2WO2B

Crystal structure of the epha4-ephrinb2 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
136
Chain Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
molecule keywords EPHRIN TYPE-A RECEPTOR
total genus 29
structure length 136
sequence length 140
ec nomenclature
pdb deposition date 2009-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2wo2B00
2BP0B 2BZ7A 4HIPA 2QT6A 4NAJA 1KCWA 1ETJA 1XB8A 3WKPA 3NP4A 1DYZA 1SFHA 1ASQA 1PLAA 3NP3A 5D4HA 3UADA 1QLEB 1BYPA 1JZJA 3WNJA 4ENZA 3FU8A 2BP8A 2YAOA 5A7EA 1CUOA 3PAUA 1AS7A 4E9VA 5FC9A 5I6MA 4GP5B 1NIFA 2ZWNA 4WTQA 4M3HA 7PAZA 1JERA 3H4HA 4DP2X 4E9YA 3D12B 3RYMA 2HX8A 3QJUB 1OV8A 2CALA 1W6LA 1HAWA 3H56A 1JOIA 1RZPA 1L9RA 2PP9A 2YXWA 3S3CB 1AS8A 2YQBA 2VW4A 1J9QA 4A68A 2HX7A 4UAHA 1W8EA 5PAZA 5D4JA 2AFNA 2W88A 3ABGA 4YSPA 2I85A 3QQXA 4A2DA 4YSUA 3S8FB 3NYKA 1NINA 4A2FA 4FA7B 1W6WA 3QJRB 2Q5BA 2W8CA 2X88A 1BQ5A 3QPKA 1QNIA 4KOCA 4HHGA 5B1AB 1N68A 1KYAA 3ZBMA 1PAZA 2PPCA 1JZGA 1QHQA 4Q8BA 1ASOA 2BWIA 2VM3A 3AG2B 2BWDA 4A67A 5LDUA 1A65A 2NRDA 5B7EA 1SNRA 3NJKA 4MFHA 4YSQA 1NIEA 4P5RA 1FA4A 1DZ0A 2PCFA 2BZCA 5ANHA 4W9ZA 1V54B 2BO0A 1AZNA 4GP8B 1KDIA 2UXGA 1MG3C 3T6XA 5F7BA 1PLBA 4DP4X 1E67A 2YXVA 1JXDA 1SF5A 2YAQA 4KNSA 6PAZA 1HAUA 3ERXA 4A66A 1GYCA 2Y1AA 5I6PA 1GS7A 5I6KA 5I6LA 4X4KA 1OCOB 2YAPA 3AG4B 2TSBA 2HRGA 4DP9X 1X9RA 2AZAA 3FU7A 2FQFA 2I7SA 4WKXA 1SFDA 1JZEA 2ZONA 3T71A 1NDTA 1E5ZA 2XX1A 2CUAA 1ZDQA 2WO3B 1E65A 3TBBA 2CCWA 3HB3B 5D4IA 1AQ8A 4A2EA 1L9PA 4BWUA 1ILSA 2HRHA 3IBOA 2IH8A 4GY4A 4F2FA 2J56A 4YSTA 3OMAB 3ASOB 1SF3A 2LLNA 1OOWA 1JZHA 4YVUA 4HCFA 2ZOOA 2PPFA 4E9RA 2JXMA 2XV3A 1ILUA 3PLYA 2IDTA 3U25A 2YAMA 5B3SB 4YSAA 4YVNA 1JVLA 1AZCA 1PMYA 3IE9A 3ABMB 2FT8A 3ASNB 5PCYA 2XXFA 5B7FA 4E9XA 2E86A 2VM4A 3DKHA 5EHFA 3X1GA 2HZHA 2GHZA 2H5UA 2FQGA 1JVOA 4NB7A 4BWTA 2FQDA 4AKPA 1WA0X 1PF3A 3CVDA 4FAAB 4AKQA 1JXFA 4AZUA 1PNCA 1ASPA 1ZPUA 3UAAA 1KV7A 1ZIAA 6PCYA 1TEGA 5F7AA 2EINB 5B1JC 1A4BA 2B3IA 1MG2C 4KO9A 2UXVA 2VN3A 3WG7B 1OF0A 1NIAA 4E9SA 3EHBB 1NPNA 3NJFA 4M4RB 3TU6A 1AAJA 1AACA 4DPBX 1ID2A 3FU7B 1GY2A 2FTAA 1V10A 4UANA 2PP7A 1IBYA 1AG6A 2AZUA 2ZXWB 4KNTA 2XXGA 3FQYA 4K9JA 2GB2A 2HLEB 3G5WA 1JXGA 3WI9A 4DPCX 1CURA 2YARA 5B1BB 1PCSA 1BXUA 4E9WA 3T9WA 3PAVA 1EHKB 5I28A 1ET5A 3ABKB 2QDWA 4N8UA 3WIAA 1GSKA 3GDCA 2IDSA 3NJIA 3DTUB 1NWPA 2FJSA 2UXTA 3NJMA 5I6NA 1ADWA 2XUWA 3EH3B 1TKWA 1R1CA 5I5JA 1FWXA 3SQRA 4BDVA 4QLWA 2UX7A 2WO2B 5TK2A 4RH4A 4DP7X 2YAFA 4AI7A 2DWSA 3TASA 2EIKB 3AY2A 1IBZA 1AS6A 2YAHA 3OM3B 4HZ1A 5AKRA 3PXLA 5I5IA 3FQ2A 1BXAA 1E30A 4HALA 3L45A 4HHWA 3QJTB 1J9TA 3SBQA 2PPEA 3SBPA 4G7SB 4KOBA 5E9NA 3V9EA 4N4YB 1WS7A 1BXVA 4G71B 2IWKA 3X1BA 2DV6A 2XYBA 4G7QB 3MX0B 4P5SA 1A3ZA 2EILB 1TU2A 2R7EA 1AZRA 3CZUB 1SDDB 4G72B 1J9SA 1PLCA 3JT2A 4TXVB 4UF7C 1KDJA 2BW4A 3KW8A 2XLLA 3N55A 2CBPA 3OD3A 2FT6A 1PZAA 3FYIB 4YL4A 2VW7A 1CYWA 1BEXA 1T5KA 2R7EB 4ZK8A 1NPJA 4HAKA 4DP6X 3NSYA 3UAEA 5B7MA 3JTBA 2Q9OA 1AIZA 2IDUA 4A2GA 1BQKA 2XV0A 4CSZA 2AVFA 4AKOA 4L0PB 2FWLB 4BDVB 3BQVA 3NJLA 3PPSA 3ZIYA 1ET7A 3AW5A 4PAZA 2PPAA 3S3BB 1J9RA 4EF3A 1CC3A 2PCYA 1ET8A 4Q89A 4BXVA 3T6WA 2B08A 2P80A 1A4CA 3CG8A 3S3DB 1WA2X 1KGYE 2XX0A 3N2JA 4YSCA 2CJ3A 3FSZA 1L9QA 2QDVA 3BVDB 2N0MA 1HFUA 2DY2A 5I26A 1SDDA 2DYRB 2QPEB 2XU9A 1IUZA 1FFTB 1NTDA 3EF4A 1MZYA 2IWFA 4YSEA 5TK4A 9PCYA 1SHXA 3T6ZA 2A3TA 1WAEA 1RKRA 3NJHA 3DIVA 1EZLA 1OCRB 2IWEA 3FS9A 4KNUA 1PZBA 2H47C 2Y69B 1JZFA 1KBWA 2PP8A 3SBRA 2FT7A 2GI0A 2BHFA 2DWTA 2GC7C 2OCCB 3HEIB 2VW6A 3TBCA 2QPDB 1GR7A 7PCYA 1NIDA 4BXSV 3GYRA 3OMNB 1PNDA 1ZV2A 3FYEB 2H3XC 2P80D 2XVBA 3EH5B 1IC0A 1OE3A 2PLTA 8PAZA 1XB6A 1N70A 3FSAA 3FSWA 1MDAA 1OE2A 1RCYA 3ZX1A 4KO6A 1BAWA 1XMEB 3C75A 4JHUA 3FPYA 3PAZA 1OCZB 1MZZA 4QKTA 2YAEA 4DP1X 1GS6X 1E5YA 3CVBA 1SJMA 3IN2A 3X1FA 1WA1X 2IDQA 3CDZA 2IDFA 3NJNA 5AZUA 4JKNA 1JZIA 4DP0X 1PY0A 4HCIA 3CVCA 4JHVA 2X87A 2EIJB 3NJGA 2GBAA 4G70B 1I53A 2BW5A 2OV0A 1AZUA 4YSRA 5I5MA 2J57A 4GYBA 4KO7A 1NZRA 3FPXA 4AX3A 5AFAA 3KW7A 3T6VA 3AG1B 4BK5C 3OQRA 1KBVA 3IEAA 1GS8A 1WS8A 4DP5X 1L9TA 1RZQA 2FQEA 1ZDSA 4F2EA 3FT0A 4DPAX 1M57B 1V55B 3NSDA 1AZBA 2GC4C 1GY1A 2MRYA 2XWZA 2J5WA 1AG0A 1OE1A 3EH4B 4YSSA 1NICA 2XV2A 1CYXA 3PCYA 3CDZB 3ABLB 3NT0A 3ZDWA 4PCYA 2UXFA 2HXAA 4DP8X 1AANA 4G7RB 5B1JA 4E9QA 3OMIB 1VLXA 2VSKB 3NSFA 1A8ZA 1B3IA 1L9SA 2I7OA 1F56A 4GXFA 4BWWA 1XB3A 4GP4B 2IH9A 1URIA 4NERA 3X1EA 2JKWA 3UACA 1L9OA 2RACA 4YSDA 4A2HA 1IKOP 1BYOA 1NIBA 3NJJA 3IN0A 2VMJA 2J55A 4KO5A 4CSPA 2TSAA 1A4AA 3GXUB 1BQRA 3AG3B 2EIMB 3AZUA 2MTAA 5B1KA 3X1NA 3FQ1A 2PPDA 5IY5B 3S8GB 4E9TA 2GIMA 2BP8B 1PZCA 3FU9A 2FNWA 1YLBB 3UABA 2IAAC 1TEFA 1UATA 1GW0A 4F7KA 3NSCA 3QJVB 1M56B 3MBWB 3H4FA 2JFCA 2GSMB 1X9UA 1ZIBA 2WSDA 2CAKA 3V9CA 1KCBA 3FSVA 4W1TA 2UX6A 3QJSB 2DYSB 1OCCB 1J5DA 2BP0A 4HCGA 2VSMB 4YSOA 3WKQA 1SHWA 3QJQB 3X2QB 1AOZA 3WNIA 2AANA 2OJ1A 3UGEA 2HX9A 1AR1B 1M9WA 3TA4D 5I6OA 1J5CA 1NWOA
chains in the Genus database with same CATH superfamily
