FAWA 4GRLD 3U1SL 4F7MA 4Q2ZB 2BS71 3AGVA 1YPZE 3A67L 3MRRB 2X2YA 2J20A 1ZVNA 4M43L 4L05A 4LGPB 4C59B 4DP6X 4JGNA 3WFEH 3BGMB 4DAGH 4QRRA 3ABZA 3NA9H 2AJ3B 3TTSA 2WLYA 4F37K 1BJMA 1Q0EA 5C0AB 4XP9H 4KTEH 1JHLH 3WTSA 3HMWH 2BSTB 2RR3A 4J2XA 3CZUB 4FQ2L 3KCWA 4L29B 4N26A 4TNWK 3V52L 5E00B 5T33L 1XX9C 4ONGH 3UBXA 5JHDA 5CU5A 3VAEA 4F5CA 1NGXB 4X4XB 5DI8B 5J13B 4F7CA 4FRWA 5LCVL 5LNDA 3MRJB 3BSGA 1KN4H 2WHVA 4JDTH 4HKZA 1KNOB 3IK2A 5EO9B 2A77H 3ALPA 3U4EA 1XIWB 4WU7A 4BWUA 1IM9D 1HZHL 2V7HA 2X0UA 1MEXL 1A7NH 2YAQA 4RFOH 3C6SB 4Z5RA 4EZKA 1T2QH 4PVNA 1GA2A 2QQNH 4ODTL 3VGAB 5C0DB 1HQRA 4M43H 1N6QL 5DQ9A 3MODH 4F5CE 1FPTH 5DS2A 3BZFA 2C3GA 2Y07L 1A2YA 4GW4A 1TJGL 4Y2NA 3TBBA 4EDWL 2NLJB 1P4LA 2Q2EB 4GUCA 5F9WB 2PCPB 3SYPA 3KPRD 2WBJD 3WKMH 1KGXA 1AR1C 2ED9A 2EH8L 3DARA 1FZKB 4JM0A 1KULA 5HHPB 4Z76B 4HZAA 2X4SB 3WFHB 4ZMAT 1YNTF 4PPTA 2V2XA 4XMWA 4HMEA 4L4VD 1X5LA 3N50A 4XPHL 1A3ZA 1CBJA 3DSNA 2MKWA 5AW6B 4UT9H 2PP7A 5TF1L 3SDYH 3VRLE 2AQTA 4QPEA 3UTSD 5CBAA 5JORA 1I9RH 1URIA 4OKVB 4P2OC 2QDWA 1MEXH 3OKNA 2E7MA 4CMHC 1EDHA 1VB9A 5JW3L 3CZKA 2BDNH 3GSUB 1K6QH 2F58H 4XGZB 3RB5A 2WB1A 1RIHL 1UM6H 2QADC 4Q0XH 2FHCA 2H5UA 4ECNA 4EMZA 3LNIA 5EBWA 1RZIA 3QHFL 1TJGH 4BZ1H 2Q20A 3CSYB 3CFJA 5ADPL 1OCCB 1NBZA 3PGFL 1JV2B 1MFDL 3MLWL 4JO8A 3WIIL 4A6YH 1GMIA 4PVBA 5AD0A 3MRQB 2ICES 5FGSA 1IEBA 2NOYA 4L18A 4F93B 4OJYA 1AZVA 2F53A 5A3IC 4QHLB 3BEVB 1MVYA 4NX0A 4Y5XA 3TFKD 4URKA 1X5XA 1GJUA 1YN6B 4MWFB 3ISRA 3ARFD 4HQQL 4J1UA 2R7EA 3P3TA 1QTPA 4WFEE 1C7TA 4Z7UA 3QQXA 4ZOBA 1XL4A 2XFGB 4LKXB 4R5VA 1A7OL 2MTPA 4AL8C 2UXTA 3MV8B 4RGOL 2F53E 3TEYA 1KJVA 2XA8H 2IH9A 3EFFB 2QKIB 4F7EB 3L3HB 1IM3B 1ZPUA 3P9LA 3MZTA 2DL2A 