2WO2B

Crystal structure of the epha4-ephrinb2 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
136
Chain Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity of Eph-Receptor A4 Facilitates Cross-Class Ephrin Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
molecule keywords EPHRIN TYPE-A RECEPTOR
total genus 29
structure length 136
sequence length 140
ec nomenclature
pdb deposition date 2009-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2wo2B00
1TU2A 2QPDB 5IY5B 4GP5B 2VN3A 3DTUB 1MG3C 4GYBA 4JHVA 5F7AA 3FYIB 1ILUA 2FT7A 1AZBA 2FT8A 3FPXA 3NJIA 2YAPA 2TSAA 4HHGA 3TU6A 1TEFA 5AKRA 1URIA 2B08A 3EH3B 2AFNA 3AG3B 3MBWB 3WNJA 4DP5X 1AS7A 3KW8A 4ENZA 1NIBA 7PCYA 3FU8A 3PXLA 1HAUA 1KCWA 4KNUA 3SBPA 1W6WA 1M56B 2XUWA 1IBYA 3NSCA 3CDZB 2AVFA 5B1AB 2XX0A 3V9EA 1WA1X 4HCGA 2GSMB 4TXVB 3AW5A 1NPJA 1NWOA 2BHFA 1W8EA 1XMEB 2DY2A 3JT2A 2WO2B 4UF7C 4L0PB 2HRGA 2XV2A 4A67A 3WNIA 2IWEA 3PCYA 1A4AA 3OMAB 1JOIA 2YAOA 1AZUA 4KNSA 4M3HA 4UANA 2DV6A 2UXFA 1GY2A 3NP3A 5B1JC 1PNCA 4NB7A 2FQEA 5I5MA 1OCCB 1PAZA 1UATA 3OM3B 4RH4A 1PLAA 1PY0A 2IDTA 1OV8A 4DP7X 1AQ8A 4A2EA 4YSSA 2VSMB 2VM3A 1QNIA 3FT0A 3AG2B 3EH4B 1NICA 2ZWNA 4YSQA 1JZGA 3UADA 1NZRA 1DYZA 4AX3A 4BXSV 3UABA 3T6WA 2YXVA 1E67A 2IDUA 2LLNA 1GYCA 2CALA 3CG8A 3FS9A 4DP4X 6PCYA 4G72B 3CVCA 3FU9A 1WAEA 2TSBA 5F7BA 1AS8A 3QQXA 2GIMA 1OE1A 2VW7A 3D12B 1GY1A 5D4IA 4M4RB 3TBBA 3CZUB 4CSPA 4AKPA 1NIEA 1JZJA 3UGEA 3WKPA 3T6ZA 4G71B 1OCOB 2IDFA 4NAJA 3T6XA 5I6KA 2FQGA 2BP0A 4N4YB 3QPKA 3DIVA 4W9ZA 5PAZA 5D4HA 4KO7A 1HFUA 1I53A 4YSPA 2FQFA 3NJJA 2Q9OA 4BXVA 2VM4A 3ASOB 1PMYA 3FQ2A 4A2HA 2HLEB 3QJSB 2PCFA 2A3TA 1CUOA 1A65A 1J9TA 4E9YA 5B7FA 2AZAA 2UX7A 2WSDA 1ASOA 3FQYA 4YVUA 1SFHA 3ASNB 1DZ0A 3GXUB 2Y69B 1NINA 4YSRA 4F7KA 1WS8A 2I85A 3NJMA 4KNTA 2BW4A 1AACA 1OOWA 4A2GA 4P5SA 2J57A 1SHXA 3FSZA 1KDJA 4DP0X 1JXGA 1M9WA 1AR1B 3AZUA 2AZUA 2R7EA 2Q5BA 1CURA 2UXTA 4DP8X 1HAWA 1EHKB 1KBVA 4UAHA 1RZQA 2GB2A 1WA2X 1WS7A 3IE9A 1SF5A 2BP8A 4DP1X 2IAAC 3HB3B 4DPCX 3X1EA 2HXAA 2QDVA 1J9RA 5I28A 1A4BA 1BEXA 2JXMA 3FPYA 1J9QA 2OCCB 3ABLB 4QKTA 1GS8A 1JZHA 4CSZA 1KBWA 4DP6X 4JKNA 1ET8A 1JVOA 2YARA 3L45A 3U25A 4KO9A 4KO5A 3V9CA 2GC4C 3PPSA 2JFCA 1R1CA 