5EU3A 2BCMA 4EUPA 3BAIA 3BX7C 3RWJB 2QLVB 1P2CB 4XN4A 5IQMA 3H6AA 4IIQA 3Q5OA 2DF3A 5DHEA 4V1DD 4M7ZB 4PJHA 4YWGH 1WWWX 2Z31C 4NUJB 4A38A 4LNRB 2AJXL 5JTWA 5SX4H 1U6AL 1UH2A 2C5DC 3G08A 3SDAC 4ALAH 1FUNA 3UTSA 2OL3H 4IBSA 2HWZH 2OXGA 3CHPA 3F58H 3UTSB 2JQMA 4JR9L 1JHLH 1I1AC 2GAZA 3EYUL 1UXWA 4GG6F 2J25A 4X5RA 2NYKA 4FJYA 2YAOA 3QORA 4NQEB 4H8QA 1AS7A 5C07D 3CWGA 3GI8H 4LEXH 1Y18B 1TVBA 3PUUA 2CLRB 1YAZA 3J2PA 1I3UA 1UXLA 4KDWA 5CWSB 3RPKA 5I6MA 3OKOA 2L7QA 3BKMH 4WI5A 5FYJE 1RUKH 3R06B 4LLVB 5JHLH 4OM0L 3BPLC 1QKZL 5J56B 1F02I 3K2KA 2WBXA 3U9WA 3U30C 5DI8A 4NN5B 4AYEC 2R1WA 2UY6B 2X9YA 3B9KB 3MV9A 2MFNA 1PZ2A 1A4KB 4V2BA 5KYWB 1KGCE 2IEPA 2XTSA 4KVCL 1XIWC 1CFVH 1DQDL 3PHSA 2AC0A 1TVHB 3HIZA 4G6AC 2CZNA 5IFHH 2F9BT 4NUGL 3LTVA 1I8LC 1P4LB 1XSOA 1NMAH 1JHLL 3GK8H 3ZK0A 5L2JA 2BRRL 2LU3A 1YEFL 3NAAL 5LGHL 4HH8A 4YFLF 3NFSL 5TQ2L 2XN0A 2IAND 3KYOA 2Q86A 1NGXA 4H8VA 1M7IA 4WHYG 3GJFK 3UJTL 4PRNA 3C6LA 1MJJB 1JPST 1UXSA 4NJ9L 3OVUB 3V0VB 4GOSA 4YOKA 4I89A 4K5MA 1U91B 3FTGB 2I5YH 1MFAH 3B7TA 3QPXL 5LNDA 4P5RA 4JPKL 3BD3A 5EBMA 4I3RH 2B9BA 4M4RA 3LQAH 5E2UH 2HKHH 2B4CL 4OSUL 1D5ZA 3FB7B 3KM2A 4M61B 4YDNA 3VQLA 1G9NL 3N43B 1P4BH 4KNSA 4XZUB 3VXNA 4JN2A 1VGEL 2BWQA 2D3VA 3IXAA 4M6NH 3U0PA 2HT2C 3VRJA 1IX2A 2CWRA 1JZ5A 3WFBL 1OAJA 4XPGH 5HYJD 4GRMB 3NRPA 3P1VA 4W6XB 4Y0GA 3GSNH 2YAPA 5FAAA 2TSBA 5BZXA 3FB8B 5L8LB 2HRGA 5LWYH 4GEIA 3K71B 5CCJA 1OAKL 4PJ9B 4JFWA 2D3NA 4Z7UF 3VQ2C 1MFMA 4X5XA 4GAAA 5I24A 1WSST 3B83A 2C9QA 5FF6A 1P7QD 3CFNA 3MA7B 2BFGA 1E65A 2F8OA 3NFSH 4Z3FA 4LPCA 2BOCA 4L29A 1AXIB 4NC2B 1JV5A 1SRDA 2JWYA 4Y19A 2X1QA 2LE9A 3GRGA 3SGEH 2WCPA 5TE6H 4MKTA 5BS0A 3WJMB 4FFYH 3MBXH 3KPMB 1X4ZA 1B9KA 1WFNA 4HCFA 1NAMA 4JFZH 4NQCD 4PY7A 4TQEL 1IAMA 5D1XC 2VDKL 3F12B 3N3EA 3D2TA 1QLEL 5GS0H 2WUCH 4UDUB 5A6IA 3RVTD 2B39A 4OCNC 5D71L 4E9XA 3G3LA 2NZ9C 1DVXA 3R19A 1Z9LA 5E0FA 3O9WB 3SCMB 4R5VA 1UH3A 3H54A 3QGVA 5F6IC 5DLLA 2ICWA 2XRAH 3WY4A 3ZRSA 2ZSVB 4L2LA 5CD5D 2D7MA 1IQWH 1YQVH 4I77H 1JXFA 2NY1C 4WQOA 1PNCA 4I5BB 1T3FB 1GOHA 5EBWB 5HYQA 4GG8A 3QG7L 4IMKC 5FGBC 3NIGB 5EBWA 1BYNA 1VB9A 5JHMA 1LO2H 4Y19B 4ONHA 4B0MM 1RJZB 1AI1H 3KPRD 3KPSB 4I3SL 3SDXB 4P2RB 4P5MA 5ICZA 2IQ9L 2VN6A 2WLLA 3N91A 4U2ZA 5D1QB 1QPPA 1DQML 4MRCA 1EEZB 3DSFH 3WE6A 3JWOC 4JJ5A 4DVRH 1YDPA 5JW5A 4DOHB 1MCJA 1MJUL 1WBYA 1LWRA 1W16A 5HHMB 2I07A 5KVDL 4X5WA 1CK0H 3NJVA 2PO6C 2Z8VC 4PFEA 1KNOA 5LHDA 4JRFA 1YVLA 1XSJA 1JFQH 1S7XA 4LARH 1JZ3A 5FO7A 4HJJL 3JZYA 2AXFB 3MOQA 1S7RB 2L7JA 2BVEA 1KELL 1KF9B 3CVHH 3MKGA 2VWEE 3RWEA 3VTTA 4RX4D 5IESH 4D8PA 2XKUA 4I87A 2ALWA 1FWXA 4XN8A 7FABL 1JDCA 1YEEL 4YHML 1KB9K 1ZV5A 3C5SB 1S7QA 3ZE1E 5TQ2H 3L4TA 1H19A 5F9WC 5C08D 1MJJA 3SCMD 4YFEA 1BZOA 3MA9L 4LEOB 5EG6C 5IBUG 4G6AD 3R1GL 4PLOB 1X6LA 1ETZA 1YN7A 3KLAB 4PJEF 2IGLA 4M6MH 3SGDH 5DJZA 3ZR6A 4ZFOA 1U3ZA 3O8XD 3PDDA 2D2OA 5HI3C 2GJZB 5F89A 1YMHB 3MJ7B 4PRNB 5K1JA 3EOBB 1TFPA 2W1NA 4G8GB 3FQUA 4ZO7A 5AZ2L 4F27A 2JI1A 1CLYH 2C9RA 4GSDL 1OGTB 3RNKA 4M3KB 3TTYA 1C08B 1CTMA 3BPCB 2BINA 3D07A 4DFHA 5L0QC 2VDQH 4J3XA 3GHEH 1FGVH 4M5ZH 4WNJA 3JUYA 3WYRA 3WN5A 1CF8L 2VIRA 3HE7D 3OD3A 4P04A 3FOMB 1PZAA 5C0AA 4HKJA 4F92B 5ID1A 5L7XL 1VPOH 2DLGA 1IKNA 1T1XB 3JTBA 3L9RB 4KRPD 2Q9OA 2AV1A 3QAZB 1FDLL 4ATWA 2HAZA 2X4SB 4JCMA 1UWXH 4X99A 2WIMA 4HCRA 3D0AA 3KJ4C 5DJ8B 1TTGA 1Z9NA 2E27L 2FX8H 1I8KA 1GKOA 3B56A 1J5HA 3W0WB 3KS0H 2PYEA 4XI5D 4Y16A 2N7AA 4JRYE 5DQJB 4BFGA 2F18A 2F58L 5KVEL 1U36A 3JBG7 2XICA 5DYOA 3AROA 4YPGA 3PHAA 2Y5EA 2FBOJ 2J5LB 5T5FL 1V3LA 2F2HA 2V17L 1LILA 1NLBH 5F7MC 4Q6KA 3DX4A 4JFPA 3OKDB 3L5WB 3P0YL 1F1AA 3IGAA 5CZVH 3CZFB 1JNHA 4GBXD 3GI9H 2D31B 2MCPL 1B4LA 5IGXH 2ODIA 1KULA 2GIYA 1XGTA 1JPFB 4GQ9H 2DWXA 1RIHL 4UT9A 2C3VA 2ZSVA 5E2VH 3C5JB 3NGBC 1T1XA 2E8YA 3NFPA 4JRXB 4N8VG 1N8ZA 4ABUA 1T7ZA 2GI0A 1JN6A 1BQLL 1J0YA 1JPGB 2DWTA 1JF1A 1HZHL 3FTXA 3ZRFC 5ADOL 1UZ8B 3UPRB 4I48B 4LPTA 4CN1A 1C5DB 4LNRA 4PVLA 3PV7A 1NLDL 3TZVC 3UYPB 4Q9CA 4KMTH 3BAEL 5BCAA 3KXFA 4YIQB 1V7NH 3ZW3A 4HMCA 1KPRA 4OD3L 1S9YA 1YA5A 2PLTA 5ISZE 8PAZA 4AEEA 1B0RB 1DVZA 2O72A 5AG9A 5AOMA 2GK0B 3RVVD 2FWOA 1QBLL 2VTFA 3QH3B 4DP1X 5GZOD 3EJRA 3CVBA 3IN2A 5LNEA 3EJZD 3ATBA 1FNGB 5ILTL 3ZRCC 1HKFA 4AL8C 2YGOA 3FQXA 3CJJA 3N5AA 1RURH 3FO1A 4JHVA 4RSVA 4XMKL 2PWFA 4R7XA 3DX0A 4OF7A 5HHPB 3G5XB 2BW5A 1P4IL 5CUSL 4FFWD 4JDZB 4AGMA 1N0XL 2HT2D 2OMTB 4R4BA 3RLSA 1KFAL 1JYVA 5BO1H 1UTDA 3VJ6B 3KGRA 3RWEB 3X14A 1PD1A 1EK3A 4E42A 1AXSB 3CFJA 1L9TA 1FL3A 1OALA 1B4RA 1T6WA 2HWZL 3F58L 4IOSA 5B4MC 2FZ3B 2K3TA 5JW3H 3BKYH 3RX8A 1UM6L 3K4AA 3KYNB 1PZ5A 3VA2C 2PXYD 1EHLH 4LAQL 3DV6A 3M46A 2Z9TA 5DS2A 2ZPKH 3NK4A 4WLCA 1JXKA 2IVFC 2E56A 1CYXA 5EIQA 4KQ3L 1ZANH 43C9B 2Y7OA 4KNQA 2MSPA 5CCKH 3G5XA 3BZFB 3BZDA 4MB1A 4GPVA 2WQRA 3IT8D 4I2XA 1MRCH 4LZKA 4TUOB 3QUGA 3UBFA 4URTB 2VMFA 2WWKT 4XO5A 4BWWA 5FGCE 1GAFH 4KTGA 4GP4B 4CUCA 1URIA 3TBSB 3FTWA 2JKWA 3V4PL 2EDOA 3KYKH 3MV7E 2YJLA 2OX5B 4YSDA 1NIBA 4UUJB 2PCPB 2TSAA 4P06A 3JTSA 3KEHA 4IS6B 1VADB 3VXSB 3AZUA 4M62H 1TQCB 4P4KB 2P8LB 3EF7A 3PL6B 4Y2NA 4TVPL 4Y4KA 2VABB 4ZUTA 2BP8B 2EDFA 2XIIA 3QEQB 4X9IA 4QO1B 3UABA 3SY0B 1TEFA 5CCHE 