3LRSB 2Q0ZX 4PJ7F 3X13A 3WTTA 2XQ0A 3IGLA 4H1LA 4FG0A 1YEJL 3H6JA 2WOBA 4F58H 3ARUA 3QAZB 4J4PC 3UBXI 4Z7UE 5T1KD 2GJJA 2RHEA 2ZSWB 4FLOA 2WP3O 4Y19A 5E6YA 4CVZB 5KEZA 3WIIH 2ETWA 1N8ZB 3NIDE 3WFDH 4CNIA 4DGVL 3HR6A 3WCYA 4P2OA 4B96A 3CMGA 3BP6A 4PGCA 3DVFA 3RG1C 4FQQA 1Z0NA 1N70A 2X0VA 4PRNA 4NQCB 3X2QB 1MCPL 3FQ2A 3APFA 4PP1D 5IMMA 1JJUA 4O58H 4NLAA 4PJFA 5LAXB 1JDDA 5DTFA 4Z8FH 3IFOB 3BDYL 1XH2A 2DJ4A 3EOAA 4ZUVB 2K7QA 3IGUA 1SNRA 3QH3B 4HKBA 1BAGA 5BUAA 5CJXA 2BW4A 1Q9WA 2VYRE 1J48A 1CICC 1YEJH 3KPPA 5JOEA 4IEFA 3RL1B 3VYOA 5I73B 3UAFA 5IREA 1KIQB 4GQ9H 5CO1A 3T77B 4PJFE 3VFUB 3CGTA 4I1NB 3LQZB 5ANMA 4GKOA 1JD7A 2NZ9C 4LKCA 1ZLWK 1RCYA 2N56A 1JXDA 2VXVL 1Z3GH 5F88B 3I6SA 1OWRM 2UZYB 3K72A 5BO1L 5L8LB 4RZCA 5BQDA 2J1ZA 1OSYA 1UYWL 1AD9A 5BS0D 4DGUA 4OCRH 3FO2A 3D07A 4UMGA 4MFHA 1QSFE 1AJ7H 2GTZA 3GSXA 1BREA 3GTNA 5ANME 1YNLH 4NUGH 3ZDZB 3QYNA 3B3IA 4EDXA 2HT2C 3GLZA 3O4OB 3I2CL 4CMMA 1L0YA 1RD6A 3X14B 1I3UA 4QOKB 1BD2E 4KK9D 4WUUA 4R2GB 1WHPA 2HVBA 3K81A 2J57A 3CC5B 4XNQB 4ZQTA 4U2YA 4PLOB 2ZXQA 5EEYA 2QPSA 1M53A 2DD8H 2VN6A 2W38A 4LCWB 1FZJB 3SEPA 5LG1A 4JFED 2XFXA 4ZMTA 2F61A 4I3RL 4EI6A 4OUUB 4ZUUA 1AHWA 4LOUC 4ZUSA 1G9NC 4PWGA 3WO4C 3FN0H 1QEWB 5F3HB 4J3WA 4HHAA 3GMLB 3A0OA 3LKSA 5I2IB 1KXQA 1P9MA 5IW3A 3LB6C 4Y4FB 1LTXA 2DB8A 4XP1L 2ZKMX 4P2RA 4P06A 2K70A 3E6HB 1QZNA 5GZNA 2D7TH 3EG9B 3VYPA 5KVEH 2HKFL 1NUGA 5IVNA 4CN1A 5DHYA 4XCFH 3TPUB 1AXTH 2MNWA 1FO0H 1MKFA 3X3GL 5TPWL 4YLCA 3EH3B 1UWYA 1F4YL 1KXQE 2X89A 4PY8I 4HS6A 1KB3A 4L9DA 4ZDHA 4ZAKC 2NQDA 4YEEA 5GS2D 2XZZA 1UH3A 3ILQC 3X1FA 2WLKA 3ATFA 1IBGL 4X5LA 5AB2A 2ESVD 2VR4A 2WLLB 2R2BA 4YSTA 3NN8A 4KJWD 4AW7A 4DPAX 3NABL 2L7JA 