2WO2B

Crystal structure of the epha4-ephrinb2 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
136
Chain Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
molecule keywords EPHRIN TYPE-A RECEPTOR
molecule tags Transferase/signaling protein
source organism Homo sapiens
total genus 29
structure length 136
sequence length 140
ec nomenclature
pdb deposition date 2009-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2wo2B00
4E9YA 2JFCA 4A66A 5F7AA 3EH5B 1BXUA 5B1JA 1QLEB 1X9RA 1YLBB 1HAWA 1WA0X 2NRDA 2BP8B 4DP2X 1AIZA 4Q8BA 3QPKA 3FSAA 2EILB 3KW7A 2YAQA 2GC7C 3UGEA 1QHQA 3X1FA 2BWDA 1AANA 3QJQB 4BXSV 4DPBX 2IWFA 3FQ2A 1GS8A 3PAVA 2OJ1A 4HHWA 4YSSA 3NJLA 1FA4A 3IBOA 1DYZA 3FS9A 4G7SB 1WA2X 1ZPUA 2WO2B 2UXTA 1OE1A 2FT8A 2GI0A 1JZEA 4KO9A 4L0PB 4W9ZA 2GSMB 1DZ0A 2I7SA 1JXFA 1RZQA 4NAJA 1V10A 5ANHA 2X87A 4GYBA 4G71B 3H4HA 3GXUB 4YSPA 2P80A 1V55B 3ZIYA 1GS6X 2IDTA 2XV0A 1A4BA 3FQYA 1A65A 1OE2A 7PCYA 1NIDA 1AACA 5B1KA 4QKTA 4E9WA 1W6WA 1ASOA 4JKNA 4DP9X 1PY0A 1EZLA 2P80D 3QQXA 4YSQA 1JVLA 2J5WA 5D4IA 4E9TA 3NSFA 2LLNA 2FQDA 2W8CA 1EHKB 4PAZA 2PLTA 3WNJA 1TKWA 1PZAA 1CYWA 3QJRB 4DP5X 1E65A 4WKXA 4YSRA 2IH8A 1PZBA 1NINA 1J9QA 2EIKB 3FU7A 1CC3A 1J9RA 1NTDA 2IDFA 3ASNB 2IH9A 1E30A 2EIMB 4F2EA 1BQKA 3PPSA 2QPEB 1KYAA 2WO3B 4G7QB 4YVUA 3IE9A 2PP8A 4GY4A 3NSYA 1KDJA 3WKPA 3AY2A 1PZCA 1PLCA 4HALA 2ZOOA 3AG1B 3S3DB 3UABA 1HAUA 4HCIA 2VW7A 3HEIB 2IDUA 3ERXA 4YSOA 3ABMB 2PPFA 4KO5A 1TU2A 1WS7A 2VM4A 4E9RA 3CVBA 4HZ1A 5I5MA 2DYRB 2HLEB 1NZRA 3AG3B 2YAHA 3T9WA 2J56A 3SBPA 1BYPA 1CYXA 1E67A 2CCWA 2CBPA 1AS8A 3CDZA 3ABGA 1NWOA 1AZBA 2YAMA 3C75A 4F2FA 4P5RA 4DP8X 1MG2C 4BWTA 3FSVA 2R7EA 1XB6A 2QPDB 2BP0A 1AG6A 2DYSB 2HX9A 4RH4A 4ZK8A 4QLWA 2CJ3A 1NDTA 2YXWA 1ZDSA 1ET7A 3T6ZA 1JZIA 1AZRA 3PXLA 4UANA 4YSCA 1OCCB 3UADA 4W1TA 1AQ8A 1JZHA 2RACA 3PLYA 1ASQA 2BW5A 2XV3A 4DP1X 3DIVA 3FSWA 1OOWA 2XV2A 1A8ZA 1A4CA 2J57A 1SFHA 2GC4C 2XX1A 3UAAA 4A2HA 2Y1AA 1ZIBA 2PP9A 2FT6A 3QJUB 1CUOA 2X88A 1ZV2A 2I85A 3NSCA 2BWIA 3FYEB 3IN0A 1AR1B 5PAZA 3FPXA 2AZUA 4E9QA 1KV7A 5B1AB 3TASA 2H5UA 3X2QB 1JOIA 2VW6A 5B7MA 3L45A 5D4JA 1GR7A 2TSAA 2IWKA 3NSDA 5F7BA 4ENZA 5B7FA 3CZUB 3WIAA 2E86A 1JVOA 1BXVA 3IN2A 1WA1X 2UXVA 1J5DA 3RYMA 4GP8B 1L9TA 2VM3A 2DWTA 1CURA 1XMEB 1KDIA 3CVCA 4K9JA 3V9EA 5AFAA 2JKWA 2YXVA 7PAZA 3OQRA 4MFHA 2VSKB 4NB7A 5A7EA 3S8GB 1GW0A 1N68A 1ET8A 1OV8A 3CG8A 4HCGA 1JERA 5I6OA 1I53A 2HRHA 3OMNB 1J9SA 2BP8A 2YAEA 3T71A 2JXMA 3ZX1A 3N2JA 3X1BA 2DY2A 1IKOP 5D4HA 1XB3A 3AG2B 1PLBA 2UX7A 5B3SB 3WG7B 5LDUA 2CUAA 5PCYA 2ZXWB 1NWPA 2BZ7A 1NIEA 2AZAA 3JT2A 1TEGA 1M56B 1JXDA 1PNDA 2FTAA 2Q9OA 2AANA 4CSZA 4A2FA 1L9RA 3WI9A 1JZFA 1PNCA 5B1BB 4YVNA 1T5KA 2GB2A 3QJTB 1JXGA 3GYRA 4E9XA 1GSKA 1SDDA 1URIA 4HAKA 4A2DA 2XXFA 2BO0A 2GIMA 3BQVA 3NJIA 3CVDA 1JZJA 1SF3A 1ET5A 3OM3B 4UAHA 3NP4A 2OCCB 1PCSA 2N0MA 1ETJA 2BP0B 1W8EA 2VN3A 3NJNA 1M57B 4F7KA 2ZWNA 3HB3B 1GYCA 1MDAA 2QDWA 3MX0B 4AKQA 1L9OA 4DPCX 4JHUA 3FT0A 4KO6A 3T6VA 2BHFA 2CAKA 3NJJA 3TA4D 2BW4A 1AZNA 2XYBA 4BWWA 5EHFA 1FWXA 2VSMB 3QJSB 3V9CA 4HCFA 4G70B 1W6LA 2IAAC 3SBQA 2YQBA 3H56A 2CALA 3ZBMA 2FQGA 1J5CA 1ILSA 2AFNA 2VW4A 1ASPA 3IEAA 3S3CB 3PAUA 4EF3A 1MG3C 3FPYA 1J9TA 3X1EA 3EHBB 2XX0A 1NPNA 1RCYA 5TK2A 1OCRB 2AVFA 2HX8A 3SBRA 1N70A 4FA7B 3FQ1A 2PPCA 1GS7A 3PCYA 1AZCA 1X9UA 3BVDB 2DV6A 1ZDQA 3SQRA 2PPEA 1FFTB 1HFUA 1L9SA 1NICA 1KGYE 3WKQA 2IDQA 3D12B 4BDVA 5I6PA 2HZHA 2J55A 1ZIAA 4A67A 2H47C 4G7RB 4CSPA 3FSZA 1GY2A 1TEFA 3TBBA 3AZUA 1BQRA 1KCBA 5IY5B 3ABLB 5I6KA 3GDCA 2GBAA 3QJVB 3FU9A 4N8UA 5B7EA 3OD3A 1RZPA 5I26A 4X4KA 2FQFA 2YAFA 5AZUA 4DPAX 5I28A 4YSDA 4JHVA 5I5JA 2PCYA 2ZONA 3ZDWA 6PCYA 1SJMA 1NIAA 2MRYA 4BK5C 3FU7B 1BXAA 1AS7A 2A3TA 2XLLA 1SFDA 1IBYA 3T6WA 3H4FA 2OV0A 2GHZA 2XU9A 5FC9A 1UATA 3NJHA 3NT0A 3PAZA 1E5ZA 4HIPA 3KW8A 4FAAB 1KBWA 1SDDB 3U25A 2EINB 1PF3A 3NJKA 2QDVA 3NP3A 3JTBA 4E9VA 1KCWA 3N55A 3X1GA 4PCYA 2I7OA 4GP5B 4YSTA 1BEXA 1PAZA 1BYOA 3NJMA 5B1JC 1QNIA 2FQEA 1OCZB 1WS8A 2PCFA 2B08A 2VMJA 3EH3B 4AKOA 1A3ZA 1IC0A 4WTQA 1NPJA 3S3BB 1L9PA 4KOCA 3UACA 6PAZA 3CDZB 1E5YA 1BAWA 1ILUA 1WAEA 4E9SA 4DP4X 2FT7A 4KNTA 1IBZA 3WNIA 1SHXA 1IUZA 2PP7A 4YSUA 2Y69B 4KNSA 4AI7A 2IWEA 2R7EB 3AW5A 3NJGA 4N4YB 1AS6A 2W88A 1SNRA 3TU6A 4AZUA 4A68A 2QT6A 1V54B 4YL4A 1AOZA 4KO7A 1KBVA 1GY1A 2FNWA 3TBCA 8PAZA 1M9WA 3OMAB 1ID2A 1ADWA 2HX7A 2FWLB 5E9NA 1R1CA 2B3IA 3DTUB 2EIJB 3FU8A 1SF5A 2BZCA 2MTAA 1XB8A 3T6XA 9PCYA 1OCOB 1NIFA 2HXAA 1BQ5A 4HHGA 4GP4B 4A2EA 1AG0A 3G5WA 2UXGA 4NERA 4BDVB 1PMYA 2UX6A 3OMIB 2TSBA 1SHWA 1F56A 2H3XC 5AKRA 4AX3A 4DP6X 3DKHA 3EH4B 3NJFA 3EF4A 2XUWA 4UF7C 4YSAA 2FJSA 1MZYA 3AG4B 4KNUA 4DP0X 4YSEA 2IDSA 4BWUA 1AZUA 1L9QA 4M4RB 2YAPA 4Q89A 3S8FB 3NYKA 2YAOA 4DP7X 1B3IA 5I6MA 2HRGA 2PPAA 2YARA 4KOBA 2Q5BA 1JZGA 2UXFA 1RKRA 3ABKB 2XVBA 1OE3A 2XXGA 1A4AA 2PPDA 3X1NA 2WSDA 4A2GA 4BXVA 1OF0A 1NIBA 4TXVB 4G72B 3UAEA 3FYIB 5I6LA 4GXFA 3MBWB 3ASOB 4P5SA 4AKPA 5I5IA 1PLAA 4M3HA 2DWSA 1AAJA 2XWZA 1VLXA 5TK4A 5I6NA 1MZZA
chains in the Genus database with same CATH superfamily
