2WO2B

Crystal structure of the epha4-ephrinb2 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
136
Chain Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
molecule keywords EPHRIN TYPE-A RECEPTOR
total genus 29
structure length 136
sequence length 140
ec nomenclature
pdb deposition date 2009-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2wo2B00
3QJQB 1E5YA 2HRHA 3UGEA 4BDVB 2AFNA 1XB8A 1MDAA 1L9RA 3FPYA 1WA2X 1GY2A 1A4BA 2VN3A 4HCFA 2N0MA 1JZGA 1ZIAA 4E9TA 3QJTB 4WKXA 5IY5B 2A3TA 5B1AB 4A67A 1JVOA 2FWLB 1E65A 1ET5A 1SDDB 4K9JA 1SHXA 2WO2B 1A4AA 2YAHA 3FQYA 2CCWA 4DP0X 4HAKA 4E9XA 3ZDWA 3OD3A 3HEIB 4L0PB 1IC0A 5B1JA 1IBYA 4BXSV 4MFHA 2BW5A 2YXVA 2ZOOA 1KDJA 3S3DB 3PLYA 1XB3A 4YSDA 1ZV2A 3X1EA 4YSSA 5I6NA 1A65A 1ZDSA 2X87A 3ZBMA 4YSQA 4YL4A 2PPFA 4QLWA 2EIMB 4E9RA 2IWFA 1KCWA 1E5ZA 1NIEA 3ASNB 3PAUA 4P5RA 1JOIA 4E9YA 2UXFA 1QNIA 1L9PA 3H56A 2FTAA 1KBVA 1W6LA 3WG7B 4GYBA 2VSKB 3NJNA 1SF3A 1AR1B 1PZBA 3GYRA 4ENZA 2IWEA 3CZUB 1PNCA 3H4HA 4BXVA 3ABMB 4KNUA 3NP3A 1ILUA 2FT8A 1AZCA 2UXGA 2ZXWB 2IDTA 1JXGA 1PNDA 3ASOB 5B7FA 7PCYA 1WS8A 3TBBA 4QKTA 2GHZA 2WO3B 3FQ2A 4E9WA 1CC3A 3FSZA 4E9VA 3JTBA 1AG0A 2ZONA 3NSCA 3C75A 1PLAA 2I7OA 5I28A 1FWXA 2AZUA 2BW4A 4DP9X 1MZYA 2OV0A 4YVUA 2AZAA 2XV2A 3D12B 3MBWB 1J9RA 1KBWA 1GY1A 3NJGA 1BQKA 2H5UA 2FNWA 1QHQA 3WIAA 2HXAA 1PMYA 1UATA 1L9OA 5B7MA 3CVBA 4F7KA 2EINB 3WKPA 1JERA 1OE1A 3FPXA 3S8FB 1AS8A 3UADA 1RCYA 3GXUB 5F7BA 2P80D 4A2EA 1MZZA 2UX7A 1RZPA 3OQRA 1JZHA 1PLBA 2XXFA 4W1TA 2BWIA 2P80A 4DP6X 4JKNA 3IE9A 4JHVA 4KNSA 1J9SA 3TA4D 4YSUA 4P5SA 4BDVA 1NWOA 3FSVA 2W88A 1A8ZA 1EHKB 1T5KA 2FQEA 1KV7A 3EH5B 1BXVA 2YAOA 1M57B 2YAPA 5PCYA 1EZLA 2PCFA 2TSAA 1CYXA 1L9SA 3NSYA 3AG2B 3QJRB 1QLEB 3PCYA 4BWTA 2VMJA 1BXUA 2JKWA 1OCCB 1OCOB 1PCSA 3QJSB 4M3HA 2GI0A 3X1NA 1CURA 1ET7A 5D4HA 3UAAA 1SJMA 2CJ3A 3NP4A 1J9TA 1SFHA 1E67A 3RYMA 2BO0A 2DV6A 4G7SB 3AG1B 3T9WA 1L9TA 1OF0A 2YAQA 5AZUA 1XB6A 1JZEA 2QPEB 5I6OA 1N68A 1OOWA 2CALA 4YSRA 3QJVB 3NSDA 2XYBA 2BHFA 3FU8A 5I6MA 4CSPA 2PP7A 1NWPA 2IDQA 3G5WA 4FA7B 4AZUA 3CG8A 4TXVB 1GS6X 2W8CA 1ZDQA 2RACA 1PAZA 3H4FA 2IWKA 5I26A 1IKOP 3AW5A 1SHWA 1IUZA 2BP8A 3EH3B 4GP4B 2QT6A 1F56A 2HX9A 1KCBA 3NSFA 3CDZA 3PXLA 4EF3A 3QQXA 2HZHA 2YAFA 4HZ1A 2DWTA 5LDUA 3KW8A 3GDCA 1KDIA 1X9RA 2HX7A 1AZUA 4NAJA 5I6PA 4W9ZA 3S3CB 1JZJA 2Q5BA 3NJIA 3WNJA 1DYZA 3NJKA 1ASQA 1AZRA 2QDVA 2YAMA 4NERA 1WAEA 1X9UA 2PP9A 4GY4A 5AKRA 4PCYA 1HFUA 5B1BB 3UAEA 4E9QA 3UABA 3EF4A 4FAAB 2XX1A 2MTAA 1ADWA 3NJHA 1GW0A 2AANA 3FS9A 1ILSA 1CUOA 1NICA 3FSAA 1AACA 4A2GA 1PLCA 1IBZA 2IDUA 3TASA 3AG4B 1NZRA 3OMAB 4AKPA 1V10A 3CVCA 4YSOA 5B7EA 4DP1X 2J57A 3OM3B 3S3BB 2E86A 3HB3B 2I85A 2XUWA 2DYRB 1ID2A 1NIDA 1TKWA 2AVFA 1MG3C 2FJSA 3WKQA 1AG6A 1JXFA 1BYPA 1W8EA 2LLNA 1ASPA 3KW7A 3DKHA 4G71B 3BQVA 3TBCA 5EHFA 2XX0A 3QJUB 1HAWA 1JZFA 1FA4A 2J56A 2QPDB 4HHGA 1NPNA 4YSEA 8PAZA 1E30A 2J5WA 3EH4B 2QDWA 1RZQA 3X1FA 3EHBB 3FSWA 1BYOA 4KO9A 3AZUA 2GC7C 2WSDA 4YSAA 2VW7A 4JHUA 1VLXA 2GC4C 2Y69B 2ZWNA 1WA1X 3S8GB 4HCIA 3NJJA 1DZ0A 2JFCA 2CBPA 1R1CA 4A2HA 2YARA 4RH4A 4X4KA 3SQRA 1JZIA 4F2FA 1WA0X 5B3SB 4BWUA 3NJMA 1GR7A 3FU7A 3FYEB 2H47C 1WS7A 3FT0A 3IEAA 5D4JA 5TK4A 2XWZA 5TK2A 3V9CA 1FFTB 4DP2X 1AZNA 1PF3A 1M9WA 2VM3A 3FQ1A 5AFAA 2H3XC 5D4IA 4AI7A 2YQBA 2HX8A 2VW6A 4YSCA 2EIJB 1J9QA 2IAAC 3ABKB 1GS7A 3PAVA 4G7QB 2OJ1A 3X1BA 3PAZA 3FYIB 4UANA 1A3ZA 1ASOA 1AZBA 5I5IA 4E9SA 3WI9A 6PCYA 2R7EA 1A4CA 1XMEB 3CVDA 2X88A 4BWWA 1JXDA 3AY2A 1GS8A 1OCRB 2IH8A 3CDZB 4GP8B 4Q8BA 1TEFA 3FU9A 2GSMB 3JT2A 3TU6A 1NIBA 3OMIB 4DPAX 4A66A 1OCZB 1RKRA 1V54B 2XU9A 3BVDB 3ZIYA 2BWDA 4KO6A 1AS6A 1SNRA 2DYSB 3AG3B 3OMNB 4UAHA 1YLBB 1W6WA 4GP5B 5I5JA 4ZK8A 2XV3A 4HALA 3SBRA 2DWSA 1M56B 2BP0A 2EIKB 5I6KA 2UXVA 1URIA 3T6WA 2I7SA 3FU7B 2GIMA 1NDTA 3NT0A 1AAJA 3SBPA 4AX3A 2CUAA 1J5DA 4A2DA 1BEXA 1AOZA 2PPAA 2Q9OA 1SDDA 4DP8X 4CSZA 4GXFA 1ETJA 3X1GA 2PPCA 2XV0A 2PCYA 2XXGA 1OV8A 1B3IA 4DP7X 3IN0A 3L45A 3N55A 3ERXA 7PAZA 4DP5X 1L9QA 5B1JC 4HIPA 3N2JA 3UACA 4G7RB 2UX6A 2DY2A 5A7EA 2JXMA 1BXAA 1NPJA 4AKOA 4DP4X 3NJFA 3MX0B 2B3IA 2NRDA 5I5MA 2FQGA 5FC9A 1ET8A 2HRGA 5F7AA 2BZCA 2J55A 3ZX1A 1AS7A 2TSBA 3NYKA 3T6ZA 2MRYA 9PCYA 2BZ7A 1I53A 2VW4A 2YAEA 4WTQA 1ZIBA 1CYWA 4N4YB 2XLLA 4UF7C 3PPSA 2YXWA 1NIAA 1TU2A 4NB7A 4F2EA 1NIFA 2EILB 2IH9A 2XVBA 4AKQA 4KNTA 1AQ8A 5B1KA 1J5CA 2CAKA 3T6VA 5E9NA 1MG2C 4KOBA 2PP8A 1HAUA 1NINA 2B08A 4HHWA 4G70B 1BAWA 2UXTA 3DTUB 4YSTA 2PLTA 3X2QB 4DPBX 4DPCX 4G72B 1V55B 2VM4A 3T71A 1PZCA 1PY0A 1BQRA 2FT6A 2Y1AA 3IN2A 4M4RB 1KYAA 1KGYE 2BP8B 1ZPUA 5I6LA 2VSMB 4YSPA 2FQDA 3NJLA 3SBQA 1NTDA 2FT7A 3U25A 1GYCA 1TEGA 4N8UA 3QPKA 4PAZA 3WNIA 4A2FA 1JVLA 2FQFA 2R7EB 4A68A 4KO5A 2OCCB 3ABLB 4HCGA 4KOCA 1BQ5A 1N70A 1OE3A 2PPDA 3V9EA 5PAZA 1OE2A 2GB2A 4BK5C 5ANHA 1AIZA 2IDSA 3DIVA 2GBAA 4KO7A 3T6XA 2PPEA 1GSKA 2HLEB 1SFDA 3IBOA 1PZAA 4Q89A 6PAZA 4YVNA 1AANA 2IDFA 2BP0B 3ABGA 1SF5A
chains in the Genus database with same CATH superfamily
