2WO2B

Crystal structure of the epha4-ephrinb2 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
136
Chain Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPHRIN TYPE-A RECEPTOR
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
total genus 29
structure length 136
sequence length 140
ec nomenclature
pdb deposition date 2009-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2wo2B00
3NJNA 2PP7A 3T9WA 1OV8A 4A2DA 3FU7A 4YSTA 1AZNA 2EINB 4A66A 2DYSB 1JZEA 4HHWA 3TBCA 1NWPA 1E5YA 2E86A 3EF4A 1RKRA 1AZBA 2QDVA 2GI0A 3ABGA 1HAWA 2IWFA 2IDQA 5AKRA 1ZDSA 2I7OA 5B1JC 1PZCA 2YAHA 3OM3B 3CVCA 1GSKA 3IN2A 1QNIA 5F7AA 3OMNB 2W88A 3ZIYA 3GDCA 4DP6X 4N4YB 2BZ7A 1JZHA 6PAZA 1W6WA 1AQ8A 1M57B 2PPDA 3PAVA 2W8CA 4E9QA 4A2GA 2IDTA 5I6KA 3UAEA 3FS9A 3WNJA 4HCFA 1OCZB 2WSDA 3T71A 2XYBA 2VW4A 1ETJA 4NB7A 4DP1X 1SF3A 4YSDA 3NJLA 4YSUA 4A67A 3CVDA 1L9SA 5A7EA 1GS7A 7PCYA 1A4BA 1AR1B 2EIKB 1NIDA 2H5UA 3NYKA 5I5IA 4YSCA 1M9WA 4DP7X 3EH4B 5I26A 3IEAA 1N68A 2AFNA 1TKWA 1L9QA 3DTUB 2IDFA 3FQ1A 3WIAA 1PY0A 2XXFA 2XX1A 3ASNB 4HALA 2VM3A 2PPFA 1DYZA 1AIZA 4HHGA 3FQYA 3NJMA 2I85A 1YLBB 1HAUA 4E9SA 9PCYA 1PCSA 1NDTA 1AZUA 1SFDA 1ET7A 2WO3B 1BYPA 2X87A 2XX0A 5TK2A 4Q89A 4AKPA 1L9PA 2OCCB 3NJKA 3KW8A 4ZK8A 2H3XC 1UATA 3MBWB 1OE2A 1ID2A 1SHXA 1PZBA 2EIJB 2XWZA 5I5JA 4EF3A 4UF7C 2Q9OA 1SNRA 3H4FA 4YSAA 3ZBMA 5AZUA 2GHZA 4BXSV 4Q8BA 2PPCA 2MTAA 3RYMA 1ZIAA 4KOCA 1IC0A 4DPBX 1CUOA 3V9EA 1A4AA 1GS8A 3HB3B 1CURA 1BQ5A 4KO9A 1NWOA 2BW4A 3QJVB 1NZRA 4QLWA 1GR7A 1XMEB 3NSYA 1PF3A 4MFHA 1BQKA 3EHBB 2GBAA 4W9ZA 1QLEB 3NP3A 1A65A 2J56A 4HIPA 4AZUA 1BQRA 1CYXA 1OOWA 1WS8A 2PLTA 3FT0A 4RH4A 2H47C 2UX6A 2YXVA 1L9OA 2VMJA 2TSAA 1MDAA 4YVUA 1SJMA 1ET8A 1RCYA 2DYRB 5B1BB 1ASPA 2RACA 1JZGA 5B1KA 1SF5A 2BP0B 1KGYE 2P80A 1PZAA 5I6OA 2YAQA 3NJIA 4CSPA 1IBZA 2VM4A 4BWUA 2HX9A 4X4KA 4DP0X 3QJRB 1ZV2A 4WTQA 2DV6A 3NSDA 1L9TA 2IWEA 4DPAX 4A2EA 3CVBA 2BZCA 1GS6X 4QKTA 3OMIB 1A4CA 2BW5A 2R7EB 3FPXA 1MG3C 3S8FB 2YXWA 2CCWA 2PP9A 1SDDB 3WKQA 1AAJA 1KCBA 2GIMA 3AG3B 1TU2A 3MX0B 3QJTB 1BXAA 2BP8B 4GP8B 5I28A 8PAZA 3KW7A 1JERA 3QQXA 4YSRA 4DP2X 2OJ1A 1NIEA 1JXFA 4P5RA 5B7EA 3S8GB 4NAJA 4A68A 4DPCX 1JOIA 1PLCA 3FSAA 3D12B 4KO5A 4F2FA 2B08A 3JTBA 1PAZA 4G7RB 5B3SB 2XVBA 5B1JA 1ZIBA 4DP4X 1NIBA 2FT8A 5D4JA 2GC7C 5B7MA 3N2JA 2PCFA 1W8EA 3QJQB 2CAKA 1HFUA 3CDZA 1ZDQA 4AX3A 2VN3A 3EH3B 2YQBA 4UANA 1SHWA 1NIFA 3C75A 3TA4D 1JZIA 5ANHA 3OD3A 2Y69B 3AG1B 1X9UA 4DP5X 3ABMB 3ERXA 3NJFA 6PCYA 3CDZB 2FNWA 1E67A 1BEXA 3QJUB 3X1NA 4E9TA 2QPDB 3AG4B 3PLYA 2J5WA 3CZUB 2R7EA 2BWIA 2DWSA 1EZLA 2JXMA 2XV3A 2MRYA 2UXTA 3S3DB 2HRGA 2JFCA 1PMYA 1FA4A 3T6WA 3BQVA 2QDWA 3DKHA 1ET5A 2HLEB 2B3IA 2TSBA 4HAKA 3X2QB 1WA2X 2BP8A 5D4IA 5B1AB 4N8UA 5E9NA 3T6ZA 2PP8A 1JVOA 1CYWA 4E9YA 7PAZA 4KO7A 1XB8A 2N0MA 2FT6A 1AZRA 2GC4C 2OV0A 1T5KA 3S3CB 4G7QB 1OCOB 3FYEB 5I6NA 2FQEA 2FTAA 1ZPUA 2I7SA 2BO0A 3FU8A 2ZWNA 5I5MA 2PPAA 5PCYA 2ZOOA 2YARA 1NINA 3S3BB 1ILUA 3PCYA 4GYBA 4FAAB 4BDVB 4BWWA 2X88A 4BK5C 4GP5B 4JHUA 3WI9A 3DIVA 2IWKA 2CBPA 4BWTA 2J55A 2XUWA 2FWLB 5TK4A 3SQRA 1AOZA 1E5ZA 3NJGA 1PLAA 1KDJA 4YL4A 1ASOA 3OQRA 3X1EA 5LDUA 3SBRA 4NERA 4PCYA 4K9JA 3FQ2A 3ZDWA 1J5DA 2CALA 1MZYA 1J9RA 1R1CA 4G7SB 1IBYA 1RZQA 3X1GA 1BXUA 2BWDA 4M4RB 1KYAA 2YAPA 1URIA 5I6LA 1TEFA 4E9XA 4BXVA 1MZZA 3SBQA 3TASA 3CG8A 1BAWA 1V55B 2A3TA 1JXGA 1OCCB 3UAAA 3V9CA 3AY2A 2FT7A 1XB6A 2AZAA 3FU9A 1WAEA 2IDUA 2XLLA 1NICA 5AFAA 4E9WA 3WKPA 1PLBA 4HCIA 3T6VA 4KOBA 3H56A 5IY5B 3NSCA 3IN0A 4YSSA 1EHKB 4PAZA 3FPYA 5EHFA 1MG2C 4BDVA 5B7FA 3PAUA 3NT0A 3BVDB 2NRDA 1QHQA 3PXLA 2IH9A 3OMAB 1IKOP 3NSFA 1XB3A 2YAFA 4CSZA 1WA1X 1NPJA 1AG0A 4L0PB 1PNDA 2DY2A 3TBBA 2FQGA 3IBOA 2XV0A 2HZHA 3NP4A 1GY1A 3H4HA 1JZJA 2FQFA 1BYOA 1GW0A 4GXFA 1OF0A 1PNCA 4HCGA 3WG7B 2J57A 2BP0A 3UADA 1KBWA 4G72B 1DZ0A 1WS7A 1JVLA 2HX8A 1AACA 3FSVA 2UXGA 5PAZA 4GY4A 4HZ1A 2ZXWB 3PAZA 3UABA 4A2HA 4GP4B 3ZX1A 3ABLB 1A3ZA 1JZFA 4E9VA 3G5WA 1ILSA 2XXGA 4G70B 1WA0X 1AS7A 2P80D 1RZPA 1NTDA 1AS6A 3T6XA 2YAMA 4JKNA 1KBVA 2JKWA 3N55A 3TU6A 2AANA 1KV7A 1SFHA 2Y1AA 3QJSB 2FJSA 4TXVB 1BXVA 1SDDA 2BHFA 4YSEA 1M56B 2PCYA 1E65A 2EILB 3PPSA 2QPEB 1ADWA 4KNSA 1V54B 5F7BA 1VLXA 1V10A 2LLNA 3FSWA 5I6PA 1NPNA 3NJJA 3X1FA 2HXAA 2AVFA 3HEIB 4DP8X 4F7KA 4AKOA 1OE1A 1NIAA 4KNUA 2VSMB 3IE9A 1GY2A 1J9TA 1N70A 1KDIA 3X1BA 2QT6A 4JHVA 4AI7A 1TEGA 3SBPA 4YSOA 3WNIA 4AKQA 1I53A 1W6LA 1B3IA 3FU7B 2IAAC 1FFTB 1KCWA 2EIMB 2Q5BA 2XV2A 3L45A 3JT2A 4YSPA 3GYRA 4KO6A 1IUZA 5FC9A 2GB2A 1F56A 4ENZA 2IH8A 2UX7A 1AZCA 1J9SA 2YAOA 1AG6A 2CUAA 2HRHA 2DWTA 1L9RA 2VW7A 1A8ZA 4M3HA 1AS8A 1X9RA 4A2FA 1OE3A 2UXVA 2WO2B 1CC3A 5D4HA 3AZUA 2UXFA 4W1TA 4WKXA 3UGEA 4FA7B 4E9RA 2IDSA 2ZONA 4KNTA 4P5SA 1OCRB 3UACA 1E30A 2VW6A 3AG2B 3U25A 4DP9X 4YVNA 4F2EA 2AZUA 1ASQA 2CJ3A 5I6MA 2YAEA 2PPEA 1GYCA 3ABKB 2XU9A 3GXUB 3AW5A 3ASOB 2GSMB 2HX7A 4YSQA 3FYIB 4G71B 3EH5B 2VSKB 1JXDA 3QPKA 4UAHA 1J5CA 1FWXA 1J9QA 3FSZA 2FQDA 1AANA 3NJHA
chains in the Genus database with same CATH superfamily