4GXUN 5JXEA 4KI5C 4OZGB 3QIUD 4PLJC 3ARFC 5I1EH 4DQAA 2EDLA 4ADGA 2MQGA 2RTTA 3QPKA 4ZMOA 3FUDA 2COQA 2ATAA 4QXTB 5DFAA 2GC7C 4KMLB 2J6EA 2YGQA 4POUB 4I9WD 1RZGA 3CZFB 1RUQH 4P2OB 3L9BA 1PDKB 4MJIB 5T3XH 2DMGA 1WFNA 8FABB 3A24A 4ZTOH 1AHWA 5DJ0B 1D7BA 3L9EA 5A3ID 4HHWA 1IBDA 4Q6IB 3KWXA 4XO4A 1E8XA 2J6EL 5EOCJ 1T83C 2ZYIA 3WO4C 2Z4QA 3OPUA 1MKFA 1KT2A 3GTTA 4MAYB 2CNYA 3ALWA 3T3ME 1IGTB 2Y5TB 4K3DL 5FEBA 3WFCL 3ZOAA 5HHPA 1OAQL 3MRQA 4K94H 3LKQA 5IFJB 1AXIB 1WUNT 3QUKA 2CHWA 2JELL 4Z0XA 2XKUA 1N64L 2K3TA 4M03A 4MCYA 5B4MC 4TSAH 3JWOC 4KKAC 3JWNC 4KHTH 2EDKA 4EZJA 3GBML 2CNZA 3GF8A 5GGTA 4GI8A 4DVRL 1A4BA 2XN2A 4TNFA 1L0XA 4ZG1A 4XOBA 2QL1A 3CWGA 4BUQA 3HG2A 2O26U 5FW8A 4P9HL 1T04B 1S46A 4AH2A 1J0KA 3VFTA 2F58L 2OA9A 4NJAH 4GMSH 3V0EA 2FQDA 1O7VA 5IB2A 2PLTA 3HN5A 5GGTL 1H3GA 1AR2A 4P0DA 4Y4FC 3ZR5A 2EDRA 3QQ4B 2O5XH 1T5XA 2EDDA 3P9MB 1CXFA 4HQQH 4OCSL 4N6QA 5CO1A 3BGMA 2EO9A 3UAJC 3M46A 4BE6A 1NEZA 1DCEA 3OGCB 2J8UA 3GUTB 3BQUD 3TBYB 5IEKB 4HV8B 4GSDL 2H8PB 2BHUA 2W9LA 1NLBH 2ARJQ 4RIRB 4F5CE 4ZFGL 4WW2A 3EJCA 4KV5F 3FQNB 3AG1B 1FP5A 3S3DB 3A67L 3CQQA 1CGYA 1MHHA 2BRQA 4TSCL 3RVVD 3QC5X 4OKDA 1SZNA 3MFFA 3OPZH 4L4TA 1IAMA 4NPYB 3QISA 1B0GB 1R5WA 3SJVE 4R2GC 2O61A 3US9A 4PGBB 4ZMAT 1AGFB 1USQA 5ILTH 3O3DA 3KHOA 2K6WA 1UD2A 3KPNB 4URKA 3APDA 2G9KA 1R0AL 1G0XA 4QRRE 3INUH 3QHZL 3TIDA 3BN3B 4L4TD 3ZZQA 3T04D 4DGUA 2EUZA 1BZEA 2EYSB 3B9VA 2JK5B 3BD4A 3WJJC 2OYMA 4LASL 2CGRH 1CDUA 4BWTA 1I1AD 3WHE1 4YOKA 2ETWA 5FKAB 1XB6A 1MY7A 5FKPA 1TTGA 3NA9H 3MRRA 5E5LA 2RD0A 2WXPA 3CZEA 1FAKT 1NOAA 2CRZA 4QLWA 2ZOUA 3CVHA 5BMFL 5IP4A 2CIKB 4JFHD 3DIDA 4LBAA 3LKSB 1MCCA 2VXVH 2X3BA 4FXGB 3V5KB 1QR1B 2IFFH 5J7CC 3SQBB 1SOKA 5F89A 2RACA 4JFTA 3G6DH 4KK6D 3O3AA 2C7UA 4HIIA 3FRUB 1J12A 5JPMA 4OZFG 1G7MB 2EYTB 1PKOA 1DQKA 3EGXA 5JZ7D 3QNZB 3CC5B 2XZAH 4HS6B 3QRGL 1CUOA 5IQ9B 3ULVC 3C2SA 3N9GH 1KEMH 3FYEB 1UASA 3U46B 1Z9SA 1TMCB 4UNUA 5H2BA 1AR1B 1EHXA 1MCBA 4P4KA 3RY5A 1D5RA 3T1FA 4NQVA 4JK0D 1PKQB 4R2GB 5DEJA 5F7WC 1PCXA 3UH8A 1T21B 1V3JA 5KSBB 1HHJA 3C8DA 4KVCH 4NPJA 2OX5A 1LD9A 1YEEH 2NY0D 1IGFL 3N44F 2CUIA 2FEJA 3F6JA 1NL0H 4PJCA 3X3GH 1CQKA 3G3LA 1BXVA 1BOYA 4P4KD 2VSDA 1G7HB 1NGYB 2J21A 1GTFA 1N4XL 1M7DA 3LZFL 4M5TA 4IBSA 4PN6A 1RK1B 3CVCA 1DJYA 4GKNA 4K7FB 2VABB 3EOTH 4LMQE 4LSUH 4MAZA 4N1EA 4N25A 5JO5B 4E36A 2YK1H 3DBXB 5MEOB 3D51A 4UT9H 4PJHA 3S8GB 4CUCA 4XNQA 4UQCA 4OZ4B 4NO0A 3BSGA 4O5LH 5AKVA 2VR6A 1J9SA 2BP8A 1B4JH 4PU2A 2JXMA 4IEFB 5FPIA 1RHHB 3SPIA 3K2IA 3AXLB 5DC4B 4Y5XB 3RX8A 4IKNA 3VFRB 2UX7A 4HFUL 4JZOA 3MOBL 3UC0L 1M71B 3AABA 2X38A 1M56B 4M61B 1JXDA 3RBGA 5KN5B 1W8OA 1ONQA 5BRZA 3T0EB 3TV3H 4J3BA 4AT6B 3KGSA 4GUPB 4F1ZA 1UCBH 2Y36H 3L5WA 3VXUA 4YLCA 1WZMA 4XN2A 2DWDA 3P3UA 1KIPA 1S9WA 3DSNA 4K5PA 2GB2A 4KXZH 2VLJB 3QEUA 3PE9A 1B0WA 4A2DA 2AKRB 4ELKB 3BQVA 4FHJA 4N24A 5DJDB 5CU5A 3C6LC 1U8CA 1NCIA 1B2YA 1Z9PA 4GRLA 5BRZD 3VD7A 3LIZH 3HUJB 5CF3A 2ENQA 3VXUD 4WTZG 4F15C 3HE6D 3SY0A 3UO1H 2XBZA 4LSQL 4XP6L 4D9LL 3F7LA 2JKTM 4Y2DD 3LV3A 5C7ZA 4Z7IA 3EF7A 2B4CL 3NCFB 4LEXL 2GBUA 4FG0A 2XA8H 1MVFA 3MX0B 4LP5A 4JHUA 2NY4B 3B9AA 1U91B 2WKOF 1UXWB 2CE6A 3MLRL 4RWYH 4OVUA 1J18A 5JPNC 1AHMA 3EO0A 5ICYB 2YQGA 3BT0A 1HQ4A 4RETB 4ADIA 4P99A 2CO6A 2UUDH 3MNMA 3SE8L 4WJ5A 1MHEA 3IJSA 3FB5A 1PAMA 3FUIA 3TOPA 4RZCA 3DSFH 2IPUG 4J7RA 1H5BC 1O7DC 1P4IL 1MG3C 1MRDH 4L05A 1TIUA 1CCZA 1OCRB 3ME0B 4KX9A 2B39A 3TCXA 2MTPA 3MLPA 2JB5L 1UA3A 2WVVB 3ZE1F 4M7ZB 2ZYRA 4JE0A 2V2TB 3RVUC 3H6AA 4XTRD 3CPUA 4XZUB 4Y9GA 2NXZD 4IOFD 1BX2A 3MRHA 1ZWIB 5CP7B 7FABH 4PJ8D 1WHOA 2AV1B 1T1ZA 2BVPA 3MRFB 1E6OL 3I3BA 4L4VB 2H47C 2FYYA 4JL2A 1U58B 4BZ2A 5J9PB 3L9RB 4PI2A 1FVEA 4PV9B 1TEFA 1QSEB 2WXKA 5I8OL 4LEOA 4XBEL 2SODB 4TKWA 3X12B 3ECBA 3P54A 5BUGA 5J89A 5I19L 3HPJB 2ZXAA 2GY7B 4AEFA 1RIVL 5HYSA 4I89A 4XNZB 1G7LB 2EXYD 4BZYA 3KE0A 1MFEL 1FQ9C 1YMMA 3GTNA 1KIRA 3Q3GA 4PJCE 4XPHL 3OF6A 5D8JL 3OLGA 2PTUA 4AYBA 2YD5A 3CFNA 3K1DA 3N04A 1XD0A 2F8OA 4QPEA 1OP5H 5A2JH 2BOCB 1CL7L 5GGUA 3DX6B 5MEPA 5IJDC 1OSZB 4YR6A 4QRAA 2J6EH 5GHWL 3VFOB 3FQWA 4IJTA 3SQOL 1YMMD 4I8DA 2YZ8A 3OF6D 3V6OA 3CSTA 4K3DH 5IOKA 3C5XA 3WFCH 5JIMA 4WK2B 4HD9A 1FNGA 1QTYT 5DK0B 1Z0NA 3QT2A 3QUXC 4XHJC 3ZXAC 3TO4A 1QLFB 1N64H 2Z31C 4G8GD 4FXKC 5KAQF 3BUIA 4MLSA 1T2JA 3E8VA 3Q1SL 3WUWG 2GAZB 2XNAB 3NCBB 3BJ91 3GBMH 3CZFA 5LBVA 4PRBA 1PDKA 1W0VA 4MJIA 4XE0A 2WM0A 4NXSA 5IW3A 4P9HH 4M5YL 2J88L 4IHOB 5I1IL 4DP4X 2PETA 4ZAKC 5DJ0A 4G59C 4KNTA 4XT1C 2N01B 2F58H 4Q6IA 1C16B 3WNIA 1EXHA 2IGFL 5GGTH 3B2UD 5CZVH 2Y69B 1GAFL 1PPIA 4FFZA 4P2OD 2CHZA 3AW5A 1UKTA 4MJID 4OCSH 5A1AA 3BGAA 2F08A 4L1BA 1IGTA 2Y5TA 3ZE0B 4YDMA 5SV3A 4GJTB 5TD4A 3KPPA 5CLTA 2Z7YA 4JQXA 1KBVA 3VI3A 3HG5A 3SE3A 3L17A 1PIFA 3KYNB 3OMAB 1KN4L 5F9WB 2QHRL 4YBLC 5DEZA 4FFZL 2W60B 4FQXC 4LHQB 1T2QH 5HVGB 3LVTA 4MAYD 2JB6B 1JK9B 1JGDB 5EU5A 4POZD 2FGZA 1S5HA 1X5FA 1T04A 1T3FA 1GTNA 4TSCH 4JHAL 3F58L 4MCMA 1QBBA 1UT9A 3GSWB 2BS9A 5BW7C 2PW1B 3NEXA 3WTSA 1MZYA 3QQ4A 4KNUA 3ARFA 3RFZC 2NQDA 3LRHA 5IQOA 2BY3A 2XG5B 3F7YB 3NYKA 3C5ZB 2ZAGA 5IJBC 1R0AH 3JTSB 