1DN0B 3K8KA 2LLGA 1JPTH 4YEEA 1T0NA 3GSNL 4IRSD 3V6OC 4P0DA 5ESVB 5DS1A 3IFOA 4N5UA 1DFXA 3HHMA 3HMXH 4C56E 1ZIBA 1KJVB 5L2KA 5F7NC 1S9KC 2WSDA 1BMGA 5ICYB 4B96A 2P5EA 1F90H 2ZYHA 3ZJAA 4JM2D 3R8QA 4V1DB 3AITA 4JO3H 2CUHA 2HH0H 2NXZC 2HTKC 3MNZB 5FUZH 3NIDB 3HZMB 4KUZH 4KVNH 4OLVL 3EYSH 3WIIH 3HC2A 1I85A 2VDRH 3CX5J 4NKOB 3I2CH 3Q1SL 4Z5RA 3TA3A 2OR9L 3LIZH 3IBEA 4PRPB 5F3BA 4FQ2H 3WLWD 2VDNH 3DJ9A 4N6RA 1AJ7L 1SEBB 3UFIA 4ENEC 4DUVA 4CADB 2P8MB 4F15B 4IW4C 1QUNB 5FWQA 5HYJE 5CLWA 3DDGA 1NAKL 4JPQA 5C0JA 1BYPA 2RCSH 5A16A 4OCYH 4AMWA 1Z3RA 2C8NA 1KGJA 2WCSA 3O4LB 4M5YH 5C08B 4RCAA 2L7UA 4GRWB 3RGVD 4MA8H 3IFPB 1OM9A 3EUUA 4OJYA 1QSZA 4RFOH 3BW9B 1YC8A 3UG5A 3VG0H 7PAZA 1B2WL 3CE1A 4RRPG 1CE1L 5CJXC 3HJ0A 4FTDA 4DOHE 4BZ1A 4F9PC 1GC1L 2YMOA 1NFIB 1NJ9A 4DO4A 1AI1L 3U4AA 2DTSA 2YZ8A 3WS3B 5ITBH 1KZYA 3ZKMD 3GSXA 5DO2D 5F7DB 2Q6WB 1CBVL 3SDXE 2V7HB 2YBRA 3KPSE 4MXVE 3QH3A 2JJVA 1D5BA 4Y9BA 4DETA 4L3EB 3ML8A 5E5MB 2E9JA 4P2OA 2D9QB 4OTXL 1DQJA 3L4VA 1BQ5A 4P4RA 3MLZL 1S7RA 2C7UB 3VSTA 1UGKA 3TPUB 1AJ7H 3BWZA 2PPCA 3BHBA 5JW4Q 2J44A 4B95C 4PV8B 2O1AA 4AK1A 1A3RL 1XZ0A 5GSRB 1Z2KA 1HL5A 1FA4A 1EX0A 1ZY9A 3ARDC 3GMNA 1GHFH 4BE5A 1KCSH 5AD0B 3I02B 4PJBA 3T3MF 1U8NB 1EQWA 3UERA 2NX5B 1PZDA 3AREB 1L3NA 3NOIA 3FU6A 5F0JB 1ID5I 3UZQA 3NGBB 4NQQA 4HS3A 4MDIA 5I6PA 4ANUA 4NQVA 1NBVH 1UM5H 2Q7AA 3L5WA 1F58H 5I15L 3JVGC 2P8PB 2MCAA 1R47A 4UBDC 5HHNA 5IP4A 1DBJL 4OJDH 3KLHD 1JHKH 3MRKB 1RHFA 3ORJA 1TT6A 4AYDC 1JUFA 5FO2A 3JWDH 4S1RH 2WLIB 2FEEI 3FULA 2Q8AH 5B8CC 1FORH 1QFUH 1MHEA 5CMAA 2HG5B 4H44C 5DRZB 5GRUH 4UOZA 1I9EA 4IS6A 2APVA 3BPNC 2MKWA 3DUSB 1OGSA 4W4OC 1DJWA 1FBIL 3DVFA 2XQYG 4DK5A 4HIQA 2J5LC 1J11A 4XO9A 1OT1A 4PJAA 2ZP8A 1RP8A 2C3HA 1DVFA 5F3FA 2E7CA 2NXYB 3HC4H 5IB5A 2ILLA 2QQLL 4JE0A 4PJ8A 5A3ID 4E9RA 3NACH 5DJCB 3O9WD 4NOBA 4F7TB 1F45A 1KCSL 3H3PL 3QEQA 4K3DL 4P5TC 2QTVA 2E4TA 3HE7B 4HK3N 1XGUB 1KB3A 2G2RA 3IE9A 2OCJA 4JEGB 1MEXL 2WLHA 3VI3B 1FN4B 4N85A 5JW4R 2IPTL 4D0DA 3JSSA 3EH2A 4HISA 3FUIA 4FFVD 2DIJA 4JO3L 4ELKB 3GMPB 2AXHA 4TLSA 1U8IB 2ZF8A 3FKUS 3OX8B 1CLOL 5HYSG 3IDNA 2MHAA 3DVNB 4ZX5A 3RZCA 2D0FA 1TTBA 3CVDA 4AKQA 4KQ4L 3B3IA 4B3EA 4B9PA 5HXMA 4PJIB 4LLDA 4LHUD 3LS5L 3PNRB 3CLEH 3OXSA 4RLDA 5J6SA 1WZAA 2L0DA 4HEPA 2D3LA 4RDBA 5F7AA 5D1XE 3L9BA 5F7UA 4PJBF 5EA0H 5ABDE 5HBBA 3OKNB 1SMAA 4LLUA 5JQ6H 2B3IA 3ZDXF 2Y3NA 1HOEA 1YPZB 1T89A 2IPUG 2XWTB 4HK3J 4O4YL 3WFDH 5I75B 3G6DH 1ZLWK 5HYEA 2YN3A 3H9SE 4JFOA 4F5CA 5JR1H 1ORSA 2X9WA 5D93B 1UCBH 3NJFA 4U6HA 4XPAL 1OSPH 4GBXB 3C6SA 3TF4A 1Q8MA 2F7PA 1CDBA 3N50A 2AERT 5LBVA 4GMSH 5E94B 4XP5H 1JZ8A 4UINL 3CXDL 5KSVA 3QG6B 5AB9A 5IW1A 3ULUC 2YR3A 4MB3A 1NKRA 5EULV 1MUJA 5E4EB 1HNFA 5L4MA 3T9WA 4X4MA 4R4ND 5IIEA 4PJBE 1NGWB 1BQHA 1CQYA 1DDHA 4C56D 4XRCA 4S0SD 5EFIA 4OZGE 5KOVC 3UTSE 1YC7A 1OTTC 4W93A 1UB5B 4B7LA 4O02A 3RGVA 2XFXB 3HAEH 4JRLA 3QUKB 1OTTD 3KBEA 4XAWL 3WTWA 4Z0XB 4BDVA 3NBNA 2WO2B 4QRRD 5TK2A 3M07A 1WFJA 3EG9A 1HHHB 3GWJA 5FUZL 4YDKH 1C5DA 4MAYC 1TZGH 3LS5H 3FNKA 3K6SB 4L8DB 2HT3C 4LKCB 2WVTA 1S6NA 4HHWA 1WIPA 4FKHA 2PPEA 1DTUA 1JTOA 2VITB 4JGNA 2NT0A 1RZKH 3D25A 2A77L 1F3JB 4PV9B 5E4AA 1IGCL 1XR9B 3GRWL 3PXJA 4HIEB 1A1NA 4HUCA 5DHXB 1WHPA 3V5HB 4J5VA 4NIYE 5CD3B 2J21A 4JMNA 3CSYA 4PTTB 4W9GC 5GS1A 4WWKC 5I1GH 4OU3A 1RLBA 5IOKA 4JFFB 2G3NA 3H53A 1JRHL 2EILB 3QEHB 3AVEA 5D6CB 3UGUA 2Y1ZA 4AIZA 4F15C 1EAJA 2GCYB 4CC4C 2E7MA 4W68A 1PLCA 5KVEH 5IVZA 4POZC 1KOAA 4BEIA 5DS8B 5E24E 1JTTA 5AYQA 1PZSA 2CLZA 3HZVB 3KW8A 3O3AB 3V0FA 1V5JA 4ADJA 5CMAB 2PXYC 2R7EB 3F6JA 4LK4A 4MA7L 5F7EH 4PJXB 4BFJA 4HAKA 1F00I 5B4MD 4JJOA 3PWPA 1KN2L 4JO4L 1T1YA 4IK7A 2WTRA 4YN3A 4AKOA 4GXUN 4NDMA 4C55A 4NZUH 3M88A 3LEYH 4Y1TA 1ET7A 2ORBL 4OZFG 1CVSC 4DEWA 4TTGA 5JPMC 1J9RA 2YUZA 4PGBA 1G7LA 2WBWB 3HCVA 4HPOH 5FYKE 3MFFA 2VZ1A 4U4IA 3S3DB 2K45A 1W91A 1LJMA 2QL1A 3B6SB 1NFDE 5I17A 2CA4A 2KPWA 2QQLH 5KS9A 4DGUA 3MLPA 5GHWL 4LEOA 3IJYA 3L9RA 4J8RA 2WZAA 4TUOA 4WGVB 1SJHB 4LVHB 9PCYA 1NDGB 3VYNA 4PRBA 4ZUUB 4RAHA 5MHSE 1XBDA 5A2KH 4G82A 1OAQH 4X0KA 2VDMB 4R26L 4NHUB 2AEPL 3FK3A 2DYPA 3G6JE 1J05B 5DMGC 5DQDL 1E27B 2H6UA 4JY6A 4ZXBC 1HH6B 1S9WA 3NZ8A 5JO5A 3SE8L 1M2OA 3JV5A 1T5XA 3KPRE 4HSQA 3AXLA 4AG4H 5LGJB 3BN9D 4J3SA 3LXBA 1I1AB 3QHZL 3VXTA 4ZFFA 4KMLB 2VOTA 2EIEA 4HIXL 4I13B 1U8QB 4KV5E 4PSRA 4N86A 5I74C 4KX7A 1YEGL 3IU3A 3VFGL 3FUMA 4NPKA 1IC4H 3P69A 4ORGA 4KY1H 3TPKA 4NKIH 4TM9A 3TA3C 1GS6X 3B2DC 1NEZG 2EVGA 2UYLA 4UTBH 1JZIA 1OKEA 3AACA 2J7LA 4YXHH 1M53A 4U1HB 3BPNB 4N0YH 3KGSA 4M1DL 5LLIC 4YXKL 3OKKB 4APQC 1EZSA 4G70B 1OB0A 2DQDH 3FCUB 3DHJA 3TVMA 3BWUF 3L54A 5HGDA 4HZLA 1IGYB 4XNUH 4A7TA 5I5MA 3F7YA 1VCBC 4FG2A 4CNIA 5DWUH 5E5UB 3TURA 4WU7A 1KGIA 3AY4A 1H6FA 2EKJA 3N0PB 3PFQA 4PP2A 3MCKB 3NA9H 1BXXA 1TJHH 1MQ8A 5AEAA 4S1QH 2MCPH 4DP5X 5IGXL 1KTLA 3L3GB 2VMEA 5DJ0A 4CJ1A 3BP4B 4IRJD 4XVUC 4U1NB 3V4PH 3FT0A 3VXPB 4AW7A 3D51A 5EIIA 4L9LC 4UIMA 3WKML 3BOVA 2V9RA 3C08H 2PXYA 5J4MA 2CBMA 1AQKH 1WTLA 3QNXA 1ZVSA 1U3HA 4JAMB 4I3GA 4AVJA 2XY1A 3CDZB 1ZT4A 1PKQB 3NT0A 3ULVL 1XH2A 