1VJSA 4CW1B 3L7EB 4G1MA 2J8HA 1EJOL 2FEEL 4U1JB 3KBEA 5F8RC 1PJ9A 2D31B 1I1AB 3JUYA 3W9EB 3SKJH 1P84K 1NSNL 1NC2A 4M7LL 4BFIA 4UV4H 4NJ9H 2Z35B 5DI8B 3UBHA 5D1QE 5DK0A 1K5NB 5HDWA 5C07A 3AT0A 2C9XA 1B0WA 5E2TL 3W81A 2EH8L 5F7EH 4HPOL 2WQVA 1YYML 2JE8A 1KJ3H 3DRQB 4EOWH 3F7YA 1EHXA 5TDOB 5JPNB 1JNLL 2X5PA 2F2HA 4FP8L 2YBRA 2P44B 3NIFE 5IREA 2Y06L 3HEIB 4ECNA 1TTAA 5FYLL 2COVD 2DAVA 3UTQA 4TSAH 3BN9C 3WFEL 4HZLB 4JANB 5IQLA 3NABL 4LSTH 1DQDH 4N90D 1FLRH 1KDJA 3AXHA 5KVGE 3AM8C 3BPLB 5D1XA 3ARRA 2EABA 4YDVB 3DC0A 3UTSE 4GAJH 3EJYC 5CN1A 4N9OB 4BCZA 1NCBH 3C6EA 1EQWA 1ZDSA 2W65B 5EOQL 4LLYA 5JXEA 4NUPA 5KVDE 3IDIB 3RGVD 1UQSB 2DI9A 3KLDA 3O45A 4IYKA 4XBGB 5D8JH 3B8SA 3PHQB 3BPNC 3QAZB 3AWEA 2XIIA 4GYBA 4HK3J 4DPRA 4G42A 1AR1B 4GW1B 3HS0C 2CWRA 2E3VA 3NIFF 2I07B 1OP3H 5BXFA 1PD6A 2YD0A 3CZUB 5I16A 1B4JH 1BAFL 2IV8A 4NUGH 4BSVB 1U8OA 4DHLA 4ZUTA 1CD8A 2JIXB 5JQHC 1UGKA 2JELH 4Z76A 3NP3A 4PHZA 5CU5A 1SJXA 2YKKA 1AP2B 3K1KC 3NVQA 4ERSH 2GAZB 5D7JC 4PTUB 1YA5A 3SGKA 3HC0A 1IEAB 2E27L 1MFAH 4JY4B 3MV8D 2O6DA 2IG2L 3IDXL 3IU3A 3MJ9H 1JPFA 3RGHA 1KN4H 4RGOL 4KFMA 3W11C 3I9IA 3VCLB 3QZNA 2WKLA 3E6FB 4M6AA 3SO3B 5F3FA 2PO6D 3D07A 2K3TA 1GC1C 4MHHI 4OTXL 4YVUA 1LE5B 1KLUA 4IU2A 3C5SB 4LCCA 5KBKA 5D7LE 4NZRH 1GTFA 3QPXH 1D2OA 1A9EA 1SJEB 3B6SB 3CFBA 3AQYA 4BK5A 3T0EE 4U7MA 3ARDA 1HSBA 4JDVA 1ZT1B 4ZPVB 3L3OA 3CVBA 5A3IC 1FZJA 3BSGA 1ZANH 2C7UB 1X9QA 3AABA 1QI4A 4Y1AD 1XF2A 3Q06A 4PWGA 2OW7A 3UZVB 4XNUL 4MQTB 4UT7H 4IGBD 3A22A 1MZZA 4J6IA 1BOGA 3QRFM 1T7XA 3DYMA 1HZHL 1IV8A 2X4OA 2XXFA 3FOMB 1FFPA 3NZSA 4N6QA 5AKTA 2VAAA 1XD0A 3J7HA 4QXTB 1GYUA 3WAKA 3FSVA 1EVUA 1A8ZA 2IEPA 3CFUA 2R2HA 3NCWA 4JPKH 1KCVH 3VFUA 5DJ6B 5EOCL 1BVNT 2DDQH 5ALCH 1T1WB 2K4WA 2MQGA 2XFXA 3U7WH 5PCYA 3X3GL 5A6IA 2TSAA 4PJBB 2UV3A 4L4VA 1T2QL 3TO4C 3P2BA 2A73A 4LCWA 1T2XA 5DMJB 3IMTA 1CF8H 3UX9B 4GAYB 4LSPH 3FCTA 1OCWL 3MXWH 1G87A 3LVEA 4H8VA 1HHJA 4K8RD 5DO2C 3DYPA 3GMNA 1I85A 1LO4H 2RTTA 4IDJH 1RZJH 4R4BA 4LGRB 1HOCA 4FQHA 3LNHA 1GYVA 5E9DA 2V4LA 1L9TA 5IHBA 2HRPL 4JB9H 2NY6C 1OF2B 5IKCA 5EO1B 4AWJC 2VAJA 1M7DB 4HGWA 2O5NA 2XWBA 4Q4IA 5ETUA 4JGMA 2E74C 1E4HA 5HDQH 2PN5A 1QO3B 3KPOB 2E0PA 4L4JA 3A67H 3PWJA 4GKNB 5A43C 2V9RA 5MERB 4ADGA 2C7FA 4FXTA 3X12B 3ARYA 3WO3B 3HIZA 5E6UB 4TL5A 2GIYA 2R4RH 5CWSA 2VR8A 1MLBB 5AB9A 3AXLB 1A7RL 2NY7L 4KUCF 5L6YH 1CLVA 3WJMA 1JPTL 2B39A 2BP8A 4P2RE 4BSWB 1TVBB 1KJ2H 1F56A 5CGYC 4PLOB 1HS6A 2AXGB 3LRHA 4OCSH 3I6LE 4POZD 4AGOA 4UILL 3CPLA 2AEQL 5GSVB 1PSKH 2H0EA 3VTTA 1FIGL 2ODIA 1UXSA 1E42A 2DWTA 5ESVA 2F8XC 2X2YA 4OQTA 5CBEB 3CLFH 4ZXBB 4M5YH 3DOHA 4FS0A 3O0LA 1OM9A 3L1FA 2IAMA 4NUJA 1C5DA 4HIXH 2VN7A 3ARZA 5CGYD 1GRWA 3JWNG 1NFDF 2GJ6E 4GI8A 1AZRA 2QDVA 3V0GA 1LEKA 4GT0A 2ZAIA 3QG7L 4MS8C 5SWSD 3UMNA 3TNNB 1I8KA 5JQ6H 3EO0B 3PWVB 3RPIB 1FVDA 2GBTA 3SPVB 5IFJB 5JPMC 3DROB 5FUOL 5FA3B 2WYTA 5AW0B 3X14A 2CJTA 2F5BH 1YJDH 1HWGB 3LNEA 3ZTDC 3MRMA 1BZQK 1NICA 3U9UA 4A2GA 5HYQB 1PLCA 2YGNA 2IWGA 4M3JA 5H8DA 1WEJL 5IGXH 3U4BL 3HN5A 3EF7A 3D33A 1XGTB 1BQHG 4S1QL 2D9CA 3KL0A 5GGRY 4F24A 3C12A 4HUXB 2D7PA 1M1SA 5J1SC 3TV3H 3P02A 5DUMH 3GMPA 2R1XB 3D39B 4L5FE 4RMRA 1HHKB 1SLWA 3GMLA 3L9EA 4QLRA 2DTMH 1CG9A 2ITCA 5D7SH 4LQ1A 3LN4A 1KB3A 3J8F7 2YQ3A 2K8MA 3EYSL 1K8IB 3FQXA 3L5WA 3QCTL 3REVA 1A6WL 1VRSA 5D9SB 1FA4A 4UIMB 4P07A 2AP2A 5EIVA 3I6SA 2KBGA 1VB9A 3X1FA 2NZ9D 2YN3A 2ADIA 1BYOA 1OGTA 4FQ2H 3QNZA 2WC7A 1YNTB 4HAFA 1CLYL 1OTSC 2Y23A 4UIMA 1RJZB 5JW5A 2ZWNA 2YSSA 1GYWA 3D69A 1SGKA 4WSGA 3RTLA 2YN5A 4M93B 3VGFA 1YC7A 3WY1A 1ITBB 5F9WB 4A2HA 1C5CH 3C2AH 5MEND 1HT6A 3FUHA 3HI5H 4X4ME 1A8JH 2IV9A 2JTYA 5DJCB 3FYEB 1WZ1L 3LN9A 1FFTB 1JZ3A 4ZUVB 4DW2H 4FQIL 3NJVA 4KXAA 1A25A 4F9PC 5DWUH 4LLVB 4O51A 4GRLD 5JXEC 4TULH 4JRYA 4R0LA 4LBEB 5DA0B 3WY3A 5KWYC 2XKNA 3BP5B 43CAA 3ULUC 3QDJB 4KHTL 3FYIB 3AT9A 4ZUVA 3K6IA 3FZUD 5FUZH 4ABUA 2BINA 3BAIA 1KOAA 5T1JA 4OFIA 4BUQA 1CGUA 1ONQA 4JZJA 4BZ1H 1YDPB 2DJ4A 1AHKA 2ZCLL 4GP8B 1P7QD 2VSCA 1NCUA 3S3SA 4DOHE 4XCFL 5IB2A 4KX8A 4P23B 4UM8B 2JJWA 4L4VE 4JZOB 4LEOA 5DJZA 3KPNA 1OVZA 3HNTH 1U3HC 4XC3L 4ZFFB 1T1XB 4F91B 4KO6A 5ANME 4X6FB 3MRNB 3FZUC 2LVCA 4MJHA 5KYXA 2RR3A 1OB1B 5F3HA 1O0VA 2G4GA 4JPWH 1HCYA 2R2EB 4CNIB 3O4LB 3FUEA 4A2DA 4ONFH 3QUMB 4NXKA 2YD6A 2Q10A 4UQ2A 4JKLA 4KHXH 3KLQA 4ZO6A 5LGKA 4HYTB 2JI2A 2B20A 4Y4FD 5CP7B 3FOMA 1QR1A 4W9EC 4TNFA 4DEWA 3JV4B 4TUJA 3R0NA 7PAZA 3GT6A 4K7FA 1NOFA 3S5LG 4Z5RB 4P2RA 15C8H 3R8BB 5A7BA 3ISWA 2GVYA 5DHVB 2DY2A 3AREA 2K6YA 2C9QA 5GS0C 4R9HA 1KEGH 4ETQA 1A7OH 3NJFA 3PDOA 1MWAB 1ZHLA 3GXFA 4O9HH 3MX0B 1YPZE 3AU1B 5KVGL 5I5MA 1CGSH 1BVLB 1D5IL 1W8OA 1LDPL 1ECYA 5IW6A 1OSZA 3CNKA 5C0JB 4AEIH 4DZ8B 3MMEA 2MRYA 1TCRB 1RZ7L 3WHXB 1KCSH 3Q44A 2C1PA 3GZOA 1I53A 4YHKH 2YJQA 1M1XB 1F3DJ 2DQHH 1CYWA 3B9KB 3FU0A 2XLLA 4RETB 4UF7C 3RDTA 3TCLB 3UDWC 4LT7A 5GS1C 4I8DA 1XAUA 3D50A 4PY8J 5TE6L 1G94A 3IFPB 4QJ4B 2IF7A 4PBXA 1WUNT 3BEWA 2Q7YB 3OAYH 4K3EH 3T65A 1KGIA 1V3JA 3O2VH 5J56B 2J73A 1ZA3A 5F7UA 5KSAC 3BAEH 5GS1A 2E9JA 3MUJA 4O5LL 4LDLB 2EDRA 3DVGB 3VRLF 2GBVA 3PHOB 4DGIL 1EJFA 4FKKA 3RWDA 2BM3A 4PGJA 3L6FB 1TT6A 1JE6A 1U9KA 3P9LA 1J0IA 3LHPL 