5ACMA 3T08A 3QHZH 4F27A 3OGCA 4UT7H 3ZMRA 3GUTA 3I6LE 3K81A 3ORJA 3TBYA 4HV8A 5GISL 4LASH 4ZMZA 3IRPX 4LLUB 5ADOL 5JOPD 3GRBA 2EZ0D 3ASOB 5JHAA 3U0PB 5BMFH 4FERA 1ZEAL 4C4BA 4NPYA 3DO7A 2BCKB 1FAIL 4QRTB 4PS7A 1P9MC 2RA1A 1U6AL 3NCXA 5EDXA 1BZQK 4PGBA 5DJYB 1VHPA 4MJ2A 3ZSTA 5JA8B 4LDLB 5T33L 5B1JA 1YLBB 4JPIA 2Z92B 2BS71 3I9PA 5J6GA 2G5BB 3CVHH 3RP1A 3WE6B 5GJTH 2VLLB 4JRYB 4DIXA 3WS3A 2D3LA 4FABL 1IM3A 1QHQA 2EYSA 3L3JB 2AXWA 1AANA 3IE4A 4HULB 1A0QH 1YMHB 1OZUA 1FN4B 2H0JA 5FKAA 5SV4A 1XF5B 4BHUI 4Y7MA 1MH5A 1T7XA 1WA2X 1WZAA 2CIKA 3LKSA 2A9DA 1IGFH 4KO9A 2FWSA 3QA3A 4HXBL 4L0PB 3SQBA 3UAJA 5FA4B 1JXFA 4N0YL 3A6BL 1VEMA 5B39G 1VCAA 2R15A 3FRUA 4X9YA 1N4XH 4PWIA 3LZFH 1QD0A 4PJGF 1J8HE 3ZGHA 3GXUB 2H2PD 1UKQA 1G7MA 2EYTA 3SDDC 1ZGLA 5G5DA 4KUCF 2XWJB 3LAFA 3QNZA 3GMRA 4QRBA 3CC5A 4HS6A 5J11C 4JRLA 4V33A 4LLAA 5IQ9A 3GBNL 3NZUA 3GC3A 2V8LA 2WLIB 4E9WA 4RDQG 2FJUB 4DP9X 1YAIA 2KUTA 2XZQL 4LSPL 3UP1A 1EWHA 4IMLB 1DSFL 4Q7DA 1OD7A 1T21A 5D4IA 5AW4B 1N6QH 2K70A 3BWZA 2EADA 3GMMA 2R0KL 4HFUH 3MOBH 1OTUC 3UC0H 5C09B 4CW1B 3F7PC 4DGWC 1KBKA 1JXJA 1AR1D 1CC3A 1JRHI 4LAJH 3VI3E 2DIJA 1G7HA 1UWXK 4GRWH 4AQ1C 4R2GD 3UZVB 2Q8BL 3WJJA 1RK1A 2R0WL 1MLBB 1R46A 2VABA 4G1MB 1QUNB 1SVBA 2VLMD 4GB9A 4NUGL 2CLVB 3DBXA 3MUGB 4PBXA 1IO4C 3AQXA 3OAZK 2JKJA 4XNDA 4W9FC 5A2FA 2PR4L 3VW3L 3GSNB 4UMGA 4YHNB 4Z78B 3OXRA 4PJ9B 1ZD6A 3ABMB 4LQFL 4JQIL 5EBWB 4IEFA 1P7BA 4QD2E 1RHHA 3V4PB 1BVNT 4LSQH 2EE0A 3IPEA 1DLFL 4KI5E 4XP6H 4D9LH 1XIWC 2VM4A 3AXLA 4UU9B 4XCCL 3UX9B 1TOXA 4LEXH 2Y7QB 5JW5B 1HZKA 3VFRA 4JY5L 1NJ9A 4L8BA 4KH9A 3T9WA 1C12B 1U4EA 3BWUF 3QHFL 4PY7B 4M61A 4MA7L 5KN5A 1E5CA 3MLRH 5HHXL 4AT6A 4GUPA 2ATKB 3RVWD 1PS3A 4Z95L 3FTXA 5DUJA 4AIXA 4D3CL 3WNOA 4AEHL 3Q5YA 1UZ8B 2DIEA 2VLJA 4L9LB 1LHZA 1KTDB 3F3HA 1MWAB 3TH2T 1CFVL 2XIBA 4ELKA 4EIUA 3FSVA 5GIRA 5FF6B 5DJDA 1FUNA 3T0ED 5GXBB 1HH9B 4L3AA 3ZTDC 3NCJL 2JB5H 5JIHA 2VLJD 3PV6B 3KL5A 1S78C 3PGDA 4AMKL 3E6HA 1TTFA 4PIRF 3UADA 1A9BB 3CFQA 3N1MC 3T8XB 2V2WA 3JWNE 3BZEB 3HKFA 1G9HA 3PQYB 1JGIA 1WISA 1KIQA 3FSWA 1KGUA 3S97C 3KBPA 3BX7C 5C0RL 3U0WH 3ZE2F 5ICYA 3MRBA 3LTVA 3KMDA 4M8VA 1TEYA 3WEMA 4LARL 4YXHL 4LU5L 4XBEH 2PP9A 4M7LL 1KZYA 4WU7B 3BW9B 3D30A 2NOYA 3S37X 4HJJH 3B4NA 2YKLL 2NY4D 4HCRA 5I19H 3FUKA 3TVMB 3ZTJH 4D9QE 1EFQA 4N8CL 4WEBL 5E8PB 3ARZA 1MFEH 3ME0A 4BZ2H 4FULA 1MRCL 1I9JL 2Y2YA 3OC8A 1A66A 2UZIL 3SDYH 4XPHH 2NY5C 2TSAA 1EAQA 3IDYC 3K3QA 3QCTH 2ZX5A 1ZJAA 3JWDC 2V2TA 5MEQB 5I0WA 3WCYA 4HCRL 2HN7B 4MHHI 4XZUA 1A3QA 1KGJA 3WNNA 4X5PA 3QFJB 2WN2A 1ZWIA 4X5WB 1J5DA 5GHWH 5I75B 1HOCA 3MRFA 4HBQA 4WEUD 3W5MA 3SQOH 1N12A 4TUJB 1WAAA 1JF1B 4TULH 5J9PA 4XVSH 4LSRL 4PRIA 1QSEA 1TXKA 1UA7A 3VG9C 4XMZA 4WJKB 3X12A 2X1PA 1I3GL 2G0KA 2Q3ZA 3EKCA 2GFBA 4NI6A 1RP8A 4UQ9A 4V1DA 3MRCA 1DQQA 3T71A 3REWB 1S7QB 3Q1SH 2O6FA 1G7LA 4U3SB 1GC1L 4AGNA 4Z1PA 1T1WB 4PWHA 4IBYA 1QSED 2P8PB 2EABA 3JVFC 4OGYL 5ICZB 3ML9A 4NNYB 2R83A 3N40F 3W9DB 5JPNA 4B7LA 1N10A 2F61A 2F19L 2BOCA 2AANA 3DX6A 3GJFB 1OSZA 4O51B 4MYWB 1I1FB 1RY7B 3S6CA 2IGFH 3VFOA 4ZMXA 5FYLE 3NH7L 1ROCA 4OIIL 1GAFH 5CJQL 3B5HA 1YEIL 2VLRB 3J27A 5F7YC 3QDGE 3ZHFA 4YX2H 1I7UA 3GEFA 1G9NL 5FA3B 2OW7A 1ZHBA 4P59L 4F58L 1ETJA 3U6RA 4N0FB 2QHRH 3HG0A 4TLUA 1DJHA 3WUZA 4FFZH 3PG2A 3B8SA 3HHRB 2GAZA 4X4YA 2XNAA 4KDTC 4AWJC 4BFEA 2EUWA 4S10A 4UOZA 5DJXA 2MNWA 4HLZH 3HJEA 5DQ9B 4GG6E 4QXVA 4IHOA 5EU4B 2X9XA 1I4FB 4BSJA 4JHAH 3F58H 5K93A 3T2PA 1KUMA 2VSMB 3ULVE 1C16A 2EH7L 3IBEA 3WTUA 1W6LA 4MD0A 3Q1EA 2IAAC 1DFXA 4NNPH 2CLZB 5B22A 2H1LM 4CKVX 3S88L 2AFNA 1EO8L 1OCWL 3BEVB 4DVBA 2D7MA 3X1EA 2PO6B 3WXVL 3AADB 3TBVB 3FT2B 5H8DA 3K0YA 1N70A 3ECQA 1ZXQA 4FA7B 2FWOA 3EXLA 1R24A 5BOJA 1LK2A 3V6FB 1KTRL 1AZCA 5ADOH 2JB6A 3PHOB 4M3JA 1JGDA 2D7NA 1KYFA 3MRGB 1U41A 2C9RA 1DJGA 1ZEAH 5EN2B 3Q8FA 1WT5A 4B9JA 3GSWA 4N85A 1FAIH 5BZWA 3QJHB 1U6AH 5KTEH 4ZQTA 2EUVA 4B3VA 3QUXA 4PVNA 2VQ1B 3QZMA 4TL4A 3VDBA 2Z31A 4RCAA 1T0NB 1MI5E 3NG5A 2E7DA 3C5ZA 5HYIA 4K5LA 2HJFA 1F3RB 2HT4D 4P2CG 2YAFA 3ML8A 1AD0B 5EMYA 4PCSA 1LO3H 2A7BA 4NIKB 1A7OL 4FQPA 3ZDWA 6PCYA 4QNPF 2J71A 1XZWA 1YC7A 1FE8L 3TEZA 3MOQA 4LLUA 5JW4R 5AYUH 2O5ZL 3JWOH 3JWNH 4QJ4B 4BHUA 5EF2A 3C5ZD 4JPWL 5BUAA 5GRJH 1IIKA 4ZJ9A 5HYQB 1YCSA 3CDYA 4ZX4A 1FNLA 2IAMB 2VZUA 3KW8A 3TJEH 4PRIE 1X9QA 5DQJB 4I3RL 1XCQA 3V0WL 1EH9A 2CM5A 5DR5L 3D08A 4WFHE 3SCMB 4HXBH 2QSVA 3EJSA 5DJYA 5IW6B 4N0YH 3EJZC 3MGAA 4FQ1L 1H8OA 1CT8B 4V1DE 5GGVL 5KJ7E 4M8QA 1IRAY 3UCQA 2G5BA 2IXQB 3LOWA 4GP5B 3WE6A 4JRYA 2PABA 4A66A 5ANME 1E27B 3ETBJ 1BD2B 4V2CB 5DVNA 5B21A 5CJXC 3S3BB 3GBNH 5HDBF 4J3OC 1YMHA 4J3TA 4CN1A 4QXGH 2ZKXA 4PJBF 3I9AA 4ZMQA 1XF5A 1KELH 4LSPH 1DSFH 4ZX3A 1J7VR 1A9EB 4JRYD 3MLWL 1MEXL 1CICC 5AB0A 4JE4B 1ZY9A 2R0KH 1CFTA 2F5BH 1KYOJ 2MJWA 2XIIA 4JFQA 4ZFZB 1UB5B 2FEEI 1QP1A 5TE7L 5J12B 2F2HA 4H8WC 1NGPH 3BESR 1JXKA 2HLAA 4K71C 3OKKA 5CD5D 1R3JA 3MCLL 4PPTA 2W92A 3BVUA 3P30L 3DI3B 2Q8BH 4NN6C 4PFEA 3U2JA 1Q4NX 2PTVA 4NUGH 4ZYKA 2KLRA 1SJEB 2XWJA 1IEAA 2MTAA 3DIFA 1JRHL 1HXYA 2PR4H 4GAGL 5FFLA 1VESA 3VW3H 2OAAA 3KAAA 4AENA 2BDNH 