3S0PA 4LCIH 4UTCA 3W9EB 3DX1A 5HHPA 1XCTB 2B20A 5KYNA 2Y24A 5HVGB 2XN2A 4E0RB 1AGBB 3O6MH 1KULA 4FNPA 3QIUC 3L3OC 1ZTXE 1ZA3B 5EZOH 2QDVA 2ORBL 3M07A 2NUTB 5AWNL 4ETQB 4F92B 2FHCA 1NCWL 4QGTA 3TT1L 2BXZA 4GSRA 1TCMA 3UJJH 4TVUA 5F6IB 1KJ2A 4FXKA 3W0WB 4OFPA 5HHVL 4M61B 3RWJA 1DJSA 1RLWA 2F7PA 4A2GA 4DIXA 1N4XH 2KERA 4KPHH 2YRLA 2WSDA 3NSJA 4QRUB 5FHAL 1R5VA 2DYPB 3ABZA 3FB7B 3V6ZA 4QXUH 1XAUA 2MJWA 2AQ3A 3QA3A 2QLVB 3EDEA 4WNJA 1LP9B 2CJUH 32C2B 5IIEA 5F7DA 4XMZA 1XAKA 4XO4A 3FT9A 1XQ4A 2IOOA 4QRFA 1BLNB 3N91A 5F6IC 2BFVL 3BD4A 4WGKA 4UIKH 3RFZA 3CLFH 3UZVA 3B5GA 1TKWA 4R4NC 1KJ2H 2YUXA 5DA0B 1QLRB 3O3EA 5JR1H 1OAZL 3GIVA 3UTSB 1OB1A 3CVHL 3TVMB 4DQAA 2YBRB 1IC7H 5BMFH 1KIRA 1RJCA 2X2IA 2XACC 2A99A 2PCPB 2XG5B 1ORQA 5LDSA 1S3KH 3D9AH 1FZOA 3RA7L 1TQTA 4OGQC 3IDGA 3ZDZB 3PNRB 3T8VA 6CGTA 1OKEA 5I2IA 1G7MA 1ZGLP 2WO3B 2XQYA 3T0AA 1JVKA 2OJZH 5HI4C 4WU7B 1S7SB 3QUGA 5DC4B 2CSPA 1B4JL 4QAMB 2Q8AL 2O93L 3W5NA 1OE2A 2AGJL 3OPZL 1P7QA 5C97A 1AHKA 1IGIH 3ZL4L 4KGLA 4X83A 3TVMC 5HJGA 4M62H 4J3OG 3UH8A 5I1KH 3SY6A 4JFOB 1TXKA 4RDQF 3IMTA 2OMBA 2ZAGA 1PPIA 4N5EC 1L0PA 5CGBA 1IC0A 4N2BA 3APMA 2E7DA 4L1SA 5C0CE 3G6JF 1Q4NX 2WBKA 4W6XB 1CURA 4KX7A 2VYRE 1RH8A 4QF1B 1C12A 1HSBB 1U8IA 3ZTEA 2A83A 4L4JA 1YNLH 3WXWH 4QRQA 3N6YA 1HINH 3QULB 2AJSL 2CO7A 4MAZA 3RJQB 4FFZA 2CIKA 3B7YA 3KPPB 2DQGL 3DOIA 4Z8FH 2WBJD 4XPTL 1AKJA 4XMPL 3K4DA 2HMID 1FL6A 4YUEL 3JV0A 5E8DL 1NAKH 1JHLH 1KV3A 3FQUB 4HLZG 2V33A 4Y4KA 2ZUSA 4FQJH 3H7LA 4U1HA 1SF5A 4E42A 4LOEA 3VAEA 3QAQA 3T1FB 1FFOA 5JW4N 2ICES 3Q2CA 1OSZA 5C0BA 3RWFA 4FQXD 2HX9A 1CDGA 4DP0X 3OHXC 4OSUL 4B53A 4FQ1L 2A9DA 1G9NC 3H54A 2FATH 4H8WH 2UVEA 2XQ0A 4FFZH 2YLKA 3EFOA 5E8NB 4Y2DB 3Q44A 3VQLA 3S8FB 3S37H 3OL2A 4PGCB 4CC4A 1IO4C 4IOFC 1DO6A 2Z4QA 4AW4A 1HL5A 5AG9A 2YSSA 3QHFL 2H0JA 1OSPH 1HNFA 4LLWB 1KXVC 5D7IB 1BZOA 3T77A 3EDFA 2ZKXA 1DQDH 1IL1B 2O72A 2CWRA 1IGFL 1KIPB 5GJTL 3CN0A 3HNSL 1UWXH 1PG7X 4PB0H 4X9YA 3DMMA 5I82A 2IXQA 2Y3AA 3CN2A 1TJIL 2IO5A 3FT3A 4J6RL 5HBBA 1UASA 1AH1A 4JG0L 1GGCH 1QPXA 1U3JA 5AW7B 4L0YA 1AI1L 2FUQA 2V2WA 4P59H 2VJ8A 4KO5A 4PJGA 4R5XA 2FIRT 2LLGA 5LBSA 5CMAB 4O02B 3UPRB 5IM7A 1U8JA 4QNPF 3D0LB 1NIBA 1WFNA 2YPLB 3QUKB 4ZUVA 4R97B 3G5YA 1A14H 5FO9B 2VMEA 3CDZA 3I9AA 3EXLA 1JNNH 4ZS6C 4UANA 3O6KL 1EZUA 4AEFA 1ICTA 1MI5D 2X41A 4HX1B 1H5BA 3RWHB 4S1QL 3BZEB 5KUKA 1BBDH 4HV8A 3FT2B 5TDPB 5CF3A 3NIDB 2ARJA 4JFDE 4QRPB 1RUQH 3W9DB 2IFGA 4D3CH 2ZOWA 4XE5B 3WMSA 4Z6AT 1HL8A 3CXDH 5B38G 1IT9H 2BWIA 4AQAB 1LE9A 5JHLL 2CNZA 3HC0A 3LNFA 2WCPA 1CL7L 3S3DB 3HZVA 2BY2A 2JFCA 2B39A 4LBAA 4YEEA 5LBSH 4XXCC 3L5WB 2A6IB 3EO0B 4KFZC 3IJYB 1W72A 3AQDA 4ODBD 1FLTX 3MV9B 5EU3A 4N8UA 1J0YA 4LRIC 1JVOA 5AQ0A 2CKBA 3UTPE 5I30L 4H5SB 4WNQA 4WO4D 3SDDA 2CUHA 4LMQE 4PJ8D 5CN3A 4FG6D 1PGRB 1A1NB 2KKQA 3TBTA 5DQDL 4Z95H 4XTRC 3AT8A 3MRQA 3SYCA 1ZPUA 2VDMB 1W91A 1FO0B 5KVEE 2DI7A 2HKHL 2EABA 3LEXB 3KM2A 3H3BC 2O4EA 1IEAA 4HU8A 4LVNC 4PGDA 1CBVH 1XF3B 4IRJA 2K4AA 5LQBL 1JUFB 2E9WA 1W72H 4HFWB 4EN3A 5L4MA 5D71H 4RDQG 3V8OA 2COQA 3HZYA 2NTFA 3THMH 1UKTA 2NY0D 5INCB 3MA7A 2QQLH 2CKBH 4FXGA 1QSED 2XWJA 2BS71 2M83A 4BH7A 1DJZA 4WF7A 1SY6L 4TL4A 3PDOB 3SE3C 3OAWA 4LSRL 3RWEA 3WN5A 4HSQA 3SBRA 4IS6A 1NCCH 2A77H 5EU4A 4LT7A 4B7LA 4YX2H 1FZMA 4NFCA 5KYUB 2Z8SA 3ORJA 4DKEL 3PY9A 3D2UB 4KRPB 3RUGA 1RZQA 4MKMA 2J1WA 3N1QC 4IMKA 5CCGE 3BI9X 1F02I 5AKVA 5DGQA 3FTGB 4W9LC 3QDMD 3WFZA 4ZTPH 3UAAA 1T80A 4ONFL 5HI3D 3LRKA 3IGLA 1QHPA 3AGVA 4OCLC 1G43A 4HUNB 3B1TA 4Y1TA 3PWJB 2WNWA 2WUBH 1UD3A 1BFSA 2CGZA 4GRWH 3WEMA 4YMPA 5GISL 1EQWA 1THCA 4KRPC 3N1MC 2BNRE 5J1AA 5D7LB 3NCYS 2Z7WA 1F90L 1BP3B 4PRDB 1PIGA 4ANKA 5DD3L 2H0FA 5JZ7C 5EHFA 3SDXF 3UBGA 1A6TA 1JF1B 4FEIA 2X2YA 4HAFA 4S0TD 2NRDA 1L5GA 3X11A 3DWTA 1INEH 1ID5I 4GQPH 4FKEA 1B3JA 3FU3A 4AQ1B 3WDJA 3LKQA 3NESA 2DQFA 2VERN 2VDRB 2JLPA 3GZPA 1T7VA 2AJXH 4PVLA 3H4HA 3QJHB 3M45A 3FCGA 4WCYH 1JZ3A 1E42A 1T04B 5HDBF 3S2CA 1ZGLB 2ED6A 5JA8B 4DZBA 5AVVB 1CMOA 5AW9B 5IVXE 4HSCX 4QHMA 5DHYA 4APXA 4K9EH 4R3SB 2OTPA 2VR6A 4GP4B 2BSEA 1CGXA 3ABLB 4NN5B 5DZPA 5GPRA 4OB5H 5HVFB 3EOBA 4JM2D 2EDBA 2AJVH 1MY7A 4RAVB 2ROXA 4AQ1C 3RURA 3ARUA 3EGSA 2ZP0T 1XWVA 2FZ3A 4P3DB 3T3ME 1Z9NA 5T1KD 3KWXA 2WLYA 5ITBH 3TIEA 1E9OB 2JI3A 1CZ8H 5F8QC 3GSNA 5DURD 4Z5RB 3CSGA 5C3LD 3VW3H 4BINA 1RV6X 1I8MA 4PP1C 4TNEA 3Q5YA 3FSWA 4CBZA 3BZFB 4ENEC 3VYOA 1U6AH 4HKZB 4J7RA 3DURA 3AUVA 5I1IH 4ODVH 5DD1H 1GC1L 2BHZA 2XRAH 4YHNB 2Q7AA 3IJHA 4JN2A 1JGVH 3SPHA 4JFZH 2JI2A 1UM6L 2IANA 2AK1L 3ZT5A 3MA9H 5B39G 3GHPA 1TYEB 3U0WL 5A2IH 4Q9RH 2Y7QB 3I9PA 3OQ3B 1LWJA 3H3PL 2R9HD 2X6MA 3GSNH 1QD0A 4H26A 1WIOA 1IGML 1I8LC 2P52A 2WLLB 5IJKA 5TH2B 3GB7A 1J8HE 1KXQA 3IRPX 1NGZA 3RX5A 4K94C 3DVGB 5C0ND 4D0CA 4HVBA 3IS0X 2IH1A 1I7TA 3NK3A 2R4SH 2E76C 1VFUA 4TSBL 4JY4B 4JPKH 5HGBB 2IBGA 2IGTA 3S3JA 1SJEB 1OE3A 2NY2B 5L9DH 1PQZB 1HILB 1S4IA 4XN4A 4KAQH 4NZUH 5FOJA 3HIZA 3AZUA 3OKLB 1MW3A 4MMXB 3W81A 3JQOB 3ULVE 2XFGB 4PJBB 1A6AA 2W94A 5C08A 1RQ5A 1JGEA 1NBQA 1LYQA 2O5XL 2VW6A 5E1QA 3NA9L 3T3PB 1VEPA 4YVNA 1OTSC 5I6MA 2YAEA 4G7VH 1M71A 1FP5A 4G3YH 2A74A 1E3ZA 4XB8A 