1ZIBA 2FJSA 1EZLA 1ET5A 4AZUA 4GXFA 2ZOOA 1JZIA 2BP0B 3X1NA 1ADWA 4PAZA 3BQVA 3PLYA 1MZYA 3UACA 3ZX1A 1ASQA 5AFAA 2E86A 4E9RA 2EIMB 2H47C 3G5WA 1KYAA 4DPAX 5B3SB 3N2JA 1MDAA 4QLWA 5B1JA 1T5KA 5B1KA 1RCYA 1MG2C 1NIFA 4HCIA 1CYXA 2HZHA 3WI9A 2XV0A 4Q8BA 2NRDA 8PAZA 3CVDA 1AG6A 3NJHA 2UXGA 3EF4A 1SNRA 3PAUA 5E9NA 4BWWA 3NSDA 2OV0A 2HX9A 4Q89A 1NWPA 1AZRA 2PLTA 5I6NA 1KDIA 3H4HA 3ZIYA 1ASPA 4W1TA 1QHQA 2PP9A 3TASA 5FC9A 2VW6A 2J56A 3QJVB 4AKQA 4AI7A 4EF3A 1X9RA 5I5JA 3NP4A 3NYKA 2IH9A 1E5YA 3FSAA 3NT0A 2QT6A 3S3BB 1KGYE 1J5DA 2BW5A 2XXFA 1NDTA 4E9QA 1L9PA 4YSCA 1X9UA 3TA4D 5A7EA 2PPAA 3ZBMA 1ZPUA 1NPNA 2DYSB 1NIAA 2DYRB 3OD3A 4HIPA 4YSAA 2CAKA 1BXUA 2RACA 2IWFA 2PP8A 2CBPA 1BYOA 1AZNA 2CUAA 2YAHA 3H56A 3OMIB 1GSKA 1GW0A 2PCYA 2XU9A 1SJMA 3DKHA 3CDZA 1A3ZA 1L9OA 3NSYA 4E9VA 1GR7A 3IN0A 1OCZB 1V54B 1L9QA 2BZ7A 1JXDA 3QJQB 1OE2A 2X88A 2PPFA 4FA7B 1L9RA 5I5IA 1PLCA 2OJ1A 3KW7A 4JHUA 3SQRA 2BO0A 1J9SA 2FNWA 1BAWA 1SDDB 4ZK8A 4YSTA 2H3XC 3N55A 2ZONA 3ERXA 4YSEA 1RKRA 2HRHA 2P80A 1SDDA 4YL4A 3ZDWA 1A8ZA 1B3IA 4PCYA 2VSKB 1FA4A 4A68A 2XYBA 1IUZA 2EIJB 1BYPA 3NJNA 1F56A 3IBOA 2UXVA 3NJKA 5I6LA 2B3IA 2XXGA 5ANHA 3UAEA 1N68A 2FWLB 3PAVA 4BWUA 5B7MA 4F2EA 5EHFA 2EILB 2QPEB 1PCSA 5AZUA 7PAZA 3FYEB 1NIDA 3X1BA 3MX0B 4G7QB 1IC0A 2GHZA 2EIKB 2N0MA 2YAFA 3T6VA 2QDWA 2HX7A 3ABGA 2W8CA 1AOZA 2YQBA 1TKWA 5I26A 1XB8A 1XB6A 4DP2X 1L9SA 4P5RA 1ET7A 5I6PA 5PCYA 5TK4A 1JERA 2MRYA 1V55B 2H5UA 1FFTB 2R7EB 2I7SA 2FQDA 2YAQA 4K9JA 3OQRA 3QJUB 1PNDA 5LDUA 1E30A 1ZDQA 2XV3A 4A2FA 2VMJA 1E5ZA 2PPEA 1E65A 1L9TA 2GC7C 2XLLA 3SBQA 2FT6A 1BQRA 9PCYA 4E9SA 1OCRB 1AIZA 3FU7A 1GS6X 1AANA 1J5CA 2PPCA 2BWIA 4A66A 4FAAB 4YVNA 5I6OA 1VLXA 1TEGA 1JVLA 1ZDSA 1AAJA 3TBCA 2IDSA 1ILSA 1CC3A 4G7RB 2PP7A 3AG1B 2J55A 3ABKB 1N70A 2J5WA 3EH5B 1QLEB 2XWZA 1JXFA 4F2FA 3X1GA 1PZCA 3FSWA 2YAMA 4HZ1A 4YSOA 1ID2A 3X1FA 4HAKA 1ZIAA 1W6LA 2CJ3A 2WO3B 3ABMB 4G70B 2FTAA 4X4KA 1A4CA 1IKOP 4YSUA 4BK5C 6PAZA 1FWXA 4DP9X 4G7SB 4E9WA 1PLBA 4KOCA 4N8UA 3AG4B 3UAAA 2I7OA 4A2DA 2IH8A 3NJLA 3IEAA 2MTAA 4DPBX 3GDCA 4WTQA 4AKOA 1MZZA 3S8GB 4KO6A 1IBZA 1SFDA 2VW4A 1KCBA 4BDVA 4HALA 3WG7B 2IWKA 3H4FA 3OMNB 1WA0X 3T9WA 1NTDA 1ETJA 1M57B 3C75A 2YAEA 