2DEYX 4W9GC 1P84K 2WLIA 4WFED 3G5WA 4BDVB 3NZSA 4LQFH 3GIZL 3L81A 3II2A 3KPQA 4HUXB 1P9MA 1A4KB 4I9XA 4IMLA 1DLFH 4PREB 2QQLL 3VWJB 5FYLH 1PFOA 1SY6A 4FG4A 3GHEL 2V2XB 1U8PB 3O11B 1A6TB 2XUWA 3KDMA 3NZHL 2WNGA 4JY5H 4NQCB 2MCMA 1PGRB 1U8HA 3VNZA 5C09A 3QHFH 4CW1A 4MMYB 4MA7H 5A2AA 3LMJH 4UTBA 4Z95H 1MJUL 4D3CH 5I6MA 4B9CA 1HE8A 4AEHH 1UFGA 3UZVA 2DTSA 1SY6L 5IFAL 3F65A 1MLBA 3CVIL 3WKMH 4G42A 5IB1B 1OAKL 3FCSB 3HJ0A 2CLVA 4U6VL 4F57L 1OE3A 1CFVH 2EIDA 3AGWA 4I5BB 5FUCC 3NRFA 4XX5A 1NIBA 3Q8CA 3ZYJA 5C09D 3DHPA 2DH2A 3GSNA 3VO0A 3QRBA 4Z78A 4K7PL 3L2MA 1UOVA 1N5YL 1DBBH 4PJ9A 4ONHB 2AXFB 3NCYS 4NKOA 1CXHA 3NCJH 5EZJB 2PTTA 5EBWA 3ULVH 4H1LG 4IBLT 1P7QA 1X5YA 2CUMA 3FCBA 3OL2A 2FIRT 5CMAB 3E6FA 5TK4A 3QO0A 3IKKA 3EJRA 5JW5A 4AMKH 3QQ3A 4O2EB 5EZOH 3GSNL 3BEWB 1C12A 2BMKB 2MPVA 1QLEB 1NFIB 5EBGA 2ATKA 4PJ9D 3SDDA 4UQDA 4S0SD 4W9JC 3V4PL 2WYTA 4FA8A 2PCFB 5EEWA 3LZRA 1UZ8A 4LARH 4LDCA 5DJZB 4YXHH 2A9AA 2OI9B 4KK9D 4LU5H 4M7LH 1KTDA 4R4BB 4ZFQA 1MWAA 3BAWA 5C9KA 4LSTL 1VACB 2IPUK 4M62H 3IXTB 1Z5HA 2Y72A 3CFJB 4N8CH 4WEBH 3CC1A 4NKQB 5IFHH 5EO0B 3IKCB 3QWNA 2VMDA 1FA4A 4YE0A 3IBOA 4JFXA 1NFDF 2JQAA 4JRXB 3PV6A 5SWSB 3D6GA 1R9FA 3ZDXE 1MWAL 1ML0A 2CPUA 4D2NA 2A9ML 3J07A 1FZMB 1DUYB 4HCRH 4IJ3C 2QQKL 1T7ZA 3AS1A 3T8XA 2DQIH 3VXTB 3BZEA 4OF8A 3PQYA 2EICA 2WBXA 2X87A 1XGRB 3LCYA 2BIPA 3PP4H 5E94A 4XNXL 4OFPA 1U21A 3ZQWA 4LGSB 3MSPA 3ALXA 3LQZB 3VFGL 3DVGA 5CWSA 4WU7A 1UT2A 1SEQL 2R2CA 3BKCL 5B1KA 5M7QA 1UOLA 4M6AA 3PQYD 3TVMA 4WV1B 1ZGLM 1SJHB 1XIWA 3IGAB 4XCEA 3ZKMC 1UT1A 5D1XB 3KR3L 4AUYA 1GC1H 4KKBD 2E75C 4OJDH 5JHLA 3BIKB 3SOTA 4B96A 2V9RA 4NQXB 2C5DC 3PWJB 4XAWH 1QZNA 2BSSB 5I18L 4ES8A 1NH6A 2B3RA 5IWLA 2HN7A 3FT3B 4MMXC 2WBWB 3L13A 2IDFA 3DURB 3TVMD 3LH2L 5EZLB 2XKNB 4X5WA 1LK3L 1XIWD 1OKEA 3FONB 2EIMB 3MJ6A 1YN7B 3NH7H 5DUML 2FHBA 4OIIH 1BHGA 3HMXA 5JHLL 2HB0A 2V5TA 1YEIH 4ABUA 3WY2A 4A7GA 1JF1A 2DQCL 4R83A 2X6BA 4PJFF 3EGDB 4BFNA 4AYGA 3AY2A 2JKSA 3L95A 1I1RA 1X5XA 2DIBA 3FO1A 3H3PL 3OWRA 4F58H 4EXKA 1E9QA 3QFJD 1P2CB 2DBLL 3BAEL 3SIKA 3MAWA 5J3HC 3GMQB 2PPFA 3REWA 1S7QA 4UNTA 1B6UA 2NXYB 3MA9L 4P2RA 4ECNA 1TVBB 2NUPA 4BFGA 4QCIB 3AG3B 3BZ4B 1OP3H 3SBPA 1CYXA 1HCVA 3L1OL 3W9DA 3L3IB 4LBEA 5HY9B 1H8NA 3ZL4H 4Z0BL 1T1YB 1S9KC 5G2NA 2YSSA 3GBLA 3P73B 5AB9A 1XZ0B 2HT2C 5DRXB 3SOBH 3DJRA 4UNIA 3ZO9A 1FL5A 3APCA 1MFBH 3F7KA 2MOQA 3TM6A 2PW2B 4MNHB 2WCPA 2AQ3A 1OCWH 3R1GL 2FATL 1S7RB 1S9XB 4OFYA 5AVVB 4DTGH 4RMQA 3S4SB 4N0FA 5DMJB 1DEDA 1SEBB 2Y1VA 2DIAA 4BUHA 2E9JA 4PSPA 5LLIC 2ZF9A 5E1AB 3FOMB 4IRJC 3RIFK 4P07A 1F1DA 3T6ZA 2Z0BA 2VLRD 2G0LA 1I7RB 4AEIL 4Z77A 1P69B 3P2DA 4XP9L 2DLHA 4HPHA 1PW3A 5FGCB 1N6UA 4AQZA 3T65B 4OFYD 5EU4A 1HHHA 1I4FA 4HSAC 1KCKA 1S3KH 5ICXB 4PV1C 3TL5A 3P4OB 5GJSL 3O6FB 3CDFA 5HGHA 4LPYA 5IB3B 2I85A 3DNKA 2CLZA 4UNVA 1ETZB 1LYQA 4APQB 1S7VA 1HDMB 5CSZB 5E99L 3FPXA 2KQNA 4ZFOB 2DQEL 5B1AB 1JDDA 4N0CD 4N5UA 2B9AA 5ALBL 4Y16B 4XN1A 5F0JB 4DGVL 1FE8H 3DHJA 3V6FA 1TR7A 4R90L 4G6MH 1D7CA 4U1IB 2VXSL 3ZUNC 5JQHC 4Q9QL 1JWSB 4GOSA 1WTLA 3IN2A 1PX8A 2UXVA 3MRGA 4I4WA 4JPWH 4U1NA 4MA8L 2FAUA 3KBEA 4L4JA 5D2NC 5DEGB 2DWTA 2PO6D 1BVZA 4FL4B 3VFPA 2R9HD 3GSXB 3RX5A 4I3RH 2OTWB 3D2TA 3QJHA 4L29A 3ILPB 4ILDA 1LP9B 2PF6A 4N28A 5CJOL 5DMKA 4FKEA 3U83A 2DH3A 5EIIB 2G4GA 1CDIA 4FQ1H 4DKFH 1XEUA 1T0NA 3KVPA 4P4RB 5J1TC 3ULUC 1CK0L 4KDTA 4S1QL 1HNFA 1AD0A 1PEWA 2HVJB 1Z5YD 1LVEA 3V0DA 4WHTB 1TLMA 4BJLA 5IHBA 4OFIA 5T5NG 4JFFB 5E8OB 4AQAA 1TEGA 1E2VA 4K8RL 4K8RD 5CGBA 2Q9OA 5HDWA 1OM9A 1K3IA 1XEDA 3BZFB 5BZZA 5HYQA 1VCBC 1AJ7L 1MEXH 1WICA 2R1XB 2DD8L 1W15A 2IAMA 3EJYD 4I77L 1HH6A 4HFWB 1IVTA 5TE7H 3SCMA 4Z7OB 3MJ8B 2JI3A 4OTXL 2P48B 1CT8A 1SOXA 1DFBH 3MCLH 4HDIB 2P4AB 3P30H 1ES0B 3W9EA 4UAOC 5CKAA 2YQ2A 4P2RE 4Y9FA 3DO3A 2IAMD 4OUUB 2FEEL 1BMGA 3U6XA 1AQMA 1JRHH 3SCMD 4OI7A 4XWOD 3H3BC 5I17A 4FQLL 4I87A 4QXUL 1NAKL 1E42A 8CGTA 2UY7B 1VPOH 3GIZH 4N2FA 5LBSA 2BW4A 3DO4A 1VFAB 4BWWA 4X7SH 2QQLH 1ACCA 3SE4C 5F6HI 1A9EA 3V9CA 3O41B 3SPVA 3D8MA 3NCMA 1UYWL 1BD2D 1LMKA 4F8QA 3D18A 5DEFB 3ECUA 1P6WA 3U9UB 4MLIA 3LN5A 1QKZH 2Y7LA 4UUJB 3K71B 2QELA 1YNLH 5LBSL 3BPOC 2EXWC 1KJ2B 4IRZA 4N68A 2WTRA 1SY6H 5IFAH 4L3EB 3U48A 1ECZA 4QDGA 4KDWA 1OAKH 4F57H 2H2SC 4M7LT 1T1XB 3CAFA 3FQ1A 3TN0C 1SJEA 1GS7A 4TTGA 3JVGC 3KWWB 4X4MA 5DD5L 5KUKA 3WL9A 1MNUH 4UTBH 1S6NA 3JXAA 3CK0L 4PWJA 5CLZA 4K7PH 4OU3A 3WKQA 3V6ZA 3V95A 1N5YH 4IRZL 4BDVA 4Y9CA 2EDTA 1SM3H 2VR8A 3K2UL 3MLSL 1TO4A 4HUXA 1A4KA 2HTLC 1FL3B 4JDTH 2X0WA 2JCCB 2JTYA 4B50A 1A6TA 4NQCA 4HIXL 5T3ZL 1MHCA 3GSNH 5T3ZD 3OB8A 3V4VA 1UADC 2MCPH 3O4LB 3BPLB 3Q5TA 3ZKQD 3GD1C 1UJ3C 1FBIL 4Z7UF 5I5JA 2PKDA 1RZFL 3FCSA 4NQCD 1MNNA 1HCYA 1CVSC 2AJXL 4I5BA 2NY7L 1BXAA 3QAZC 5LGHL 1AS7A 3QP3A 4X6CE 4ZUVB 3V4VL 5HDLA 1HNGA 2F9BT 3H55A 1CICA 5T1JA 2XU9A 2AXFA 1CD8A 1UM6L 3NT0A 3F85A 3TFKC 4GI6A 4KMQA 1MWAH 1RIUL 5CMAA 2BNQA 2A9MH 1F8TL 1U8LB 1L5GB 1FIGL 1U30A 4O2EA 5D1ZC 3AWGA 2GJ6B 3BEWA 3KLDA 2BMKA 5DUPL 1JGUH 4X4ZA 3EYQC 4NP9A 1RULL 1FJ1B 5HJGA 4Q58C 1FGVH 2I7OA 4G43B 4KTDH 1PAZA 4KKCC 1DDHA 5DD3L 