3QQ9C 3WSQH 1TYRA 4GAGL 3SKUD 1VZGA 3PV7A 5D5MA 5F1SA 4RSYA 1D7BA 3OKYA 4ZOBA 3H7LA 5F0LB 2OFQA 3G6DH 3MRJA 5I6LA 4BHUI 2B2XH 4YSPA 1KXVA 4HIIA 1L6ZA 5TGBA 2UZIH 1RMFL 4XNDA 3RZCD 2CK0H 2ID5A 3V6FA 1ORQB 1TQTA 1N59A 2EE0A 3QNFA 4KGJA 2OCCB 2R1YB 3RVTD 3E1ZA 5DZNA 4DZBB 5I9QB 1N70A 3S0PA 4U1IA 3WTWA 3A6CH 5EN2B 1ES0A 1XF4A 1HSBB 4JDVB 1EEQA 3TBTB 1IGYA 4YDMA 3MODH 4ODXA 2HKAA 4KVNL 1PZAA 3GRWH 4PJHA 4WUUD 3SGEH 1QFUH 3N41F 1TFPA 3DRQA 5EB9A 3FTSA 3EGXB 1U30A 1WHOA 1SM3L 2ZPKH 2P5WE 3PU7A 3FPYA 3OPUA 5HHPB 5M7QA 4XNZC 2BSTB 4EI5D 5HHOA 1ZIAA 2PR9A 3S37L 4I1PA 3ULVF 2XFXB 2HH0L 2O5ZH 3EYUL 3QJTB 4K3HA 1QA9A 5CM1A 1MJUH 4OIIH 1MCDA 2R0KL 4Y2DA 3DYOA 1YN7A 3K72A 3NN8A 5IJKA 4UMGA 4YDLC 4X50A 3C8DA 5IWLC 4DP0X 3FB8A 1G9MC 4ZFOA 4BSVA 1UEYA 3QORD 4PRAB 3QUZA 3SYPA 2A9CA 3DSNB 2WXGA 3KYAA 3P2TA 2EVJA 3BC9A 2FEEI 3MRLA 4HUWA 3CN0A 2YS4A 3QJXA 5LXVA 5IWLA 4WZ9A 3PHQA 4AYFB 3BKJH 3PWPE 2CKBB 3X1EA 4D8PB 3U6XA 3VACA 1KJMA 1MLCA 2CR0A 4L1HA 5I6NA 4XP6H 3ULVE 4YL4A 2KZBA 3ZDXF 3CFKB 5H2BA 1MIEL 2ZUQB 3DI2B 4PTTA 4HFUH 2VXSH 3UBXI 1UACH 3ARTA 5EWIH 1CZ8H 3KCWA 3OGCB 4JRFA 2ZXQA 3DGDA 2FTAA 2GHWB 1DVXA 3CXHJ 1Z9PA 5IP4A 1ANUA 5IB3A 4PJ5E 2N7BA 4B27A 5EUOB 2R0WH 5SWZE 4ENZA 4RFEA 2VN6A 3TEWA 2YA0A 3ZJAA 2AJ3A 1SUHA 2RFXB 2CO3A 5DHXB 3QEQB 5M94B 3V6BR 2G3MA 2CSPA 3JWDC 2A9DA 1SMOA 2OMXA 3GKZA 4OJAA 2ENPA 4OIAA 3ABMB 4E9LA 2EEDA 2C9UA 2UXGA 4K3JH 3GSUA 1PZ2A 2XQ0A 5GRVK 3WL9A 5HVWA 3ECBA 2NLJA 1FO0B 4AQ1A 3QUYD 3TN0A 1LO5A 2O5XL 4NC0B 3SY6A 1WFOA 2VAAB 3IGUA 2J25A 2JKTM 3BZ4B 1UKTA 2QKIA 4Y89A 3V8CA 2IQ9L 5JIKA 4AQ1C 2OS7A 2YGOA 2WCPA 3IMSA 3RY6C 4C59B 3C8KA 4YUEH 4OFYA 2DBJA 1ACYH 1COBA 1MZYA 3MNMA 4H88L 4H8UA 5LCVA 3ARFD 2Q1EA 4EPSA 3MLXH 3O41B 5HJDA 3QUYC 4WJKB 3HG5A 2ZKXA 3C9NB 2FE0A 3MBWB 4Q6IB 5TFSL 3UTTB 5E5MB 3V0EA 3P4MA 2FBJH 2O26U 1A4JB 3SCMD 1AKJA 2HXAA 5KN5A 2IOOA 3PQYA 2OMNA 4AJYV 4KZ0A 2VXQA 3QDHA 4F7KA 5CEZL 5AWNL 3SD5A 3L4YA 3TS8A 4G6ML 4L29A 5CCKH 1OE1A 4IIQC 4J3OC 4XOCA 3QFGA 3VFUB 1EHLL 3S5LA 2UX7A 2KS0A 2QBWA 3FT2A 4WCYH 1DN2A 4OI9A 2A1WL 5GRJH 1KSRA 4OUUA 2PMZA 4FFZA 3RL1A 2NX5D 4ONGH 5F0MB 2NY2B 4P5SA 3BUDA 4BDVA 3DXAA 2ZOTA 1LWRA 3V0HA 1J05B 3CFNA 1PG7L 3BJ91 3D2UB 4P2QB 4PLKD 1N8ZA 4RAVA 1HEZA 2PXYA 2OTWB 5SV3A 1DO5A 3RI5K 5DJCA 3MCKA 3WJLA 1MI5B 4ZO9A 1B2WH 5LGJA 1U8PA 1BJ1H 3VDCA 5CUSH 5DJDB 5D96C 2PETA 2X4RB 3A24A 5BZWA 3JZ7A 4BWTA 4Q2ZA 3VFWA 3VRJA 3SCMB 1THCA 4EJ1C 5BS0B 4NZUL 4EEEA 5B38A 3UTZB 1N5YL 2XYCA 1X4XA 5D72L 3K0WA 5DEFB 5D4HA 1AE6L 3VFPB 2ADIB 5L2KB 3FHQA 3VD7A 1E67A 4Q52A 2XETA 3K2UL 1N64H 1YEEL 5ISZB 5BCAA 3CDFA 3IJSA 2YD9A 2YAQA 4MMXB 1RHFA 4TSCL 1DLHB 2V2WA 4X8CA 5K39A 2QPEB 1U8MA 1UZGA 2F54A 3U4AA 4Z7IA 4Z7WB 4PCKA 4MJ5A 1MLBA 1DVFA 1Y18B 4FLHA 2LAAA 3IJYA 4P4KC 1BZ8A 1EDHA 3W11D 4CSPA 2J20A 5D1QD 3G6JA 5KYUA 3MUUA 3TIDB 5F3HB 3G5WA 3LOWA 3OJ2C 1UJ3C 1CICA 2BRRH 4D0DB 4P5TA 4RRPG 3RDTC 3UDWA 4DQOL 2VZTA 1U8QB 2OL3A 3CXDL 4LB8A 1X7TA 1HE7A 2E8ZA 3RWIB 5CZRA 4EZJA 3NGBC 3MQIA 5J12B 4P23A 1WFUA 3F00A 2X7LB 4H0GA 4EXPX 2J8UA 4LPWA 1F4XH 2NMSA 4DCQA 1XGYL 2VDRL 2NY0C 3DUSB 2N7SA 3TNNA 5JTWA 4MQXC 3C8HA 4A2MA 4MAYA 5MP6H 3DX7A 2VLKB 3F7QA 4QHKJ 4GQPH 3ARWA 1WC7B 2Q8AH 1T21B 2N56A 4Z7WF 4AZ8A 3HTLX 2PUQT 1JPSL 3DX9B 1RIHH 4HJTA 4EIBA 1EFXA 2OM5A 3MYZA 4KQ3H 3S7GA 3VFSA 3FO0H 2UWEF 4X4XA 4IKKA 1U95A 4MNGE 4XCEB 2WZAA 4JHBA 3EOYG 3TBSB 1TZ8A 2R4SL 3IKKA 1Q0YH 4URTB 1DANU 4FOMA 4JFFD 3K81A 4QOKB 4J2QA 1ADWA 3TYFA 5I8CA 1QWNA 2ALAA 1KB5H 1K8DA 3RWHB 3V2AR 1Z5LB 2IDUA 4JHAL 4ZMNA 5J13C 3P3RA 3KMDA 2VE6A 1JGDB 2WTRB 4FFYH 3FTWA 3Q3GB 4AT6B 2E86A 2ITDB 3ALWA 2YBRB 4LZKA 5E99H 4POZC 2JH2A 5IBTL 3L2LA 1HILA 3PGDB 2R0ZH 3DECA 2AKRA 4AEEA 4ZTPL 1YMMA 1JXFA 4P59L 1CE1H 3MV9A 5L4MA 1QZ1A 3I6LD 4XNYL 2NY4B 1QRNE 2YMXH 2W0FB 5KZCD 5L7XH 4Z95L 3TBCA 4B7IA 3GNMH 1ZHNB 2GTWA 2DQEL 3OJVC 4M6OH 4XGZA 1NPNA 4ICWA 4RFOL 8PAZA 5JUEH 2J5WA 2V2XB 1F97A 3MA7B 2FO1A 3VFTA 4MD0A 4B9JA 4APXA 3AZUA 1QQDA 3FT1A 5CLYA 5KVFH 2ILLA 2BVOA 4PJIA 5CD5C 4HCIA 2Y5QA 3IFNL 2Y07L 3M7OA 3VWJB 1DBML 3R06B 4HOXA 1EUTA 2X1PA 3BEVA 5FGRA 1UWGL 1NUNB 4LOVA 1M9SA 1ES0B 1SMAA 2WKOA 4XVTL 2AK4A 3LS5H 3FN0H 4MTMA 1RJLB 2DM7A 5DJ0B 2H47C 3GM0A 2RJMA 4GQQA 5IV2A 5L88L 4U1SB 2EE6A 5T3ZD 3QH3B 4ORZC 3QISA 2YPVH 3NGBB 2R2CA 4XN8A 3WIIH 5GS0L 5ID1B 4G8IA 2RD0A 4O02H 5F89A 5C6WH 1NFKA 1IAMA 2CDGB 4L23A 5KJ4A 5D4IA 3KLHD 4ZT1A 2X4PB 2E7LA 4TNGA 2EIJB 1MCWM 3D85B 3GJFB 4OB5L 4BZ1A 2CO7A 1WT5C 2X4OB 3T3MB 1SQ2N 1F18A 1U8QA 2OL3B 4HV8A 4JFDE 1I7RB 3UC0H 4LMQE 1ODUA 1OP9A 2CPUA 4YO0B 5IESH 4I5BA 4PJCA 1F13A 2UZXA 2PYFB 4BK8A 4D9RE 3MOBL 2V33A 2JXMB 4EI6B 2JCCA 1BIIB 2FECI 2R69A 3WKMH 4KQ0A 3AU0A 2Z8WC 1TDQA 5DK3A 2IPTL 5E2TH 1MAKA 2QHRH 1QUNA 1YY9D 3U1SH 4Z1PA 1OTSD 3TCXA 1RKRA 3ARDB 5K59F 1YUHB 5FOJA 1SJHA 3ULUF 5E8DL 1QAWA 4F7TB 3VXQB 3SBRA 4CMMB 3CSYA 3I2CH 1PL3A 3M8OH 5DHEA 4JE0A 1EEYB 3GO1L 5IW1B 1URIA 5EIIG 5GGVL 2BSSB 5HHQA 3DVFA 4UT6A 3APDA 2CUAA 1KPUA 3GSWA 5IUSA 2O5YH 1NBVL 4ESKA 2KZ1B 3VM7A 1YY9C 4ELME 1JWUB 2R0LL 3ECQA 5HD8C 1IRAY 1G7LA 