5B39G 3P11H 3ET9F 4DP8X 1KZQA 3U4EB 1SXNA 1V3KA 2AI0L 3HG1D 1NEZA 3WUWB 5A3IC 2VLKD 2G2RB 2GTWB 3QA3B 4QAWA 2JB5L 5IWLC 3L6FA 2I7OA 2AKRA 2OMXA 1HDMB 3NABL 5TF1L 4MZRA 3DX1A 3ZKSD 3S2AA 3DO7A 5C3TA 5HDRA 4OH2A 1NOAA 4WU7B 3CFEA 2BDNH 3IN0A 3ULVF 3RVUC 5TGBA 4HT1H 1INQA 4R9HA 1SUHA 3H9YA 1QLFA 4Y4FA 4MSWA 4WV1C 4OLWH 4O5LL 3BP4A 1OD7A 3I3DA 4QJ3B 1M7XA 2GCYA 3SJVA 1BVNT 4P2QA 2IAAC 4KKQA 3MUY1 1UA6H 3LMJL 1MHHB 5GGTL 2ZSWB 5AZ2H 1ZS8A 2DQTH 5JIPA 4XOCA 3IDGB 4CKQA 2PTUA 1KC5H 3QZNA 4MDJB 3O6LH 2ZKHL 3EUDA 1KIQB 5EU7E 5IW3A 5AAMC 5F1IA 2HG0A 1ZGLB 2X42A 2YD2A 5ECJE 4RIRB 2ZXGA 5D5MA 3JYCA 2XWDA 2FGWL 4WI3A 5FM5M 3VGAB 4IMLB 5KJ4A 3R7QA 5B39A 1PZ5B 5DK2A 4L3AA 4AQ8A 3L3IB 3X2QB 5MEOB 4YDKL 1KJ2L 4XAKE 1JBJA 4E5XB 2X1WL 1R75A 1FQ9C 3WMPA 1MF2L 4OD2B 1DUYA 3HLAB 3IVKB 1OAUL 4LVOB 3LPOA 2VM9A 1VERA 3DETC 2P45B 3O9WC 5GGRA 2NW2A 2TRYA 3B8YA 4JQVC 4W81A 1ZHBA 2BSSB 2NDGA 3K46A 2ZYRA 3MC0A 5C0GB 4M56A 3QUML 1K5WA 2XQ0A 3FZUC 4GKOA 4Y1AE 3M17B 3QJHB 4N2AA 4H88L 4ZW3A 5D6DC 4K7PL 5KANI 3WY3A 1RSYA 5T5NF 2EYSA 1YMMA 4HPYH 3WNJA 5ABAA 1OPGH 2ZIDA 3D85A 3QZWB 5I1CH 1DJHA 3GJFH 4XNMB 3SKNB 2F19L 2Z92A 3WU1A 4XNMA 4EZLA 5HYJA 2AQ2A 5C7XL 3WO3B 2L3BA 3TCLA 5CEZL 1LDPL 4WY7L 3S2CA 3VGGA 3BT0A 4HF5L 4JRWA 1NGPH 1N5AA 1RZPA 5CLTA 1MHPL 2H45A 2NW2B 4GQPH 3D18A 5TH2B 3S0PA 1QFWH 2GBUA 4TF4A 1MCNA 2A9DA 5ELIA 3MRCB 2Q10A 3QWRD 1FPTL 3Q9QA 4AVKA 2XNAB 5B22A 1IGJA 4QOKA 4C4KO 4PRIA 3IAQA 2EDHA 4BA0A 2VC2H 5BW7A 1ES0B 4UU9A 3L3OB 5CJQL 1N12A 3MJ8A 1IQWL 4FA7B 1DCEA 3WGVB 2Q5BA 1S7TA 3OLEA 5D7SL 5IWLA 3MCG1 1QA9B 3T3PB 2VXSH 3LS4L 3MNZA 2YWYA 3EHBD 3HBGA 1ASOA 1T1YB 4XPFL 4XMWA 2HVBA 4U3SB 1R5WB 4G1EA 4JKLA 2UZYB 4UI2A 4WNQA 2PWHA 5DT1H 3IKKA 3V8OA 1MREH 5KSAB 4UM9D 5ANHA 1AKJA 4PUBL 2IG2L 2VABA 3ZLQC 1NCCL 8FABB 1PLBA 1DSWA 1MLBB 4MMXB 3SJVE 4Y88A 5GSVB 6PAZA 2ADFH 1DVSA 3L9EA 3FUJA 4LVNC 2F7RA 5F1OB 1HVXA 4FC3E 3MRCA 4P9HL 4WWID 3LH2L 3IF1B 5IEKB 3IJ8A 1A14L 4PJCA 5T3ZH 3VXRA 1NBZB 4HUWB 5IJVB 1S9VA 3VG9C 1LEIB 1QTPA 5E1AA 3QCTH 2WXPA 2YPVH 4HKZB 4B9FA 1EDYA 3VRIB 5I74B 1GOGA 1SOKA 4R3SA 3T4YB 2P43B 1ZLUH 1AE6L 2AJUH 2ZONA 2Q3ZA 1ETZB 1YN7B 5E56A 5D2NE 4BKLA 3N43F 1ZE3H 5JLZA 2J2ZA 5BQDA 5FO8B 2CCWA 3GXIA 5D7SH 4PRPD 4Z7VB 1WUNT 1IC5H 4MDIB 2APXA 1VGKB 5IHZA 5LN4A 4FFZL 3UYRL 1X4XA 3EOBA 3N6YA 4G8GA 3TS8A 4O02B 4QHMA 3N1PC 3D69B 4P2CG 4JKKA 3FTYA 5C6PB 3FL7A 3H9SA 4F5CE 3MJ9L 4NKMB 2EDDA 2JELL 1BZEA 4FE9A 4HGWB 4ZNEE 5DCCA 2K70A 3ZDYB 1MVFA 4RGMC 4FXGC 1XZ0B 4PQXA 3HI5H 2BS71 4POZD 5FPIA 1S5IH 3F6LA 4IU3A 1CFQA 1LL1A 2E86A 4RNRA 5DMKA 1ECZA 1NGZB 2PTTA 3S4SA 2ZX9A 2ITDB 4GNKB 5F8QC 1FNSL 3RWIB 4H8HA 2Z1PA 3RWIA 5IG7B 1ZHBB 2BSSA 4NT6A 4NC1C 4JFVA 3RGBA 3SGJC 1RUML 4U1HA 4U0RC 5DGQA 1FV1A 4OZIA 5CFAA 1ZPUA 1KV7A 1CFVL 3HLAA 2V7HA 2YBRB 3CHOA 2G2PA 4X9HA 2E7LA 2NCEA 4R90H 4XOAA 5FYJL 2WB7A 4D94A 1YQ2A 5GS0D 4ZFQA 2BS9A 2BSRA 3W9EA 3TESA 4HG4J 1UYWH 2CMRH 2UXVA 3WG7B 5C0BB 1E50A 1MW2A 2AQPA 4NNXB 1M05B 1NPNA 1OTSC 4M4RB 4XP9L 4XMZA 3WFZA 3OG4B 4PCTA 4ZTPL 3NCBB 3M7FB 4HWEL 4LKXA 3VXTB 1ID2A 2NCMA 2R69H 2PWEA 4NQDD 4Y5VB 3TNMA 3W39B 5BRZB 1UWGL 3FQYA 5B38A 1YY8A 4XN7A 1WP6A 4X98A 5G4OA 1JXGA 5HDWA 4M6NL 4ZX3A 3V4LA 1BXUA 3BVXA 2G75B 4J3OH 5BV7H 1EHKB 1SJHA 3W57A 1DVFB 2V5TA 3HHRB 2NNXA 5CJ5A 1IAOB 5KG9A 4MJ6A 1TZAA 1MCSA 1KC5L 1Z1WA 3AXIA 4KI5E 3LPPA 5CN3A 1NWPA 3PHQB 1P7KB 1CLVA 1N18A 3IGUA 3QFDA 1AH1A 2VH5L 5DK3A 4PGDA 4RGNE 3DMMA 5JNYB 2FCBA 2WBKA 3AWGA 4QLWA 1MCBA 3QHFL 4FG6D 4GG6E 4RH4A 2PCXA 3G9AB 2Y4SA 1Y6MR 1FFQA 1D3CA 3HUJF 3CU7A 4K9EC 4U3XA 4GXVH 4U3SA 4AZ8A 1UWXK 3VFSA 5HI5D 3VFRA 1IGIH 3VMNA 2H2SD 1YAIA 3MKKA 1X5HA 1WD8A 5E2JA 2XOTA 4FL4B 4PGCB 4PY8J 5AVXB 2BXZA 5DJYA 4J3WA 3O6LL 1A6UH 2COVD 3T4AC 5DZLA 3V4PB 2W9EL 3QDME 2IWKA 4XNYL 1A47A 4BBWA 2GG1A 1GGCL 3B9AA 1CI5A 1WWAX 5JHLL 4TVPH 4RZCB 4DZBA 5BUPA 2JE8A 2VH5H 2R0WL 3FT4A 5SV3A 1T83A 5C71A 1SYVB 1XCTA 4Z78B 1SMOA 4H1LG 3FYIB 1QSFA 1BEXA 2WXGA 2GIXA 3NSYA 4P4KC 3UC2A 2OZNA 2LFGA 4CSZA 4EO5A 5IFHL 3QUXA 1E9QB 2Y06H 3FZUD 4FNLH 4LLYA 2JNZA 5IHUL 5TQ0H 5EEWA 2TRHA 4G3YL 2C4FU 2XQBL 3SGKC 3BDYL 1XGPA 2NYZA 1JNNH 2DJUA 3QJHA 3QQ4B 4Z7QB 5AB0A 3CG8A 3ZZ1A 3KCPA 1Q9OB 4HUXB 2NNAB 4CL7A 3KCPB 4F80A 5EIIG 4FQCL 3N85H 1KIQA 1N5AB 4JDTL 2XWBA 5D1QD 4AW4A 3UJJL 4KKLD 1NTDA 4GQRA 5MERA 1CFQB 2F54E 1IAII 1TTFA 3F7PC 5FGSA 3X3GL 1RKRA 1YO4A 3L3IA 4KFZC 1FLTX 2F1EA 2Q7YB 5E7FA 4OY9A 3QZLA 1BD2D 1NDMA 1CGXA 1VACB 1TFHA 2CJUH 4EDWL 4BD4A 5K9QI 3VD0A 2DLIA 2FX7L 2H47C 5ID0B 1JZFA 1INDH 2FECI 4GFXA 5DD0L 5KJRH 4NO2A 3EGSB 2VN4A 4APQD 5HHPA 3MLXL 3BRDA 3CSGA 5LCVH 2X2HA 2VXSL 1CTOA 7PCYA 3TBYB 3O3EB 4UZUA 4BXSV 1FSKB 2Z4QA 4LVNB 1RVFH 3US9A 4K3EH 4JFZL 4FNLL 3FSAA 3QUHA 2W92A 3ISWA 1RCYA 1JD9A 4Z7NE 4G11A 3EDDA 1UKQA 3LKNB 4QRRB 4AWJC 1BM7A 3B2PA 4I7ZC 4AV5A 3G5ZA 1YYCA 3OC5A 4FQ1H 4MNHB 1NCCH 3HPLA 1EMTH 4ZZKA 5F1KC 2CO7A 3NJNA 3DX2A 1GPOL 2RQEA 5BQ7B 2QGCA 4FHBD 4PLJD 1YNLL 4HLEA 2OA9A 2WLNA 3T1FA 3IF1A 4WF7A 5IEKA 5JYLA 4XCNA 4DO5A 1IGTA 4D3CH 2NZIA 2X38A 2OV0A 3O8XC 5DC0A 1MLBA 1KEGH 2PYFB 