1WS8A 2PCFA 3QUZB 2CMRL 4ELMF 2VE6A 1DEEB 3KS0H 1ZVSA 2BNQD 3MUHL 3VFGH 5K9OA 4R4BA 4OJYA 2DEWX 2PWFA 1L9PA 2JI2A 3O6KL 3QXDA 3BKCH 1OZTG 4Y1TA 2N0KA 3ARQA 4PJ7B 4YBHA 1QLEL 4CGUB 2KYIA 3AXIA 3P40A 2ZG1A 2HKFL 2V3EA 1VGEH 2DM4A 2ZF8A 3KR3H 5EO0A 1SN5A 3IKCA 4XCFL 4KTEH 4YSUA 4JFDE 4JRXA 5SWSA 2H3KA 4G6FB 4J6RL 5GSRB 1FZMA 3DX8B 3V7AE 5LKNA 3SODB 3ZKXB 5MHSE 3TYFB 1MIML 5F6IB 4KZDH 1O6TA 1XGRA 5DUMH 4NQSB 4Q14A 3C09C 5C08B 5JHLH 2DMKA 5SX5H 2B3IA 4BKLA 3FTGB 4JRXD 5DJ6B 2DQCH 3Q01A 5SWSD 3UG5A 3X11A 3QK0A 4BUGA 3LQZA 2H6PB 2JMRA 5F7NC 2J6WA 5GSVB 3H3PH 3RWGB 1N7ML 2BVEA 2R1WB 4FYTA 2DBLH 1S7UA 4Q56A 4F33B 1G7IB 3BAEH 4JHWL 4WV1A 4OH2A 5ID1A 1OW0A 3HMXH 3FTZA 1DBAL 2FR4B 1JIBA 3MA9H 1T7YA 1EHNA 3CX5K 4DP6X 5C0JB 2ZT9C 3ZDYF 5KVFL 5CEYB 4ZI8A 2BY2A 4NQXA 3T4AB 4YSEA 1HYSC 3P3YA 1GA2A 2BSSA 2D7OA 4XP1H 3D0LB 3D39A 1L9QA 4ZS7L 1WCQA 2YAPA 3FT3A 4EN3C 3DURA 3U2IA 2XKNA 3HZMB 3LEYL 5D7JC 4Z3GA 4Y1AB 1DVFC 4X7DC 4YHLH 5D1XD 4B60A 4MYPA 4MCNA 1P84J 2W38A 4R5VA 4N6RB 2XFGB 4CC0A 4BXVA 1U8QA 1LWJA 2XVGA 2FATH 3IF1B 4HF5L 2ODHA 3GJFH 1KB9K 3HR6A 4HJTA 4OZHE 3GMQA 2ZUWA 1NBZB 4F9PC 4UYPA 3L4YA 3DUHA 3OKDB 4Q6YA 5A40E 5IMLB 2OCFD 2ZSWB 1CFNB 2OXHB 3OAYK 4LO9A 4AEIH 3RIFF 1NMAL 4QCIA 4XP9H 2V9QA 3WIHA 2DM2A 1W2KT 4OLXL 4XAKE 3TURA 4PYGA 2NYYD 1AE6L 3OKYA 2ZUSA 4X6DB 3L3IA 2NRDA 3NPSB 4EIZC 4KK5C 1NFKA 3RTLA 4YHZL 4JAMB 1CE1L 3IFOB 4L37A 4QWWD 1B4LA 4DZBB 3P73A 4JFUA 5GJSH 1XZ0A 2NXYD 3CZLA 4M8UA 4XNAA 1NCTA 1XH3A 2F1BA 2I9LA 2XPGB 3X1FA 2G9HB 2Y1YA 1U3ZA 1WITA 3QJQB 4E41A 2PW2A 4MNHA 4QHMB 5E99H 1GJUA 2X3CA 4DPBX 4QUOA 1S5IL 2DQEH 1YNTB 1S9XA 4LP8A 2EDHA 3PAVA 4CVWA 3SKUD 2ZAIA 3TH3T 2CGYA 4Y2LA 3S4SA 4F7EB 3ZR6A 5TDOB 4FNUA 2ITCB 3GXPA 5KVEL 5ALBH 1PZDA 4G7SB 3VU2A 4DGVH 4JFZL 3VGAC 2YXMA 1SHSA 4R90H 1JZEA 4MMXA 1TDQA 1G7PB 2VXSH 1KBBA 1HZLA 2GSMB 4Q9QH 2I7SA 4NAJA 3HB3C 1EHAA 2BK8A 3QFDA 5E08H 4OCYL 3T65A 3WNMA 2MIZA 3VM5A 5ICXA 2E27H 2WLNA 5HSFA 2HKAA 4XX1E 4U6XA 2IDTA 5I6XC 4R3SB 2DJMA 3P4OA 1AD9B 5CJOH 3O6FA 3EZ8A 1FVCB 5F8RC 3U9PL 3UL4A 2EE9A 2FX7L 2ZOLA 5IB3A 3Q6FA 3TZVC 5D7SL 4APQA 1BQUA 1HDMA 1W6WA 5CSZA 2IADA 1JPGA 4ZFOA 1CK0H 1INQB 5ISZA 4S1QH 3ZE2E 5EDSA 4WWID 3HFFA 3VJ6A 3EH1A 3NSFA 5I1GL 4D94A 4WSKA 3O6FD 4LLYA 4WO0A 4Y16A 1PJWA 1KTJA 3BP6B 3JQOB 5B38B 4U1IA 1NCWH 3BP4B 4GW5B 4K8RH 2NCEA 4APQD 5J3HD 4H0LC 4ZFOL 3EOBB 3MN8A 5IVZB 1E30A 1MFMA 4MA1C 1Z66A 2JJTC 4MX7A 1C5CL 4WSGA 5FUCE 1AJ7H 5DEGA 4LLQB 2DD8H 4I77H 1S7XB 4XNMB 1KWGA 3DYOA 2QPEB 1DJIA 4KKRA 3B6SB 2WBJC 3WSQL 2OTWA 4KRLB 4Y16D 1EDQA 1IARB 3BPCB 1LP9A 2NY1B 1HXKA 1OLLA 3NSYA 5CP3A 5EU3B 1QBLH 4OTXH 2OS7A 2G5RA 2ZKHL 2VW7A 5ESVA 1JZ6A 5F71A 4UYQA 1DVTA 4NQEB 4OZIA 2E46A 2IALB 2NLJB 4IRJA 3VGAB 2D4FA 5LHDA 3TH4T 3UYOD 1RIHL 4YC2C 1T0PB 2DYPB 2DYRB 3CH1B 3D39E 2XIDA 2WXQA 4CAGA 3JTTB 3ZHKA 4FQLH 1ZVYA 2PR9A 3L3KB 1NAKH 4QXUH 4HOMA 2W80C 1JI2A 1JVKA 5FV2A 1CVRA 1NWOA 4Z7NB 1KTBA 5GGRB 1T89C 4A38A 3BZFA 5I74B 4P5RA 2R1XA 4C59B 4Q0XH 3CN0A 3A6OA 1U3HB 3R19A 3L9YA 1EANA 2YD2A 4WNQA 3C2AL 1KLUA 4JFFD 3VGFA 3AU1B 3MJ8A 5EEUA 5LBSH 4LLVA 1K72A 4BEIA 5IMMB 3AROA 1FC1A 2J44A 1ES0A 3RTQB 4EVNB 3MR9B 3I6LD 3S7GA 1U93B 2CJ3A 5ITBH 4P04A 4MBRA 1DJWA 5DFVD 3GKWL 2HFTA 2JKXA 1W16A 1ZK5A 2ZCLL 3DECA 3RVTD 3B9KB 3H9SB 5HHQB 1BFVL 1FI8C 2BVOA 4IRZH 1CF8L 3DROB 3K2UH 3MLSH 3TGXA 4LVEA 4PRHE 3GUFA 1RH8A 5EFIB 2GG1A 3O41A 1KCSL 3GSUB 4E41E 3QEHB 4HIXH 5T3ZH 3BH8B 3I02B 3NSCA 3AJ7A 4LQ1A 4UUJA 3K71A 2ESVB 4PJAF 5DRZB 3D48R 5C71A 2NZ9D 3DDFA 3HZVA 3W3BA 4ZUSA 4H44C 3E0GA 1KJ2A 4HUUB 3VMOA 4ANUA 3F01A 5K69A 2ZUXA 2EEXA 3MRPA 4X0KB 3X2QB 4L3EA 4NWUH 2VW6A 3JUYA 3L45A 3O8XB 5D1QB 1RZFH 2GK0B 4G6JL 3BUTA 4L8DA 2AJXH 2R29L 2NY7H 3KWWA 3RIAK 3CZUB 3V4VH 4HWZB 4XPGH 1WA1X 1FL6B 3PHQB 4J3SA 1KJ2L 4ALAL 3DETC 5JOFA 3UJTH 1UM6H 4G6AD 3P11L 4L3ED 1KCLA 4J3OH 4NSKB 1FL3A 2E5EA 2JCCA 1U8IB 1F8TH 1DZBA 1FIGH 3B43A 3HNVL 5FGBC 2V9TA 4WFFE 4G8IA 4NM8L 4ODUB 1WGVA 2VL5B 2H9GA 5TDNB 1FORL 1ET8A 5DUPH 5F7FA 5ISZE 2P3YA 2ROXA 1RULH 1JERA 3AVEA 3B2XA 2WQVA 3ZJAA 4NZJA 4F8NA 2AQTA 5A16B 4L8CB 1IVLA 2CMRH 3X1BA 3R4DA 4URTB 5D4HA 2JQMA 3KJ4C 4DKTA 1T03H 3O6KH 2VNCA 3GPSA 1QLEH 2P5EA 4Q9CA 2JKIS 2ITFA 3VWKC 1QRKA 1R3LB 3O4LD 2TRYA 2HKFH 1QPXA 3K6DA 4RAVB 5SX4I 4LKCA 1L9RA 3LXUX 4XCFH 4XVJL 4GSUA 4XBGB 3M6DA 4QNPE 2E4TA 2R51A 1T5KA 2WTOA 4MD5B 1KENL 5LN4A 1HESA 4FTVA 1CDHA 4J6RH 1URIA 2BJML 3O2WL 5C0GB 4WVRA 1U8LA 2O5NA 1CD0A 2DRUA 4UOQA 1NC2A 3O3EB 4OZIE 2GJ6A 2VDNH 1EJFA 1M7UA 3AS2A 4K7PY 4KROB 5BS0B 1FJ1A 3TN0A 2DLGA 4W9DC 3OLIA 3JVGA 1OALA 5TJWK 2ADJB 1DEEA 1V7NL 1MCHA 2LV4A 4FN0A 4BKTC 5C0DB 1N7MH 2GJ6D 4PJ7A 3VH8A 4WI8A 1YPZF 3LNHA 4LVNB 1FSKC 4UOJA 3STLB 1Q9KA 3AWFA 1DBAH 5EHFA 2D03L 3GMLA 2VR7A 2VM9A 2FUQA 4AQOA 2GBTA 3F12B 3RKDD 3QUZD 3G5ZA 5HDBE 1TTAA 5DD0L 1JYXA 5EPMB 3SBQA 5L2JA 2HT3C 4PVLA 1GHFL 3TJHC 4RMWA 3FB8A 3NIFF 5AL8A 5GSRA 3OSKA 2DQHH 2XFXB 1K5NA 3DX8A 1TO5A 3R0MA 2VTFA 4ZS7H 1KB5B 5C7XH 2HG0A 1EXGA 5BQDA 1ZLWK 2VW4A 4EF3A 5JIQA 3LEYH 2Q1EA 5C07B 1TQUA 2CR3A 2JI1A 1PU0A 1QYGL 4NQSA 2WXNA 