3KPSB 3ILPB 1VPOL 4WW1A 4PRAA 4OV5B 1J9CT 1RULL 5IHUH 2NY1D 2BVPB 1NC2D 3GBLA 1LNUA 2IXQA 1RURL 2H0PA 1KCUH 2FX9H 3ULUD 1FG2A 1M7XA 4YZFE 3BDYH 5C07D 5D8JL 4LQFL 3UACA 1LTXA 1AGCA 1WWWX 4W9HC 5B22A 4DP4X 1WK0A 4YHOH 3IXAB 5J3HD 4QHLB 4YXLH 3FB7A 3SE3A 2IALB 4PJCE 4WTXA 3GXMA 3L48A 5F71A 1B4JL 5BW7A 2YC1B 2MTPA 3Q43A 3CDCA 4QRTA 4X6CB 5B8CC 3HE7A 4KZDH 2FLRT 4YHZL 4OF3A 1TVHB 1X5LA 2W59A 1ZIBA 1SVBA 3DUUB 3QC5X 5EV7A 1CFBA 1G6RH 2G5UA 3QS2A 5DU7A 3VNZA 1LILA 2D7QA 5JXED 2AJYH 2X28A 1D6EB 5EIIB 4Q6KA 1P6AB 1MFMA 1YEIL 5DQDL 5C08E 3HR6A 4UIKH 5A2LH 4Y4FC 5TDPB 2FNBA 3ZZLA 3OKLA 4R2GC 5E5MA 2CJUH 3ECBB 2HB0A 4TLSA 3GMRA 4PJCF 5CJQL 1D9KB 4N2AA 5BV7B 3D30A 3U30B 2L7UA 5J6GA 2HYMA 3X17A 1GA2A 1FNSL 2E6PA 4GMTH 4X5XB 5DZVA 3VA2C 5D7KD 3QXAA 5D6CA 1F86A 3SE8H 4F37K 1U3HD 4U3HA 1ZMYA 2ZJSH 1MAML 1U91A 1ZANL 4ZG1A 2BP8B 3DVIA 4V2CB 1BHGA 4R2GD 4Y2LA 1UZ6E 4KTDL 3KVQA 4TVUA 4ZYKA 4GW4A 1TEGA 3KWVA 1LE5A 4ATTA 4QRAA 2ROYA 5LQBH 4PJXE 2NTFA 4M1DH 4RIRB 3UTSA 3VXOA 4A2FA 2NXYD 5KW9H 5DMGC 3CD4A 4U3CA 4HV8B 1IGCH 1I7RA 3TZVC 4ZW5A 25C8H 4TUKL 3SDDB 1KB9K 5CHNA 1MELA 2F61A 1NM9A 4OVVA 1U8CA 4PGDB 4QT5A 1OE2A 2GB2A 3HAEA 3HZMA 3DO7B 2Y24A 3NH7L 3RJDA 1KCVL 3HVDA 3WE1A 2GKIA 2XJKA 5I0VA 4AIOA 4X9IA 2IBBA 4K4KA 3S4SB 4F3FA 1VGKB 3ARDD 2N1KA 3E6HB 5IVXB 4X2UA 4H8PA 4XHQA 4XO3A 5EC1B 3ABGA 3NZUA 1E5YA 4FQ1L 3K72B 3U1QA 2FH6A 2CHXA 4XVJL 3P0YL 4N0UE 5HVHB 1JZGA 2WXKA 4H44C 4B95C 4C54A 3ZKMD 3PDGA 2WANA 4YX2L 3VD1A 4HUWB 3EJZC 4MCMA 4Q58C 5BO1L 4F33B 2V9TA 5LGHL 1E65A 3L16A 5AW1B 3DX0A 1SEBB 3BUPA 3V4LA 5ABZA 2WO2B 1P4UA 1NL0L 3BQUC 3MJWA 4CAGA 4NHCH 4WEBL 4XOEA 5T5FH 4FYTA 5J12C 5D1XB 2DYPD 2NPLX 2QLYA 3HLAA 3I9PA 4K71C 3H9HB 4FXKC 5FDWB 1JD9A 2JCWA 2OSYA 2YK1H 3IXTB 2GUOA 2X6UA 2OR8A 3MV8B 5CWSB 1KNOA 5E6YA 5HI3D 1FYHB 3BH8A 1B88A 4L4VD 4UYQA 1HXKA 5L0QB 1KTLA 1D7CA 5C0GA 3RWIA 4X8JB 2A6IB 5DD3H 1CU4H 4H8WC 3ZBMA 4NFBA 5E4AA 3SKMB 3T0AA 3WLBB 3F3HA 5L6YL 5AAWC 1VERA 3EOTH 5T33H 4LLQB 3SJVB 1E5ZA 3H0TA 5E9AA 2P5WA 4OCSL 1IBDA 2XDHA 3H56A 4QHMB 5F21B 3STZB 4DFHA 2BVEA 3TN0B 2K78A 2AEQH 3QR2A 1PVHA 3SN6N 1FIGH 4GKLA 3CCHB 5EORH 4XNQB 1G7MA 1MKFA 4ODTL 2A9BA 1Z9SA 3RFZB 4PY7A 4TKWA 5SWQA 3O3BB 1FFOA 1HL5A 4M5YL 4LARH 5HY9B 3EIFA 3CU7A 4HIXL 3KPQA 3OHXC 4MZ3A 5JHBA 1ROWA 3H2WA 4PP1D 4WFGE 1XD1A 4ZW6A 3OXRA 4I4WA 3T2LA 3S37X 3WTVA 4XWGH 3Q05A 1V05A 5CLWA 1A0QH 3W5MA 2ORBL 1J86A 4E9VA 3K2MC 2A9AA 2CGRH 1KJ2A 2FWSA 2I69A 4PBWD 5C0BA 4D9QE 1LP9A 4DKEH 1P7BA 1FWXA 4M6NL 1JHLH 5IBUB 5IQ7H 2A0LC 1J5IA 2EXTA 1UYWL 4XCNA 4PGBB 3EO0A 3RPIA 3SPVA 5KSAB 2AJUL 3KPRB 4GBXB 1DZBA 4IU3A 2WWKT 3N6YA 5CIPA 4U1LA 4XH2B 1NCAH 1QHQA 2W9DH 4A37A 4JQIH 3UZVA 2DZEA 2OTUB 1VZIA 4L3EA 1PMYA 1TENA 1YRKA 3M1BA 3PL6D 4XNXL 5E5UB 4U6HB 1FL3B 2ZX7A 4KUZH 3NIGB 2DTML 2V5SA 2XPZA 5ICXA 4H8WH 1K72A 3HC4H 3Q5TA 1XF5A 2WLYA 1RZGB 4GQ9H 4A2EA 2V2XA 2CMRH 3WNKA 3WY2A 4BGLA 4A6YL 3NCMA 2W94A 1ADQA 1GHFL 4MJ6A 2V2WB 4DP6X 2J21A 5EA0H 1DVTA 1U33A 4R90L 4I3SL 1O75A 4PD4K 3KLLA 3E2HC 3D4GA 3QDME 3IMWA 2WXNA 1CLYH 3O6LH 4Z7UA 1KV7A 4OCLC 3SPGA 3ZDZB 5B38B 1KXQE 2WXMA 4RZKA 3C6SB 3VDBA 1TQUA 1EJ6A 2ICEB 1HK6A 1INEH 4CVXA 2F08A 2B1OA 3EFOB 4YXKH 4M29A 4GSRA 1QHOA 2BIQA 1INQB 2NY3C 2Q0ZX 3ISYA 4LFHG 2WGNB 1PCSA 3K91A 2PWDA 2HVBA 4N2OA 3T1FB 4OY9A 4R8WL 3T0DA 1J12A 1Y6KR 2X70A 5AKSA 4G8FA 1MFDH 4RDQF 5IMLB 3D25A 5FUZL 1JZEA 2Y7QA 2BMKB 4JPVH 4FFZH 4JFTA 2ZCLH 1E43A 2A6JA 2GFBB 3WNNA 3S48A 3AB0B 5K9OA 3MRQB 1RZ8B 2MPVA 3QUHA 4HXAL 5I2IB 3HE7C 3OAZH 4PM1A 1YMHA 3WFHB 4B5ZA 4ANVA 4XC3H 4PRBB 5IM7B 3CZSA 4MQSB 1Z9SB 4EKXA 3W9DA 1JNNH 2A6JB 2FJUB 2GFBA 2M26A 2Y1YA 3ZE2B 1LL1A 4PRPD 5D7JD 4PPTA 2D7NA 4JPWL 1IUZA 1PZ5A 5CF3A 2WUCH 2IADA 1S3KL 2Z91B 4NHUA 2HX9A 3ELQA 5FF6A 2PO6A 4LSUH 3NSFA 4RBPH 4U1KB 3VYOA 3LZFL 4KVCH 5LNEA 4J3OD 1E7VA 3RBGA 2AHIA 2UZYA 2YFNA 2YAFA 5FO8A 4L3CB 5EBMB 1NEZB 3V4VB 3DK2A 4FLRA 5EZJB 3ZZSA 1SJHB 1L0QA 4AUYA 2F53D 2AQRA 3C09B 4CW1A 4P9HH 4QGTA 1G5AA 1DCLA 1OAZL 1DQQA 4O9HL 5FAAA 4NN5B 4M1GH 2IMNA 1X9UA 2I24N 5AKRA 5C0AB 4X6CA 1R3JA 3P0GB 2YLKA 3VFTB 2R29A 3UABA 4F7EB 3L9YA 4DK5A 2Y9RT 5HGGS 3DBSA 3FK3A 4NCC2 1IBZA 4QXGL 2DEYX 4AXWA 4PTTB 4JPQA 1ZLUK 1VEPA 4Y9CA 4E36A 3N5AA 1KBBA 4XO9A 1EO7A 1PU0A 1RIUL 2WSKA 4PRHD 3RI5F 4QRSA 5IR1B 2BFVL 1OM3L 2Y3NA 3QH3A 5ID1A 1N8ZB 2UVEA 3JV0A 3Q01A 4O5LH 3BVUA 1CIUA 1UM5H 1BYPA 3KWXA 4FKEA 3MRLB 3WKQA 1ASPA 2UWEE 2N01B 1AQDB 2B3RA 1INDL 1HXYA 4HKXB 3L3HB 2ZOLA 4NBZB 2P28B 3C5ZA 4GAFB 1HJCA 1YEGH 2GK0B 1E8YA 3QIUD 5F7LB 2AQPA 1C16A 3GGWB 3I3BA 4QXWA 3SDXF 3MUGA 4P46B 3UCQA 3V4PL 1E30A 5DGRA 4U3XA 1DEEB 4X5WA 5GSRB 2YPLA 1ZE3H 3FSWA 1AOHA 3HKZA 5DUBA 3VGGA 4YSAA 3LPOA 1KTDA 2VW7A 3PJNA 3RDTD 1VLXA 1LK2A 3GGWA 3U2SA 1URLA 5I1KL 2G75B 5LXGL 1XH2A 2KERA 4HIHB 4W9GC 5KJRL 2HCZX 2G3NA 1Z3GL 2AGJL 4JFWA 4YGVB 4X5XA 2ED8A 2Y7QB 3BSZL 4JFFE 1XSOA 2BCKB 2XWZA 1GZHC 1AZNA 1SN2A 2UVFA 5FW6A 4Q9QL 2F18A 2GABA 2RQ8A 4PGCA 3U79A 2OLDA 1D5MB 1HVXA 2WK2A 3QWOB 4XNMB 2DQ6A 3CDGA 4M8VA 3N85H 2FJGB 5DK0B 3RIAK 1G7LB 2DQMA 4CN4A 2QSQA 3DRTA 1DTUA 