2CCWA 3FSVA 2P80D 3QJRB 4HCFA 4YSDA 5TK2A 2IDQA 3HEIB 2UX6A 4NERA 1GS7A 1AZCA 2XVBA 1PZBA 2Y1AA 1OF0A 1OE3A 1JZEA 1ZV2A 3BVDB 4GY4A 2XX1A 1AS6A 4KOBA 2DWTA 2BZCA 2BP8B 2W88A 1SF3A 1V10A 2DWSA 3EHBB 3QJTB 1CYWA 4GP4B 2JKWA 1SHWA 3FU7B 2GBAA 3S8FB 2EINB 1BXAA 2ZXWB 1RZPA 3S3CB 1PZAA 4E9XA 3S3DB 3PAZA 2PPDA 1BQKA 4GP8B 5B1BB 3FQ1A 3WIAA 1YLBB 2GI0A 5B7EA 4BDVB 2X87A 4WKXA 3T71A 3GYRA 2BWDA 3IN2A 3JTBA 3RYMA 3NJGA 3NJFA 1BXVA 1AG0A 1PF3A 3CVBA 2AANA 3AY2A 3NSFA 5D4JA 1XB3A 2HX8A 4HHWA 2YXWA 5I6MA 4BWTA 1BQ5A 1KV7A 3WKQA 3X2QB 1JZFA 4E9TA 3SBRA 4MFHA
chains in the Genus database with same CATH superfamily
4B7LA 1G4RA 2KT6A 4PRIB 4UNIA 5D2NA 3L4XA 1DE4A 4JHVA 1MWOA 1NDGB 2MOGA 1WE5A 2UY6B 4AE0A 4PGJA 5HHVH 1KSRA 5K9JH 3S3SA 4HHGA 3SN6N 3WIHL 4UV7L 3TNMA 2X7LB 1WISA 3T2OA 2FWSA 3TA3D 3WNOA 2XC8A 3MRKB 4BV1A 1SRDA 2IVFC 4H8VA 4FQLL 1E50A 2YQ3A 1OXYA 2X2JA 2QEJA 3OJDB 4IBLT 4Q74A 1XIWD 2Y0SA 7PCYA 3N06B 1DLFH 3HBPA 3QIBB 3AB0B 1HE8A 2O6FA 5B3NA 1JPEA 3UGUA 5D2LA 4HK0B 2VDRB 2P8MA 1AD9B 4P2AA 4IS6B 2EDQA 5DGQA 3ZYIA 3PIQA 4YDNA 3UZVA 2EVFA 2DLFL 2KZBA 3D69A 3HPJA 43C9A 3I3EA 1GPOH 5J9PB 4JDZB 3WLWD 2R0KH 3X11A 3QQ3B 5LAPA 4M8QB 4JN1L 4UF7C 3FB6B 3KLHD 4K5MA 3WNNA 1P7QA 2W94A 2H26A 1G43A 4EN3C 2UZXA 3ZE2F 4I0KA 3GTVA 2O5XH 2F2HA 3HPLA 3WLWC 1G6VK 4UIMA 3RQ3A 5CEZH 1GY2A 4PJGB 1TLKA 2B3RA 4RMVA 3E8UL 3GSNB 3MXVL 3MV9D 4PS7A 1KB9K 5E7FA 2LT9A 3H9SB 2I60L 2FQEA 2L7JA 1MCWW 4LOUC 3UIZA 1TT6A 4ZPTA 4DEWA 2HJKB 4OKVA 5FHAH 3OM3B 3CFJA 2AABH 5EZOH 5SX5K 3VDAA 4KQ4H 2ZWYA 3C60B 5SWZB 1GIGL 3P3UA 2IH1A 3AG2B 1YRKA 2AXWA 3EG9A 1JZGA 4YLQT 1WCQA 1DYZA 1KJVA 1ZEAH 3L8QA 1JF1B 4XHQA 3ARWA 5INDA 2MCMA 3NAAL 2XACC 4CC4C 2GY5A 4K7PL 1GYCA 1Q1JH 3ZHKA 2H6PB 3VRLE 2GSGA 4DP4X 5F7NC 1ZOXA 4MBOA 3CFQA 1HQ4B 4B53A 5KW9H 1A21A 2D4FA 1DSFL 4R0LC 3GRGA 3E6FA 5DO2C 4PR5A 3HZMA 2WKLA 4JY5L 1I82A 1GY1A 3BLKA 4OAWB 3FJTA 3KEHA 3UTPE 2JKXA 2KH2B 4AIXA 3BEWB 4BSWA 2F74B 3O3EA 1YJDH 2V8MA 1XR8A 4N4YB 3C6SA 3D2UB 3DX2A 5D4HA 5GISH 4WUUA 3VX1A 4WO0A 1QLRB 3KM1A 3LHPL 4KJYB 1FV1A 2Q9OA 2X38A 2IQ9H 3KLDA 4LLYB 4BXVA 1MNUH 2Y2TA 4QNPF 2B1AL 1PMYA 4A2HA 3SE6A 1HXMB 4NNXB 2XQYA 1EUUA 4Z3IA 1BPVA 4FXGB 3K91A 5F8RC 2FUQA 2R2EB 