2JQZA 4WCYH 2VO5A 5C08A 4X5XB 1NCAL 1C08B 3FTGA 4ORZC 4AGLA 3BC9A 3GSRB 4G6FD 5D2NE 4XNBA 2H6PA 5GRVK 3QYCA 3WHXA 4M6OH 1NICA 5GRUL 4DOHB 5EIIG 3D12B 3MV9E 1G7IA 4F33A 4WW1B 1MW2A 1JTTA 3QEQB 4R96B 2W0PA 1MCJA 3GRWA 2C1PB 5C08D 1VKXA 2WY3B 4YDJB 5CEYA 3ULUE 5AD0B 4NC1C 3H54A 1GZPB 3BT2H 1LLAA 3D0LA 1UZGA 2R2BB 3PGCB 1YJDL 2VWEC 2LLGA 1F97A 1RZPA 2Q76B 4YHZH 5I26A 3RDTB 3SO5A 4TVUA 1A7NH 5LB1A 4Y1AA 1S9VB 2V8MA 1SMAA 2VDQH 4EOWL 4AYSA 3WIHH 3L8QA 4N6RA 3LYRA 2A6IA 3OKMA 2BERA 4BK5C 3EYQD 4MQ7B 4Z3JA 2Y24A 2BP5M 1S5IH 3VMNA 1KXTA 3IF1A 3VG0H 2EO7A 4A2LA 4N2KA 5LWYL 3HKZA 1Q94A 4JUSA 2EC9U 2YD8A 5K39B 2WNWA 3LZLA 4Y1AD 4FLOA 2GYSA 5F9DC 4R4FH 5D7LE 1GSMA 3N44B 3NACL 3RWDB 5IMLA 2WIIA 3MLUL 1CFNA 5D9SB 2OXHA 3U25A 3RWHB 3RUGF 3BN9D 2CO4A 2EINB 4AGPA 1UH4A 4ZUUA 3T0DA 2RGSA 4OCYH 2DMBA 3B1TA 3PJSB 4X6DA 3WKNA 2J25A 3D4CA 5GS3A 4JAMA 1TZ8A 3IFOA 3VACA 3T0WA 4DZBA 1Z6JT 4FG6C 2F5AL 3U9PH 1IC0A 2XPGA 4XB3A 2P5EE 1RL1A 5D7SH 4JPKH 2F15A 2RAMA 1UFUA 4KOCA 6PAZA 4QHMA 2OMBA 5EG6C 1ILUA 5EC2B 4MMZB 1YNTA 1BM3L 1RJZA 1KCUL 5EU6A 4KZEL 2GCYA 3ATDA 4F7EA 1UXLA 1ZTXL 3MRLA 5TDOA 5IJCC 2ITCA 4FTVE 4UILL 3H1ZA 5I1GH 1X3DA 2R4SL 4CBZA 3SDCC 3PFUA 4AI7A 2IWEA 5F7UA 3US1A 5EOCL 1UACL 1AGEB 4P46C 1QSZA 3FAWA 5D7JA 2J43A 3CBRA 4GRMA 4R6UA 1UWYA 2QT6A 3R06B 3V0JA 1MCRA 5HXMA 5L8LB 1C5CH 3VXMA 1AXSB 1FDLL 1A47A 3CHQA 4HT1L 1HYSD 4XN9A 3WSQH 4NYLA 3FU8A 2X53A 4OSUL 4R3SA 3IDUA 1AD9A 3GO1L 1FVCA 1OARL 1FPTH 3IU3B 4HH9B 2KHAA 2WXGA 2ZKHH 2AITA 2YMTA 4XXDB 5CSGA 3TO2B 2OMXB 4G1EA 3N42F 4YXKL 1GGCL 2BVUA 4QLRA 5I30L 1F1GA 5I8EB 2DKMA 5HHOE 1INQA 1HCZA 1THAA 2TSBA 2YJQA 1RIHH 5JTWA 3TPKA 1OSPL 5CP3H 1WEJL 4WHYG 3H9HB 2BNRA 2Y3NA 3KLAB 2YPLA 3BP4A 3EADA 4AV0A 2A74C 2BIIA 5IVZA 4DP7X 2YOCA 1DDTA 5IK3B 3GS0A 4LCYB 5EF0A 2YARA 3L54A 2O6EA 2PWEA 4JANB 4PV8B 2YN5A 3C9NB 1YC8A 4NJ9L 3BPCA 3KM1A 2GJZA 5EC1B 3P0VH 4RNRB 3F00A 3PUCA 2CKBA 2OK0H 1J0JA 1R75A 3CX5J 3KPSB 4G72B 2W9EL 2FX8L 1WK0A 1RZ8B 4Y0GA 4GEIA 1QRNE 4NQEA 5DMGD 4XOEA 4H7VA 1MRFH 1K8IB 1LO4L 3IJHB 2CLRB 3ZE1B 2IO5A 1YECL 2M8XA 1PLAA 4ERSL 4PJFE 1HSAB 3GKWH 4B27A 5G4MA 2PXYC 3CH1A 2NY1D 2CKBL 1XR8B 2ZCLH 3JTTA 4F37K 3L3KA 1WVZA 5GS1C 1CF8H 4OLVH 4OCNC 3RZCC 2DLTA 4NQED 5DD1L 1AY1L 3RWIA 1IQDB 5GGRA 3C8KA 3B7RL 3FO0L 3KW7A 1KCSH 5KYXA 3QWOB 1R3HB 1U3HA 3MVSA 3VGDA 1WWCA 3MJWA 5BVPL 2AQ1A 3AU1A 4F3FB 4YGVB 4JO2L 3MUY1 3S2AA 4LIQE 1BOGB 4EVNA 2JE8A 3MR9A 5JHDE 3DPDA 4WUUA 1IZJA 4G6JH 1U3HD 4NLHA 3P0YL 2B1AH 3BRDA 1Y7VA 2XTJC 1RURH 4Y89A 4W9IC 1Y07A 1KLGB 3B9KA 1MCEA 5HHQA 2V7NB 4AEEA 4F2ME 1KJ2H 2E9IA 3UIZA 4ALAH 1WZ1L 2XHNA 3P11H 3UJIL 3D0VB 3RTQD 3AM8A 1NKRA 3B37A 4GQPH 1LDPL 2WPGA 4WUUD 4YS4A 4IU2B 3VB9A 3VTAA 1FH5L 1HZHL 3I3DA 3QEHA 5LGYA 4PJIF 3BP7B 4BM7A 5AW5B 2GTWA 3BAJA 3B9KD 3H9SD 1WIPA 5EU6E 5DRZA 3TPUA 4ODHL 4QRSB 3U30B 4Y2NA 1CD9B 4MCZB 4ODWA 4HUUA 4LHJB 3QQXA 1CGUA 1MQKL 4MAUH 4E9TA 4UV4L 5KS9A 1ZSDA 3COOA 3WNJA 1Y6KR 2WB1A 1I8IA 2Y7MA 3KLHD 2ZCKH 2X6VA 1K85A 1JCKA 32C2A 4OBSA 1K9TA 4WKZA 1E65A 4WKXA 3RAJL 3FCGA 2ESVD 2C9UA 2BIOA 2WGNB 2X2UA 5F8QC 4Z76B 3VXME 3IJ7A 5HPMA 4XVJH 4PG2C 1QO3A 3HN3A 4ZNEA 4Z7VA 12E8L 1KENH 4O4YH 4ZUTB 4DZ8A 1UOWA 2A4EA 3O8XD 5D1QD 1CGXA 4YVUA 5FFOA 3IE9A 1NAMB 1PBYA 4HALA 1MAML 4U49A 5F1IB 2OMUA 4ZMLA 1UD6A 4FMKA 4ODUA 5TDPB 3TC9A 3FHAA 5JYMA 3UP6A 2GJJA 5D72L 2OTPA 3L4XA 4KO5A 4JG9A 1LO5B 5E51A 2CZNA 4DETA 2BNRE 4JDEB 1WS7A 5TE4L 3VGBA 1QMUA 2YPLE 5I5MA 3H42H 2H7WA 2VL4A 3E2HB 3IMSA 1GYVA 2ZKMX 3DV4B 4JB9L 3MNVB 3QORB 1F41A 4Z9KB 3FZUD 3U6XS 1R3LA 1H9DA 4RAVA 2D03H 1EEYA 7CGTA 1TQSA 3MYJA 5B8CC 4XBGA 2F7RA 2D9CA 4ZOBA 5DD0H 3F6LA 1E5UI 1GHFH 3TEXA 5FGSA 5FHAH 1E6JL 1KPRA 2DPKA 1XF1A 3QRLA 5C0GA 4KDVA 5C0CE 4MBOA 2VDKL 1I9RH 4KY1H 3O3EA 4JG0H 4WWKB 3FB6B 2ERJB 5L6YL 4QI3A 3BI9X 1QYGH 4ICXA 2V5YA 3I50L 4M8RA 4BV1A 1XCTB 4S0TD 1J1OL 4CMMB 5DMYA 2A6JB 1ET7A 4JZNB 7TAAA 1NGQL 4XE5B 2IV8A 4QHNA 2QFRA 5GRUH 1EMTL 1WH0A 1Q8MA 1YDPB 4DP1X 4KROD 5BS0D 3STLA 1MCOL 1EO7A 2O6PA 2QV2A 1QACA 1XBRA 2LFGA 1SGKA 5FGBA 3F12A 3BKML 2NY3C 3II3A 5EPMA 2FHFA 2Y1AA 3PFQA 1WFJA 3VXPA 4DN3L 2XFXA 1TQBC 1IQWL 3VI4F 1KB5A 1DVXA 1YJDH 3LH9A 5E5MB 3AXHA 1IKNC 2EQDA 2IEPA 5DLML 3V4UH 1MCDA 5F1NB 5B38G 3GRWH 3DUSB 4NIYE 5EH1A 4EOWH 4JFDB 2YMXL 3JBG7 1MHPL 1C08A 4FGMA 3FUHA 1RZIB 5JHMA 3GSRA 2JIXB 5B7FA 3RKPA 5A6IA 3BH9B 5LUMA 1KB5L 4FQQB 3K2KA 1G7QB 4POYA 3LN4B 5E00A 5ECGA 2V4LA 4HW6A 3C60B 4PTUA 5LWYH 3VCLA 1HN1A 2Z8VC 4WF7A 5C07D 4MNGE 1M6UA 4HWBA 3NACH 4LESA 4N9GB 4R96A 2C1PA 3RG1C 3HNTL 3MLUH 4Q9RL 1TVHB 5AD0A 3JYBA 5LGKA 4YHYC 3QIWC 1FFPB 1GZPA 4D9RE 4PJGB 5HJ3B 3N50A 4LXFA 1OV8A 2R2BA 1IFGA 4H26B 5IQLA 3RIKA 2FVNA 2FO1A 1UQSA 4QT5B 5D2LA 1I7ZA 2CRMA 3FK3A 4U3XA 4HWBL 3QEQD 5KS9E 1S9VA 4LCWB 2VQ4A 3OKEB 4AGMA 2ADIA 3HRPA 3TBSB 1SXCA 1HHKA 2FL5B 3OJ2C 4MQ7A 2MPAL 4JVUA 2X6UA 2ZXBA 3H9ZA 1KCUH 1XXFC 3NMEA 4I18B 4KZEH 2ZP9A 3LPPA 3LJ3A 3RDTD 1ZTXH 3CSBA 4Z7VE 3RU8L 5K39A 3ZGIA 1SBSL 1T7WA 2R4SH 3TYGH 5E8NB 1NBYA 1E2ZA 4PLKC 3RWDA 4NUPA 3ARUA 5EOCH 3I6KB 5D70L 3RWHA 4KFZC 3VE0A 3LSOB 