1I8AA 1E6OL 5I8EA 4JPSA 5D5MF 1F4AA 1C1EH 4XNMA 2VLRA 4L8BB 4JREC 5F9AC 1BFTA 2C9VA 1OCRB 3QYCA 2IADB 2Z91A 2JKLA 3OKMA 3P30L 3V7MA 5FHAH 5IW1A 2YD7A 1FHNA 4JRXE 3QULA 2ZAHA 3H85A 3ZW3A 2NSQA 2EZ0D 4KJYB 1Q1JH 4AYMC 4QYAA 2BWQA 1LEGA 3WU1A 1NC4B 5CD5D 1CFMA 1BZDA 1E3ZA 1Q0XL 4WUUE 3ZHFA 4NM8H 2K6WA 4XPGH 2VTFA 5BZXA 1FNFA 4L9LB 2BS8A 3NPZB 1BEXA 1UOLA 2XA8H 4ACPA 1AOZA 5EFIB 4ABWA 4UQIM 5DEFA 1JRHI 4HPHA 5FYKE 1FVCB 2WWOA 5D1ZA 3WFDL 5D5ME 2C3GA 3X1GA 3RVXC 2ZWYA 4X80H 3VVVA 4LEXL 3GBEA 3MV01 4HWZB 4RGNB 4OZHE 3G6AB 5ACZA 5T3ZE 1JCVA 3D0VB 3KNBA 1AO7D 4PB9H 4BGDA 3QHZH 2VMCA 3QORB 2IFFL 1R19A 4JFEE 1D6VL 3T4AC 4UTCA 4R84A 5F9DC 3H2QA 4HFUL 5K59E 1PAMA 5EWIL 1QSEE 4DGVL 5DT1L 1BXAA 3K2IA 1GZPB 3WHXA 3OVUB 1JYXA 5G5DB 3U0TB 4ZNCD 4X98B 3QORA 5E8NB 1DQML 4LSSH 3QIBB 1ZK5A 5AYUH 3IB4A 1RPQA 4PUBH 3QXTA 1T5WA 1BBDH 3A0OA 4R7NA 1WGOA 3TBYA 3EYVA 1MRDH 2D4DA 1WGVA 5KVDH 2OPCA 3CE1A 3CQFA 4UV7H 4LVEA 5I6XB 4YHIB 3MUHL 3QNYA 2KUTA 3UZQA 2ZNWA 4F2EA 1NIFA 2NZ9C 4NQEA 4ZQTA 4WNJA 3NIDB 3VFOB 2J71A 3ZE2F 3NACH 4KOBA 1KLGB 5E95B 3TTSA 2XN1A 2PP8A 1A4JA 3ZO0A 2Y2YA 1HAUA 5HGHA 3VB9A 2B08A 1A9EB 1SJEA 3B6SA 3CFBB 3NZHL 1OP3K 2YKLH 4FG2A 2X4UB 4J1UB 4G70B 1JHTB 4NT6A 4QRQA 1W72L 5TFSH 3EBAA 3LXCA 4I2XB 5MENB 5I75B 2BHUA 1GOHA 3HE6B 3PXJA 4JRYD 1R5WA 1HL8A 3VCLA 5KVEH 3LTVA 5HHXL 5HTSA 2E9BA 2YXFA 1UD4A 5AWNH 1UCBL 3LNIA 5DI8A 4OUUB 3KPRA 3QR0A 4MB4A 2LU5A 3VD2A 1IIIA 3WOVA 1EHLH 2F7OA 2WVVA 4OJFH 1XBRA 5GRJL 4R0LC 5I66A 4KOCA 1UUNA 4NRXB 4L29B 1BQ5A 4UTAA 1T1ZA 4Z78B 3PYCA 4UI2A 2YOAA 1ZD6A 1UZ8A 3BESR 5KVMC 5AENA 4KRMB 2YA2A 2K4AA 3VQ1C 4ALAC 4HPOH 3T8XB 5ANHA 1BZ7B 4L3EB 3ZSTA 1UM4H 4U1NB 5EU4A 4PV9A 3R8QA 4XOAA 1NCIA 2F9BT 3L3OC 5IFHL 4IBTA 4RQQA 5ENWB 2QVTA 5F7WC 1ADQH 4YVNA 2W9LA 3BIKA 3BPLC 5LBSH 2EYRB 4DT2A 3CFKA 1A6PA 2GJ6A 2W65A 1QFHA 5HJGA 1XB8A 1Q9WB 1UZ6F 2E75C 2UY6B 1U8LA 5TE7H 5DZAA 3BH9A 2GEEA 1E28B 2B1HL 4EO5A 4KY2A 1MI5A 2QGCA 4NZUH 2VDNL 4QXUH 4ZXBC 5K1VA 4WWNA 3F64A 5CJOL 4QNPF 4M8UA 4WTZG 2G2NA 3SDDC 5EOQH 4R26L 4QRRE 3GJFK 2NDGA 4OCNC 4Z7UB 1BQSA 2WLZA 4H20L 2G9HB 2NX5A 4OAWB 2VMFA 2XHNA 2R9HC 4PJEA 1DL7H 4QRSB 2JJTC 4E9XA 3X13B 4WWPA 4ZOEA 3FQXB 3L5WB 1JGUH 2ARJA 2WLKA 2ZIDA 5B39B 1OWWA 2EO9A 5T3XL 3IJHB 3U46B 3LEYH 3IDJB 4MFHA 4D9RD 4DWHA 1X5IA 1PIGA 2DQCL 2VDQL 4FADA 5K39B 1YEDB 4JFUA 2H41A 2P24A 4QHMA 4TVSa 3PLYA 4WFHE 3STZA 1EEZB 1ID5I 1XTLA 1UT2A 2HLFC 4IU2B 1A5FL 1Q4NX 5DHMC 3H9SE 4NZ8A 3R19A 1BREA 3RY5A 1RZIA 4AM0B 1TTBA 2O30A 3DSFH 4Y7OC 3L13A 5GSRA 3RVVD 3V5DB 1BW8A 1JG9A 5J06A 3V5HB 5CGTA 4W9DC 5CCJA 2IG2H 3IDXH 3MJ9L 2D03L 2R69H 3FCSA 3PWJB 1RZKC 4GKNA 4MNGA 4E9YA 5DHVH 2APTA 2EXWC 5DLML 4NDMA 1YY8A 1F4XL 1NGQL 3EYOA 1XGYH 2VDRH 1X7SA 4AGMA 4PD4J 4AVIA 5EZJA 3IFOB 4LLUB 2F54D 3QQ4A 2IH3B 3PWVA 3NRPA 2AEOA 4KJPD 4GXVH 1R5VB 3OAYK 4UQAA 1YEKL 4XX5A 3TONA 4WUKH 4XB8A 3D4ZA 2G60L 1ZCRA 2V5MA 3IMUA 1WS8A 1BEYL 3FQRB 3QWOA 4FTDA 4ZMOA 1CICD 1W16A 1FYTE 2EDEA 1KIQB 4TMPA 3VXPA 3N43F 5CSZA 3IRCA 2WB1A 5TDNA 3H55A 3NCJH 3MNZA 4KKLC 3SB3A 4NNXA 1OGAB 4KTEL 4UT7L 2VSDA 2Y7OA 4E2OA 1HYRC 3GSNB 2UWEA 1N0LB 3BAYA 2FIKB 4IQHA 5EEWA 5HP5A 1CD1B 4FI8A 3D12B 3FJTA 4PRNB 1DUYB 2K6ZA 3QHFL 3ET9F 1PIFA 2QGEA 3IWVA 1QLEL 2FDBP 2X4SB 3GS4A 2UY7A 1TQSA 5HGBA 4KVPA 4ZFZB 4F2MB 1CFQA 3P9MA 1JUFA 2C4FT 3U7WL 4HAGA 3V4UL 1JI2A 4OU3A 7FABL 3HI6H 2YMTA 4NOBA 3T0EB 2GK0A 4O58L 1CE1L 3BQUD 2DQGL 2VZUA 3GK8L 2EDJA 2WQWA 2XWBB 4Z95H 5C0RH 4MZ2A 1FFQA 2VE6B 2Z0UA 1JZHA 2WN3A 3L3GB 3MAWA 4LSPL 3HUJB 4XXCA 1X5HA 2AXFB 4JFFA 1U8JB 3QR1A 5IKCB 4Z7VA 1M71A 1KY7A 3QE5A 4KNSA 2KLTA 3EFOA 4M8RA 4YSUA 4WK4B 5E24E 3UEZA 4MJ2A 2D3VA 1WTGT 1P4IH 4GIAA 5DMIL 3WDHA 1KTBA 1B0GA 1U58A 2CNZA 3CSFA 3KPPB 4WFGD 1KB5A 1GC1L 1YMHB 3WFHA 1FH5H 2CDFB 1CTOA 3IGAA 1KGCD 4OAWA 1MCFA 1ZHKB 2GTZA 2E9GA 3UP6A 2DB8A 1M4KA 2D7TH 3BGMB 2BMKA 3JV5A 2YPVL 2FO4A 3LKPB 1GH7A 4XT1C 3MDJA 4WGVB 5CEXB 3MLPA 1XSKA 3OR7B 4WO4B 3QYMA 5D7HA 3TYGL 5BVPH 4G7SB 2ZE0A 4NC2B 1JPTH 4ZSOE 1OF0A 2OL3H 3TJHD 1TR7A 3IVKA 5EBMA 1MOEA 4QY8B 3UC0L 4WU7B 1WD9A 1JFQL 3VMPA 1OOWA 1KULA 3BKML 3D87B 3WNPA 1J0ZA 3I9GH 5FEBA 4LLVA 4LOUC 1N67A 4O51B 3U6RB 4DSYA 2WLIA 3VGBA 3CLFL 2IPTH 3Q48A 3Q8FA 4IOSA 2X4UA 2PP7A 1ND0A 2BSCA 5E5RB 3U1SL 3TA3A 3MLYL 3HA0A 4UDTA 4URKA 3FL7A 4XMVA 4Q97A 4WY7L 1XR8A 3IMVA 4UM9B 3BVVA 1S9YA 3FB6B 1Z7JA 2CGYA 4GFXA 3ZRFC 2WVUA 4OFKA 3ILPA 4WW1B 3EH3B 4BQCA 1D5RA 4DN4H 4OZ4A 5LVEA 1NCOA 4FMFA 3VRIB 4N3UA 4CC0A 2V3EA 1PKQA 2EDYA 1H3TA 1FSKB 2ZYIA 3D1MC 5TDNB 4IBZA 3EJCA 3TOPA 1JF1A 1QG3A 5CZXD 3LQZB 2B1AL 3SCMA 1KDIA 2FX9L 2HX7A 3JYBA 4FQXA 5HDRA 4PBVC 1MCHA 2HFFB 5AVTB 5EFIA 1AHWB 4AQEB 4YEFA 3SD2A 4MSWB 3TV3L 4YWGH 1FE8H 1OF2A 5EC1A 3FF7A 3JV6B 1HTYA 4GEJA 2Y2WA 2VIRA 1NEZG 5CBAB 3U0PA 3IBEA 4I13B 3OAUL 1MIMH 1TJGL 1T03H 3DUUA 2GJ6B 3L4VA 2WQRA 2V6HA 4MDJA 3VWJA 1X5ZA 4W68A 1O9ZA 4YHZH 1AACA 1UADC 5B8CB 4BE6A 3MGTB 1JWSB 3UL4A 4C8XA 3O45B 4XBGA 1RQ5A 3CFMA 3VGAC 2W9EH 5FUCC 3UPRA 2FB4H 4DVBA 5G55A 3VSVA 2JI1A 1E0OB 1IGFH 3M6DA 2QPUA 2D73A 3QQNA 1QSFE 3NDZE 5AALA 