3GBDA 5IB2B 4ZTOL 2OTUA 3ASNB 4RAUB 5KS9A 1F4HA 4L4VB 4Y1TA 1SXZA 3CN1A 4L9DA 4ZUVA 4U7SA 4Q97A 2OX5A 4OM0L 3RAJH 2XY2A 2XZZA 3RWEA 3S97C 3O2WH 1B6UA 5GRUH 5B1CA 4JN2B 4HWZA 2OTPA 2IQ9L 4KRPD 1SHSA 2X89A 4PS4H 2W38A 4N2AA 3LQZA 5IBLC 1JXGA 1UT1A 4BFEA 4OFQA 3QARA 4EZMA 4RFNC 4JFZL 5JO5A 2C9RA 4YGVB 3V4PL 4MJIE 2C9QA 5IGXL 2I69A 3ALPA 4NQSB 1I9JL 3MREA 4LOFA 2XZAH 7TAAA 2ORBH 2ZKYA 3FUHA 5D1QA 2M26A 1KTDA 4NHUA 4G8AC 4DFIA 1N2RA 2ZQKA 5EC2A 4PJDA 4Z3JA 4JL2A 5CCKL 1Y6MR 3NDYE 2VXSL 4IRSC 4NRYB 2VITA 3R7RA 1EZLA 2XTJB 5D1XA 2AGJL 4DFHA 5B8CC 1JZIA 3ARGA 1PL3A 3EADA 4JR9H 5DXWA 4HKJB 1NFKA 3C5SB 5TDOB 5GS0H 1BVKB 3D25B 4F7MA 4Y5XA 2EACA 3C08H 4QTHA 5CBEB 5HI5C 5DJZB 2E75C 1XH3A 2KERA 1JPFA 4GLRI 4R26L 1BQHB 4AYGA 1I8AA 1T1YA 4FGMA 1P5VB 2FJUB 3OJVC 4BZ2H 5MEPA 1H6FA 2W0FA 1YY9C 4KRPB 3EW3B 1X5FA 4CC0A 1YPZA 1AO7E 2N1KA 1RHFA 3OXSB 1MHHB 5EEYA 4JG5A 1S5IL 2MNUA 5MENA 1S3RA 1G7QB 4XC3L 2VXQH 4L05A 2A9BA 3H85A 3F05A 4YHNA 3CSGA 2PWHA 3MRGA 1PY9A 4XMZA 3X13B 4W9KC 5AVUB 1QHQA 2B2XL 3B1UA 5ADOH 3GMNA 4FYRA 4RGOH 4BQCA 5A2AA 2YD4A 3WLBA 4IBZA 3MJ7B 1X4XA 1WWAX 5T1DH 2VCOA 3NT0A 2P24A 1YYML 2BY1A 1R19A 1DBMH 1SUHA 4GUCA 3MOAL 4MLSA 2ZG1A 3L9RB 5A7EA 1PSKL 2IH3A 3L4UA 4LE8A 2X4UA 1OALA 1T83A 1U3HB 1FZKA 1YMMA 1PKQA 3MUGB 4TVPH 3AQZA 3O3DB 1BXUA 3ES6B 4HAGA 2AQ1A 4C59B 2WVSA 3F2LA 2Y9RT 5DO2D 1AIFA 2VOTA 4GW1B 1E90A 4QGTA 4P23A 4LCCC 3CVHB 4HUWA 4XC1L 3B3BA 5DJ8B 4ELDA 4JX0A 3BQUB 5CZXD 4YEFA 1L9OA 2IAND 1CFNA 2DICA 4GG6F 3JV5A 4F9PC 4YFLI 5J6HA 5D8JH 3ROOB 1NGPH 2ZOTA 4JMNA 3BUYA 4AM0B 3QXDA 1PIFA 5KVFH 3J7HA 1LO2L 3GRWA 5ALBL 1LO0H 4L18A 3QJQB 1JWMA 3VFVB 3KH4A 3CU1A 1A4JA 4N1EA 5DA0B 3FZUD 5CP7A 4AV0A 4GAGL 4DN3L 1F3JB 5F9JA 3ZT7A 1JGEA 1YY8B 2BNRD 3GM8A 2WK2A 2XXCB 1C5BH 4XHJD 4X80L 5KSAC 3K0YA 4NNYA 3OZ9L 2DQJL 1FIEA 4AXWB 4DZBB 4JFDB 3VE0B 2J44A 2WQRA 2Y07L 4DVRL 1NCDH 4FQXA 3VXNA 1E9PB 3KGTA 4BGLA 4Z7NE 4GBXA 3KZ8A 1YCSA 3FFCA 3QDHA 3M8OH 3VI4F 3ZT6A 2YSTA 4GKSB 1LP9F 5ABAA 3UPRA 1WTLA 2DWEA 4WLCA 3UG4A 5KJRL 4J3OG 3B5GA 3KLAA 4JKLA 2OBGA 1UWEL 3UBFA 5GRWA 1TKWA 5EULV 4MNQD 1EXHA 2J6WA 4P48A 1ET7A 2OTWB 2JB5L 3DBXA 4U7KA 5M94B 4Y4HC 2Y7MA 3DUSB 4ODSH 4F8NA 5EIIG 3ULSB 1ZV9A 