2KDYA 2AXGA 2H32B 4PJEE 1TR7A 4UILL 4OCXL 4RA0C 3OXSA 1PKQB 2D03H 4O4YL 1GPOH 1NPUA 1X5AA 5KYYB 3KVQA 3S3SA 4Y5YC 5IBTH 2GQHA 4MMXC 1UKSA 5JOFB 3KYMB 3R1GH 1NCDH 4N6RA 5F7UA 2MQ3A 5D2NB 4ZXBD 2PO6D 1XH3B 2VZ3A 1I7ZA 1CTOA 1FL5B 1KCLA 1EFXA 3GZKA 1USQA 2YO3A 3UBXI 2XZCH 4JO2L 4BZ2L 4K07A 5J6HA 2QKIA 2XTLA 5GJSL 2OR7A 5IBUB 3RGVB 2Z31B 1Q90A 2BSTA 4KDWA 4EZLA 2W9DL 1H9DA 3LS5L 1AD9B 4WWNA 3QAZC 4HGKC 4ADJA 4LRNH 2ARJQ 4DP6X 5ISZD 1AVAA 2V2TA 4L9LC 5FDWA 5ILTH 4LKXB 3L1GA 3QH3A 5D2NC 2RR3A 3CZEA 3C60B 4HCFA 3N42F 2HG5B 5ICXB 3B2UC 5AW2B 1CIDA 1RERA 1V8HA 1TPXB 2VMFA 2Z31C 4YXHL 2E7BA 4TNVF 5DHXB 3UTZA 4FLRA 4NGHH 4IBSA 2EIKB 5CLTA 5HGDA 3WIIL 1BSIA 2GJZA 5IMOA 5I16B 1N59B 1YA5A 2ZAHA 3B6SA 3WENA 3L6FA 1NMAL 4P5KB 4XVSH 5F7EL 4EI6B 4P5TB 3BWAA 4MXWH 4MS6A 1EA9C 2GEQA 2B14A 4NKOA 1OTUC 4QHLA 1MFEL 2ITEA 4R4FL 1EVTC 3C60C 3BYYA 3Q6GH 5HDQL 2KT6A 5EBMA 3TWCH 4XGZA 5F44A 3RJOA 2YPVL 5FUZH 2WY3B 1TPXC 5E6IC 5E6YA 4PPTA 2X2HA 2VABB 3DJSA 4XOAA 5CLZA 4MJHA 4HWBL 1G9MH 3BAYA 5DFAA 1SJHB 2BINA 2W65A 3IMBA 4HLJA 4KH9A 3BWUC 4A7UA 2MKLC 4P2RA 1L9PA 4KQ4H 4MSWA 4PJGF 2EVJA 3PGCA 1S8DA 3KW8A 2EXWC 3NZSA 2VLKD 5DK3A 3CD4A 3F7KA 3QHZL 1DEEA 3P77B 3GS0A 3TEWA 2F1EA 4Q6YA 1CICD 2OMTB 1QVOB 2P5WB 4PJ7B 3LNGA 4FYQA 5C0IB 4IHBA 4ODWA 4U1SA 4Y19A 4YSAA 4FQHB 4A39A 3TBVB 4XH2B 4I18A 5L2JB 1E3FA 2NYYD 2WXIA 1YRKA 1QLEL 4A2MA 5E00B 2EIBA 3WFHB 3AAZA 2Z7UA 3FU6A 3JBG7 5CKAA 5I74C 3GS7A 4HDIB 5D5MA 3IETB 4M5ZL 2K4WA 2PXYA 3QDJA 2D31A 4X7EC 1BPLB 3RPIB 3EJSA 3KXFD 5DTFB 3KWUA 3RTQD 4BFEA 1I75A 2YKLH 3VGDA 2F53E 3VFUB 5KBLA 4M7ZB 3BKYH 2CHDA 5F1NB 3MJ7A 5DMIH 1T2JA 5EO9B 1ZT4A 3I2CL 3LQAL 2XXMB 2CHZA 2WWOA 3L13A 1WJ3A 3DV4A 2Y1VA 5E6SB 1YEHH 1TYRA 4X50A 5IFAL 1VCAA 2XQYG 5KS9E 5IHUH 5EEUA 3B2MA 3K6FA 4B6ZA 2YEQA 2XNAA 1W0YT 3B9EA 2RACA 2X05A 4IK6A 4HFUL 3IFNL 2BP0B 5AW8B 3FONB 2DD8L 5I6OA 4M7ZC 5HYIA 4YR6B 2Y36L 2N7BA 4XBPB 4BHUA 5GIRA 4X4KA 3M46A 1EAOA 4MYWB 4WTQA 2AJUH 2ZX9A 3UO8B 4ZNCD 1F1DA 3L9BA 1M2VA 1GS6X 1LEGB 4DWHA 3OAUH 3AQYA 3LPPA 2V2XA 5B3JE 3SKNA 3APFA 2Z3FA 5CU5A 4EUPA 5ITFB 1O7VA 3TYGH 5ES4B 4FLHA 1WE5A 2YZ8A 4PJXB 5LNGA 3UPAA 4F15B 1E4KC 1GMEA 3FW6A 4PFEA 5AKSA 2ICEC 2CHWA 4LCCB 1G4MA 4GRWF 4BV1A 2Q86B 1BXAA 1TYJA 5D70H 3GSOA 1JERA 5IG7A 1QZ1A 1G7PA 5EBWA 2OJ1A 1NIEA 2LHAA 3RUGF 4P5RA 4MQTB 2DWDA 4NAJA 4Z7UA 1GGTA 4N0YH 1PLCA 4DH2A 3ZTJH 3QIUA 3L3OA 3W5MA 2A6DB 3G5VA 3IRCA 4G7RB 2VDOL 4WU5B 1I85C 2BHYA 5T3ZL 3F01A 3KE0A 4N2AA 1E6JH 3NFSL 2P42B 1U8LA 3D39D 4EUPH 4WW1A 4TSCL 2Z93B 3ZMEA 4LCCC 4LSVH 4YDLB 3KL5A 4WI9A 1GH7A 5D7JB 2FSEA 3EYOB 3BP4A 4M56A 2OJEB 4OW6A 4RX4A 2H6UA 4YXLL 3W9EA 4FNLH 4FCHA 5FLUA 1AGBA 3QRGH 6PCYA 4OLWH 3PNWB 4P2CG 4E9TA 1U8QA 4KV5F 2AXFB 4JQIL 2NUTA 5AOZA 2XV3A 4MNHB 1Y6MR 3VXRB 4UDUA 5LHDA 5A2FA 5FM5M 4R83A 1PMYA 4JM4L 3RU8L 3L48A 1IBBA 4FHJA 4YDLC 1ZHBB 4MNQE 1DBMH 1GGBH 4HAKA 3FCTA 5D7JC 3O45B 3NA4A 3W0WA 5K5YA 1IAIH 4IDLA 2HN7A 5DEJA 2PP8A 4X98B 3MR9A 5EOQL 4N0UB 3VM5A 4E9YA 1O6SB 5EO1A 4GUCA 5T5NF 5I1EL 3VFMA 1TZAA 5I8KH 4QRUA 1KEGH 5JHBA 4BKLA 1AZRA 2DYPA 1RZFH 4WHTA 3FB7A 4PSPA 3GBNH 2G60H 2YK1L 3OXRB 4WFFD 5AYQA 1LP9A 1OGAE 32C2A 3LKPB 5FAAA 4NIKB 1KB5A 1MWAL 3TCXA 5MEOB 2DBLH 4IGBB 4GMTH 2X0UA 1BLNA 1J0KA 1W9XA 3PUUA 3FQTB 3AACA 3S35H 4FMVA 4JX0A 5HY9A 5BS0B 2YARA 2ITCB 2NY7L 3B2VL 1ILUA 1KLGB 3PCYA 1SXZA 1YSOA 4BWWA 2X6AA 3I6KA 2YGQA 3K74B 1IGCL 4RFEB 4M7JL 4ZAKB 3DIVA 4NKIL 4U05A 3UTSA 1Q1PA 3TVMA 5TK4A 2YBRA 4Z78B 1AOZA 2UYLA 4JFPA 4GQZA 2ED7A 2FEEL 2DQTH 1ASOA 2FRGP 3EOTH 2CO6B 3G6JE 3GXTA 1OP3H 1LO2L 1DBJH 3MLXL 4YHLH 4IGBC 3QO1B 2P9RA 1W0WA 4PTUB 2NY3C 3O11B 1F86A 4G8GD 4Y1AB 1KB5H 3O9WB 4U2ZA 1CI5A 1S7SA 1LWHA 4I8DA 1MRDH 5D1XE 5E4OA 1PS3A 3FFDA 1A9EB 1HI6B 3FUFA 2VDPH 2ENQA 1DBAH 1F13A 5KSAB 1N18A 3NVQA 1SZNA 3QUXC 4ZAKC 5I1AA 1BAWA 3QT2A 4DW2H 3ILQC 1WZLA 2XN9B 4NQEB 2VDLB 1DANU 1SVBA 1KIUB 4KK6C 5J6GA 5CCHE 3VG0L 4FQQB 4N22A 4FYSA 4JFOA 5JYMA 4OZIB 2H8PB 1QSFB 1K8DA 2AZAA 4YS4A 3DOHA 3MO1B 1R3HA 2GBVA 2K6YA 3KPLB 3S36L 5I8OL 5ECJE 2PWEA 5FA3A 4PVBA 4MGXA 3DJ9A 3FCSB 5TE6H 4S0HA 1RZ8A 3QCUH 1WP6A 1XHHA 3H56A 1HSBA 3E8UL 4LOFA 2QZ5A 1HSAB 4CL7A 5DD5H 4J8QA 2Y7NA 3NTCL 5KSAC 2B4CL 2V5TA 1U8OB 2YR3A 5JHAA 3OHXA 2X40A 3KPPA 3CFTA 3HUJB 2YAFA 1A2YB 3T2LA 4FQLL 3VGAB 2DY2A 3TBWA 4HH8A 5CSZA 4Z7OB 1UJ3B 2X4QB 3IBOA 1UYWL 3GK8L 3GO1H 4OQTL 1EAQA 2OPCA 2VDQH 2BY1A 1IBGH 2F0CA 3IKCB 5ANMA 3FQUA 1KXVA 3WTUA 3QUMB 2J88L 3T1FA 3UAJD 1JVLA 2V0AA 5GHWL 4R26H 3FFCE 2WKGA 4ODHH 2UXGA 5CEZE 4P46B 3G5XB 4FJYA 1C5CL 1A3ZA 4CSTA 5IB1B 4HJJL 1C5BH 3QJZA 1PX3A 1NGPH 4KZDH 3VGAC 3N1PC 4JREB 1MREH 1N26A 4YE4L 4QNPE 1G9NH 1UJ3C 2AANA 3S7GA 3SN6N 4BUHA 1XF2A 3WTWA 4QI3A 4JG1H 3QJSB 3I9GL 5IKCB 1TZIB 4LLWA 1G94A 5D7IA 3EYQD 2NX5E 1IL1A 5LB1A 5J8OA 1KIPA 5KSUA 4ZX4A 5IWLC 5F70A 4DOHB 4KPHL 3VXSA 3B2XA 2R4RH 2NNFA 5I6PA 3WMQA 4FQPA 4YL9A 4BZ1A 3QUYB 5GZND 3TCLA 4IKLA 1G5GA 4QXUL 1OT2A 2EDYA 1Z66A 4WO0A 2VKWA 5BQ7B 4JREC 4AKOA 2FBJH 1NANI 5EF1A 4HUVB 4RSVA 3GTNA 1K5WA 1GY2A 3CFDB 1TENA 4MWFB 4O02A 3UPRA 4CA4A 4LPYA 3D0LA 