4PVMA 5CEZH 1BVLA 4M6OH 4O4YH 5GGSA 2NW3B 5BJTB 4GYBA 5GGSB 4WO4D 5K1NA 4NEHB 1RK0A 3VXRB 1GS8A 4W6WB 2B1AL 4BHUA 1MFEH 5D7LD 3ZQWA 1CDCA 1S2EA 3TLRA 3FCTA 5IMLB 1E6JL 2OJEB 3RURA 3FO2A 4JFEE 2X4NB 3SDCC 5ACLA 4MMXC 4HUVB 3BZFA 2WIIB 2ZWLT 4OSUH 3IKCA 4RA3A 4KZDL 1TJXA 4R4FH 1KMGA 1BDYA 2F8VA 2XV2A 4JO1L 5FXCH 2RHEA 2E74C 4JY4A 4NC0B 3LIZL 5KSAA 1LDPH 3VG9B 3F7YB 1VRSA 1NCHA 5B1JA 5DJAB 3HJEA 3M1CA 3HG1A 1PU0A 4CU7A 3OMIB 2V5YA 4U0RB 4Y16C 4AY0A 1DVTA 1UJTA 5EPMB 4X6CB 2HTKD 5FUOL 1UEYA 2VNCA 2A77H 1RLWA 2CKBL 2D0GA 1DVQA 3NCXA 3KLKA 5E5RB 5L88H 2MH4A 3EXJA 3F2LA 3I6KB 1AC0A 4FZEH 5F0LB 5FYKU 5SWSA 4EN2A 1ES0A 4UU9B 3BPLB 1X9QA 3LQMA 4RFEB 4LSDA 4ZZFA 1VKXA 4P57A 3P2DA 5ICUA 2A4ZA 3KCWA 2AK4E 1K5NA 1BAFL 4JM0A 4NZ8A 4RNRB 5SWZA 5DMKB 4CU6A 5FM4A 3CFDA 2VAAA 3LX9A 1EA9C 5INDB 3ISRA 1NAMH 1QRNB 3FU9A 3GUTA 3AREA 1KPUA 1MLCB 1VSCA 3K6FA 3SYPA 2HFGH 3W38A 2DBLH 5JPNA 3FQUB 2VMCA 4FQHA 1ACXA 1DEEB 2ZCHL 1VA9A 4HZLB 4RGMB 3T8XB 1ZHLA 1GW6A 1WDAA 3DPBA 3SO3B 1LE9B 2NXYC 3EJYD 5F96L 5HJBA 5KYUB 4NWUL 5T1KD 1WCBA 3MCYA 4CVWA 3D39E 5DUBB 2XN9A 2ZUWA 1KXTB 2XG5B 3CH8A 4PJ8D 1CGYA 1IFHH 4A7QA 1HXMA 4Z3HA 4XB3A 3LN5A 3ZKMC 5CZKA 2AJZB 4LHJB 5I73B 5KYWA 1N0LA 4MAUH 5C70A 4ZMZA 2NNAA 5HVHB 4HKZA 5IM7A 3LEYL 1LWHA 4CSSA 1ZXQA 4XBPA 5AKTA 3WNNA 2JKIS 5EDSA 3MFGB 4PJCB 4Q4EA 2R1XA 1O6VA 3PABB 1F90L 3WHXA 3GJEA 4TUJA 1TMCB 1D5IL 2CPCA 3SQBB 2N3JA 5A7EA 5BUAA 4PJAF 2UV3A 3QAQA 5AKSA 5T1DL 5DRNA 2ADIB 1QO3B 3FF8A 4U1KA 4JZJA 1N6QH 4PJ9C 4ODTH 5BVJA 4JJ5B 1RQ5A 4HUUA 1JZ2A 4MBOA 4PGCA 4HUUB 3QUZB 4WU5A 3DX9A 1OV8A 3GSWB 4QY8A 4FFWC 2VJ8A 4K71B 2EDQA 2EXYD 3EGXB 4PRAB 1B6UA 2VW4A 1PPIA 3KEDA 3S35X 2J8UB 4NENB 4EUPB 2HX7A 2UVEA 5FECA 1KYOK 1JDAA 3QIWB 3H7BB 4KTDL 2VDOL 4PJ5A 4NKIL 5AVTB 2V6HA 4PJ5B 3VH8B 4IM8A 2LAGB 4TRPL 5CZVL 4PBVC 1TZIB 5SWQA 4WWNA 1P2CA 3U6XS 1EO5A 1GZPA 3LRMA 1FLRL 3CHSA 2NDFA 3QXTA 5EOQH 5HJGA 3RL2B 2OKMA 1O7VA 3ZDZE 1ACYL 1PLGH 5J06A 4KMTL 3REWB 5AB1A 2F6AA 3HZYA 3SBWA 2WOBA 3ZSTA 3B9DA 3NQKA 4C4BA 3VXUB 2VMDA 3AG2B 5LDUA 2F5BL 4OGYL 1H3TA 3K1DA 4PYGA 2WP3T 1NUFA 5TQ0L 1MRFH 2PCFA 1V54B 1FIGH 1OIOA 3IYLW 5C07E 3ALXA 4PLKD 5GGQL 3EO9L 4HUNB 1MG3C 4RAUB 3T6XA 2W5PA 3KPMA 1DL7H 4B9GA 1E67A 4E2OA 1F11B 3UAJA 3OR6B 4WK2B 1YMMB 3L48A 5EU6E 3SKNA 3TFBA 2G75A 3HZ3A 3QRGH 2FGZA 2PCPA 3QUKA 4EN3A 2VXQL 3MROB 3KPRA 4N20A 1N0XH 3K2UH 1RK1B 4IOIA 4UTCA 4F7PB 1MCKA 5D7IB 3CLWA 3CCHA 2JIXB 3ULSA 4N2GA 3GSVA 4GSDH 4S0TD 3Q13A 4JM2B 5DJDA 3HNVH 2XA3A 4G8EB 3SDDB 2HUHA 4LSQH 5ANME 1EAPB 1IFGA 2HT4C 3V8CA 5IB2B 3PQYE 1NCWH 3B1TA 4WGKA 4J7RA 4EOWL 2H32H 3HRZA 2XX1A 1WG3A 4GSRA 1OT2A 5H2BB 1HC1A 3DJSA 4NQXB 4WW2C 1YECH 4M5YL 4N1HB 3GMPA 2R69A 2DI9A 1ILSA 2GHWB 4IIQC 4P2YA 4HZAA 4KJYB 4R97B 5HHOE 1BHGA 4FXKC 4JUTA 2UZPA 2X70B 4JN2B 2JLLA 3ASOB 4OLYL 5A2CA 1DDHB 2Y36L 1AHWC 1RVFL 4EBQL 4XN2A 3NH7H 4MQTB 3SE9H 5JIDA 3QE5A 1LO4H 2VT0A 1EEZA 3WE6B 4NQED 3PLYA 1CO1A 2IDTA 1QRNA 4YZFE 1PYWB 2WV3A 1MQKL 1WISA 1PMYA 4G9FB 3ASNB 1DUZB 4FYRA 4HVBA 3FQWA 2WYIA 1FL5A 3GSNB 3BSZL 4JFED 1EEQA 4PJEB 1MNUH 5E4OA 2IGTA 5DJYB 4JLRB 1CDJA 2J71A 2DW5A 2PW1A 1YPZA 1XF2B 3D69A 1FSKC 1SJEA 2NW3A 5BJTA 2AJ3B 3ARUA 1FC2D 3BFQG 4KDTA 4KJWD 4A6YL 1ZLDA 4NO3A 1RJLA 4LLMA 4I48A 4JFDD 3F8UB 1BAGA 4HJIA 2Z1KA 2ATAA 1F4HA 2ZG1A 2VLRB 1EFXD 3ME0B 4ADIA 2AV7A 4UQ2B 4UNTA 4HOXA 5AVRB 3PWLA 3MRPB 5SWSD 2WIIA 1XGQA 2XQBH 3WENA 5EF3A 5IUSA 5DHDA 3WEXB 5LVEA 1M7DB 2LVEA 5EN3A 4RMRA 3MO1A 4LF3B 3LH9A 4NQDA 3ILEA 3MBEB 1AG6A 4JG0H 1N6QL 4XNDA 2EDJA 1WBZB 4GEJA 1OPGL 1P5VA 3UEQA 3HUJE 3L2LA 1GGIH 1UD2A 3BJ91 5CJOL 5KAQG 4TVSa 3ARED 2ZXAA 5ECGA 3RU8L 3K6NA 1R0AH 2P8PA 1IC1A 5I28A 3ULUE 1FVEA 2KLRA 3UEZA 4H88H 1EO8L 5A7BA 3HI1A 1KTDB 3WIAA 4J4PD 3RWCB 2WLIA 2QZQA 4LOUC 3N40P 1J18A 2IV8A 2R0KL 3QXDB 4XCNB 4X6CF 1OQXA 2BIHA 1AIFB 3BZ4B 4PM1A 2FECL 2R0LH 3FQTB 3V6FB 3I2CL 5J6HA 5D6CA 4AIZB 3JWDL 4LCUB 4Z76B 1KWKA 1N6VA 3DYOA 4XT1C 1KLFB 3FF7A 4WUKL 4DVBA 1OVZA 1QFHA 5EUOA 4ZFZB 4LCVA 5SX5H 2JI3A 1NUNB 4URKA 2EEDA 5IQ7H 1J9TA 4Y16B 3WEOA 5AW7B 1RHHB 2W80C 3TIEB 2OMYB 3DROA 3FRPB 4PJGB 5DD1L 4PS3A 4WFHE 3O8XA 3VAEA 2F8XC 4EEEA 2AXJA 2EXTA 2PUQT 5DGRA 3HC3H 5SWSE 3BMWA 1P6FA 2DV6A 3V0GA 1D6VL 2QSQA 3L1OH 3WLBA 2D7PA 4O5LH 5FDWA 2GJPA 2LLLA 1AP2B 4EI5C 2VJ0A 5D1XA 3EJJX 1Z5LB 4PJ8C 3WDHA 4WUUE 1I3RA 1HCZA 5C3IA 3QJXA 2DM3A 4NZJA 4H0IA 4KTEL 3OR6A 2HJFA 5KS9B 3TWYA 4WIQA 1ZWIA 5LAXA 4DP6X 2R2EB 4PPTA 4HX1B 2J4WH 3WKYA 1S7QB 5FKAB 5F97E 2B1AH 3QUZC 4FQPA 5DMJB 4YHYB 1CPUA 4ZFZA 4OFYA 1EXUB 2G3XA 1D2PA 3K81A 5J7CC 2VDQL 3RIAF 1TQVA 2HFTA 3BP5B 4N1EA 3HG3A 1A25A 3IS1X 4N2LA 5D70H 5K39A 2AITA 2GYSA 3QJOA 3THMH 3OKOB 3OZ9H 4QRBA 1R5IB 2NY0B 4NGHH 1LNUB 4FMKA 1L6ZA 1QW8A 2YD7A 4HFWB 1E3XA 2IPUK 2JK5A 4UBDD 5I6XB 3VGAC 1SOXA 2R1YA 1GTNA 5CO1A 4YSEA 3DSNA 2DEYX 3FQRB 3BCDA 3P4NB 1TETL 4WFHD 1RJYA 4G7VL 3SBWC 3OV6A 1CIUA 3DIVA 2PYED 5EEVA 4Y16D 4APXB 5E8PA 5DZPA 4GXUM 3KR3H 4HC1L 1AO7A 1MNUL 3UO8B 3QUMA 2Y69B 5FYKD 1WLHA 5EEXA 4LCIH 4X6CA 4ZUWA 4LVEA 1MXGA 3Q2CA 5F6IB 3H7BA 1AMXA 4MMZC 3ULVH 