4HLEA 4K94H 3UIZA 4H26B 4YNYA 3UAFA 1NOLA 4PY7B 3KBHE 4XRCA 3ZTNH 3KW7A 4JZJC 3TPUA 5IB1A 1KZQA 4I89A 1R5WB 1HQRB 1WZ1H 1EAOA 4V11A 2ZXCA 4G80B 3HE6C 3BHBA 3QJUB 3RUGA 1JZFA 1L7TL 4ZXBA 1J11A 4G1EB 4WI0A 2VC2H 3BP4A 2WJ5A 3Q9QA 4L2LA 1YSOA 2APFA 5EZLA 4FXGB 4D2NA 5HHNA 2GEQA 2WNKA 1ZTXE 3HE7D 4GEIA 2VLRB 3WLBA 3W3BA 2R29H 3OAWA 2KI6A 3T1FA 5EDSA 5HGHB 3JVFC 1T1XA 4OGXL 2W5PA 4GS7C 3VQ2C 2BNQB 2YRLA 1W15A 5FECA 1H6EA 1P5UC 1QSZA 3QW9A 5LQBL 4JFZH 5KSAA 3D4CA 1RAMA 5F6IB 3HE6D 4MXQC 4PP2A 4F2FA 4XCFH 5DQ9A 4P4KD 1GIGH 1HEHC 1WS7A 3BO8A 4P5TD 2YO3A 3NH7H 3ES6A 5DO8A 2XG4B 1OEZW 5L8KB 1HNFA 1BX2A 3S8WA 1KIUA 3GSXA 2DLIA 5F44A 2WTRA 3EDKA 4Y16D 4GUOA 4G2AA 5FB8A 1T1ZB 4LASH 3VXPB 1BVNP 3MRPA 4Y0GA 2ZG1A 5FW7A 4R7DB 2WVVB 4Z3TA 1XQ4A 3LQAC 3T4AB 5KG9B 1JXDA 4F20A 4ENED 1U93A 1T0OA 4K94C 1JJUA 3S88L 4AIXA 3PJSB 3ABZA 4PS3A 3WBDA 3VXSA 5BO1H 4IDLA 4A66A 3CMOH 5EU4B 4UU9B 5IW6B 4ZK8A 4UAHA 1FAIL 3FQ4A 5DFAA 2XV3A 1KG0A 1FV1A 2P8MB 1K3ZA 4IIQB 1P7KB 2EIKB 5I6KA 1LJMA 4HKJA 1SXNA 4AX3A 1D5IH 3BZEA 2VISB 1W8NA 3QUXB 1QHPA 2FGWH 2NQDA 5AW9B 2PR4H 1I1FA 2NCMA 2DQDH 3B7YA 5EZIH 3H9HA 4GIPD 4NBYB 5DRNA 5FDWA 3HMXA 4PJDA 2VR7A 1N19A 4HZLA 3QIUC 4DP5X 5BMFL 4JREB 3EOTL 5T33L 3K3QA 5C1MB 4FTVD 4LEEA 3MBEB 1CN4A 3O2VL 3REWA 2WZ5A 2YUWA 2LAGB 4WTWA 1CPUA 3D3VA 3FN3A 4I48A 5AVRB 4XP9L 1D5BA 1G1OA 3DETC 2EEXA 3BAKA 4QIRA 1IC4L 4ICXA 4PWIA 4DGUA 2WW8A 2YEVB 5F3BB 3LMJH 5KYYA 3LKNA 3HAEH 3N91A 4LLQA 1WZAA 3SJVA 4WTQA 4B9GA 4ZRGA 1J8SA 4KK8D 2XQYA 2I07A 4LSDA 1DO6A 1JTPA 4NPJA 4QWWC 1A3LH 5F93C 2B2XL 2HP4A 2IH9A 4QRPA 1A0QL 4QCIB 2AJ3B 1QBML 3B3IA 3EO9L 1DQLL 5DGQA 3ZPDA 1E90A 2NT0A 2R59A 5E9NA 2A6KA 2CK0L 2XN0A 4M6NH 5IQ7L 5IIEA 2NR6C 2P5WD 2YRBA 3EDEA 4RMWA 3MJ7B 2AS5M 3WTUA 4JO3L 3ARBB 4WAFA 1S7UB 2AJUH 4I0PA 2DQUH 4ZS7H 3PL6B 4X0NA 1IBFA 3QWRD 1XZ0B 3S2CA 3GBNH 3H3PL 2P8LA 1G84A 2VERA 3ULUE 2EDTA 4EVNB 4EAEA 3RG1C 3MODL 3S5YA 5I8KH 4LRNH 1RJCA 5GGQL 1AYOA 3QUZC 4KUZL 3MNVA 3KLHC 3TO2B 2X0WA 3FU5A 4HS3B 2EUZA 2XKUA 5E6IC 4B5EA 3FT3B 5I1DA 5GGSY 1UJ3B 4I9WE 4KBPA 4A6YH 4PHXA 1IL1A 4A68A 5C0BD 4F15B 1GHFH 1A6UL 2VZ1A 3HPJA 1VGKA 1J48A 3GSVB 4I3SH 3O8XC 1G7IA 2DIEA 3CZEA 4F8PA 1SBSL 4FMVA 4ZFQA 3VXTB 2HLEB 5KOVC 2GCYA 2ZYHA 1HL4A 1P7QB 1XF5B 1QFOA 1LMIA 3G9AB 4YDZA 3BXNB 1S7SA 1QWUA 3TBWA 3FUFA 1MPAL 5CLZA 3DX4A 5F96H 4YHYC 2YD1A 5I1HL 1SOKA 5A2BA 5C86A 3IDIA 1SF5A 3NQIA 4F7EA 4J3OF 1RZIB 4J3SA 3SYCA 4GQRA 2EDBA 4APQD 3X11B 4YC2C 1MFVA 5IHZA 5KVFE 4E41E 2WNGA 4BUHA 4EQ2A 2QADC 3IDJA 3IYLW 1OL0A 5IY5B 3H53A 1TYJA 3GSUB 1SHXA 2YWZA 2VL4A 3RVUC 1UACL 2CKBA 3MR9A 3QIWB 2XN9E 3FQYA 4X6DE 2HG0A 3QEQA 1CFNB 1X3DA 2P46B 4HAKA 2H26B 3VSTA 5J1AB 5B4MD 4PW4A 1CFTB 1N6VA 3RKDD 5KS9F 4G9FE 3AQXA 2DMGA 1ORQA 4A55A 5IUCA 1VEOA 3GHEH 4HSCX 3LZNA 1DJGA 2V2TA 2NW2A 4B0MM 3KPNB 1XWVA 3LEXA 2IBZY 3HRZB 4Q9RH 3T5WA 2FSEA 4YSDA 3FB6A 3H6JA 1QRNA 1QQDB 1V7MH 1ZRUA 4NYLB 4MVBC 2XC8A 5E94B 2Q86B 3VNYA 4EUPG 1A65A 3WD5H 1ZT1A 5SV4A 1IFGA 3Q2NA 4HPYH 2IWFA 2NNCA 1NIEA 3ASNB 3F04A 4CILA 4BUGA 1E4KC 4NQEB 1QNIA 5E23A 5K9OB 4JO5A 3DX9A 1W6LA 2L4OA 2NY5C 4G82A 2DQTH 5ILTL 3O6FA 3UG3A 4KVCL 1SF3A 2X3CA 2AQSA 3MLVH 3M46A 5KS9E 1HYSD 4HF5H 4MVBD 1PY9A 1J8HE 3KLKA 4NQCE 3VWKC 4UQCA 3WXWH 1YNLH 4HWEL 2NY3B 3FO9B 3NBNA 3FH8A 4H1LA 2JVUA 1KXQA 5CCHE 4PJEE 3TT1L 1RUQH 5CP3H 3UTOA 3VWKA 1OAZH 2XN9A 5KYWA 1NEZA 2CBMA 1A6VH 3V4VA 3DRTB 1E6JH 2CKNA 3T2NH 4FNQA 4G6MH 4OQ1A 3I3EA 1HEZB 1M42A 2PXYB 4CGTA 1XMWA 2PABA 5D7JA 1PKQB 4KMQA 3RTQB 4Y88A 4ZX6A 1XGUB 2V9UA 3AVEA 1TZIB 1JP5A 2X1XR 3MCYA 1WBZA 4KRNA 1PYWB 3KPMB 4QXGH 1KB5B 1F3JA 2ICCA 1T6BX 3DUHA 2ZAGA 3W0WB 3KM2A 4YS4A 1ACCA 3RX5A 3H9SD 3SDDD 2EXWD 4Y19D 5GIRA 2A77H 4PJEF 3BISA 4JVWA 3BOVA 3GLAA 4ZX3A 5GGSB 3H0TB 1P7KA 3MRCB 1AI1L 3FTVA 2AXWA 4FX5A 1X5FA 3SGEI 2J44A 1INDH 3UPAA 1UG9A 3BVWA 4AYID 2WBJB 1Q90A 1U4EA 4KPHL 1U3HB 3MGTA 4CDGC 5IVNA 3V4PH 4ZS6C 2FECL 3IVKB 3B8YA 5HGAB 2P4AB 3IFPA 3O6MH 1AE6H 3FDWA 2DBLH 1HSAA 3MRJB 4OZFH 4N6RA 4HKXA 1JGIA 1VKXA 3ZKMC 5HHOE 2LR4A 4WFFD 1TYEB 4MXVE 2FR4B 5JZ7C 2ZKMX 2FQEA 5IM7A 2G2RA 5E0FA 2AV1B 4AE1A 1E2VA 2ESVD 3BSZA 3G6JB 4HWBH 5KYUB 1NGZB 3GHPA 1RJLA 1P6WA 4JR9L 1EZLA 2HLAB 1JIBA 1LM8V 4U6XA 4WV1B 4N20A 1VAHA 5INCA 4PREB 1UA6H 1ZTXL 4HH8A 5CD3B 4G7YL 5KAQG 4UV4L 5FYKL 5JZ7D 3C5ZD 4TLKA 4MYWB 4NQQA 3CXDH 5F7EL 2Q8BL 1KJ3L 2EDMA 4EOWL 1ZXQA 3BP7B 4KJWD 5ECJE 4P99A 3LHAA 4HK0B 1TZOA 2WLJA 4JCLA 3WGUB 3QS3A 1ZLSL 4ZODA 4PJFB 4MKMA 5SX5K 1UURA 4LVNB 1F45A 1JF5A 1CD9B 4XO5A 4PGCB 3B2UC 1KEML 3NABH 3QCUH 1FLRL 1GJWA 3I6GB 4N0RA 2X53A 4Z7WE 1YO4A 3WFZA 1NCNA 4RESB 2DYPB 1I1RA 2HT3C 2O6FA 2P7TA 1JZDC 2Q7NA 1F58L 1U3ZA 2C4FU 2WWMD 1RIHL 4U1KA 5E6IB 5I8EB 4EVNA 1IQWH 1QSEA 4U1HA 2NQ3A 1K8DB 1SEQL 3ATEA 1A7QH 3BT2H 2DI8A 4RGND 3HHRB 2V7NB 1X9LA 3RIAF 3RURA 1IM9B 5KG9A 2XZZA 2R23B 1KFAL 4AL8C 4JQXA 3GMPB 1FG2B 5F7FA 4I0PC 2H45A 4DJMA 3B1UA 2QEJA 2WY3B 4NKDA 4FNTA 3PV6A 4ZPTA 4GAYA 2I5YL 1GGTA 3ARBC 2CZNA 2Z0BA 3AB0C 4JY5H 1ZJBA 3BKYH 4PB9L 4MDJB 2YR3A 4WO0A 4MNQA 3OSVA 3GB7B 2CO4A 5KSUA 