3SBPA 5C9KA 5T5NG 2YPLA 4UIKL 1W6LA 4XXCA 5E6UB 3DARA 3BMWA 3QUKA 3CLFL 3H85A 3EH2A 3P9WB 5FO9A 4M1DH 5C0CD 3CZSA 4ZUTB 1CXHA 2B7DT 5JR1L 2EIMB 1BVKB 4FLSA 4HX1A 3CPLB 4LRIA 4YSPA 5BOPA 3RWHA 3QUYC 1F4WL 3BZEA 1IC7L 4WQOA 5TDPA 3FT2A 3SOTA 3RY6C 1QAWA 2YFOA 5D1QE 4BZ1H 1S3KL 3W9DA 4ZFFA 1B9ZA 4G6AD 3F04A 1WCBA 3Q0HA 1TTRA 3T0BA 2UXVA 2OJZL 2KLRA 1QEXA 3L5WA 4IBTA 3MRJB 4O02H 3EO0A 3L81A 3WLBB 3BDYH 4FA7B 3MV9A 2XJLA 5J11B 1IGIL 5C0FA 3PP3K 4DFHA 4M62L 4H5SA 4ZO9A 4ALAC 1KOAA 2VM9A 1TIUA 1DQIA 5I19H 4MCNA 1ZEAH 1G7QB 1A1NA 5DJZB 3FB6A 2AQNA 5I1KL 4P4KC 1CTMA 4BFBD 2L04A 3LPFA 2E75C 4XZ4A 1TUPA 1AXSB 4QOKD 3FKUS 5CGMA 3SE3A 3CCHA 3EJZD 1HYRC 4EDWL 2WC7A 1J5CA 1P84K 3OAZH 4WUKH 2PTVA 1AANA 4YGAB 1HE8A 1X9QA 4MAYB 5HYSA 2FUTA 1XF3A 5J11C 1I4FB 5F9JB 4RCAA 1DANT 1JUFA 2B8OT 1DVZA 1XF4A 4HFWA 5E7BA 1CBJA 5F1IA 2W07B 5DHVB 4TVPH 3WFBL 3ZDYF 5L2KE 3DETD 2DJUA 5INCA 4Z8FL 4XVJH 2AAVA 4OJFH 2ZOTA 4AVIA 5EA0H 4IOIB 3PQYB 3PDOA 4L5FL 2A1WH 5JHDE 3ZKMD 3V4PB 1NAKL 2NR6D 1OQOA 1JHLL 5EBLB 1JZHA 4NZ8A 2VDMH 4FQJL 2VXTL 1M57B 3D2UA 5DCCA 2ISDA 3SDXE 5LN8A 2YLHA 2RA1A 3CVIH 3HMXA 3EZ8A 2XXCB 4UUJB 4XP4H 2FB4H 4JLRB 3HRPA 4H25B 3ROLA 1KTRL 3FTGA 3FUDA 2FATL 4NFBA 2AQTA 4FTVE 2CXGA 4YSDA 1C7SA 1FYTE 4FFZL 4YAQB 1A66A 4Y8AA 2XWTB 4QDGA 3SKJH 2WUCL 2E7HA 1IAMA 5HDBE 3WEXB 3PWJA 4JFDD 3C6LD 1OSPL 5E23A 3S34H 2QQKH 2BSSA 1M7XA 1DQDL 3F7PC 4PGEA 3FH7A 4CGTA 4PMFA 3FQ1A 5D7LA 4IRSC 4LCYB 4NDMB 2FECL 2XXFA 4PB0L 3SQOH 1DYZA 1JF1A 3IWUA 3IFLH 5FYKL 3NJMA 1GGCL 1HAUA 2X9YA 1ZWIB 3SDCD 3HMXH 3DX3A 2WQ8A 4QRTB 3LRGA 4WUUA 1G0DA 3UTPD 4AQ1A 1U42A 4Z7UF 3RI5K 1S3RA 3D33A 1T5XA 4YFDB 3SDAB 1C8QA 2J25A 3WLWD 3GIZL 3GD1C 2OCCB 4M02A 3LQZB 3QJHA 3ENEA 1V27A 2H3XC 3LRMA 3EBGA 3HC3L 4JFTA 1JNNL 2YJQA 1TTFA 2XWZA 3BKJH 3FQRB 4HJTA 3P0YL 1T6VN 4Z0BH 1BBDL 5AZUA 4BXSV 5DK2B 4X7CC 5C70A 3BP6B 3CFJA 2WN3A 4RAVA 1IAIM 1BFVH 1RUQL 3T2OA 3IU4L 1PD1A 4KOCA 4RMVA 5FXCH 3CXDL 1IT9L 3HI6H 4P3DA 3ZTNH 3W82A 2DQ6A 4PJHA 1UVQB 5LBSL 4F57H 1BQ5A 1PCXA 1E9OA 5F97E 3BWSA 4IU3B 1CS6A 1JRHI 4Z5RA 2DWXA 3QQ3B 3VX1A 5F1KC 4Z3EA 4RMBA 5I73B 3ATAA 1W2KT 1I1CA 2GBAA 4ZQTA 3IGAB 3EBHA 3BZFA 4YN3A 2LFGA 1I8LA 1FHNA 1OOWA 3JWOC 4PCSA 5AUMB 1LE5B 1R4XA 3V6FB 4L3CA 4OCSH 4R7DB 1LGVA 2DYRB 1P4IH 1I3VA 5C09B 2WQSA 5B1BB 3DO7B 4GW1B 5FF6A 4RMRA 5MENA 2GY5A 4OFKA 1LP9F 2L8AA 4KUCF 2P80A 4XP5H 4B95C 1CBVL 5IVZA 5I0YA 4CSPA 4K8RC 5FEBA 4Q74A 1C16A 2WWKT 5I73C 4ZFOB 4JDZB 1VRSA 5D71L 3V5KB 2OX5B 2BNRD 5IK3A 3THML 2IWEA 5ACZB 2VXVL 2WLLA 4N9GB 2QQLL 3Q5OA 1XH2A 4QKTA 1HL9A 5TH2A 4I3SH 1XBRA 3BT2H 1U8CB 2ZG2A 3DVGA 4AH2A 3TT3H 1P69B 1A1OA 2FBOJ 1SDDB 1FFQA 4YX2L 4KGJA 2GW5A 4K94H 3AG3B 5HGBA 3TYFA 1SJEA 1TZHB 1PQZA 1HILA 3QXTA 4G8EB 4JO5A 1FV1B 3REWB 3ZDZF 4Y5YA 3OKLA 3EAKA 1TNMA 4MMXA 1WBYB 3VWJB 3VSVA 8PAZA 4DGVH 3QUZD 3R8QA 4M48L 1WC7B 3FUJA 1UCBH 2OK0L 2KUTA 1P2CB 4DPCX 3LNIA 1P9MC 5IB4A 4ZTPL 1HEHC 2X4TB 4K3GA 3BKCH 3IDXH 4ZX3A 5J3HC 5TQ0H 3MXWH 2ESVB 3N9GL 2LU4A 5E70A 2H32A 4PI0A 4ZW5A 2WUBL 3QIWB 3MBEB 3OF6D 5JQIB 1PKQA 4B27A 1RZGA 5ICZB 1YUHA 4LLAA 1R3JB 4NP9A 4GOSA 4L9LA 5HD8D 5D8JH 2DMCA 3BW9A 3VWJC 3ZRSA 3M17B 3T65B 3ZTJG 5D2NA 3IJSB 2FEJA 5C0BE 3F58L 1FL5A 3WGVB 3WBDA 3HB3D 3NMEA 1H3PL 3MLVH 3HC4L 3UG5A 3NZ8B 5DT1H 4HZAA 2Q0ZX 2JXMA 1EZLA 4RGMB 4EUPG 4NXSA 1CIUA 2Z31A 2OL3L 1JTOA 7CGTA 3NZUA 3BD3A 1FA4A 3QIWC 1UZ6F 2DKUA 5DVKA 2AJXL 3Q5TA 2H32H 1KIQA 4HS3A 4WCYL 5EC2A 3X2QB 2X1OA 3KPRA 3LEVH 4LKXA 1I1RA 5DUJA 3UTOA 2FWOB 2D4DA 4M43L 4UT6A 4J23A 5D1ZB 3PWLA 3C60A 4Z77B 2EKJA 4NUGH 4K9EL 2HG5A 2LAAA 2MHAA 4HU2A 3RVTC 1E6OH 3MRMA 2AJVL 2WP3O 4Y5VB 5E6IA 5DLLA 1AHWB 4JFYB 4RGMC 4UQ2B 5HI5C 1TJGL 3O3AB 1G7JA 3JYCA 4KI5C 4PJGE 3TX4A 4BGDA 3CSTA 4ZODA 4MX7B 3RVWC 5I16A 1J8HD 4CNIB 1Q9WB 1N59A 3WXVL 4L4VB 2ZWNA 5DR5H 4EI6A 4P5KA 5ITBL 3OKEB 4ONGH 5GGSY 4BFRA 2OS7A 2BXYA 4IU2B 2NY1D 5E2VH 1CD8A 1KPRA 5JO5B 5L8KB 5D7IF 1LXMA 4B0MB 1DFXA 4NCC2 4UT6H 3L4CA 1SMAA 3ILDA 1U6AL 4Y5VC 3ULVD 4XPBL 1AHWC 3LEYH 2HPTA 5DD1L 2X4OA 4UV7H 1BOGA 3OQRA 2XRAL 1WWWX 2IGFH 4AW7A 1XD1A 4GAGL 3OSKA 1SJHA 2ZOLA 1FC1A 1W8OA 1U41A 1JGVL 4FA6A 5LNDA 2JE8A 1UACH 2CALA 2E0PA 2J8OA 4PRPA 3MA9L 4ZMXA 4JKLA 4MJID 2YD4A 2HH0L 3BVTA 3V0VB 2J71A 3SCMB 2P5WA 1TEFA 1QVOA 2OMTA 2QV4A 1MIMH 5C0AA 5IR1A 1RPUA 3SBQA 1ROWA 5C0IA 4Y0GA 2VL5B 5I1GH 3LIZA 1OAUL 2X4SB 2O5YH 3FF7A 4FQHA 15C8H 1XFPA 2PWGA 1NUFA 1H6TA 4XN1A 4CN4A 4FP8H 2XPZA 2W1NA 2R4SL 2XLLA 4IRZA 3WFHA 2AQSA 2NY6B 3NIDF 4ZFZA 2IAMB 4HDIA 3BRGC 4KKAC 3IETA 1M7DB 3QWRA 4CSSA 4EAEA 4OIAA 4YHPB 5F3HA 5L9DL 2J2ZB 4QHNB 4AMKL 2DLFH 2EZ0D 3RPIA 4TQEL 5DTFA 4Z7AA 2DZEA 3SCMC 2VO5A 1RPKA 4BDVA 1VSCA 3ROOA 4JY6B 3AC0A 3PJLA 4DK3A 1D5ZB 1NKRA 4G6JH 2ARWA 2DIAA 3VH8A 3HG4A 4G7VL 3SE9H 1HK6A 3LIZH 3ISRA 1BGXL 4G3YL 4KHXL 3P40A 4PS3A 2EDEA 2P45B 1OPOA 3GMRA 2NY6C 1JGIA 4C4BA 3B9KB 4GRMA 3VXUB 4GRWE 1JV5B 2D03L 4IRZH 1GPOL 5C9JB 1E4KA 1PNCA 1K6QL 2AVGA 5E4AA 2ICEA 2BP0A 4N1HB 2X1XR 4MA8H 1CG9A 3R1GL 3RUGE 5HYEA 2YMTA 3P0GB 4XNQB 2ERJB 5JUEH 2XPGB 4YR6A 1VZGA 4LPXA 3O4LB 4P2OC 