5AYQA 1UZ6E 1AR1D 4GI6A 3ARSA 3INUH 2OMTA 3OXRA 7FABL 4TM9A 5EU3A 4KXZH 4W6XB 2VLKE 3MPCA 2DQFB 3ZDYE 2ZP9A 2PO6D 5E1GA 5C0DA 5C0AD 1MH5A 4K3JH 3U36A 3QHFH 3L4WA 3ATFA 3D4CA 3QJHA 1E27A 4EQ2A 2JB6A 4UU9B 4Y4KA 1L6XA 4Z7AA 1S4IA 2DIBA 3U0WL 1JPTL 1QVOB 2H32A 3DX0A 4YFLF 1DO6A 1SGKA 5IBTH 3SDDC 3U0TB 1MCFA 3IJYB 4OJEH 1EZUA 2JMRA 3KPNA 1KCLA 4GSXA 4UZGA 4YIQB 4N2OA 4L3AA 2OL3L 4AQ1C 3CZLA 2AKRA 3K74B 5JA8B 1SOQA 1N5AA 3ULSA 4J12A 5GGSB 5GGQH 4BFGA 5L8JB 4PUBL 5CD3B 1KPVB 2X70A 3WTVA 4UAOB 4HUXA 1RFDL 2OXHB 3CDGA 3OKNA 1KCSH 5F3HB 1I3GL 1SLUA 1Q9LA 4N8UA 1LILA 5BVJB 3AG4B 2LE9A 8FABA 5DT1H 4QRRD 2QKIC 3S8GB 2DWEB 3B7TA 5F7MC 4JVUA 4RVBA 4BSJA 1IEAA 4BEIA 4DETA 4PJAF 2WJ5A 2VZ1A 3WG7B 4KX7A 2ESVE 5AL8A 1E9PA 1JI1A 4M56A 3C75A 3CN3A 2BSDA 3EFFA 2B16A 1N3NA 4NP4L 1KTBA 4NAQA 1TVDA 1O9ZA 25C8H 2R29A 4AITA 3LZNA 5CMAA 4AZ8A 3D39E 5JW3H 5LGJB 2EXWD 2IFFL 3ZZQA 1QLFA 1RU9H 1JZEA 3N04A 4JFWA 4M62H 1PX8A 5ID0B 2HJFB 1SOKA 3EGXA 3MRPB 1HNYA 3UTZB 1V8HA 2J6EH 4U1HB 4M48H 3D05A 3NRPA 2W88A 2E7DA 3EHBB 5B3JE 1YQVL 3T3MF 5IVXA 1GL4B 3VXRB 3VTMA 3BUYB 3FT9A 2C9AA 3OAUH 4XBGB 2F54B 3LNHA 4JG9A 2VAAA 1MRDH 1VPOL 2YD7A 1PQZA 4ODVL 4YXLL 3DPBB 1OPGH 4FI7A 4KJQD 3CHSA 3IETB 2P8PB 2BFGA 2CRZA 3O2DL 5E99L 4NC1C 4N0CC 4XBGA 2XWBA 1FFPB 5E1AB 2XBDA 4JHWH 4TOYH 4WW2B 1WIOA 2ZUWA 3CVBA 3UG5A 2AANA 5D4JA 4F37F 3CNKA 1T1XB 3ES6A 2VH5L 4KKPA 4NQDB 5HGBA 5L4MA 5GRVL 4YHLH 3NDZE 4LSSL 3VG9B 3IDJA 4GMSH 1QMUA 3GZKA 5BV7C 1CO1A 2Q0ZX 1U21A 1JFQL 4FP8L 3MRJB 2AJZA 3OAYH 1RHHA 1F0LA 5IY5B 4OJCA 4PWFA 5DUJA 1U95B 2UWEA 3NZ8B 3EZJB 5H8DA 3AUVA 5C71A 1ZANL 4IYKA 2BVQA 3WNJA 1DJIA 3BAEL 2ITDA 4AG4L 1LXMA 3ZTNH 4K9EC 5IK3A 1TZ8A 1GXEA 2HT3D 1U2CA 4GEJA 2AF2A 3TJHC 4MJJA 4PLKC 2XDHA 1OB1A 1IGMH 5IROA 4NCC2 5KSBF 1CDIA 4YS4A 3PGFL 3UMNA 5CSBA 2XWTB 4IJ3B 1PZ5A 1YMHB 5MEPB 4LNRA 1FC1A 4KMTL 4LHQB 5E2TL 1A6ZB 4FERA 2VR6A 1JZDC 1RZ7H 1NPJA 3K3QA 5MP6L 5AUMB 1T6WA 1AQKH 1W0YT 1YYLL 3DX7B 2YN5A 1XF4A 4P2OC 2NXZD 5FECA 3KPNB 1WQVT 4K94L 1Y1UA 4KX8A 1VCAA 2H2SC 5DUBA 4IMKC 3SD5A 1U92A 4NQQA 3UJJL 4XMVA 1QEXA 4LPVA 5TDPB 3T1FB 3VA6A 5GGSY 1ZHNB 4TUKH 4RH4A 5KAQF 4HT1H 5D1QB 1BVNT 3T3PF 4OQTL 5KVEL 2VRQA 2R8SL 1X7TA 3NZHL 4JZJC 