2GSGB 1MI5D 2DQIH 3D0LA 4G6JH 4WDIA 5HTSA 2DB8A 1F42A 5CSBA 1MCOH 1QFWI 4AL8H 2GTWA 3QA3A 3PHOB 2H3XC 2XVBA 1FYTE 3LXAA 1I8UA 4HJJH 2MJWA 3MJ9A 4RESB 2DM7A 3KLDA 4F2ME 5JNYA 4LHUG 1MCPH 1RIHH 1XCQA 4FOMA 4I5BA 5EO9A 4UM9A 1JGLH 3WD5L 1U9KA 5IJDC 3WEXA 4GIAA 3HAEA 4JHUA 3PAZA 1MCDA 3QO0B 1XL6A 4UNVA 3RX5A 5DRNB 3RVVC 4HP5A 1J88A 1U3HD 6CGTA 5AZUA 2DJSA 4G6KL 2VLRA 5D1QC 3EXLA 2Z0UA 3ARPA 1KPVB 3TO4A 4KZEL 2VISA 5CHNB 3SDAA 3OKYA 1X6NA 4ZTPH 5F88A 5IJCC 1OEZW 3OAUL 25C8H 3O6FC 4XBMA 4YFLI 4JFXA 5EN2A 5B3JE 3MLZH 2PO6B 3SKUD 3QIUB 5D4QA 4PN6A 3CLEL 1AHWA 5I8KL 3L9YA 3T0ED 4HS6B 5I18L 1NL0L 3OAWA 1UJ3A 3M8OL 2DRUA 4CC4A 2WXQA 2BY2A 2H26B 3WD5H 4DPAX 1WEJL 3HI6L 1MHCB 4IRZH 4X6DA 1H5BB 1MW0A 1J0ZA 3L5JA 5D2LF 1QWHA 4IKKA 4LO9A 1XL4A 3K4DA 4X7DC 5J3HD 2ZD0A 1CF8H 3KBPA 5KTEL 3VFVB 1AGDA 2MTPA 4FLOA 3VFVA 3S36H 1FNLA 3VXME 3MXVH 4N0UE 2WNGA 3ZDWA 2WBJB 1HZLA 2B3RA 2BOBB 3KWWB 5IQ9A 4ZG1A 1BFTA 2BFVL 4I2XB 5E6ID 2X41A 2M8XA 5JIIA 4N3UA 1L9SA 2E27H 4RWHA 1WFIA 3FAXA 2CHXA 5FUCE 12E8L 2AEQL 3JWNG 1HSAA 1NUGA 4MJID 4R8WL 3X1EA 3IXAB 4WAFA 2A1WL 4UT6H 1IKOP 3AS0A 4EZMA 3HFMH 3ARFD 4NO0D 3MHZA 1C5BL 4M6AA 2DYPB 5CSGA 4R97C 1Q9WA 3U1QA 1QI5A 2F5AH 2ZSWA 3CFCL 4K3GA 4F7PA 1V3JA 4QXVA 4YHKL 1HH6A 1KFAH 1S9WB 3B3BA 3RDTD 3BO8A 1NGXB 3H3BC 4HF5H 5DF0A 1IL1B 2J8HA 3WIFB 4F58H 4L48A 4FNRA 2QMJA 4BH7B 1YN6B 1PFCA 3QAZC 4MJIB 4KITB 1HQRA 1M56B 5IB5B 1RK0B 2VLJD 4F7CB 2R23A 2JFCA 3BUQA 1U41A 3NK3A 4PJCF 2DQUH 3BVNA 4WI2A 3KWVA 2WMPA 1M7IB 1O9ZA 3A6CH 5B8CA 3D48R 2A73B 4HS8L 4JREB 2DIBA 1RFDL 1FHNA 4LP4A 3HZMA 3I6LE 2AANA 3MN8A 1AR1B 3AWEA 3QQ9C 1N3NA 1XH0A 1KGCD 2GY5A 3IXTB 5JYMA 2DQDL 2BP0B 2X0UA 2BZ7A 2BVPA 4NRZB 4P3DA 3FTSA 3ULVE 1FH2A 2CO7B 1A6ZB 2OMUB 2R4SL 1I1FA 1OB1A 5KSUB 3Q43A 4LSTH 4NUQA 2JCWA 3R0MA 1JWUA 2VN5A 1USZA 1JNHB 1ASQA 1EGJA 3GKWL 4PW4A 1YY9D 3SDYL 3S37L 4HJ1A 4LCWB 4S0HA 2H6PA 4XVSH 3TVMC 1DSFL 3LKRB 3VD4A 3AS3A 4GW5A 4LCWA 1FFNB 1XGYL 2BP8A 2C3VB 1TSRA 1XAUA 1XR8B 5ESQA 1VFAA 1MCOL 4AL8L 4TSBL 4O02H 4EI5A 1HU8A 3HUJA 1ZLEA 1CTNA 4OFPA 3LZFL 4WTQA 4PG9B 4LSUL 3H4HA 4RDQF 1EWHA 3HE6A 4TNVF 1JYNA 2Y5TB 1U8NA 4AEIL 2B0SL 3L4XA 1HAWA 2XNAA 4L3CA 4R2GB 4YH6A 1ZK9A 2E47A 3V95A 1XXFC 2XTJE 3ES6B 1G9MC 3IXTA 3GHBL 3PWJA 2Z7ZA 3V4VB 1OB1B 3V7MA 4Y4HB 2HJLB 2QJDA 3BKYL 1L6XA 2UVFA 5C9KA 2DPKA 2W9DH 1VESA 3EG9B 4JHWL 4RSYA 2OXHB 4O58L 3VXMA 2VDLH 1JGUL 5J89A 4YMPA 4ZUSB 2ESVE 4KZCA 4L8DA 1ZVHA 2UZXA 2XN9B 3BAXA 4AOFA 1WCBB 1Z7JA 1CDGA 4NNXA 4WI4A 1AGFA 4OZHF 1N59A 1TJGH 3LN5B 3V52L 4JPKH 4QRPD 3EO0B 2JKSA 2AV1B 1MRCL 3GHPA 3EGDB 4B60A 1JZGA 1IILE 2HSIA 4AJWA 5B38B 3ARVA 4JHAH 2NRDA 4WTZG 4XXCC 2WC7A 3TBVB 4IHOB 1ZWIB 3UP1A 3LNHA 3EFFA 5J11C 5IM7B 3DJZA 4FEMA 2WQWA 1NJ9B 4K7FB 4KKRA 4XAKD 5AVSB 3RKDD 3STZB 1IFHL 3MRGA 3X14B 1JYXA 2DMBA 4AMXA 4Y8AA 1OO2A 4ZFOL 3IFPA 3O6KL 2Y7LA 4KV5F 5GJTL 3UIZA 2CRYA 5K9OB 3WFBH 1DBAL 1IC7H 2IMMA 4FLHA 1INEH 2CUIA 1IZKA 2YAQA 3T4AB 4HIIA 4RRPA 5A43C 5JPNB 1HAUA 3EJSA 2FZ3A 1V05A 2EAEA 2YEZA 3RE0A 3C09C 3QXWA 2HJLA 4YDLB 1ZLVK 5I6LA 3TJHC 3MV8D 3VGEA 2WLLB 3UYOD 2AEIT 3ARBC 5E9DB 1PDKB 5GGUA 1ZXKA 4XNUL 5L2KE 5F0PB 3OXRB 5CGTA 4ZTOH 3P73A 1RUPL 1BQLH 2BOBA 1GYVA 3KWWA 4YHYC 2I24N 2WQAA 4M1DH 2FX9L 4YGVB 1T22B 1KXQE 1U42A 3IK2A 1FO0L 2KT6A 1L0XA 3CX5K 3F83A 2CUAA 2G60H 1UC6A 2BHUA 5E03A 1HHKA 1LVEA 1F4YH 3H8NA 1QBLH 1W0VB 5I6XC 4KK6C 1UACL 5KBLA 2ENQA 2H9GA 3BVUA 1MWOA 3LZRA 2I9TB 5FV2A 3CBKB 3HG1E 5HDQL 5HHXH 2G5UA 1TSHA 5D96C 5E2UL 5C2UB 4U05A 2K9FB 2VR6A 3ZYZA 4BQCA 4QOKE 1QFWL 3HI5L 4N2CA 4C58B 4D0BA 5BS0E 1MFBL 4JO8A 4QRPE 4Z18A 4FNUA 2A9BA 3L1OL 5E1GA 3TWCL 3OGCA 4CMHC 1OAQL 3HAEB 4FQJH 4QIRA 3W1ZA 3T2PA 2YFOA 3UBXB 2CNYA 4NUMA 2AAVA 2WMPB 1MW1A 2BMKB 3LKPB 4OCSL 4OLUH 1WAAE 4LCYB 2NXZB 5CHNA 1T4KB 1KTBA 2EXWC 5DEFB 1TYRA 1F41A 5IB3A 1TEGA 3ZL1A 4WUUA 3VXRD 1CD0A 2EC8A 5GGTH 5IBLC 3EYOB 1FRGL 4H40A 2ZAGA 4XN5A 1QACA 1SN0A 5T5FH 3DGCR 3GLZA 3TTSA 3OKLB 4OBSA 3ZDYF 2XG4B 4PIRF 1DLFL 3M86A 4IBWA 3T0AA 4ZQKA 4YPGB 1U8KA 5K5YA 5IKCA 1CN4A 3BKML 2JH2A 2P42B 3GBNL 4O02L 3L5XH 1RZGB 5JDSB 3GSOA 5D2LB 1ROWA 1JF6A 4LPWA 5I82A 4ABWA 4ZQTA 3RWFA 1O7SA 3IDJB 4ELMF 3WS6A 5EBMB 5ANMA 2LHAA 4EQ2A 2Y2WA 1BOYA 2OMBA 3DSNB 5EORH 3LQAC 3EGSA 3TEZA 2LU7A 4OF8A 2BIPA 4FX5A 5IQ9B 4TV3A 1JHTB 4YHMH 5I71B 1FG9C 2IPTH 1G9HA 3FUKA 5ISZA 2Z4QB 4KKBD 5LG1A 2Z92B 1DVFD 3W3BA 5DD0H 4HUXA 3P4OA 1KY6A 5FHAL 3VM7A 4XHJC 2A6DB 2YAFA 3EYFB 4R7NA 3GB7A 3NH7L 3SE9L 3CCHB 5DHVA 4HMEA 5I1KL 4JQVA 4NP4L 1D5BB 3APMA 1E30A 2WYZA 2FJHA 4P2QE 3K74B 3G6AA 3EAKA 1N4XL 2ATPB 4Z3IA 3STZA 2GK0A 1SVBA 2Q7YA 3FN0L 1JPGA 3HKZA 3LIZA 1F97A 4TNWK 5HYFA 2VAJA 2ICCA 4R5TA 4RMVA 4G71B 3E8VA 5GIRA 4HJEA 3ARDB 2XYBA 1SYVA 1XCTB 3LQZA 1AKPA 3FFOA 4BFEA 3PGCB 1ACZA 3QHFH 4OZIE 4NQSA 3SDAB 2ENSA 3IJYB 1FFPA 4J8RB 2A6KB 1H8OA 2KKQA 5DZJA 4QRAA 3QZBA 5DHMC 2B14A 4L9LA 4MBRA 1KIPB 3U6RA 3B5TA 5C2BL 1EERB 3VFPA 2J88H 3DX7A 5CBEB 4H13C 1E7UA 3GMLA 4L0PB 4OJEH 3WLWC 4F9PA 3WTUA 3CFKA 4L4VB 4EVNA 1RU9H 2DQ6A 2BOLA 5DHYA 2JCCE 2E6JA 2HTLD 2XPZA 4JHWH 