5KOMC 2F61A 3JVGA 1E4WH 5EDXA 2NXZD 1AS6A 4WAFA 5AG8A 4PP2A 2ATPB 4M5YH 3MLZH 4ZNEA 3V6OC 4WWKB 4TNWF 4OZGB 1I85A 5ITFA 3B1UA 3FN3A 3DSFL 3FJTA 2SODB 3WO3B 1WZ1L 2VLRD 2WKOA 4LRNL 4JJHA 4TOYH 3MUY1 3D0AA 1RIHH 4LCCA 4XRCB 5G2NA 5ILTL 2Q86A 6FABL 5E8EB 2NXYD 5CINH 5IBLD 2MWCA 4KNSA 4LOUC 4YHMH 1V10A 3K0YA 5K1VA 1KELH 1EAPB 5J0BA 3KD4A 4KV5E 3MLRH 4V33A 2XSKA 2A6DA 4F7KA 3T8MA 4X6CB 4PRNA 1OE1A 2ZUXA 5H4YA 3HKFA 4WU5A 4WWKC 3VXPB 3EGDB 2EYTB 1H3UA 3X1BA 2X4NA 1TEGA 5AW3B 5ENWA 4XVSL 4X5WA 4JPQA 4HIEB 1S7QA 2Z93A 1B3IA 4HK3J 4K0OA 5JQHC 3BAEH 1VJSA 1PX4A 5D7JA 1HZHH 4XVUC 3EYOA 1UM4L 1KCWA 4HBCL 4P2QB 4YGVB 1JYVA 4HJ0C 2OMVA 2XKNB 3POCA 3EXJA 3L95B 3O6FB 2F53D 3PNWA 1INQA 4ZUUB 1HZLA 2AXFA 4LAQH 1G9ML 5BXFA 3T0DA 4ZMWA 3K1DA 4MNHA 2BM3A 3O2WH 5CUSH 1BMZA 1DCLA 4RAHA 4TTGA 3GSWB 3ARSA 4KQ4L 2C1OA 2JB6A 4OZHA 1HOCB 3EYVB 5H94B 3GKWH 3QRFM 3O45A 1G6RA 1ADQL 3QUHA 2HFGH 4X98A 3ALXA 4HF5H 4N0UA 3P3UA 1FL3B 1KXHA 4Y5XB 3TBYB 2PPEA 1MJUL 3WIFA 1OPGL 4ORGB 2DIEA 4EEEA 3I74A 3OX8B 4E41D 2VAAB 1ZGLM 4FCAA 1JWSB 3IAGC 3OXRA 3UTTB 1HESA 3ZXAC 4LOVA 5MEOA 4QXTA 1LK3H 3X3FL 4IGBA 4IW4C 1DO5A 3NJHA 2I60L 2IANE 1VHPA 2PP7A 2OQJB 2DDQL 1ZTMA 3L2NA 4RESB 5BS0A 1QBAA 2YKLL 2ITCA 4PJHF 3BKYL 5DMGD 1IM3B 1R6VA 5HHXL 1G6RH 2WYTA 1R24A 3R18A 4LMQI 3IMVA 4RFEA 4Y5XC 1MSPA 5DMIL 3QUXA 4ZAKA 1WBXB 2NYZA 4BEIA 1EGJA 2EKSB 2CA4A 5AKRA 2IGLA 3KR3L 1KXQE 1WBZB 4PD4K 1E28B 2CO6A 1S2EA 1FCGA 5DSCA 4NYLA 1Y1UA 1WIPA 5DJXA 1P4UA 4AYMC 4F8PA 3QO1A 1MAJA 2W9LA 4KKCD 4WWPA 4ZQKB 1VGKA 4Y1AA 1UUNA 2DTSA 3U1SH 4LBEA 1UB5A 4OTXH 4LPVA 2C9PA 4A7SA 1SN2A 2DMGA 1A9EA 1HI6A 2VRQA 3ARBB 3OZLA 5AVTB 4AE0A 4NQVB 1C08B 2FGZA 5KSAA 4FADA 3C87A 2RAMA 4JDEB 5C08E 1X7SA 2XN9A 4NQEA 1YZZA 3OKKB 5D93C 1JFHA 3L9YA 5I1CH 1KIUA 4HOWA 4UOW1 4FQQA 1GS7A 1EGJH 5A7EA 1A4BA 2G30A 2H5UA 4OZIA 5IROC 2H8PA 3M86A 1OD7A 4GG8B 3TYGL 2HSIA 4IBYA 1OT4A 4ZTOL 2AQQA 2JNZA 2QVIA 3FCSA 5HYSG 4LSSH 1TQCC 1A6VH 4I87A 2WV3A 3F7VB 2QGEA 3HS0B 4OVVA 5DO8A 3ARBC 3ZOAA 3P4NA 4LHUB 3TO4D 2I85A 3Q8EA 1NKOA 1PCSA 1U8OA 3H42H 3QNFA 3PFQA 3NJVA 1QI3A 2AV7A 1YYLL 2J1XA 2A73B 1FNLA 2EDNA 1P84J 3T3PF 1OZTG 1F8TL 1PL3A 3UGXA 1UJ3A 3FBQA 4RMWA 5T33L 1NQBA 2F15A 3EHBD 1SOXA 2I24N 3H8NA 2WB7A 1QBMH 2QBWA 3IKCA 1IJ9A 1T1WB 1OGAD 3AGWA 5IFJB 43CAB 2C3VB 3HS0C 3QR0A 1RZKC 3GXMA 4H2AA 1XD0A 1ID2A 3TBSA 3FTXA 1AYRA 5IWLA 4NZTL 3RFRA 2EAEA 4L29B 3TH3T 1KUMA 3G5XA 1A7PH 1UB6B 3QRGL 4U0QB 1Z9OA 4OLWL 3FO9A 5IB1A 3HPLB 3QG6B 4MHHI 3QRBA 1BF2A 5F9WB 3BAKA 1XCQB 1JSYA 1ZLWH 2XN1A 2JIXB 2D3VA 5A3IC 4MJ4A 4WHYH 4RWYH 5IKCA 1K2DB 4BKTC 1TZIA 1DFBH 1EJ6A 2X89D 4I5BA 4OUUB 3HG0A 2HTLC 2WVTA 2ZSWB 3UYPB 3LD8C 2GFBB 2BOBB 2XICA 1EHXA 3KPQB 1MCBA 1RFDH 5D1XD 2XBTA 5DYOA 1KEGL 3QUYA 5HHMD 3Q06A 3Q8CA 4HIPA 4J3TA 5DRZB 4RH4A 3RY6A 3GBNL 1HZKA 5F9WC 1CL7I 2ZWSA 5BQ7A 4JKKA 4ZSOB 2V8LA 1NCTA 1OEZW 1OQXA 3KDMA 4S11A 4HUVA 3CFDA 3GJFK 4GMTL 1RAMA 3L17A 5B1KA 4CW1B 4P2RE 3S35L 3KMDA 3BWUF 4EXPX 2IV9A 4ZUTA 2HUEA 4AEEA 4Y2OB 4H8PA 1NGWB 1A7BA 1BVKA 1S5HB 5IB2B 4TVSa 3CPLA 1UFGA 4M03A 2E4FA 3FCUB 4Y19E 1YEFH 4PJ5A 4P4KA 3EOTL 1VCBC 5F0LB 4LF3B 1DBJL 4YHLL 2MTPA 3HI5H 3A4FA 3GMQB 4G9FB 5D5ME 5T3ZD 3V55A 1KB5L 1H9VA 2QADD 1MRDL 4QCIB 3MODH 4RBPH 4KDTC 4W93A 3ZDYE 1QPKA 4Q58C 2VDPL 4ZS7H 1DBAL 4IEFA 4OCNC 4L4TB 3DBXA 4GQ9L 3ZKND 2WINA 4DW2L 1C9SA 4YDMA 3LPWA 3LQMA 1NCNA 3U9UB 3D4CA 3LZFH 3FFCD 2B08A 4W68A 1TSHA 4AG4L 4ALAH 4XWOC 3WFCH 2C5DC 2BJMH 5AL8A 1AXSA 1RJLB 5B7MA 3N2JA 3T09A 1M6OB 2YD1A 2BVQA 4MA1B 3VXTA 5DFVD 4N0CC 2X4RA 1PG7H 2WSKA 3ZN6A 1HFUA 1JPSH 1NEPA 2ZPKH 5DD5L 3TA4D 4JQXC 5ANHA 5F9JA 1E4HA 1LO4H 5HVHB 2NX5D 3UL4A 1HXMB 3MRIB 1FVEB 2ZP8A 4XVOA 5EF0A 3EJRA 1L9NA 3FUNA 3QQDB 2J5WA 3BESR 5EOCJ 2UXTA 4IOIA 4HIIA 5DQJB 4AIEA 3OKNB 3BEWB 3GO1L 3CMOH 1BZ7A 2VDQL 5SWZA 2EE6A 1I31A 1IBGL 1NDGA 2EDWA 3FU0A 4UQCA 3UP6A 1SPDA 1OAKH 4PY8I 3A3YB 5E9NA 3F7RA 2H2SC 4QRSB 2Z7ZA 4H7VA 4IRSA 1DSFH 1U8PA 3D3VA 3FHAA 3L4UA 5BUGA 4KTEL 4UUJA 5TFSH 1HQRB 4L3AA 4H25A 3AROA 4NX0A 4Z7UE 4TSAH 4QAWA 2QFPA 1NGPL 4KZDL 3MJ9A 2V7HB 4YAQA 1NCHA 1G9NL 4F33A 4KK5D 2NT0A 5IVNA 3HN8A 3KLQA 2BVYA 3WEXA 5D1QD 1OXYA 4FHKA 1MXDA 4U6HB 3K91A 1U8HB 4R90L 2WLHA 4UBDC 5PCYA 2OYLA 5F9OL 3SKMA 4C83B 5JXEC 2EE9A 4BCYA 1W0VB 2WKOF 2ZXGA 5HYFA 3R7QA 2HFFA 2IWKA 3QNYB 3VI4A 4YDZA 1FBIH 1UA6H 1CDIA 3CWGA 4PH8A 4JE0A 1MCDA 5IBUG 1G0XA 1YEIH 2Q2LA 4QRTA 1TITA 2FBJL 4B41A 1A1MB 3MJ9H 4K3EL 4LHQB 1NFDB 3ZE1B 3DVIA 2AW2A 3HZMB 3SQBA 1JPST 1IM9B 3NOIA 3MRFB 1URIA 1DBKH 4BELD 1G9EA 4M1DL 3W0WE 3NRPA 3CG8A 2PR4H 5EORH 2VH5L 4WKZB 2WZ0A 5D2LA 2GJ6D 3BP6A 3FQXB 4BZ1L 3MRCA 1BIHA 1PYWB 5L2KD 1LP9E 4OFYD 4GSUA 4HCIA 3E2HB 4LASH 1MLCB 3FZUD 1XV8A 3RHWF 5EU7C 3KLHC 3H53A 1CVSC 4IU3A 4B3EA 4YSSA 5JHDD 3I3DA 4YHOH 2CK0L 3QQ3A 2VKXA 5E08H 4DF9A 4OZHF 3D2TA 5ESQB 5FYJU 1IKOP 3UTSE 5J57B 2EACA 3GSQB 1ZEAL 5HTSA 1F3JB 5AVSB 2PETA 1MHCB 1E2VA 2HVKB 2VDNL 4R7DA 3P3YA 3JWOH 3E2HC 4FTVD 3ZDZE 4P23D 1MHEB 5C09A 1FYTD 3IFPA 4GLRH 4WUKL 1CR9H 4GW1A 3DO7A 3VFOA 3G9AB 5GGVH 3QIBD 4F8NA 5F71A 1CDCA 1UEYA 