3APFA 4L8SC 3FTUA 1S2EA 3WJMB 3EJTA 1FDLH 3CDGB 2YQ3A 3M8OH 4HT1H 4MS6A 4R0LC 3TA3B 3ZK0A 4I3GA 4OGAC 4OSUH 2FJGB 5AW8B 3WS6C 1G6VK 4XNYH 3GO1H 3QO1B 1OARH 3IGLA 1GYCA 3DX0A 5IV2B 1VEPA 2DZEA 3BSZL 4YXKH 1GGCH 2YLHA 5I30H 5EC2A 4MMZA 4P5MA 4QHUB 1I3UA 2H45A 2UWEF 2MCG1 4ELME 4U6YB 4ODSL 3ZT6A 5HI4D 1D2PA 1SXNA 4MDJA 5TPWL 1WEJH 4UIKL 4Y19A 1P4LB 3GT6A 2DQTL 4OJCA 2W0FB 2WUCH 5T5NF 2BC4A 4AQEB 1AGEA 4Z7QF 1UVQB 3NCCB 2IQ9L 3MXVH 1NFAA 4U7SA 2QTVA 1F6AB 2CBOA 3FPYA 4EQ2A 4LK4A 3ZDZF 2JLPA 1A4JB 1AXSA 2O1AA 3SDXA 1BXXA 4NS0A 4BK5A 4DO4A 1WJ3A 5D96B 2PPCA 4NQDA 4Y19D 2GITB 4HJ0D 4NZDA 3IU3A 4HH9A 3VXNB 3BVDB 1BFSA 1EGJA 4LCCC 4DFHA 3RRQA 2W9EH 3BAIA 5I8EA 4BH8B 5I6PA 5KW9L 5IVXF 2HZHA 3V0VA 43CAB 4ERSH 3KLQA 3G5YB 3U1SL 1KCRL 4XN5A 4CSPA 5B3JF 4AJ0A 5IJKC 2NW3B 4NQDD 4XPTH 1MY5A 3FSZA 4H4NA 5FFGA 3KLAA 2CKBH 3GJEB 1NEPA 4I0PB 3TBBA 1KCBA 2APSA 5MI0B 2KMWA 4KJPC 1HWWA 3QJVB 3HG1E 4ZO6A 5DD1H 3MKKA 3CHSA 4C57C 1JYVA 3IDGB 5IK3A 4M43L 3FO0H 4LCYA 5AZUA 4DPAX 2FIKB 4X98B 3CIQA 2CR0A 2B0SL 2FH8A 2PCYA 3HMWL 4M48L 4JANA 3C9NA 3FQUB 2FK9A 2G3NA 4PB0H 5EC1A 2EACA 4PMFA 5BVPH 4RNRA 1GOGA 4NZTL 4KRNA 3KPSA 2X70B 4KAQL 1KLFA 5AB2A 1JG9A 1RZ8A 1T6WA 3CIAA 1JNNL 2QLYA 4FFVC 2R8SL 4HS8L 4WI4A 5FC9A 2CLRA 2ZUUA 3NJHA 4PJDB 4AYFB 1HSAA 3P0YH 5SWZA 2JCWA 1ULVA 2QQNL 1XR8A 5G4NA 4DQOL 3KPSD 5F7LB 5D2LE 2NR6C 3I6GB 2XWEA 3VNYA 1IQDA 3FFDB 4YQXL 1BYOA 2WSPA 1IAOB 1FH5H 2V7HA 4LCCB 4QRPB 3P69A 1HZHH 1R3HA 1Z9OA 2E76C 4J12A 4HUVB 5BJTA 2Z91B 3OHXC 1JWMA 2GY5A 1DBML 5IM7B 1L9NA 1A6AA 3B7UX 3CDZB 3KYMA 4F3FA 3M88A 3WEOA 4YGVA 4CJ0A 3C5JB 4E42A 4E9SA 1OP4A 4N8VG 5DO8A 1MQKH 1XH1A 1BOGA 3GK8H 3RPIB 4JKPH 3M7FB 1ZLUK 35C8H 3PAYA 4KFMA 4CBPA 5CZXD 5H94A 2A74A 4FYQA 4J8QA 4KVPA 3RAJH 5I1DA 3PRZA 2DI8A 2AK4E 4M7KL 1KLGA 5HJBA 2V7NA 4A68A 2EC9T 5IUSA 4LLDA 4WU5A 3D0VA 2D7TL 12E8H 1MFUA 4IBVA 2AJUL 4JMNA 3Q6GH 4HUWA 4IU2A 5L8KB 1MAMH 3CHOA 3G6AB 9PCYA 1J1XL 4OBRA 5SX4H 3DC0A 5E2UL 4G3YH 4WRLA 4X9GA 3KPTA 3GI9L 2AEOA 4MXQD 4MCZA 4U1HA 4K5MA 4NC1E 4X4XA 1SHWA 2CA4A 5EUOB 3S96B 2PXYA 5TE4H 1DQVA 1N59A 3EF4A 2EEAA 1BJ1H 4K2UL 2VWEE 4ONOA 3RZCA 3TEWA 4RDBA 1ITBB 1NCOA 5FCSH 4I48B 5K1VA 4PWKA 4U0QB 4M1DH 4Z76A 3V52H 2F6AA 4HEMA 3SDXE 3KPRB 5I1JL 3W81A 4GKZB 4G11A 4KOBA 1MCQA 1OK8A 3CPLB 4ZUTA 5JW4Q 5D4QA 1E5BA 3IFNL 3ABKB 1E6JH 1NAMA 1O5PA 3AT9A 2VDKH 1A7RL 1B2WL 5F1IA 2ZWSA 4GKOA 5TDPA 2C9XA 3PIQA 1DANU 1MPAL 4B0MB 5L6YH 1RV6X 3T3MF 2IOIA 1XGQA 1L7IL 3QJOA 3I50H 4XC1L 5C6TL 3EUDA 5E4AA 2WQ8A 1J1OH 2CDEB 3UEQA 1LO5A 1NMCB 4JVPA 1G43A 4M3HA 1M53A 2DL9A 1CU4L 3NIGE 1NGQH 1NAML 1KCVL 2J8HA 5L2KA 5E9DE 1AO7B 1LE5A 3OKLB 3CFUA 4W9EC 1BXUA 1V7ML 4QO1B 1WA0X 4RQQA 2O6DA 4FLQA 4FX5A 3DXAB 3SKNB 1ZLEA 4JGMA 3LD8C 3UC2A 3BKMH 4R7DB 4JQVA 3T6QC 4MRBA 3S35H 1L0YA 1F4WH 2G75B 2X4PA 2IANB 4DKAA 1MJJA 3P4MB 4NAMA 5KVGE 4DN3H 1CDCA 2GJPA 1IQWH 2YPVA 2MSPA 1PQZA 3QORD 5DLMH 5FCUH 4XCYB 2CJTA 2FEDC 3OXSA 4YSSA 4JREC 2ORBL 4KK8D 1XCTA 4AM0B 1QLRA 3KD4A 5LCVA 4I2XB 4KRPB 2BOBA 4CMMA 3FNKA 2HVKB 4JZNA 4XP4L 5AOLA 2YPVL 3PDOB 4W9ZA 1KB5H 5A7BA 4NZFA 3KCPB 4PG2A 3PF2A 2P24B 1LO2L 1ZT1B 3O45B 4B9IA 1RPKA 1OAXL 2HJKB 4PJ5A 3MODL 3HNTH 4Q9RH 25C8H 4KQ4L 1TITA 1M1XB 1RZJL 5KVDE 2NPLX 2UVEA 4XN8A 5IF0A 4PGDA 1NIDA 3LNFA 2DQMA 1I82A 2Q3AA 4HK0B 4LHUA 2PUQT 2GUOA 4HPOH 5E5MA 3T2QA 3VA2C 5BNXD 1JN6B 1PY0A 4WY7H 1BG1A 1OLZA 4PJ5D 5F1NA 2NDFA 4HWBH 3JSSA 1KGCE 3OLEA 1GXEA 6FABL 5T1KB 3QZLA 2LLNA 5HDBB 5ABDE 4K94C 1F3DH 3OB0H 1RZIA 4S2SB 4PJAE 2MPAH 3BH9A 3CX2A 4PJBB 3IETA 4C56A 4U1SB 1G9ML 2YRBA 3RU8H 3HC3L 1SBSH 4F2EA 4M02A 4N9GA 4JCMA 2FCBA 2QFPA 2R0ZL 3MKGA 4LVOB 1TVHA 2HSIA 1DQML 1KDJA 4LKXB 3WKPA 1SRDA 1D6EA 5HJ3A 5DJ8B 2IDUA 4ODVL 3MV9B 2C4XA 4H26A 4NN5C 4YXLL 2XCMC 1S7TB 2A9NL 1ZXKA 3UZQB 2Y23A 1TT6A 5EWIH 1KBPA 4ATWA 3ZMNA 3MA7B 1ZOXA 3SO3B 1XD1A 3OKEA 3QWQB 4FEIA 1K4CB 2XBDA 3WY4A 4YUEL 3IS1X 4X5QA 4P49A 2EVHA 4LP4A 5HHME 2FL5A 1E4HA 1SBBA 2P1YA 1CG9B 1EIBA 1BYPA 4HEME 3S37H 2DWXA 1MOEA 4ODSH 3ARVA 4KUCD 1WHPA 5AYTA 2J5LB 5TPWH 4HS3B 4LCWD 2D0HA 5E8NA 4UIKH 1E5AA 4LVHB 5BXFB 2DQTH 1QWHA 4BFIB 3I6KA 4GKLA 4XMKL 1IKNA 2VH5L 3J7HA 2QGBA 1F4HA 4S11A 3LSOA 2UVFA 2FLMA 4ODXA 5I66B 2NY3D 3RLSA 3BXNA 5D7IB 2XTJE 1EJ8A 5DHMC 3TA3A 4DO6A 2FJGA 1PZ5B 5L2KE 1V05A 3D3VA 1BVKB 3QO1A 5EN3A 2OPCA 4UANA 1OTTD 5FO7B 3BIBX 3VVVA 1LGVA 2WQRA 3FC8A 2IC2A 4FNQA 3PL6B 4QHUA 5KW9H 4UBDD 3NQIA 2W81C 4PUBL 3WD5H 3QH3B 5KAQG 3U1SH 1EAPB 1KCRH 4U6YA 2DN7A 3TA3D 4AQ8A 3FMGH 4D8PA 3QIWA 1N0XL 4F7PA 3N41B 1MAKA 1EGJH 2XX1A 3FQXB 1P4LA 2WWMD 2WYZA 4FC3E 2FT6A 3MRJB 4OV5B 1CFSB 4AY0A 1UVQA 4XMPH 2GSGB 4C8XA 1URZA 1Z5LB 1OGAE 2J8UF 3NIFE 4M48H 3QIWD 3MCKB 2K6YA 3HAEG 3W38A 2K8QA 3FDWA 5F7BA 2GITA 1WC7B 4JM2C 2AC0A 4V11A 4NZTH 3VXNA 5BV7B 2QR0B 4KPHL 1JNNH 3UDWC 4ISVB 4HS8H 1NFDB 3HVNA 4F9LA 5F3BB 3EYVB 1XMEB 43CAA 2ARWA 3IPBA 1YO4A 1GGBL 2OMNA 2DQFB 3ZYOA 4N2LA 3WLBA 1A6ZB 2NW3A 2DQUL 5L7XL 2B2XL 4I0PA 4K7PX 4L8SA 5CEZE 1PZSA 5D7KE 3VXQA 4P5KB 2AJVH 2Z7UA 3V8CA 4R0LA 2EH8L 4MSWB 2UZYB 2HRHA 2YEQA 3OMNB 3IDGA 2YAEA 1JWUA 