4IM8A 2ZTBA 1CE6B 5BXFA 3MREB 3O0RH 4XCCL 5I1GL 2BIHA 1N67A 1CS6A 4NZ8A 3TFKD 5EU3B 1KCVH 1BFOA 3M1OA 3FS9A 3FHQA 1P4LB 3IMUA 4K7FA 2YFNA 4Y2OB 5HDBB 3RPIA 4OIFA 5DHYB 3SQOH 2O72A 3FU9A 1WBYB 1ND0A 1HHGB 4RGNB 3F6LA 3VSVA 2YPVH 3DHMA 2IPTL 3TBSB 4KV5E 1JZ8A 1A6TA 4DW2L 4Z7UE 2VDKB 1DHKA 1F58H 2Q76B 1UOLA 3CAFA 3FUMA 4HU2A 5F7KC 1IFHL 1E4HA 3DTXB 3PS6A 4X4ZA 1DQDH 2CNYA 5J1AB 1IQWH 1SZNA 5EZOL 3V4PH 3S4SB 3FFCB 4A7TA 1Q9WA 1U8OA 4NZFA 5H37A 3UC2A 4LCIL 4AYID 1UJ3B 4YSPA 5L0QB 1N19A 3S36H 3NJJA 4JMXA 1G9MH 1BZEA 3VE0A 3QNXB 4I13B 5L9DL 2BXYA 3FQ2A 2BNQB 5DEJA 3Q5TA 3LS4L 1GGBH 1UASA 3L3OC 4NNYB 3RVXD 4BFFA 3M88A 4EIGB 2ZUVA 4JFEE 1A65A 4EBQL 1K85A 1PIGA 1RUMH 2WSDA 3IDXL 4FLHA 4K23H 3SDYL 4Y19E 4OUUB 1LK3L 3RUGE 4A7UA 3MLSL 4J6RH 2V5SA 4HEMA 4KTYA 1CLYH 2WXPA 1FVDB 4JO1H 1DVTA 3BI9X 4OJFL 4CMHB 1J18A 1Z1WA 1IAII 4YSRA 4GUQA 2I85A 1FDLL 4JZOB 1XCQA 2JXMB 3SPVB 2DQ6A 4PV1C 5L88L 5EO0B 3ULVF 1QRND 4NHCH 4M93B 3K71B 1RK7A 4P5SA 2VLRA 3HZMB 3IPFA 1MHEB 4P4RB 3S35L 4WNJA 4Y2DC 2H8PB 2H9GA 5C2BL 5EO1A 2XTJC 5CINL 4WU7B 3V0DA 3BN9C 2H6PA 5D1ZC 3HI6H 3KWWA 2YMXL 1P4BL 3HE6C 5T3XE 4H26B 3HE7B 3PY9A 4KRMB 3K71A 2HXAA 1Q4NX 3L1FA 1MCHA 5I28A 2WGXA 4R4NC 1QQDB 1JGIA 4TSCL 1XCQB 2JXMA 4TNVK 3VGAC 4M1DL 3ABLB 2AJSL 5F6IC 1G94A 1MIEH 1UA6L 1IJ9A 5FWQA 4ZPTB 2D3JA 3RX5A 3OQ3B 3TPKA 4KO5A 4YQXL 3PPSA 1ZIBA 3F7LA 4BINA 4X2UA 4PJBE 4JFEA 4OF0A 1MWAB 3JWOH 3MRGB 3X13A 4AZUA 2IMMA 2X6CA 1P4BH 4YHKH 2J25A 6TAAA 2BNUA 5E6RB 2HAZA 4GSUA 1MZYA 3VI4A 1ASQA 1UA3A 5DZNA 2PW2A 1T0NB 1HHJB 1XGPA 4JDZA 5DVMA 4TUJB 5JW4R 3G6AB 4HJJL 5MEND 3GZPA 1KFGA 4XX5A 4BJLA 1H3XA 3S4SA 4PRPB 4OCSH 3H7LA 3HRPA 1HH6B 4UQEA 4IS6A 2K6YA 3QPXL 5DJYA 2HZHA 4QXTA 4PJ9D 1WAPA 4P46C 4M4RA 2X1WL 3QC5X 1D2PA 4UNUA 3U1QA 4F7MB 2AXHA 4KK5D 3KPRB 3P11L 4Q6IB 1IBGH 2IADB 5AAWC 3PABA 3NACL 4HKJA 1BFVH 4N68A 4L8CA 5FUOH 5EOCL 5DHYA 2XFGB 3TASA 1MNUL 2ZAIA 3CFEA 4XXWC 5E2TH 3WS3B 4AKQA 1MCQA 4IRJC 4XMLL 5I5JA 1LWRA 3BPLB 3LPPA 1A8JH 4LVHC 4A6YB 3E38A 4FE9A 3QRGL 4J3VA 4MQTB 3RY4A 2B15A 3S36L 5IMMA 1DE4B 3V5DA 3WNMA 1EXUA 2APSA 4KUCD 1FJ1B 3N42B 2WB1A 4A7QA 4TYUA 2GJ6A 4JQVA 1FZJA 2BSSB 2DZEA 5C0BD 4N85A 1K9TA 1ZKAA 2C4FU 4P06A 2D7TH 5A2LH 