2XN1A 4XO5A 5EF2A 1WE5A 3QJHA 5DLML 3EUDA 4EI5D 4OZHF 4XPBL 1NIFA 2XKUA 1SUHA 3KPSA 4X5WB 1EXHA 5DZAA 3QFJA 4XP1H 2D9CA 4L2LA 3ABKB 3WTWA 3QI9B 5EA0L 2IVFC 3AY4C 4B9CA 1AQ8A 2UWEF 3HNSL 1GPOH 2KDYA 2G3NA 1K5WA 4ODBD 5KZCD 5I19H 2K8MA 1CFTA 5T3ZL 2HFTA 4HWUA 5HDOA 5TF0A 3PHOA 3CPLB 4IGBB 3BPOB 3WYRA 5D2LB 3FCSA 1T7XA 4J3OF 3VCLA 3TCXA 3X12B 2XN9E 2WIMA 3KYKL 3KPSE 3ZL1A 4BFNA 2CDFB 5C97A 4XBEL 1C5DB 1I9EA 2VDQB 4RMQA 3MFGB 2BLFA 3L54A 2NCMA 1L7TH 4H20H 4GRLC 4HF5L 5BV7B 1OF2A 2H1XA 3V9CA 1CL7H 1GYVA 3BESR 4PMFA 4JM2A 1MFMA 3LAFA 4MZRA 1M7IA 2R27A 4G7YL 1UVQA 2H0PA 1E9QA 2E0PA 4FKHA 3RY4A 4DHLA 4EN3A 1AGFB 2JIXB 3BQUB 1OZUA 3U30B 3P2TA 3ULSA 3H55A 4GSDH 2CJUL 3L3IA 4H5SB 2BOBA 3DMMC 3FT2B 1BVKB 3DJTA 3TEXA 4LSUL 4ZAKA 4GAJL 4WEBL 5SWZA 1T0OA 3PJLA 4PYHA 2BY3A 5IMLA 2BVEA 3HI5L 5F21B 2X40A 4U05A 2HTLC 2NXZB 3DHMA 2EC9U 2ZF8A 5J11B 1SJEB 2X2IA 3Q8BA 4WWNA 1KEGL 2D3VA 3WIHH 4E5XA 5I15H 2AZAA 1JPST 2CSPA 5DJ8A 5DD5H 3QIUB 1OAJA 5SWZE 2V8MA 4G7YH 3TZVB 4RAHA 5DRZA 3AY4A 1K4DB 43CAA 5M95B 4ELMB 4X6EB 2EEBA 2JK5B 1FNHA 1X5ZA 1HJCA 1U93A 4JCWA 3CU1A 3RNKB 3TIEA 4DP2X 3C5JA 1U8JA 3WLWC 5LDUA 1N68A 2LW3A 4K3DH 1T1WA 2J6WA 2QTVA 2WBJC 4TXVB 2ZF9A 1EJOH 5MENB 1XGPB 5EUOA 1R0AH 2WQSA 1MHHA 4GFXA 4FZEL 4GRLA 4HW6A 2WB7A 1KIRA 3FT0A 5EU6B 1U8KB 2UXFA 5F1SA 3FFCB 1VRSA 3HLKA 4QRTA 4KJQC 4WNQB 4E9RA 3MUZ1 5C0IB 4NAQA 1LEGA 4BFIB 4HWZA 1BF5A 2W0LA 4FGMA 4GKSB 1A22B 5EUOE 5HI4D 2AQNA 1C12B 5IR1B 5IW1A 1WT5C 4UILH 5FA3A 8FABA 2NZIA 4NP4H 3TV3L 1K4CA 2PF6A 2IDFA 2W0FB 1QUPA 1I1AD 3GJFH 4WW1B 4Z3GA 2Z4QA 3DI2B 3SE8L 1ECZA 4FFWD 2DQIL 4IJ3B 5CEZE 3NJKA 3JXAA 3FRPG 2OR8A 2EDQA 3WEMA 2ZNWA 1SGKA 1NPUA 5BRZB 3MV9D 