3MYJB 3FDWA 2FX8H 4ZFOA 5INDB 3ILEA 3V5KA 5HGHB 1OARL 3MLYH 2OX5A 3R06B 4K8RH 1EBPA 1S78C 3X12B 5LWYH 2IQAB 3F6IA 4N9GA 4XC3H 1P9MA 3B7UX 4XVJL 4OJFL 5EA0L 4Z3FA 3ZZSA 4XOEA 5IJVB 1JK8B 1SDDA 4GSQA 2PCYA 4POZD 1GVIA 1TQUA 1HIMH 1TZHA 2P8LB 2VDML 4G8EA 2ZJSH 3REWA 3HG2A 4RLDA 3VWJA 5I8EA 1SLVA 3O41B 4TUKH 4H40A 5DMKA 3CVIL 1DQVA 2VLJA 3NCXA 3VH8G 4PWGA 1MFAH 1N12A 4ZMTA 1QRNB 3HEIB 4FQIL 3T0ED 3GBML 3U2IA 5SWSB 3OJ2C 5ID1B 2CLVB 5CIPB 1E8ZA 2VRAA 2A38A 4W6WB 1UZ6E 1TZOA 3NEXA 1M7IB 2DMBA 4WDIA 3BKML 3CX5K 3ARDB 3GBLA 3OKMB 5DZAA 1ZSHA 4LLUB 3RWGB 3QIWA 4L3EB 3PWPD 3S34L 1E8XA 3CC5B 3HBGA 4OZIF 3WHE0 2QQKL 4PJCB 5AOMA 5ICZA 2E4TA 3FU7B 1R3JA 3MV8B 3FRUB 2CIIB 3Q1SH 5ANME 4ELDA 5FYJH 4LSTH 2H6OA 3CFIC 3SQOL 2XV2A 3L45A 3M17A 3T65A 3IJSA 3KPTA 2J8UB 5FC9A 3WS3A 3CSPA 4J3BA 4ETYA 1Y18A 1OSEA 4L1TA 2VN4A 1SLUA 1LTXA 4LSDA 3V4VB 3NZ8A 2NW2A 5LGHH 3PL6D 2D7TL 1A8ZA 2I32A 3B3BA 3HE7D 3DTXB 1R3KB 7FABH 1UA7A 2VMDA 3HUJF 3LHPL 4OVUA 4I0PB 1MCNA 3R19A 3BVUA 3MLUH 4YO0B 4Z7OF 4YHZH 2IDSA 5D7IE 4O58L 1ZVHA 2WM0A 5GGQH 5J5EA 5KTEH 2FWOA 1OAYL 2NSMA 3GF8A 4UM9B 3TESA 3TS8A 1P6WA 3U30B 3VXSE 3CZGA 3KYKH 2V5MA 3A24A 1KF9B 2ZUVA 4LLVB 1BFVL 4Y5VA 1DQJB 1P7QD 5EEVA 4CDHA 1AHWA 1RIUL 2BIOA 3MREA 3O3AA 4RFOH 4I0PC 1Q9WA 1J9QA 1A7OH 1FNAA 4L4VA 4LIQL 2CH8A 4RWHA 3U2SB 3ZIMA 2YPLE 3K72B 2IALB 1AR1D 4IU2A 3TBCA 43C9B 5JO5A 4F2MA 1D2PA 2CXKA 3TFBA 1E4JA 1X5KA 3U30C 4ELKB 4YNYB 3SJVB 4P48A 3BT0A 4XAKE 4BK8A 2BK8A 2I7OA 3NIDE 1B0IA 5SV3A 1BG9A 1I3GL 2VAJA 4ZD3L 1P4IL 1KCSH 5D6DC 3DJZA 4EVNA 1Q0YH 4QXGL 4Y16B 1AKJD 1SQMA 4HEPA 4XP5L 3JTSB 3WNJA 3MCKB 2XC8A 3TJEL 4QHUB 3SO3B 4PU2A 2R39A 4TVPE 5C86A 5CM1A 3MV9E 3CFBA 4NRZA 5I17B 3L4TA 2JI1A 3U4AA 3NJLA 1O9WA 3HAEH 2Y5TB 4ZMPA 4I3SL 3CPUA 3X3GL 1FNEB 5C0BD 1CB4A 2HT2D 5I1JL 3UDWC 4YSCA 3JTTB 3TT3L 3ESUF 5I26A 1OP5H 4HW6A 2AI0L 2P49B 1M7DA 1NEUA 3JZ7A 2IV8A 4Y16C 1L9QA 2YGOA 2IDFA 2J2ZA 4X6BB 4QHNA 1PY0A 2C7FA 1JZ7A 4XMXA 4GT0A 3SO3C 4DGVL 3Q9PA 4JY6A 4MRCA 3ZTCC 1CF8H 5BVJB 3OWEA 4XMWA 1YLBB 4DPRA 3RIKA 2CBMA 2YA2A 4P2OA 2TRYA 4XBGA 2HVJA 2DICA 3INUH 3V0EA 3BKCL 2Q76B 2WQAA 2VERA 3DMMD 2X87A 2XX0A 4X99B 3HLAA 1JL8A 2IADB 5ERWA 5BRPA 1YN7A 4LCVA 4ODSL 3VXUA 2Z1PA 3S4SA 3TV8A 3X14B 5CCKL 4WW2C 5C9JA 2QHRH 1U8NB 1HC1A 1JGDA 2A5UA 2WANA 1ROCA 2Q9OA 1R5IA 4XNQA 1S5IL 5SX4H 2XPGA 4PD4J 3O4LA 1NAML 1V3LA 4KXBA 4PEEA 5JMOC 2VUOA 5DT1L 1OLZA 4JHBA 2ATPA 1SYSA 2H3NB 1QNZL 3TFKD 2ENPA 4WWKA 2OMWA 4OZGA 1NBYB 1CGSH 3IU3B 2P8MA 5F0PB 4F8LA 1NZRA 2GSGB 4XHQA 2XTSA 4KMTH 5TDNB 2C1PB 1IU1A 5E8EA 5D7LE 1DVFC 5EU6A 3RX7A 4K23H 1MCFA 5ADPL 1HXKA 4Y4FD 1EAPA 2R2BB 2EIZB 1CYXA 3KPSB 1E6OL 3LB6C 4A7VA 4F7MA 1ACZA 2TSAA 1F42A 2HT3D 4WHYG 3VU1A 3VFSB 1D6EB 1WLHA 1A25A 2X9XA 5EBGA 4WUUE 4AJ0A 1I3UA 2NY5C 2Z8WC 5F9AC 3VXPA 1Z9PA 1BVZA 1S7VB 1L7IL 3HZKA 1RURL 2X3BA 5DR5L 3OAYK 4U6VH 4BZYA 2K1MA 3WNMA 4ONGL 4HIEA 2GEEA 4X6DB 5K39B 1EEUA 1CI3M 1M9SA 1MFBL 4GMSH 5JW4Q 2XKNA 1CGVA 4YHIB 1JHKL 3L95A 3K2KA 3OJMB 1UT2A 3R7RA 5BO0D 3LEYL 1C5DB 4S1DD 2QVKA 1QFWH 4EN3D 4HG4K 5HSFA 4ZFGH 2IGFL 2BOLA 4TULH 4NHUB 1RUPH 5D7KD 5DEZA 2GIMA 1YEKL 5C7XH 3PFUA 3VI3B 5F2FA 1JZ5A 3B8YA 3GSWA 3DI3B 3D8MA 4PJHE 1GAFL 1MQKL 1HOCA 1LWRA 3EYVA 1WYJA 5H2BB 3ZHKA 5E2TH 4FZ8H 3RP1A 2GSIA 2IBZY 4LZKA 3CSYA 4WY7H 5DZJA 4Y5XA 4ZPVB 3U4EA 3H1ZA 4WIQA 2O5YL 3MMEB 3TBYA 2EXTA 1NH6A 15C8L 4ORGA 3ARFC 3GINA 4FQXB 5IQLA 4DVRL 5AAPA 5DZ9A 1JWSA 1NGXB 2XVBA 1ZIBA 5D2LF 3U6XA 2P8PA 3G6DL 1HH6B 5F88B 3WO4B 1U3HD 1XTLA 1H15B 2R0KL 3ME0B 3QE5A 4EBQH 2HMIC 4KHTH 2DLFL 2YQBA 4DKTA 1SHWA 5EU5B 1YG9A 2ZUTA 1QQDB 2HKFH 2X10A 4N87A 5EOCL 3A0OA 3LH2H 3MFFB 4KC3B 1GJIA 2X2JA 1V7MH 2Y0SA 2XT1B 1JMXA 4R7VA 2OYKA 2VT0A 4OV5B 1JYNA 4O2EB 5I8CB 3ULUC 5K93A 3ZDXB 4J2XA 1WBZA 3MJ8B 1E28A 3RPBA 5EWIH 1UZ8B 3HNTL 4NOBA 3WO4C 1XGYL 5IROA 3DKHA 2N1KA 1J1OL 3SE8H 4UMSA 5D72H 4JPWH 4PG9B 3B7SA 5IV2A 1WA2X 4FULA 3ZKXB 3ZQWA 1EEQA 3VDCA 4MA8L 1CYWA 5ETUA 1XO8A 2PYED 3ARBA 1BG1A 1UH3A 1C08A 4ICWA 1E4WL 2WZPA 5EZPA 3T3PE 3VFTA 3OKKA 5JW4M 3FN9A 1MI5B 5I6NA 4NKDB 2MOGA 5J13B 3U7WL 4DUWA 3MLZL 1IC5H 1XIWA 1A4KB 3B5TA 4L9DA 1OAJA 2QMKA 3FF8A 3DPBB 3FU8A 4GG8A 1P7KA 4TOYL 2IOMA 1KWKA 1JFQL 3CK0H 1GGIH 1P53A 3ZKQD 5F1OB 1PKQE 3ZKXC 1RIHL 4BJLA 2CO3A 1HN1A 2D7PA 4JPVH 3F7VA 3HS0A 1ZCRA 3QYCA 3MGTB 3P4OA 4OCYH 5CINL 4X2UA 4YHML 3GDBA 4CADA 5I0VA 3SQRA 1VGEH 1KELL 4LHUA 5D2NE 1BQUA 1AZZC 4M8VA 3J07A 1MN4A 5CJOL 3CDYA 5EZLB 3G7TA 1JK9B 3CHSA 3L3IB 2ZKYA 4WO4B 3L4VA 4PJ8B 4H20H 3KYOA 4AUJA 1JD9A 5CJQH 1N2RB 2DQDH 5FV2A 4AV4A 4J1UB 3OSVA 2BWDA 3KJ4B 3Q3GB 4LEOB 4WFEE 3X13B 4L8DB 4CBPA 1T1WA 3BAEL 5EEYA 4OKDA 2W60B 1HZHL 43CAA 1J1XH 1UXMA 3TASA 1UOKA 1D9KD 3KPRE 1FQ9C 4ABWA 1XX9C 4PV9B 4YEFA 3VUAA 2IAND 3GXNA 2H45A 1RZKH 3N43B 3H0TB 4L29A 2K7PA 2OSWA 4XPGH 1UB6A 4NM4H 2JMRA 1JBJA 2WXFA 1XB6A 3FU9A 2IDUA 3VD0A 4UV4L 4LAQL 2PW1A 1KGXA 4PJ8C 1XCQA 4FG6C 2NY0B 4DAGH 2FCBA 2EICA 5CUSL 1QSEB 1YMHB 4KU1A 1K2DA 3KJ4C 4PV8B 4RMSA 3DNKA 1MJ7H 3OZ9H 2J20A 2H0EA 4OUUA 2DLHA 4PW9A 4HIXL 8CGTA 3FPYA 4XCFH 3RDTC 