4ONFH 2H6PB 2J6EL 3NRQA 4XXDA 5CP7B 1KWGA 1C8QA 1G43A 4MVBD 4WWOA 1T21A 5DJAA 5ITFB 4FABH 4ZMTA 2AJYL 3L3KB 5F3HA 2X3BA 1M3IA 1AR1C 1A1NB 1PY4A 2P80A 1JZ6A 3RTLA 3WFHA 3AQXA 1T20B 4IK6A 4GW5B 1ITCA 1F3DH 3VGFA 2ARJB 4WHYH 2KS0A 2R23B 1SBBA 4JG1H 4UB0L 2F54D 4Y5YB 2HLFD 4L9LB 2PR9A 2HKFH 1L7TL 2IWFA 3IMVA 4KTYA 3S5ZA 4OIAA 4O2FA 4HYTB 3FHQA 1IAOA 4XWGH 1MIML 4LF3A 4NQDB 5KG9B 1HJBC 3MBED 1EZLA 2IAMD 1Y6KR 3HE7C 1W72L 1KIPA 1UCTA 3U6RB 4M43H 4ANXA 3PHQA 1AO7D 2V0AA 4YDVB 1A7PH 3KXFE 3BP5A 3NPSB 5FEBA 5BS0D 1Q9WB 3ZXAC 2GUOB 4XTRC 3B7UX 4M48L 4GQQA 1QPXA 2MMXA 2BX5A 3DX6B 4WHDA 3ARSA 4GINA 2OI9B 4Z7QF 1IAKA 5CGBA 4K94C 2CQVA 1KLGB 3WTTA 4N8VB 4OT1L 3FYEB 3N44F 4LBEB 5KSBE 1IC0A 1P6WA 3T3ME 1LE5B 3CFUA 5BOZG 1HQRB 4K3JH 4V11A 4WTZA 4MRBA 5LAXB 1ZJAA 2W07B 3ZX1A 2EEBA 4XNQB 4LNVA 1ZCRA 4JO2L 1G1OA 4WV1B 2VZOA 1JPSL 4HXBH 1MFVA 1BVZA 2WLMA 4NFCA 3S5LG 3VWJC 1SOSA 4NT6B 3JWOH 2YS4A 3BP7A 4GBXC 2HLAA 3VXOA 3GUTB 1KCVL 3QRFM 4F7CA 1CIDA 3RIKA 2JB6B 4UQ3A 3QIWC 4LSSH 2CGYA 4NCC1 3T4AA 4R0LB 3TJHD 1FNEA 3EBHA 2WXLA 3P73B 5HDBE 4F24A 2OZ4H 2R29L 3T6VA 4YEFA 2Z91B 2DMGA 1GH7A 5FDWB 4BK5C 4Z7OF 2W0PA 2X4QA 3W81A 2CKNA 5D5MF 4G7VH 4M93C 5D96B 4DF9A 3WNOA 1TZOA 3EO1B 5EUKA 3S37H 2W9DL 1M57B 5JO5B 1DQQB 3DURB 5TDNB 4UQEA 3GIVA 3U48A 3S88L 3BQUB 3CD4A 4YL9A 3F64A 3NFNB 4MAYB 4LSUH 5BMFL 4G3YH 5DK0B 3ESMA 3IU4L 2F08A 4QOKD 3DOSA 2OZ4A 4X7SL 3V4VA 1HDMA 1F56A 4BKLB 1R3JA 4G6FD 4N0UA 2CKBH 3NEXA 2VE6B 5JXAH 5EEZA 3HC0A 2MNWA 1J1XL 1CXFA 1JGUH 4D0BB 2BIQA 3QO0A 4WNSA 4EN3D 3WTVA 3I74A 3IB4A 3L5XL 3T0EC 1LK2B 3QS3A 4Y4HA 2ENJA 5JR1L 4APXA 1YLBB 2PNDA 3L1GA 4BGLA 1SQ2N 2R1WB 2UY6A 5T3XH 1BIIB 3C5JA 2PO6A 1BQSA 3FU5A 5DJ0B 4JFXB 4GT7A 3GQFA 1UM6H 2R15A 4JFUA 5HGAA 3X12B 2MOVA 3BMVA 3RAJL 3CV5A 1PKQA 4XC3H 1S9XA 3FT3B 2OR8A 2CAKA 5I1CL 5G4MA 4CMHB 4H26A 2XZAL 1R6VA 2V7NA 4U6VL 3DO4A 1P4BL 3QJSB 5FYJU 4DNLA 4X8CA 1DBAH 4KI5F 2VSMB 2ISDA 1BJ1H 1MDTA 3HHSA 5AENA 1QSEE 3SKOB 2XSKA 3GSRB 2EVHA 3LDBC 4WFEE 2N01B 3TL5A 2G5RA 3IU4H 1H3WM 5I1IH 3G08B 1A7BA 4PY8I 4UT9H 1O9VA 2YIHA 1XVSA 1JI2A 4XAWH 3WFHB 3ZHDA 3TT1H 4NYLA 5T33L 3MRHA 3K6IA 2WWOA 1ETJA 2ZXCA 2Y23A 2WM0A 2WVVA 5M94B 3TBYA 4M61A 5J57B 2BDNL 1FZJA 1LP9E 4JPIB 4PSPA 4JDEA 3ZSSA 3RHWK 3ZPDA 1DFBH 2VLKB 5K9JH 3KZ8A 4PV8A 1QLEB 1QVOB 4L4TB 1E5CA 3G7TA 3MLVL 4Q9QL 2EDNA 2SODB 1KEMH 1AXTL 3RX7A 4X8XA 4ACTA 4N6QA 4ZXBB 1CDYA 5GS3A 4ZOEA 2EIZB 1DQVA 2VZSA 3TCLB 1NIFA 4EI5D 2ZWNA 3GS0A 4JY6B 1KJMA 3MRLA 3W39A 5KVGH 5DRWB 1CGTA 5C6TH 5DRWA 2HX8A 4P46D 2VDPL 4C4KT 5KEZA 1LO5A 3T5WA 3WIFA 2VZ3A 5C0AE 1JFHA 5BOJA 1IL1A 1ERNA 2ITCA 3GEWB 1U91A 3FTGA 1L4IA 3HRZB 5FYKL 4M62L 3QYMA 4FKKA 4U1JB 2F5AL 3P77A 5KSVB 1PEZA 5C0CB 4JFDB 4BKTC 5JUEH 2Q86B 3A67L 4JDEB 1ZMYA 4RBPK 3ETBF 1KN2H 2LU5A 3MQIA 1N67A 2J8OA 3HG0A 4P2RD 3MV7D 4QD2E 5GISH 2MCMA 4MS8D 1DQIA 3TN0B 3VM5A 3D85B 3GLAA 3NTCH 3QZWA 4APQB 3D87B 1QNIA 5IR1B 1JHTA 2H41A 2EYSB 1AD0A 3O81A 3AQDA 3DGDA 1KYAA 5DFWH 3A4FA 2BWIA 1Z66A 2WWKO 2ZYSA 3P4OB 3ULVC 3APCA 1W0WB 1SNRA 3RL1B 3WS6C 3BAKA 1NIEA 5F9OL 3BH9B 3RQ3A 5KJRL 2V5MA 4I0PA 3DV4B 3CQPA 2NR6D 5E9AA 2ZCKL 5EMYA 2EKSB 1AZNA 4G1MA 4YHOH 4FG4A 4N25A 4ODVL 2WZPA 3NA4A 2AP2A 2WQXA 5F7BA 1YJDC 1K4DA 4TRPH 1SF5A 3A4EA 5E08L 4LLUB 1FNAA 4D0DB 3HR5A 3IFOB 3IRZA 4M7JH 5EU7C 5IREA 2LR4A 3H2WA 3DMMC 5GGVL 1G1KA 3VDAA 2XPGA 3KLQA 1OTUD 1J8HE 2DKMA 5I19H 4K94H 1CI3M 3VWKD 5H94A 3O4LD 4RFEA 1A7NL 5IMMB 3MJ6A 4KI5C 4ZQKB 3D4CA 4LDEB 1SMDA 5SV4A 1T20A 4AGNA 1MY7A 3ZE2F 3SKJH 4G5ZH 4EDXA 2NT1A 5I8OL 4JNXA 2IGFH 3D3VE 2GJJA 4BH8A 3VXSD 3MXWH 1B3JA 4WKXA 5D7LB 3GBLA 1PG7W 1QSEA 5F8RC 1R24A 3JWOL 2JMRA 3V0HA 2OMXB 2AEOA 1Z9PA 4GT0A 4TUJB 4PD4J 3QEUB 4BWUA 1KUMA 3DX7B 5CBEA 1ECYA 3MV9E 2FRGP 4XX1E 2YD9A 1OANA 5AYTA 3OMAB 4NP4H 4Z8FH 1H8NA 3WHE1 3X12A 1ZHNA 4NXKA 5E08H 4FI6A 4Z0XA 3ZE2E 2F74B 2JXMB 3EFDL 5D6DA 2OSWA 4TQIA 4ONGH 3C87A 1JD7A 3ZUCA 1MH5B 2EZ0D 4AM0Q 1ZAGA 2AJZA 2G9KA 4OF6A 3I50L 9CGTA 3PWPE 5DVLA 5C8JB 2XXFA 3PAYA 2F53B 2AJ3A 2HFEA 4EDWH 4IQHA 1ROCA 3S88H 2GHZA 4L8CB 2ETWA 2Z93A 4BELD 5BV7L 4N2EA 4S1QL 1U95B 3GMQB 3LRSB 4C8XA 4LVOC 1PJWA 1UM4H 3MLWH 4HUKB 3VI4E 2C1PB 4XB8A 3KDPB 2XHNA 2NUTA 2EINB 4MMYB 2P5ED 4LCCA 4NPYA 1R4XA 3FW6A 4H2AA 5E8EA 4YE4H 1KIUB 3FFCA 2CK0H 2O30A 3Q8EA 2PETA 2Z91A 5T3XE 3MNMA 2A74B 3MLSH 2ZP9A 4FABL 5LGJA 4GUPA 1N5YL 2ZUXA 3ZDXB 5JA9A 2X7LB 4KNTA 5HPMA 5BVPL 2DJ4A 4K9JA 2AK4D 1HH9A 3R4RA 1J0IA 4NKMA 3V6BR 4R0LC 3ZE1F 2ZNWA 4AVHA 4TLKA 1OP4A 1U30A 1AGCA 1M9SA 2A4EA 2GABA 2HFEB 2YXFA 1J1OL 4N9GA 2ZNXA 4JPVL 5DO2C 1M6OB 1NDGA 5IK3A 4JG5A 1WBYB 3PJSA 1XGRB 4XNZB 1U92A 2VLRD 4OLXH 5L6YL 4WEBL 4OKDA 1NUDA 5C0BD 4FA8A 3FB6B 3NZHL 3LHAA 2FJSA 4LDOB 4ZO6A 5LDSA 2P28B 1ADWA 1X5YA 2DWEB 1KB5A 1QYGL 4P46C 5AAMA 1HK6A 2YJQA 1HYRC 5FW6A 4C57C 4ERSH 5A2BA 1NPUA 3W56A 3L1FA 3BZEB 3LZOA 3FB5A 3TASA 4LLQA 1MWAL 1OP5K 3ROLA 1LP9F 2XIDA 2YK1L 5DURD 3DBSA 4OQTA 3GSQA 4QRFA 1ZTXH 4X80H 1P9MA 1BXAA 1RIVL 4QMEA 4JE4B 4XHQA 4U6XA 3HNTH 1RZ8A 3V9EA 4U31A 1P1VA 3H9ZA 1L3WA 3DJRA 3EOAB 4M9PA 5JHDE 4GRLD 