2Q8BL 1GJIA 5TDOB 3TF7C 3BT0A 1IM9A 4NENB 2QSVA 4J28A 2UVEA 4ZS6D 2D7PA 4GG6F 5J6HA 2ZX5A 3ARFC 1P7KB 2IJ0C 4N8VG 3B7TA 1JWSA 1CVSC 4B7IA 3E1F1 1RZKH 4D7PA 5FYLL 1QUNA 4IBVA 1YEEH 1TCRA 4CN4A 2NY0B 1XGUB 2N7SA 3F7YA 3ZZQA 4EOWL 1SOKA 3NGBC 5I5IA 4PRIB 5T1MB 3KPRA 5DJ6B 2WBJA 3EDJA 5HDQL 3AS1A 3IMWA 5JQHC 2AQ2A 3MFFB 3LVTA 3CVIH 4Y4KD 5IQLA 1NM9A 1TPXB 2PABA 4O2FA 2C7FA 3HZYA 4M9OA 4WU5B 5J9PB 5I1AB 1EVUA 4L4VA 3ZT5A 2ENPA 1MCEA 3NPSB 4QTIH 5DVPA 1C8QA 3DRQB 3VI4B 4D7BA 3AXLB 2RACA 3UTSA 1A6UH 1AGDA 1J86A 3OC8A 4HLZG 2R1YB 4UQIM 2CQVA 3KPRE 5AKTA 4M8UA 4A7GF 3DX1A 4F7TA 3MBXH 1JK8B 1FIEA 3TLRA 4PRAB 2OS7A 3L4VA 1KN2H 4U1SB 4NPYA 1EGJH 3SGEH 3VJ6A 1XAKA 1GC1L 3PHAA 5J12C 3VX1A 5I1CL 1AE6H 2APSA 2GSIA 2ZIDA 3UTSE 1AYRA 2OSLB 3IRPX 3O8XB 2LVEA 4GBXB 3BRDA 3C6LD 5IVOA 3HHSB 1KIUB 3EYQD 4XNZC 2ZP0T 1CFBA 3KXFB 5FYKL 5KTEL 4UM8B 1R3HA 2LAAA 1FV1B 1Z9SB 1AFVL 1FP5A 1PCXA 1VCAA 2XV2A 3MNVB 1M3IA 4Z78A 1EJFA 3Q6GH 5AVZB 4ZZKA 1XH0A 3LRGA 5L0QB 4P3CL 2PKDA 1IVTA 2YBGA 3UZVA 1J18A 2L3BA 1XDTT 4MAYB 3ARFA 5C0FB 1FLRL 2JTDA 3CFBA 4XPTL 1HSBB 3MTRA 1QI4A 2D73A 1FN4B 2VRAA 3TJEL 4PLKD 2Z8WC 5B3NA 1T0PB 5D93B 1NICA 4AQ8C 2XACC 2HTKD 2YUVA 1VFAB 1YUHB 2C3VB 5I82A 5K1VA 1LEIA 3HN3A 5IWLC 3OV6A 1T1ZA 1E3ZA 2WCSA 3D0LB 3GSRB 5AB1A 4OT1L 1IILE 4MA8H 3S3CB 1E3XA 3EGDA 4OLXL 1BQLH 1J9RA 3ARDD 5DQJB 4FFZH 4URTB 3LKPA 3DGGB 5I6NA 5EOCL 1AFVH 3S34H 3QJSB 4NWTH 4KK9C 2YA0A 4U1MA 1KGWA 1NAMA 1RK0B 4NWUH 3I9GL 4IBLT 4N5ED 4RLDA 5KS9F 3VWKB 1IEAB 3TBSA 3FQYA 3A21A 5HHNA 1WFOA 3FYEB 4NQTA 3BMVA 1KIPB 2CHWA 2X3CA 3MRHB 4M7LH 2GTWA 1URZA 3MLPA 2OA9A 1HCZA 3T1FA 1N6UA 3V7MA 4XMVA 3D2UD 1EZSA 2UZIH 1H15A 3QQ4B 4LIQL 4U6VH 5DS8A