5FYJH 1N12A 3MGOB 3QFGA 4P5TA 5FA4B 2OZ4A 5GGUA 1U92B 5H35B 2J3SA 5HYQB 1DSFH 2GQHA 4K71C 3IAQA 4QOKA 1DUZB 1MAKA 2Z4TA 3BQUD 4AEEA 4TVPE 3BPCA 5DJXA 2HLAB 5EUKA 4GINA 4S1RL 1GSKA 1RJLB 1FO0B 1U6AH 3ZKMC 4D8PB 1MF2L 2ZKMX 4NC2B 4CU8A 1YEFH 3VFRA 4G80B 4XMKL 5F8QC 1XF4B 1IM9D 1KGJA 3B8SA 3LH9A 3DX7A 2AJUL 4R2GB 1CLZL 4XZ4A 1EWHA 1KCVL 1V54B 3RWEB 4D0DB 2LFEA 4MBRA 2F15A 3QQDA 4Z7WA 4U1LA 4RFEB 5E2JA 4UBDD 5F1OB 1IAKA 3CV5A 2EVHA 3MOAH 4OLYL 1A7OL 3KYNA 2DYPD 5DJ6A 2M1KA 3MXWH 2NR6A 4LHUG 3R0MA 4QXVA 3U4EA 4ZD3H 4JZNA 4K5PA 1WHOA 2E9JA 1RD6A 5IJBC 2AV1A 1OP5K 3VDCA 4Z7OF 3N55A 5E8PB 4BA8A 5IOKA 4KAQL 5EO9A 4WFHD 1H6UA 2ITDB 4N2KA 1G7JA 2VSKB 5T1KD 1FA4A 4KKAC 4KTEL 5HYJD 1F56A 3D2UA 4WUUD 1LMIA 3IGKA 5CP3A 3OLEA 4NNPH 3PAVA 4O58H 3DSFL 4QRSA 5FX3A 1FF5A 4WUKL 2R0LH 4O2EB 4EBQH 1O6SB 4WU5A 3D2TA 3ZE1E 1HKLL 1I7ZA 4RRPG 4X9GA 5BV7B 2GEQA 3CC1A 5I73C 3FO0L 1FYTB 1WFUA 3L4TA 1R0AL 2BOBB 4HJJH 3PHQA 2DDQH 4UTAL 2R1WB 2ZYHA 4TS6A 1T2QL 4XWOD 1MI5E 3MJGX 4KKCD 2P9RA 4MAZA 3VWKA 2P8PA 5I19H 2VDPL 2XCMC 2VM9A 3OF6A 4UIKH 1FYTE 3ZR6A 1R3JA 2NY7L 1CJYA 1KJVB 1UD2A 3KNBA 4ZMZA 1HXYA 1TZIA 3J8F7 2EIZA 4E9SA 4MZ2A 5IV2B 3BDYH 2ARJA 1C5DB 1AXSA 3R1GL 1BZ9A 3Q2LA 2DMCA 1RSFA 1CZ8H 4PV9B 4MS8C 5LVEA 2KQMA 4PJHA 4IEFB 4ZBJA 2HLFC 2Y6TE 1E8YA 1VLXA 2A6JA 2GK0A 5IB1A 4OBSA 1UCTA 1NLDH 2EDLA 2QQNL 2Z7WA 3MA9L 3VNYA 1BZDA 2HJFA 4LSQH 1CC3A 2PP7A 3NAAH 4JR9L 4ELMB 2I07A 2DQTL 5ID1A 2Y6SD 3GSRB 3ZOAA 1PZDA 1BD2A 3GS0A 3ETBF 3HPLB 2VKXA 3B34A 4G3YL 2X1QA 5JUEL 1SOXA 4C56B 3CD4A 3CQPA 4IMLA 4MLIA 2ADFL 4L1TA 4BKLA 4EUPA 1TDQA 4QRBA 5CJXC 1THCA 2ZCZA 3MV8E 4H8QA 3CUPB 3B2UC 3FUDA 4N22A 2Q76A 2LV4A 5KS9E 3GKWL 3EYUL 1XH1A 3O4OB 3ZUCA 1HEHC 4N28A 1MFCH 2CO2A 1GZQA 4EXPX 4F57L 4Q7DA 3OJDA 2RJMA 3MLTA 1S2EA 4HUXB 1EANA 2R29L 3NA9H 3Q1EA 2A6DB 1OSEA 2G60L 3HRZB 3LAFA 3QWOB 4LCCA 4M5SA 4NQCD 1VSCA 3Q43A 3VFGH 3VXRE 4M7KL 5TK2A 5E51A 4MNHB 4JPKH 4ZPVA 2XVBA 1XWVA 2X6AA 2HVKA 3BP7A 1ZA6B 4HKZA 1TITA 4TSBH 2R69L 1BEYL 4RMTA 2WXLA 3SIKA 1IBGL 3IJYA 2PWGA 1FAIH 3TBWA 3MLPA 3M8OL 4NRZA 4OIBA 2XX1A 3BEVB 2ICCA 3UPAA 5LO7A 3Q9PA 2XVGA 2QLYA 3FSOA 1MJUL 3QXAA 3SYCA 5B38G 2XJKA 2VXTH 3Q8FA 4AG4H 4KTEH 1SF3A 1YJDC 