4M1CD 4JS7A 5DUPL 1FVCB 3QFJB 1CGUA 4YHOL 1XO8A 2ED7A 3LRKA 3X1BA 5KYNA 3MV7A 4FA6A 4ETYA 2MOQA 5IMOB 3CZUB 3TT3H 5FR3A 1AR1D 4ZDHA 3U6XA 4CAGA 4P49A 5I1EH 3A4DA 1QLEH 4JX0A 3VSUA 2TAAA 3L3DB 1HCFX 4I9XA 1WCQA 5C09E 2FT6A 4YL4A 1H3VA 1CYWA 3DIFB 4J1UB 3QI9C 1N19A 3EDEA 3GSRA 1G1CA 2WXMA 3IGAB 3OC8A 2IDUA 2XV0A 5EC2A 1QI4A 3QI9D 2DQUL 4TS6A 4YUEH 2Q2EB 3FMGH 4MZIA 3SE3A 3L7EB 7TAAA 4AYFA 1A6AB 1LK2A 4A2MA 3PGCA 2PMZA 3HG4A 1BFOB 3QORD 3AUVA 4KX8A 3SGJA 3SYQA 4YBQD 1BZ7B 1TZ8A 1RPKA 1CZ8H 3D6GA 2JSFA 3QDGA 1HILB 4MNQD 4XO3A 3SE4A 5HJDA 4YXLH 1XD1A 1I8KB 1UA3A 2VRQA 4B5EA 5J1AB 4U7KA 3W0WD 1NCNA 4X6DE 2UWEB 4LBAA 1IGCH 3GRWH 4NRYA 2I9LB 2YD1A 2ZJSL 4PJEA 1KJ2A 4XBGA 4NN6B 3HS8A 5I1HL 1U8LB 1FFTB 3D18B 3MV9D 5TH2A 2WKLA 3FRUA 4YE0A 3M8OH 3U36A 3MREA 3E7JA 3OR7B 1G7PB 4YDIL 5AWNL 1A6VL 3ENEA 2MNUA 4GUQA 3SQBA 3QUYB 1FO0A 3L2MA 3LKSA 3QDJA 1PZUB 3IFNL 3CQQA 3PGDB 5DT1L 2CDEB 3V4VH 1AZVA 1WPCA 5J6GA 5D5ME 1T1WB 4JFHE 1LD9A 4JL1A 1NCGA 4MHHI 4HULB 2FR4A 4K3DH 4H20H 4FQLL 3U9PH 3VFWA 4DKEL 3JWNC 4HJGA 5HDBF 1KG0B 4XCCL 5HVGB 3TP4A 2V9TA 3ZUNC 5MENB 1RHHA 4CA4A 4P46A 4DESA 3MGTA 1F5WA 4AQZA 2WUBH 3C75A 3EKCA 2HN7A 3MGTB 3RB5A 1E5YA 1BP3B 2Z7YA 1R3HA 4KHXL 2JKRM 3GFUA 2K8QA 2JJUA 5AVZB 4XH2A 3B9KC 5EEYA 3CXFA 4I4WB 1CCZA 3SZ6A 3MV8B 4PJDE 4W4OA 3QQ3B 4NHCL 4Z3EA 1FZMB 4NNPH 3FONB 5F1IB 1UJ3B 3RZWA 1CFNB 1I3VA 1ADQL 1DQLH 4FQQB 4A6YB 5KVGL 4I3SH 5JQ6L 1F2XK 1PQZA 5EOQL 1I1RA 1AGBA 1BZ8A 2CHZA 2MQCA 3EOTL 4L0ZA 1NZRA 4WO4A 1XR8A 3FC8A 3LEVH 3H0TA 4YHNB 3KPLB 2XZQH 4MZ2A 1M7DA 4LSPL 4OGAD 5KBKA 1K5NB 5SWZB 3VFMA 3NDYE 4UOW0 1M1SA 5I73C 3T65A 2WTPA 3VE0B 2FDBP 2V2XA 4GKSB 1DLHA 2VB5A 5BO1L 5IB1A 4RISL 1L0QA 4CGUB 2FE0A 3DMMB 3ECWA 3THML 2W65A 1CL7L 3PL6A 4OI7A 2E9BA 1BQUA 1BFSA 2OTWB 1SGKA 1S5IL 2K6ZA 3QISA 3UJIH 1I3GH 3QIUD 3U7AA 4XTRD 5KVGE 2NLJA 3H3PH 4UQAA 2OM5A 1IAKB 4O2CA 1WBXB 4JDVB 2IH1B 4MA8L 2AEPH 1IGTB 5TPWL 2W60A 3EJPA 5I1JL 2C1OB 3AT0A 4Q74A 2YHGA 1IAIM 3ARBB 2H0PA 4J6RH 2IBZY 3FUFA 4P5KB 4HKBA 3HN5A 1CS6A 1GGIL 1PY9A 1F4YL 5JUEL 4CSPA 1BQRA 4OT1H 1EANA 3P4MB 4EOWH 1ZE3C 4ECNA 2A74C 2YA0A 2V2XB 4GKSA 4O2FB 5IY5B 2DQCH 3G5YB 4M6OL 2I27N 4PHXA 1BGXH 1A21A 1MCHA 5EOTA 4HOZA 4OUUA 4OBRA 5HGDB 5I1AA 1PEWA 4L4VD 2P5WE 1UATA 4BZ2H 1PL3A 2KDGA 4KROC 3WFDL 4F7KA 1OF2A 4MNGA 3VB9A 3MJ8B 4GAYB 2H3NB 5DHVH 3QZWG 3FH7A 5I76B 4QHUB 1QR1B 1S7TB 1QAWA 1IM9D 2DQHH 2UZIL 3NUKA 2CIKA 5CFHA 1X9UA 5GS0C 2DAVA 4QF1A 2AXWA 1XZWA 2HMID 3HFML 4F20A 3OXRA 4P2OB 3RY6C 3AS2A 4AQ1C 4OZGF 1CICC 1TQUA 4MQSB 5CSZB 5E51A 5SWZD 3WKQA 5LJYH 1W2KT 1ORQB 1ZT7A 1OP9A 5FK9A 1DQQA 1HL9A 1IEAB 1ADQA 3ULAB 4PJHF 4ODBD 3TA4D 3ILQD 2QELA 5FIEA 1J5CA 4IOFD 4JFYB 3RY4A 1S7WA 4EXPX 1Q0XH 4YHIA 5LBSA 1QHPA 1WIUA 4L4TD 2OCFD 4JHAL 2DEWX 4DEUA 3GMNB 4E5XG 4PRHB 4EXKA 4TNGA 3O6FD 3MRGB 3MDJA 2NY1B 2BH0A 3D0VB 3PGDA 1SN2A 4KVNL 3ZL4L 5A2JH 3B7YA 3BYTA 2JB6A 1IVLA 4TQHA 4UQ3B 4F57H 3U36B 1WEJH 1USQA 5GZOC 5J6GB 3VXQB 4JCWA 4Y2DC 4MJ4A 4X7TA 4I1PA 4QHKJ 3Q44A 3DK2A 4M7LT 4UV7L 3P30L 4WWKB 4UTBA 4Y2DD 4KUCD 2P4AB 3RWGA 4FYTA 3T4YA 4Q6IC 2F68X 3O2DL 5HGBB 5HY9A 1IKNC 5DVOA 1U8OB 5I8EA 4YPJA 2PCFB 3WXWL 4JHBA 2V8MA 1JERA 2X12A 2BVOB 4NAMA 2AXFA 3V9FA 3RYMA 4X6BB 3B34A 1A5FL 1WC7B 2XTJC 3EGDA 4XNZC 1NSNL 4IDJL 2EDRA 1BZ9B 4AH2A 2XA8L 3SDCA 3BPOC 2ZPKL 1NBZA 4ELME 5HD8C 1R9FA 1A4KA 5BZDB 2D7QA 1F6LL 2DQEL 3D30A 3CMOL 4YXHL 5JQIB 2OMWB 1E3ZA 2DS4A 5IVXB 1UWYA 3OAYK 1BEYL 5DMIL 1ZGLA 3ABGA 2I85A 3DXAB 1OP3K 3MA9H 3NYKA 3QDGD 4WCYL 3RU8H 3TVMD 1HE7A 1EUUA 4E5XA 4MD0A 3OKLA 5D7JD 1I7RB 1KN4H 4NQEA 2VLJE 1X7QB 4PWGA 4ZDHB 2QQQA 2GJ6E 3ZTJH 1T03H 4OFKA 4ZODA 4YK4C 2V33A 1K6QL 2NTFB 7CGTA 1NCJA 5IESL 3R06A 5FCUL 2OXGB 4Z7UB 3UCQA 1A65A 3DX9B 2NZ1A 1SPDA 4MB4A 1DZ0A 5FV1L 5BVJB 5IHWA 1CLCA 4GFTB 4I0PD 3QORB 4GP8B 1MF2H 1CFTA 3AS1A 3BVNB 4O2EA 2NY1D 4DP4X 2BNRB 2GJRA 2B59A 5JA8B 4XMPL 2ZWZA 1BJ8A 1M1XA 1RZ8B 5AW6B 1WBXA 2DWDB 3BUDA 1UT9A 5IB3B 5I6KA 6FABH 3HMXL 3IAGC 2JCCF 1O5DT 2F61A 5I1HH 1SYSB 2XZCL 1GZQB 4AUYA 2P9RA 1DBBL 1B0WA 1OCOB 1KCUL 2FL5B 4QHLA 3IDMA 4A37A 3BISA 4GUCA 4MKMA 3BKCH 3D9AH 4GLRI 5CEZD 4Y7MA 4UZGA 3RWHA 4DP9X 2XJKA 1P9MC 3D39A 4ZYKA 5EBGA 4JDVA 1M71B 1W0VA 4U7SA 1UD4A 3B7SA 1KGXA 4AT6B 2ATPA 1IGFH 3C9NB 4E41D 1W15A 5HHQA 3D2UB 5GS2H 4KI1A 4OZIF 3QXUA 3QXAA 3O0RH 3UDWA 3DVIA 3KJ6L 3ZHKA 4ENED 1R34A 1HI6A 3GKWH 4QT5B 4FQXC 4RDQG 5EFIB 1VDGA 1TZHA 3MLRL 5JOEA 1UJ3C 3O3BB 2IG2H 5AYUL 3O3BA 1I1YB 4GRMA 2JF1A 2H2PC 3IDIB 3LNEA 1HSBA 4OUOA 4H8WL 1W0WA 3ABMB 2XWTA 5FDYA 4UYQA 1MVYA 2KL6A 5KN5B 2GJ6D 2OYMA 3QUYC 1E40A 5A2LH 5JHDB 1ORSB 2BS8A 4WO0A 1XT5A 5JHDA 4PJ9A 3LPFA 4ZTEA 3FCSA 4AEHH 3B9KD 5IB2A 1OGAD 2F1AA 1R3HB 3B37A 3BWAA 1IE5A 4WHCA 3ILQC 2ZYIA 1NANH 3GSOB 5D2LA 2YXMA 4FEIA 3ETTA 3TIDA 4K5PA 3X3FL 1ZRUA 3GSVB 4OFVA 3NPSC 1JG9A 3Q2VA 3NA9L 4O58H 3UJJH 2FLRT 4JFDA 2G4GA 3GXFA 4D9LL 1AE6H 2AJUL 5JZ7D 3QXAB 4J27A 3VXNB 1A4BA 3ZL4H 3SDXA 1F13A 4AMKL 4KO9A 4EI6A 3WKNA 2AAAA 2VISB 5KUKA 3V7AE 4KPHL 1U3JA 5FYJD 5IMKA 2AJYH 3IMSA 3ASWA 1YJDL 4IBQA 1AAJA 1YDPB 3KMDA