4PLKD 4YQXH 4ANKA 4JDVA 4IOSA 2P8LA 5TQ0L 1F4YL 5ETUA 3GSQB 4O58H 5D93C 3AMKA 4JFOB 5D6DC 4K15A 4I0PD 1XXDC 2DLIA 4J3VA 3FQUA 4R26L 3WG7B 5LDUA 4FLRA 4RMBA 3VD1A 2BZ7A 4C4KT 4ZUWA 4C56E 5LXVA 2AZAA 2E7CA 2VDLB 4NGHH 1MN4A 4J8RB 4ZQKA 1B4RA 1XBDA 4IYKA 2IFGA 3WLWC 3QZOA 1FO0B 1NGZB 3ARGB 3N0PB 3MGTA 3VA6A 4A2FA 5GS0C 2UY6B 2BRRL 4LE8A 5B1BB 4F8TA 3ILDA 1TTRA 4PJDA 1ZKAA 3KYKL 4HAKA 3MJ7A 5TGBB 2EECA 3D69B 3NJIA 1BCIA 3BMVA 4FMFA 4MS8D 1G1CA 2AJZB 2IMNA 4M7KH 2CM6A 2WWOA 5AVQB 2E59A 4PW3A 4GG8B 2D7TH 1W8EA 2VN3A 3G5VB 1TJHL 2AJUH 3I6GA 1M57B 1AKJA 5A2CA 4JNXA 3EO9L 1FFOA 1IAOA 2ZG3A 3EFFA 4LCCA 4LF3B 4QRPA 4CN4A 3QS3A 4OD2A 2X1XR 2Z91A 3K72A 1HE7A 3IWUA 1BZ9B 4I0CC 4Z23A 4HKBB 4B97A 5E2UH 2VCOA 3NIDF 4KO6A 3GI9H 4ZTEA 1DO6A 2WJ7A 3C5JA 4WGVB 4H13C 5IJKA 1K6QH 3QULB 1AKJD 4U1MB 5JORB 4IW4C 3RPIA 4HGKC 3SKJL 5HYEA 4QRPD 1IBHA 3VSUA 4DESA 3F7QA 2B20A 2KZKA 2FGWH 3ZBMA 2FQGA 3WDHA 4PJCF 4XVTL 2EIZB 1ASPA 4Z8FH 1OM3L 5GGRY 3V7AG 1C5BL 3MJ9L 5DJCB 3U0TB 5F88B 4YL9A 3D3VE 4GUOA 5T1DL 4DERA 4N87A 3LHPL 4I0KA 4AJVA 5LQBL 3MV8B 3AU0A 4KJPD 4U1GC 4GUCA 1I8LC 1IBGL 1A7RH 1B2WH 3G6AA 5K59E 4DW2L 4PJHF 1WPCA 2A6DB 1KGYE 3GS4A 1L7IH 2Y7NA 2A38A 2AJYH 4U33A 4XC1H 5C6TH 4ONGL 2IH1B 4TYUA 5EUOA 3S96A 4JR9L 2CK0L 5T1MA 3RDJA 1GZQA 2GSIB 1NAMH 1KCVH 1SMOA 3LZPA 2YC1A 2AVGA 2EDXA 1HCFX 2UZPA 5CLXA 1XGUB 4NBXB 3VRJB 1TPXB 5EO9A 5I6KA 1V7MH 5E1IA 4I48A 4TLKA 2V6HA 2ZXQA 4PG9B 4X4KA 1T22A 3HS0B 3KPRA 3K7UA 4GKZA 3OHXA 4YSDA 3BP5A 5MENB 5HHVL 1YSOA 3NSJA 3KPLB 4BE5A 2XLLA 3BUQA 2YUWA 4W9HC 1JGEA 2XN9E 4EBQH 4PQXA 4FQCH 2ORBH 3KPRD 4WENB 1RSFA 1MF2L 4IIZA 4HEPA 5ABAA 2CDEA 3VXRB 5ADPL 1E5ZA 4BZ1A 3FFCB 4MJHA 3O0LA 1MJ8L 4P9ML 4XP4H 3ROLA 2YPVH 3GQFA 2GI7A 3MV7B 4GAAA 1F00I 5FUZH 2VRKA 4FI8A 4AMWA 1AO7A 4DCQB 3NP3A 5FX3A 5LNDA 4QO1A 1OAXH 3X1GA 3QJZA 1A3LL 3DXAA 4U1GB 4ZW8A 5LCVH 3V55A 4MB3A 1F11B 4BZ1L 4R7DA 1OCZB 2R39A 2ZSVB 1FZOB 1RZJH 4HIJB 4HSQA 3I75B 2J8OA 3IDMA 4O9HL 2G75A 2WVTA 3AB0C 2D0FA 3NK3A 2IANA 1NPJA 2BHZA 3P4MA 2OL3B 3U36B 1TYJA 2XWDA 1RJYA 1AO7D 2ZZUT 3HN8A 3L48A 1WAEA 4OZFB 3MRMB 4XCYA 2QPUA 3DXAD 1IFRA 4KBPA 4RLDA 5I9QB 5AEAA 4TPRL 6FABH 2NX5B 2J2ZA 4DEPB 3Q9QA 1AHKA 1N2RA 4I2XA 4OM1L 5AVZB 2R7EB 2IAND 3I85A 3PDOA 4GAJL 3T2NL 2P52A 3KCPA 1G9MH 1SNRA 2P24A 1ZT1A 3O45A 1AOZA 3PUUA 3HC3H 3DVNB 3WFEL 3TBCA 5I0YA 3FUMA 1ICTA 3QNYA 5E9NA 4P9HC 4EXPX 2YD7A 2R0ZH 4KRPD 1SF5A 1M1XA 1DQMH 4PJEA 4YIQA 4XX1G 5I73C 1NIFA 2L7JA 2V37A 4IRSB 4ESKA 1EDHA 3NJVA 2A9NH 4U05A 3Q2LA 5T1KA 3TBWA 1TNNA 4YUEH 3KYAA 2FJSA 3RHWK 4N5ED 3BQUC 2H3NB 1P4BL 1A6UL 3QWRD 1N19A 4M4RB 2ZIDA 1EQWA 4U1SA 2PYEA 1QNZL 3HC0A 5CBEA 3LPGA 2A99A 1FNHA 4AXWB 3U7WH 3UROR 5DRNB 5E9AA 5LGJB 1BEYL 4EO5A 1IB5A 5T1KD 5L88L 2BSDA 3FN3A 3E80A 4A1RA 3RVVC 1ERNA 2VZSA 3O6ML 2VH5H 2WSDA 4LKXA 1G0YR 4I3SL 1IC1A 2N1TE 3LN9A 1I3RA 5HGDB 2NNCA 5DJ8A 4WW2C 2PYED 5DDHB 3KCWA 1S7TA 2VDOB 1AFVL 3ZO0A 3MA7A 4NC0B 1ANUA 4JFPA 4N20A 1K4CA 5H37A 2AJ3A 4HOXA 3BE1L 5AAPA 5DURB 5F7AA 4NHCL 1CG9A 2FEDD 4LOVA 4QOKE 3AACA 3BWSA 1JDCA 3ILEA 4CVXA 1HJCA 3LVEA 3F84A 4L3CB 2WZPD 1ZCRA 2YBRB 1PJ9A 3PWPE 1I1AC 4PWGA 4HS3A 1IKFH 5KBDA 3EZJB 4YO0A 3DJ9A 1QHPA 5BXFA 4MXWL 3VRIB 2E6PA 2QVIA 1ZLVK 2IWFA 4WI2A 3C08H 3M1CA 3FQ2A 1FYTE 4Z7UB 1OGSA 5IEHA 4NHUB 1XO8A 2WNXA 5D7IA 1ESOA 2WXJA 3L7EA 4KK6C 2GK2A 1KPVB 5DZAA 3VI3F 5CLWA 5F7DA 5JIIA 1DYZA 2AHIA 1PZ5A 2O5YL 3KH3A 1BVKA 2EUXA 5DRWB 2PCPB 2IQAA 2BY1A 3L16A 3SD2A 1VERA 1DANT 4I1RA 4JO4L 4K5NA 5FO7A 4GAYB 3TEUA 5JZ7C 4HBCH 5DI8B 3FUFA 1CF1A 3H4HA 1JNLL 2IVFC 5EF3A 4QEGA 1ACYL 1GGBH 1J87A 2N7BA 1S9YA 3HE7B 4FCAA 3VD4A 1M05B 2YLKA 3QHTC 5GZNC 5L7XH 2B2XH 1ZHKB 3FQXA 3FQYA 4KI5F 1GL4B 4OV5A 1CFSA 3DRTA 1HQRB 3WEBA 1WG3A 1XF2B 2F74B 1ASOA 3MGOB 3TT3L 2OMYB 4H8QA 1DQDL 2H1PL 3PL6D 3ISYA 4ELMB 1F4YH 1SJVA 4P4KC 4PAZA 3KXFA 3MCKA 4DJMA 4R26H 2E8YA 5FYKE 1JHKL 1WC7A 2F53E 3UG4A 4YSRA 4NT6A 4PBWD 3UYRL 2RR3A 2QR0A 3CQPA 15C8L 5CUSH 4AM0Q 2P5WE 4B41A 3U4KA 2BRRH 3V9FA 5FO9B 2EDNA 1TZIB 3EYVA 3SPCA 2NSMA 2NZ1A 4PJEE 3CHPA 2DBJA 4RAUB 5C0AA 2VR5A 3QUHA 5BV7L 4YWGL 2ZOOA 3K5SA 3LPOA 1RFDL 5HVHC 4X0NA 5DVKA 3QZWB 2FSEB 4MSWA 3NFPB 2UZYA 1H3PH 2LE9A 3ATAA 1FVDB 2JJUA 3H2WA 3N3EA 4YAQB 2OTUB 1P1ZB 1TU2A 3D87B 1HI6B 3EO9H 3MMEB 3QXVA 2D2OA 1S7WB 1H3VA 3GSQA 1U42A 4HZ1A 3FTVA 4HIEB 5C0AD 5LO7A 3EYOB 4IGBB 1J0IA 2Q2EB 4JY6B 5HI5C 4HJGB 3WFZA 5DJAB 3LQAC 1FNFA 1E67A 2CCWA 3S3SA 3QPXL 1R19A 1RD6A 2Y2WA 1UWEH 1FO0A 2IG2L 3ZDYB 3WUWB 4HK3J 5FYJL 2UY6A 1NOLA 5FYJD 1I8MB 2Q86A 3M86A 5IQMA 4NO3A 3HE6C 5TGBA 3FT9A 1MG2C 4Q4EA 1AQDB 1ZS8B 4TRPH 3QJFB 4XVTH 4KJWD 4FXLA 4Y2DC 4D7BA 4GFTB 4ZSOA 1OM3H 1XX9C 1FO0L 1RJLB 3CFKB 1C5BH 2B4CC 1BBJA 4WWNA 3ARGD 1FFNB 2BINA 4GG8A 4W93A 2DYSB 5HGBA 5C0EB 5CFHA 1IBFA 5T1DH 3G04B 3LHPH 1IBGH 1P5UB 4KC3B 2FB4L 1H6EA 1OT1A 5D5ME 3UDWA 1SN0A 3OR6B 4FQIL 4S1SL 4F1SA 5FK9B 3M1BA 4HKBA 4UQ2B 4G8FB 2BW5A 3QQDA 4IMKA 2IBZY 1OSYA 2Z8RA 4JO1H 1ZVHA 4JR9H 3BIAX 2CK0H 3A3YB 5JORA 2F8XC 2FUTA 4O2CB 1XGZA 3CZSA 1JF6A 4OJFH 5HVHB 5IIEA 5BQ7B 4MKMA 3SYOA 1KSRA 2X1QA<