1IJNA 3CVIL 4XHJC 3U83A 3IJEA 2R0ZL 5FYLE 4ZTPH 1MFAL 1JV2B 2DH3A 4N5ED 4U6TA 2X6BA 4HJJH 4WJ5B 5DEGA 5B1BB 1FCGA 1Q9WA 3FFCA 5AYUL 4QRUA 1NH6A 3JXAA 2H32B 3MZTA 1BBDL 2WXRA 3VD5A 5I74B 4FTVB 4AYDC 1G9NH 1GMEA 5JUEL 5KVDL 4OZGE 4XHJD 5B3NA 2DWDA 4MZIA 3TASA 3B2XA 3TZVB 4LF3B 1OSZB 2DLGA 3QPXL 4UT9L 4AGQA 1E9PB 4DP1X 1GGCL 1AO7A 3VU1A 3LRSA 3IT8D 3N06B 4PI0A 4OKVB 5JOPD 2Y07H 1YPZA 1J0JA 2VC2B 5A16A 3TH4T 1T5WB 1AG6A 3MLUL 2WZPA 3OKKA 3HNSH 3LS5L 2AJVL 5GGVY 1ESOA 1DBBL 2XX0A 3NIFB 1HAWA 4S2SB 1PS3A 2PYFA 1U91B 4GRWB 4Z77A 3UJTL 1AMYA 1JGVH 4GB9A 1F90L 3QBTB 4OZGF 5DRZA 5AVZB 1CLOH 3Q6FA 4U7KA 4CADB 2GJJA 3IJ7A 4JHUA 4WQOA 3ZKQD 1G4RA 1KWGA 3O3EB 2BNRD 1DZ0A 5IESL 1C8PA 4NM4H 4OLXL 5DC0A 3X3GH 4ALAH 2VO8A 1U21A 3SQRA 3ZLQC 5DRZB 5B3SB 3MOBH 4C56A 1GAFL 1IE4A 4L3FA 4PJDE 3ULSB 4DP2X 1CF8L 3WS6C 3JWOL 4J7RA 3D2UA 4X99B 1OCWH 3MXWL 1QBAA 1N59B 2KYIA 4HUXA 4I5BB 4XN1A 2ICWA 5DFVC 5I19H 3VD9A 3AGVA 4PJ8A 1I3GL 1T0NA 2VDPL 2ZCZA 3BFOA 4PRPA 2EUXA 2YFOA 4Z7QF 1KJ2B 1K2DA 5C0BB 2YQGA 1ADQL 1UZ8B 5IHWA 3GO1H 3V0WL 1MFNA 2OJ1A 3PDOB 4N1HB 4X42A 5LBSL 1SDYA 4HJ0D 4B41A 4Z0BH 5I66B 1X7QA 3KPMA 3QUKB 4R5TA 3WI9A 4OJEH 4XX1E 3FFOA 4OIFA 5DVPA 2G9HA 5EU7E 2WWKO 1L0PA 1QYGH 3AY2A 3MRIB 2CG9X 2O61A 1CD0A 1ZHNA 3BCFA 3F6IA 3ME0B 3RFZC 4JANA 1V54B 4H20H 3V0AC 3FQNA 4PJDF 1D5BB 5F88A 1FLTX 2AQTA 3BI9X 5D7LB 4X4YB 3OX8A 4BHUA 4YHOL 2NY7H 3FU7B 2DJSA 2H2SD 4F8OA 4ELMA 3C60B 3VDAA 2VDLB 4P05A 1XGQA 2XV0A 5C9KA 2A6DB 1A5FH 4G9DB 4V1DE 4OLZL 5C2BL 2QQLL 5EZPA 4PRHA 5B1CA 4U2YA 3WUWB 4WHDA 5J11C 1JNJA 1XBDA 3G5YB 1NAMA 4UINH 5HHME 1TIUA 1WYJA 2R56H 2ZQKA 4RMVA 3QEHB 3B2PA 5JMOC 3P1VA 1JBJA 1OGPA 2CJUL 5I8OL 1NCCL 4N0YL 4KKBD 4E42A 4U6XB 3WMSA 4YOKA 3PDDA 4WFHD 4CKQA 1CICB 5HYSB 1ZVYA 4ZFFA 3UPCA 1YJDL 3PNRB 2OYMA 1W80A 4GQZA 5KYWB 3QA3B 1FNSH 4GMTL 3HC2A 4TSBL 3QQ4B 4TRPH 4XBMA 1EXHA 2VITA 2VJ0A 1B6UA 3EYOB 3BIBX 3R18A 4WTZA 4KTDH 4UZUA 1DUZA 3G7TA 4F3FB 1IU1A 4BA0A 2FUTA 3PNWB 1DSFH 3LKOA 4LKCA 4MGXA 4DGYH 5MEPB 2J5LC 2VXVL 5KW9L 1WV7T 4U1LB 1HI6B 2CE6A 2RHEA 4TUKH 1JV5B 4YDJB 2OTPA 4QTIH 5C08B 3CX2A 3TBVB 1NCWH 4HD5A 3LH2L 1QWHA 2VXUH 3MACH 3MOQA 2BNUA 3DX1A 1IKFL 2NUPB 3FO1A 2HT4D 4M4RB 3VXRE 3AWFA 1KGYE 5LAXB 4N2MA 4G8GB 2BVYA 1KELH 1JN6A 1F3JB 3D6GA 4XMLL 1XGZA 3L4CA 3Q5OA 1Z2KA 1TLMA 2UZYB 4PJXA 5H4YA 1T80A 2NY2D 4AV4A 4UNIA 1IVTA 4Y2DC 5BZDA 4XVJH 4B9ZA 5JIDA 3UO1H 4KO5A 5HGDB 2ZX9A 5BV7C 1NJ9A 2Q6WB 2H0FA 2M83A 1LXMA 2H1PL 3QJHB 5F9OL 3G04A 4AENA 1MSPA 1FVEB 4ZFZA 5LGHH 2BNRB 1ERNA 3KPOA 4G6KL 2EZ0C 4FQIH 3AFLA 3HG2A 3ZTJG 4CA4A 4PMEA 3FQUA 1NL0H 3ME0A 2IOMA 1TZGL 3SKOB 1D6EA 1MNNA 4TOYL 5IB2B 1MY7A 1AHMA 4HGKC 4BK4A 2YK1L 5D1ZD 4KKCC 2HA1A 3FTGA 3WEXA 2E7BA 1THAA 2NW3B 3EFFA 4G83A 4G42B 3CMGA 4N0UA 3MFFA 4TL4A 4UTAH 2FL5B 1KC5L 5GZOD 5I71B 1PQZB 2F7IA 2FJHB 2V7HA 3NAAL 1T83A 4A63A 5DD3L 4ZW8A 1KNOB 1U58B 2EVGA 4KDVA 4A67A 2EIZB 4H2AA 4HX1A 3TX4A 4MMYA 1HNGA 2BOBB 2EO7A 2OXGB 3FRPB 3L1GA 2IDCA 3DJSA 3TPKA 1UH2A 2VN5A 1FGVL 2LV4A 2PW2B 1CDIA 3OD3A 2GITB 3PIQA 3AXLA 5H94A 1B0RA 3D9AL 5D2NB 3BD3A 5FO2A 4I48B 2P7TB 4I9WD 1R46A 3I84A 2ZOOA 4JO8A 4IW4C 5J57B 3MRRB 1QI5A 3HG1A 2FZ3A 1C12A 3MLYH 6TAAA 2D8KA 4ZNEA 4IBWA 4YSSA 2EVIA 1SXCA 1XGUA 2J12B 4K23L 4U33A 3RPBA 4GINA 4KI5D 3NOIA 4OD2B 2F53E 4HK0A 2ORBH 2OJEB 1L7IL 4ABVA 1IGJB 4DKEL 3EJUA 1DBJH 2M2DA 1JHLL 4UM9A 1S7XA 1C7TA 5KVGH 1UH3A 5DS8B 1MJ8L 3CVHL 2EXYC 4MNHA 1RZGA 1DEDA 5E6ID 4HOMA 5I6XC 4NRYA 5C0AA 1NMAL 3D39A 4XAWL 4AEIL 4CSTA 3FUNA 5KBPA 1Q94A 2HJLA 3FHEA 4JFYB 5FYJL 4PW3A 1IFRA 5CSZB 5DA4A 1FV1B 4IIQA 1RZ7H 3RVUD 2ZCKH 5IOPB 3QZLA 4QHUA 3MKKA 2X4QA 4Q14A 1P6FA 1ZT7B 3ZKXB 3FFDA 4YLCA 4QKTA 3ZE0B 4MAYB 1T4KA 2B4CH 4M5SA 3MA9H 1I7ZB 4ODVL 5FO8B 1LYQA 1GW6A 2E7MA 3NEOA 1OHQA 4FQXC 4K3EL 3VG0H 2R27A 4JFDA 2I7OA 4F8QA 1AVAA 3FTYA 2I9LA 4N26A 4S1DC 3CQPA 4D8PA 1P4LB 2OV0A 1OP5H 3TFBA 3H2PA 3Q1SL 1YYLL 3OZLA 4R90H 1R4XA 2QTVA 3BRDA 5SWSB 4Z18A 1C5BH 1HXYB 1GY1A 1IGFL 5GRYA 2FNWA 5A3ID 1H3VA 5BQ7A 1EXUA 4FQXD 3L81A 5EDXA 3VWJC 3RNKB 3CK0L 3QXUA 2HKFL 4ODUA 4L9LC 3RWFA 3TVMA 5JHDB 2GJ6D 3G6DL 5T1KD 2DTSA 4QMEA 1YHPA 2D0GA 4JQVC 5TE4H 3SKOA 1QP1A 3BP6B 4I18B 4PJ7B 1MCBA 1QI3A 2P80D 1T7ZA 1TVHA 4IKNA 4OD3H 4NKIL 1L5GB 2O4EA 4Z7AA 3CC1A 1L9MA 3EOAA 1FZMA 3QUYB 5A16B 3SO5A 3RJOA 3VWJD 2EKSA 5LDSA 1R34A 1U8IB 2EYSA 1ZEAH 3QDMA 2O1AA 1SPDA 2EYTA 2H4EA 3W5NA 3SPHA 2Z31A 4U6VL 4N2LA 3JTSA 1JYVA 2OJZL 3V7AE 4OF8A 5LAPA 2R9HD 1UOKA 5DUPH 2XPGB 5EEXA 3FB5B 3IS0X 1T3FA 1AJ7H 2A7BA 5IMOB 4JL2A 4XP5H 3VQLA 3O9WB 1ZS8A 4H1LG 5J13B 2ZPKL 3PCYA 2FRGP 1NKOA 4JFPA 4Y8DC 1OK8A 3S37H 4BFBD 1NANI 5GRVL 1JNNL 2HH0H 2D31A 5E8OA 1SJMA 4MAUL 3WGVB 1N0XH 5GRZA 3EYFA 3CIQA 2YLHA 3FUMA 3CBJB 1CXIA 4U1GC 2HUHA 4GRWH 1S3KH 5I6OA 4OZFA 2CALA 5E9DD 1ZSDA 1YEFL 2E7HA 3VO0A 2J4WL 1LK3H 1HNYA 2B8OT 5KBLA 1HQ4B 3TESA 3POCA 1SY6L 4IBSA 4OKDA 3US1A 1F00I 1KYOK 4EDWL 2J43A 2R15A 1T1WA 2IMMA 4DZ8A 2R2HB 1NCGA 4N0CD 4DUWA 2P3YA 2YZ8A 5BUGA 4AYBA 3MC0A 2A74C 4M1GL 4DEUA 2EIEA 1MIEH 1SHWA 2A9MH 1CICC 4K0OA 4PVMA 5C92A 4KGLA 