2W0FB 4BSWA 2GFBA 3CDGA 2HFGL 3DJTA 2PYFB 4IBWA 4M3KB 5KYXB 4NKQB 3RKDC 3OZKA 2P44B 3ZMRA 4ZTEA 3MRPB 4CSZA 2BSRB 4QT5A 4U1JB 3KCPB 4FJZA 5IW1A 3CHPA 3FAWA 1BDYA 1T7ZA 1LMIA 3ESNA 5C08D 4ZSOA 3PG2A 2VR4A 3OKYA 3QDMB 1GY1A 5EDSA 1V3JA 1HDMB 4V1DB 5DHEA 3CU7A 1A21A 4W9EC 1RUMH 4HCGA 1Z0NA 5B4MD 2MCMA 4G1MB 4PRPE 3F65A 3HRZC 5GRYA 3MQIA 1AACA 5E5UB 1UOVA 5J56B 4KDTA 3UABA 5GSRB 1PLGL 5L4JA 3QFGA 2KDGA 4Y2OA 2P5WE 1NGWA 1G6RL 2EH8L 4ZDHA 5C0AE 5AVUB 3K7UA 1NTDA 4A63A 4BFGA 1BJ8A 2EC8A 1MH5B 1QG3A 2JKWA 4X8JA 3STLA 4XMVA 2ZWKA 4AGPA 2XZAH 1EFXD 1CGWA 2EEFA 2FVNA 4Z3HA 3GMQA 4JO1L 4G9FA 4QTIL 2LQRA 3OB0H 2HLFD 1O5DT 4OTXL 5DU7A 4QCIA 5IOPB 5I18L 4JQXA 2ZNXA 4NLHA 1BYNA 3MOQA 1HWGB 1A7RH 4QY8B 1K3ZA 2FD6L 4Z7NB 4XC1H 4PJDA 1EGJL 2DAVA 5BO1H 1L3WA 5FCUL 5FO7B 1ETA1 3S88H 4GSXA 3KHQA 3VCLB 4JHAH 5IJBC 1PZSA 4JM2B 5FV1L 5IT2H 1T83C 4KVPA 3MRNB 1M6OA 3VXNB 3G9VA 5T1DH 1FFTB 5CR1A 1A6VL 2IPUK 5T1KB 3ET9F 4WFGE 5TE7H 1IARB 2XTJD 5CD3B 3QQ9D 5DURB 4H88L 4F37K 4GS7B 1I82A 4K2UH 1FVEA 2LT9A 5CZVH 2C9XA 1AZCA 3MLTB 5DK0B 3T4AC 3VRIB 3QQDA 2CUAA 3BIBX 2VC2L 1UH2A 1XDTT 1TU2B 1E0OB 4A2FA 2FO8A 5DQJA 2WXLA 4ZNEE 4D94A 1BBJA 3FN0L 3RWDB 1QBML 2F54D 1M7UA 3IJ8A 1M4KA 3U0TB 3FL7A 2G2PA 1YNKH 4KNTA 2J4WH 3A67L 1B6DA 4OCWH 5EIVA 4QRSA 2D0GA 1FG9C 1OK0A 3E1ZA 2AS5M 3VD4A 4F2EA 2AZUA 4IBUA 1J8KA 4HS8H 4TQPA 4GS7C 4PRAB 4F9LA 2GPZA 4B5EA 4XN5A 1HQRA 1HNGA 1J0ZA 4G71B 5KBMA 2YQGA 2H41A 1U95A 1K4CB 2V7HA 4YPJA 4DEWA 3SDYL 3DROB 5TTRA 3EYUL 1U3NA 4NT6B 5L4IA 4IIZA 3ZY7A 3NJNA 1DFBL 4WWID 2ATKB 4AY0A 1PKOA 1U8HA 4C83A 1FLRH 1AZNA 1CU4H 3PWNB 4JHWL 1M1XB 4OZGF 4YDIH 3V2AR 4X9GA 3DHMA 3OR6B 1W0VA 2EE2A 4WK0B 3K6DA 4GXVH 4Q2ZA 4A04A 3NCJH 3QDJD 1RFDL 1XGTB 4P49A 2QSCL 4N0RA 4YPGA 4QUOA 2R9HC 4C56A 1PZCA 1S9YB 2WB1A 3QDHA 1Z3GL 3LN9A 1BQLH 4E5XB 4FS0A 3OMNB 3MACH 4OGYH 1A1MA 1DN0B 1QBLL 1LO3H 2YQ3A 3PAVA 4GW4B 3HZMA 3L54A 1IM9A 1QFWM 3GLAA 3MRFA 4OZHE 4I1PA 2JQMA 2X4PB 1BF8A 2WIMA 1AQDB 2CO1A 1VKXA 1Q38A 4WKZA 1FPTH 2VN6A 3FB8A 4N0UE 3IM1A 2O30A 1CPUA 4IJTA 5KVFH 3TPKA 4ZXBB 2PO6B 2QKSA 2X0VA 1ZLVH 3GHEL 4AK2A 3N44B 2NTSP 4L48A 1PYWA 5LCVA 4LSPH 4PGBB 3BH9B 3A6BH 4TPRL 1Q9KB 1U2CA 3HI5L 5A1AA 1JTPA 4MAUH 4JHZA 4RMQA 5C2BH 1FN4A 1IMHC 2JF1A 3R0NA 4DKFH 3OKDA 1KN4H 3L16A 1UD4A 2XX1A 4TLKA 4D9LH 4G80B 2GTQA 5TGBB 2XWEA 1H8LA 2PPFA 1EZVY 5BS0E 4ZS7L 3HAEG 5ISZB 5I0ZA 1BAFH 2MIZA 3ZE0B 2F8XC 5JPNB 2B5IC 4ILDA 3DXAB 5HDOA 4B96A 2RQEA 2EVIA 3DUHA 2CPUA 3FUMA 3MV11 3GSQA 5EUOA 4ZXBC 3LZFL 5ID0A 2DW5A 3KS0H 1AD0B 3WFCL 3O0RH 1MQ8A 3VA6A 1MHCA 5TF1H 3WEAA 2HVKA 1RXLA 2OXHB 3D08A 4MJ5B 4Q9CA 4GI9A 1H8OA 1E8WA 5JOPE 3QIUD 4QGYA 1MHEA 5LCVH 3NUKA 5FKAB 1PG7L 1H3GA 4HEPG 3MRGB 4NQDA 2WLKA 3V0IA 3LKOB 4Y1AE 5BJTA 3V0WH 5H8DA 2ZPKL 3MYJA 4LARH 4ABQA 2E7CA 1LO4L 4C47A 5JPNC 5HGHA 4G6MH 4Q8BA 3DUSA 3R06A 4ZO7A 4AGQA 3X12A 4JZNB 3MGOB 1ZE3C 2XN9E 4NQEE 1OK8A 3QS3A 1X5FA 2WMPA 3CZLA 3V9EA 3KBEA 2IWGA 3D0VA 2F7RA 4OZIE 1DZBA 3II2A 4XCEB 5IJVA 1JK8A 2LTQB 2YPKA 5DC0A 3HHSB 3VFRB 4YZWA 3AS3A 1T20B 1QW9A 1GR7A 3S97C 2P8LA 3CFEA 3RVXD 2Z9TA 1KC5H 1RZ7H 1VPOL 2VZUA 4MFHA 4ZYKB 1DSFL 1CXKA 3GUTB 4KITB 1RUKH 1BPVA 3AXHA 2WBWB 4NPYB 1JE6A 2DWEA 4IDJH 1CICB 4FNQA 3WDHA 3VACA 3ECWA 4TSAL 2ZXEB 5HGAA 5CIPA 5ID1A 4Z7QB 2Z1KA 3HUJE 2VISB 5GGRB 1M7IA 1JIBA 3HE6D 2PCFB 3S4SG 4R2GB 3VGFA 4F27A 2LTQC 1HYSC 3OKMA 4X9BA 4Z7OE 2DYPD 4LLUA 2JJVA 2E7LC 1SXCA 4L3EA 2H0PA 1ZHKB 3CC5A 4HCRL 4PJCA 2VQ1B 1IBZA 3FRUA 2CIIA 3MV8A 4X8CA 4IBLT 4KUCD 3GEWB 5AVYB 1L9TA 3TN0C 2YC1B 3EDJA 5FO2A 3KXFB 3RTQB 1UA6L 1CICC 3EYSL 2WTRB 2WYZA 1CLCA 3QC5X 4UT9A 1T4KB 1YEIL 2FWSA 4HBQA 3QJXA 3LRLA 5HYQA 5D7SL 5CIPH 2V17H 4ISVA 4OLVH 1M42A 4R2GC 3MJ9L 5C3IA 4OFIA 1ZLEA 3MUHL 2NYYC 4I0PA 2BP8B 1MOEA 5A2BA 1T5WB 3PF2A 3ZMNA 4YSRA 1SOQA 4UQ3B 4NZRH 1X5JA 4EKJA 3SGEH 4N5ED 4B97A 3MOAH 5EORL 2GK0B 4DOHE 3HFFA 4GKNA 2SEBB 3F64A 3P54A 5DGRA 3WUWB 1NKGA 1VB9A 1X9LA 2ZSVB 3DGCR 4KJWC 2VDKL 4H1LB 4FOMA 1CGUA 4NJ9H 2Y9RT 4LLVA 2Y7SA 5B3SB 3CHQA 4N20A 3WMPA 1MVFA 4UT9H 2NNXA 5KW9H 2IPTH 4AGNA 1MXGA 2P28B 2R1YB 4MBRA 2CAKA 3WFDH 5KYWB 4N8PA 1MCOH 3S96B 5E1AB 5D6DA 2VN3A 4AYEC 2AJZA 3U2SA 3EJYC 1QR1B 3AXIA 3P3SA 3LKRB 4OZFB 43C9A 2AEPH 2KC0A 3QJUB 1E7VA 4FDWA 4QR7A 4WGVB 4YNYA 3SJVA 2KI6A 4LCWD 3FK3A 1L6ZA 1IKFH 4CAGA 1AE6H 4PJ5E 2F9BT 4K4KA 4PIBA 4BFFA 3UDWA 3US1A 1ET5A 3B9AA 2VQ4A 3HS9A 1NCGA 1BVOA 3UIYA 1UADC 3Q13A 5EB9A 5F7LB 5DZVA 4Y16A 1LDPH 1XXFC 5GGVL 1WIUA 3JTSA 2YXMA 3RNQB 1SXSA 3D39B 4UNVA 4IOFD 4YE0A 1MCPH 5JMRA 2EDHA 1T3FA 1T5KA 3MLYL 5I17A 2C7UB 1F58H 3CE1A 4N6QA 3VGGA 1HH9B 1Z5YD 5AB2A 1ZVSB 4XC3L 2D0HA 4P9MH 3BUQA 1FNEA 4JJ5B 1O6VA 3RX8A 1KBPA 2RB8A 2BO0A 3JTTA 3BAXA 3EFDH 1XGRB 5IHZB 5F7NC 3A22A 1HIML 1MELA 4WW2A 1TQWA 4X6BA 4NC1C 2ZJSL 4OCRH 2AEQH 2BVPA 4TUKL 1HCFX 4BWTA 2XUWA 2JQZA 4JKWA 1MFAL 2MCG1 4UB0H 4KXCA 4ZFOL 3SGKC 3X1EA 2OULB 3SKUD 4QJ5B 1JWUB 3DV6B 4ZS6D 2NSQA 3VXSD 4X99A 5E4EB 1J5DA 3FNKA 2IADA 2XJKA 4JRLA 2NDFA 1CWVA 1J9RA 4PJDF 3GXDA 2Y7MA 5FIEA 3W57A 3KGRA 3X14A 1FNSL 3L9EA 1U8NA 3D85D 4E9XA 1AY1H 3KHOA 2DH2A 2PWDA 4LSTL 4JW3A 5CWSB 1DVFA 2XWCA 4KVNH 4UQ9A 1DVSA 3D3VE 1A3RL 2YPLD 1F4XH 1BZ9B 2D2CC 4APQD 1MKFA 3BVNB 4WK2B 4OH2A 3H2WA 1SEBB 1RPQA 5LGHL 3W37A 2DL2A 5E4EC 1MNUL 4XAKD 2H3NA 4MB1A 1E7UA 3KPNB 7FABL 2ZCKH 1DQQB 1GTFA 4KOBA 1YVLA 3IU3A 3TWYA 4M6OH 2GSGA 3ARGC 3MLUL 1RZIB 4PAZA 1NCBH 5TDNA 2QQNH 5KTEL 3BVDB 2BSBA 4LHUG 4FC3E 2EDQA 3UC2A 4B60A 4AYFB 1XB3A 1TZGH 3VI4E 3SZ6A 3KPSA 5DJCA 2WZ5A 3NG5A 1HNYA 3PABB 4JGUA 4KQ0A 5JORB 1D6EA 2OYPA 2CNYA 3LKSB 4HHAB 4JG9A 1GW0A 1S7VA 4GXFA 1T1YA 5CSGA 2K8QA 2NY5H 5DYFA 3UXFA 2MFNA 2ZUQB 1DZ0A 4KMQA 4N2MA 3Q43A 3TF7C 4X6DA 1ZKAA 4NWUL 3MV01 5L8JB 3KPOB 2BWQA 3A6OA 3LDBB 4YHIA 2YAMA 4UT7H 1LEKB 3MOBH 4I3RH 5D2LE 4AM0B 2LU7A 1Z32X 1UH4A 2A9AA 1C5DA 3ARFA 4NQUA 5KSVB 5MEQB 1UWEL 4WEBH 1ZVNA 2R29L 2OTUB 2V7NA 3F83A 4NHUA 3T8XA 3O0LA 3K71B 3VI3A 1KCSL 2NSXA 4NP4L 1Q0YL 2ZUQC 1OIOA 3DGDA 1AGFB 1FIGL 5H2BA 3ZE1F 5D7HA 3X1FA 5IP4A 2OSLA 3D4GA 5C07D 1GA2A 3VGBA 4HT1L 5KS9A 2XZQH 1KBGH 2YEZB 3MRDA 4ZPVA 2FJUB 5E6RB 1J18A 1JNLL 2VSMB 3IE9A 2IQ9L 2JLLA 4AV5A 3KWWB 1NGXA 5JZ7D 4IMLB 4IKKA 1HH6A 3NDYE 3WNIA 1H15A 2EC9U 3ME0A 4ODUA 3ESVF 5C09E 3BUTA 1P5UB 4WJ5B 3VD3A 4OIIL 1CK0L 4ZFQA 4FJ6A 1XCWA 3KYNB 3NABL 3RZCA 3BDXA 1PZ2A 4KO6A 4HZLB 4NNPH 1OAXL 3D25A 3DRTB 1CF8L 1PBYA 3WL9B 3AU1B 2IH8A 5G4OA 3MFFA 2G9KA 2F7QA 2ICWA 1JNHA 2YAOA 4U7SA 5I5RA 2R2HB 4GAJH 4FFVD 3GMNB 3WEBA 2HRHA 4LE8A 4MDRA 4OV5A 4O2EA 2MOVA 5J1SC 1UOWA 3MJ8A 5JIIA 4YC2B 1UZ8A 4GH7B 2HAZA 5AYUH 1RP8A 1IVLA 1JGUH 3CUPB 2BRRH 5EUOF 3ULUH 3O4OB 4GUQA 5D4HA 3L5JA 4PG9A 3AXLB 1PVHA 2WAQA 1P5UC 3SGDH 4WUUD 1OHZA 2DM3A 2XBDA 1QSVA 4GKSA 5M7QA 3B56A 4Q6IB 5FYJE 2VB5A 2DQUH 3D7PA 1XH1A 5EFIB 1Y7VA 1KGWA 1EHAA 4U4BA 4BHUI 4IHOB 4B50A 1Z2KA 2VLJE 5C0CB 2BNQB 8FABA 4PJIB 2AERT 1MI5A 3H7BB 4YC2C 4JFUA 3K81A 5GZNC 4DO4A 2W81C 1R19A 2X12A 1MFDH 3KJ6L 4PP1D 5IW6B 3DPBA 3O4OC 2IC2A 1S7UB 5JXAL 1ZANH 4ENED 2R2CA 1KCVH 4N8VA 4JAMB 2VLMD 4D8OA 4Q6IC 1CXIA 4GIOA 3LPGA 3MUZ1 4JFVA 4NAQA 5HHOB 3MGTA 5DF0A 2DJSA 3FB5B 3OC8A 4K23L 2MSPA 5K9OB 3KLAA 1KWGA 2BP5M 5CZXC 5LN4A 2CMRL 1ZDSA 4GBXD 3N0AA 5EZLA 1YMMB 1JK9A 3V52L 5AOJA 1BD2A 1F5WA 4OM1H 4PJ8A 2H26A 3TH4T 1N2RA 4KI5E 1ORSA 1M05B 1IAII 2D7OA 2GCYB 3Q3GA 4J1UA 4LEOA 3UAEA 5I6KA 4QOKB 5BRZA 1OCZB 4LLYB 1A3LL 3RDTA 4BYHA 4AL8C 1BWMA 3GMPB 4PV9A 4PJCF 4GMSL 2IFFH 5MEND 3H0TA 5BVPH 3D34A 1P1ZA 3VRJB 2Q6WB 1L0YA 3RIAK 5E2UH 1EK3A 4ZFGL 2PUQT 4TULL 2N1TE 3WCYA 4HGWB 4L37B 5E8OA 5C7XL 1OF2A 1A6PA 1JRHL 5DD0H 4FL4B 1GYVA 3QXVA 4KXZH 4L4VE 4PV8A 3EJZC 3RLSA 3QEQB 5F0MB 3GI8H 4FKKA 3HRZA 3FQWB 2FLRT 3QPXH 2AXJA 2W0FA 4FZ8L 5IJDC 4YDKH 5LGKA 4JR9H 3G6JA 2EDMA 5KYXA 6TAAA 2GTZB 1HOEA 2X1WL 3H55A 3IAPA 4F2ME 2C8NA 3MRPA 3ILPA 3MJ6A 4U1JA 4X6EA 3P1VA 2ADGA 5T1MA 3ZT7A 3S36X 1A6WL 3A4AA 1KB3A 3CFQA 1SJXA 5FOBA 3QDMA 1I1AC 2APWA 3CVHB 2R0WH 4V1DA 1E90A 4FL4C 4AQOA 1T7YA 5ACLA 1XGPA 4KHTL 2KPNA 5DD6B 5T8IA 3ALPA 3K8MA 2NR6C 3C6LB 4OGXH 2ZP9A 5K9JH 3CN4A 2GJPA 3N40P 4AIZB 2NNRA 1GMIA 1NUNB 2NY4C 2HKFL 3HG1A 3LNHA 4G82A 2LOEA 2Z91B 2MTAA 3LH2L 5CCJA 4ZMQA 4NJAL 1BJ1H 5JHMA 3QXAB 2XVLA 1TTCA 1MH5A 2EC9T 2WLJA 4KQ3H 4X4XA 5JW5B 5EWIL 1BZEA 3SDCB 2WTOA 3RDJA 3SE8L 4ES9A 5D72L 3LKNB 3QJVB 4YHKH 1T83A 4W4NA 4XCNB 2FIKB 1PSKH 3ZYJA 3NAAL 1QWNA 3L3JB 2Z31D 2YMOA 1F11A 1BQKA 2APVA 2Y2WA 3DX7A 2BCKB 3NACH 1DBBH 1FH5L 1A65A 4XCCH 5FW8A 5IQ9B 2M8XA 3KLKA 2UX6A 1K85A 2VMJA 2CK2A 4HEMA 2FX7H 3KPRD 4IJ3B 4D0DA 4TLTA 3T4AA 4RETB 1OTUD 2R15A 4MDJA 5DO2D 3C60D 5FO7A 3SDCC 4FI7A 1YQVH 1F1AA 1K8IB 1SM3H 3V6OE 3MRNA 4RGND 3TNNB 5E6ID 3VXUE 3CK0L 2X1PA 3VXNA 2JB5H 2YD5A 2N3JA 1BX2B 4JPVL 1PD0A 4O2CB 4OCYL 1E5UI 4DPAX 3PPEA 4U4IA 4WW2F 3VXMA 4I48A 5BQDA 1A4CA 3HLKA 3LN5A 5K33A 2QSQA 1MG3C 3O4LE 3MLTA 5DK0A 1CLZH 2Y23A 3MSPA 2BH0A 2PP9A 2WXOA 3HNVH 4H20L 1FFPA 3COOA 4XZUB 1TU2A 2ZAIA 2DQDL 3EIFA 2FO4B 2AJYL 4F3FB 4OZGE 1KXTB 3CSBA 4KXDA 1P5VB 3RWDA 1XEDA 1CFQA 1T03H 4LCUB 1ZJAA 3UO1H 1JXFA 1J1XL 1WTGT 4OU3A 4XPHH 4LDCA 3AREC 1YJDL 1OY3B 3VRLF 5EU6E 1X7QB 4PRPD 3HBPA 5IMMB 2AKRB 4QTHB 1NEZB 4NM4L 4R8WL 2J12B 4DERA 2P5WD 3UYRL 4LEXL 1AP2B 2BNRB 5C0AD 2RQ8A 5K1JA 4DAGL 1FFNB 4D9RD 2XA8H 3N1FC 4XVTL 1U8KB 1FC2D 1MCCA 1B2WL 2PTUA 4NT6A 1COBA 1KJMB 1ZDQA 2UY6A 3SKOA 4AGOA 3UTQA 2XWDA 5AB9A 4MD4B 1MJ7L 2WAHA 3C75A 2VR3A 4IKIA 1JZIA 4OLZH 4YDJA 3V0AC 5I76A 4EDXA 1JZ4A 4Z1PA 1BJMA 1R0AH 5FM8A 1E67A 3MZTA 1OM3H 5KJRL 1RIVH 3MROB 3VM7A 3WNPA 1XGTA 4X80H 4MMZB 3QEGH 3QUZB 3EADA 2EADA 2Y6SC 1VADA 1S9YA 3S5ZA 1O9ZA 5C0RH 1H0DB 2WXHA 1FH2A 5IVXB 2DQHH 4OGZA 3C5SB 4OAWB 1DN0A 1KGCE 4EI5D 1K72A 2R2EA 5E99H 1KCUL 2VL4A 3U9PH 2O5NA 2K6ZA 3SOBH 1I8KA 2X4PA 1Z3RA 2N0MA 2F74B 1AQDA 2XQYK 1JCKA 1WVZA 1FRGL 2J72A 4K15A 4G7QB 1WSST 4LVOB 4KROD 4MMZC 4X6DF 4WFGD 2N7SA 4KZ0A 5EUKB 1B6UA 5HJBA 2YMXH 4ZXBA 4G11A 1OAQH 1R34A 3FO0H 3KEDA 4LP8A 3L7FB 2EYSB 3W39B 1KG0B 4DVBA 2XZAL 12E8H 2JJTC 4PGBA 3BH9A 3EGXB 4Y7MA 5FYLH 1A6ZB 2JKXA 2MQ0A 2H4EA 3NBNA 4KXAA 1AKPA 1TETH 1D3CA 2IVFC 1H3XA 4G80A 4M6AA 5KSBB 3VI3F 2Y6TE 2I5YH 3HN3A 2VQUA 1OGSA 1J10A 1E5ZA