4YDLB 4ZFGL 1CFVL 5DHVA 3ULAB 1RIVL 3F5WB 3PXLA 2DQDL 2W0KA 3LZOA 5I75C 3WEOA 5HDBF 1N7ML 2LFGA 2R0WL 4F5CA 4KRPC 2XFGB 2EDQA 4I1RA 1X9RA 4EIZC 4Z7NE 2ARJQ 5BMFH 4PVLA 1I1FB 2VLJA 2VUOA 4K3JL 3LQMA 3F7VB 2VISA 2BSRA 4OGZA 1FNHA 1FG9C 4MCZA 2RFXA 3EHBD 3MRKA 3IJSB 1NEPA 3AROA 1HFUA 4LCIH 4AGLA 3RNKA 5ADOL 4E9QA 3OLIA 1NA8A 1EV2E 2IQ9H 5DZJA 3D0AA 3L08A 5T3ZL 3V6OE 2XX1A 4HJEA 4NNYB 4YUEL 2VZVA 4G9DA 2MOGA 3LMJL 4O2EA 2EDWA 1NCDH 3ZT6A 1F4YL 5AVXB 1A3RH 2K7PA 2G2PA 4I85A 4L8SA 5HDBE 1NZRA 4F8TA 4ZD3L 2F7PA 5K9QG 2Z9TA 4XO4A 4LPYA 1LP9B 4P46A 3HN8A 5HHVH 4OFDA 4B0MB 2DYRB 1MCSA 2JK5A 3RUGB 5LNGA 3MLRH 5KBMA 3WEAA 2AVFA 2FJSA 5T5NG 4HQQH 4B9KC 5JA8B 4NO3A 1Z3GH 4JO3H 3O4OB 4ZMYA 1WD8A 2WYZA 3MLTB 3HS9A 1M2OA 4JVPA 3PG2A 2G75A 1VGEL 3OSKA 4WCYL 4FNRA 4R96A 1BVKA 4PJ9D 4FQPA 1XGRB 5JYMA 5E1QA 1F1GA 1WCQA 1YEHH 3ARBA 4P2OB 4MAZA 3DO3A 3CN1A 4PJAB 4X7SH 1V3KA 4Y4KD 2WPGA 3LIZL 3MKGA 2XY2A 3VQMA 1D9KA 4JX0A 3SPIA 2XZCL 3DPDA 3R4DA 4LU5H 4YDJA 4PG9A 1VA9A 3SSGA 2OJEA 3GI8H 4GXUM 4L4TB 3CGTA 4AC2A 2K8QA 1DQKA 5FHAL 3U4KA 1S9VA 1KPRA 2BSSA 5HHQB 1BMWA 2EC9U 4WW2C 3UG5A 4Y4KC 5CZVH 5SX4H 3ARGB 4KQ4L 5TK4A 2VDKL 4I0PD 3QDGA 2BPBA 5FA4A 3DDGA 5D72H 2QVMA 3LQAH 3RTQC 3APMA 2IJ0C 1IE5A 4HUUB 3QEQE 3K2UH 4N22A 3ZYZA 4GRLA 3PAZA 1IT9L 2R1XA 4KFZC 1A3ZA 5LHDA 1TQWA 2JNZA 3KXFE 1FAKT 1D5ZB 2E7LC 5FV1L 1E4XL 1JDDA 2XQBH 3UAJD 2VZ3A 3HKFA 4QJ3B 2X88A 4FLSA 3U82B 1QFWL 3HC3L 4X80L 2EIZA 4HX1B 2VKWA 4LHUD 2KLSA 1MHHA 1H5BC 2VXQL 2FCBA 5L2JA 2PF6A 3JT2A 1P7QA 3GLZA 1KIPB 5EUOA 5IEKA 4TQHA 1Y18A 2V3DA 2ZUVA 4CBZA 2GT9B 4L9DA 1HU8A 4WI5A 5I5JA 3ZL2A 4DQOH 3D69B 3GPEA 3TXAA 1SEBA 3NT0A 5ERWA 1RUPL 3WFBH 1XEDA 1A14L 1KZYA 3VD4A 1HXMA 3VSUA 1FIEA 4BKLA 1WFTA 4H5SB 5I1GH 3DK0A 4JRWA 1OP5K 1OAYH 3WNLA 1DUZB 2EUWA 2R8SH 5KYXB 3F6JA 3N1GC 3O3AA 3ERXA 3VTAA 3L4WA 5E8PB 2WAQA 3DXAE 3MR9B 3QIWA 3KLSA 2YRZA 5FYJD 3UTPD 3IAQA 4G6JH 4L8DB 1B0RB 4HPYL 3PABA 4AUUA 5HYJD 5EEUA 2OMUB 4FF9A 3UYOD 2Q8AL 2DIJA 2L3BA 4RGNE 4ZYKB 3NACL 1ECZA 4KQ3L 1RZ8A 2B3IA 5TD4A 1K6QL 1ZVSA 4L3AA 1TEYA 3RHWF 5LNDA 4G6AC 5F7AA 1PFCA 2QADB 2R4SH 1B3JA 4NAQA 5IMOA 1ULVA 5CHNB 3KYOA 4N9GB 2MOQA 3WUZA 3OAZK 5EN3A 4JJ5A 1MCJA 5TQ0H 2MPAL 3PJLA 2HFGL 3N0PB 3B56A 4JHAH 3CCHA 1GSMA 2EEFA 4U4IA 3RFZA 1RUQL 1TZIA 4IBYA 5E8OB 4PJ9B 4XPTL 5DFVD 2KHAA 1ZHBA 4XB3A 4AUJA 1VFOA 1XH0A 1SLXA 4YAQB 3RBSA 3V6ZB 1GJIA 5KSAD 4BFEA 2DD8H 4JO1L 4UQEA 5I17B 1C08B 5HYEA 1KV3A 2I27N 1IAOA 1ZXKA 3MN8A 3UJIH 4DAGH 3QNXB 2YD2A 1KPUB 4BELD 3NEXA 3O6FD 4RMBA 1IM3A 5FO7A 3I6GA 3KS0H 4PLNC 3LH8A 3L3IA 1P5UA 5I15L 1V55B 3CZJA 1GGYA 2KL6A 4QHPA 1WAAE 1PY0A 5AD0A 1CLZH 4DQAA 1FO0L 1X5YA 4N5UA 1NLBH 4J3VA 3QZBA 3H3BC 1R5IB 2X44D 3FB7B 4MJIB 3PPEA 1PFOA 3LJ3A 4PS8A 4AGPA 2FQDA 1AI1H 2HTKC 1JPGB 3Q8EA 1B0IA 3U25A 3LXAA 1SYVB 2I60H 2XTSA 1OALA 4UQ9A 3UTTD 1GGIL 2AXHA 1RY7B 2NZIA 3IFNH 3M17B 4BFJA 5F7HA 1JVLA 4NJAL 4RX4A 2B1HH 3TC9A 3ABLB 3UBXB 4C83A 1FP5A 1W72A 3TBYB 3VXSD 5CJOH 1GL4B 4AW4A 3D85A 2OX5A 2ZSVA 2BJMH 2P5EA 4DTGH 1NBCA 5E2WH 4KO7A 3QFJA 4MCYB 1RLBA 4LBAA 4OLEA 4Z7OF 1IMHC 4OGAD 3TIDA 4FI6A 4Y19A 3TIEB 4UM8A 4OB5H 5IV2B 2CM5A 1BFOA 3VXMB 5FGBA 2EAEA 3ZK0A 2A83A 1NBYB 5HDOA 5FYKD 2VDQH 3CV5A 4EI5C 5C3LD 1N6QL 2XPYA 4IOFD 5CEXA 4L8SB 1I8KB 4Q4EA 1WWAX 2VN3A 5DTFA 1BF8A 1U8MB 4IK6A 5EMYA 4PJXF 2ICEA 4IBLT 4MNGB 3TIEA 3T04D 2EUVA 1P9MA 2QSTA 1I8MA 1QTPA 5HHOD 4WFFE 2A3TA 2FATH 3DSFL 2FWLB 4J2XA 1SDDB 3Q2WA 2MEJB 5FKAA 3V6FB 2H6PB 1UD5A 1TZAA 2ICEC 1A6TA 4L37A 1ZAGA 4Y2DD 1Q94B 2HJLB 4HIIB 4JFYA 1TJIL 1JPFB 5TGBB 3I2CL 3D3VD 1QR1B 3MRHA 4QRRB 1NGQH 8FABA 4U0RC 1ZLSH 1T6WA 3ZDWA 1O6SA 4Z7OE 3E2HB 4L0PB 3O9WA 4PBDA 1IBYA 2G3ZA 5L8LB 1KY6A 1A21A 3TBTA 4K7PY 1KCKA 1UD3A 3IGLA 1CXFA 2PTTB 1UB6B 3KL3A 4GXVL 1TNNA 2OR9H 5KUMA 2G60H 3U1PA 5DVLA 4F80A 1W0YT 1PG7W 2FX8L 3SQBA 1BEYH 1V3LA 2ZP0T 4QRPD 3L5HA 4A7TA 1Y7VA 2ED7A 3ZL4L 1SEQH 3BT2L 1DCEA 2DRUA 3II2A 1JZ5A 3H9SB 3NCJL 1I1AD 3FUDA 1A7NL 3FCUB 5MI0B 3ZY7A 4UNVA 5AAWA 4YBLB 3EBHA 2APSA 4L5FL 4FLOA 4PR5B 1D3CA 1U95B 5FGCE 2IWEA 3ZDYB 1N3NB 1UT1A 2XWJB 1V5JA 3DVNA 3G5XA 4PJHF 4JRYE 4YXHL 4BXVA 3PF2A 3GSNA 2AV7B 5C0JA 1H0DA 1AQHA 1R3LB 3ASOB 3TO4B 2HUEA 2ADJA 2AQQA 2R2BB 4MX7B 1NCJA 1G6RL 1G0DA 4E9WA 1YC8A 3HI6L 4QRTB 4HJJL 5F7DB 4O58H 1JHKH 4BFRA 3KPPA 1BWMA 1MHHB 3JTBA 4HIQA 2XQYK 2ITDA 4L4VB 5C0RL 4HS8H 4MJID 4UIKL 2JJUA 2QQQA 4PRHB 5ANMB 5FKPA 1I7TB 4QHNA 3GI9L 3JV6A 4PWKA 3V0VB 4CC4A 4G3YL 2AC0A 3WXVH 1J1PL 5KOMC 2JQMA 4GG6F 3QJFB 3O8XD 2OMZB 1R33A 4OCYH 1ZA3B 4M93C 1FBIL 5KEZA 1GC1H 3FFCB 4CC4C 3KVDD 4F9LA 4FEMA 3WKPA 1NKGA 3MLUH 5INDB 1OIOA 1S3RA 2JMRA 1H3XA 1OANA 2DQFA 1DVFB 3LS4H 3VXUA 3MTXA 3CC5B 1LEIA 4YDNA 5T1DH 1PDKA 4KKPA 4HEME 2ZUWA 3U2SB 5C0CB 5JHMA 3IE9A 3OG4B 2O93L 1PZSA 5DTFB 5KJ7E 2DQFB 1MEXL 4HWNA 2DQJL 4K7PL 4KH2A 4NQDA 4D0CA 4UDTB 1HZLA 3FT4B 4GG6E 2IANA 2MNUA 1RVFL 1UXMA 5ICYA 1UOWA 2OMYB 1JFQH 2UZPA 1QSFA 1BSIA 4WIQA 4TVPD 4MXWL 4AYSA 4U1HB 2H0JA 4BCXA 1IZJA 3GQFA 4PJGA 1T0NB 4PRPB 4G5ZH 5D7JB 5B4MC 3NCBB 4UDUA 4XPBL 5CIPB 1M53A 1GKOA 4PJFF