2OMVB 4MA1B 3QK0A 3SE9H 1I7TB 2R9HD 1E27B 3BE1H 1KG0B 3AACA 2VC2B 3IJ8A 2NZ9C 2B59B 1NL0H 4E9XA 3TEXA 2R27A 1UVQB 2YRBA 4HIHB 1FH5L 1OM3H 5AVRB 2FD6L 3ZXAC 1R3LB 1GZPA 5I74C 5BOJA 3ULUL 4ACTA 2CLRB 3NCJH 3IN2A 4OF5A 2FX7L 5DQJA 1GYVA 2GW5A 5IMKA 4MS6A 2FSEB 1E2WA 4NXKA 4XH2B 3POHA 1D3CA 4ODTH 2XNAA 3DYMA 4X7SL 4XN2A 5EWIH 2XWTA 1NLDL 4PJIB 2HPOA 1XR9A 3QJFB 3B6SB 2J1KA 2WWNA 2PCXA 5KAQG 3M07A 4YO0A 3DJZA 3TLRA 1YECH 4KXCA 1N59A 2D3LA 5LQBL 3QW9A 4HLZG 3V6OC 5CBAB 2A6KA 1ILUA 5EU5A 4E42B 2DQDL 4F7TA 2A9NL 2PTTA 5FFLA 2ZWSA 3AG3B 5ITFA 5F9DC 3QCUL 4J4PC 1UTDA 4QXGL 5BRQA 3SEPA 1A1MB 1P7KA 2WBXA 4U1KA 4Y8DC 4GXVH 4FZEL 3LRLA 1AS7A 1Q0EA 2FO8A 3DURB 2VWEE 4ENZA 1CLOL 4JGJA 3A6BL 4F33A 3WS6A 3HHRB 4H44C 2C1OB 6FABL 3S48A 1B0GB 2VERN 1KLFA 1ERNA 3WJJA 2WSPA 2QQKL 2WB7A 3BC9A 4H8WL 4OBRA 2EO9A 2AVFA 5ABDE 2VLRE 3UYPB 3AY4C 4HCGA 4WI0B 5A7BA 5IUSA 4GAYA 5EPMA 2EXTA 3IK2A 2I27N 1SYVA 1V7ML 1XF3B 1FNHA 1T03L 1M1XA 2NXZB 5I1DA 5EOTB 3GPEA 3WKYA 4TULH 4KKBD 3F65A 3MRQB 2IWEA 2R56L 1MFCL 3DXAB 2V5RA 2WIIB 4M5ZL 3EO0B 5HYEA 4FTVE 4HFWB 5GZOC 3A4FA 4EI5A 4P2RD 2X4RB 1QI3A 3MNMA 3PNWB 1J8KA 1OT2A 5FS5A 2WQXA 2I9TA 4ZUTA 2B14A 3IF1A 1MHPL 4I9WE 1DLFL 1PAZA 5DWPA 4JFFE 1JZ6A 4LL9A 1KFAH 1UD4A 5GJSH 4QTFA 3TNNA 3WMPA 1THAA 5KVDL 2F53D 3TJHD 1EA9C 3WD5L 3L9RA 4BE6A 5I1CH 1L3WA 2G4EA 3LRSB 3G6JE 4TNVF 3F5WB 3ZTCC 4D9RE 1LO2H 5FO8B 4F5CA 1NA8A 3IDMA 2GTWB 3QZNA 3CFKA 2DQHL 5ICYA 5CN3A 1NCJA 2MMXA 4NAMA 5IT2L 3LKQA 2L7QA 1ZGLB 5F1IB 3MA9H 5HD8C 2WVTA 3BKMH 4OQTA 1K8IA 4AEHL 5J8OA 4XPTL 4XCFH 2BNQE 1C16B 1G7IA 1QFWM 1H3GA 1JGVH 4HIXH 2C1PA 5I0DA 1XH0A 5D4IA 4BGDA 1ORQB 1S7QA 2VUOA 1QA9A 5FKAA 3HS8A 5CWSB 4MCMA 5T1MB 2CSPA 3QDMD 3OKNB 5F3HA 5I8EA 3WY3A 1A7RL 1KN4H 1CFQB 3GLAA 4GSDL 2CHZA 1HL9A 1QUNB 4L0YA 4O00A 2UY7B 2FQFA 2QSQA 4ZUSB 4UT7L 4JGNA 5DD6A 1YUHB 1A14L 2VC2H 5TDOA 2PCFA 2DW5A 1X5XA 4B27A 5C9JB 3HIZA 1TZAA 3U0TA 1BWMA 2KLTA 4NRYA 4BSVB 3E9TA 3QDGA 5DMIH 1H8OA 3OB0K 3TN0A 1KN2H 4PJDE 5GS1A 4NHUB 3OAZK 1QWHA 4LQFL 1GCYA 2JTDA 1T7WA 1OQOA 1QFWH 1AH1A 4O9HH 1OOWA 4APQD 5FDWB 1OD7A 3EYOA 4RZKA 1HSBA 1UOKA 3RNKB 5E8OA 4TNGA 4DP0X 1D5ZA 5L2KD 4PJIF 4GAGH 4FTVB 1M9WA 4Y16C 4CDGC 4S1QH 1UUSA 3BIBX 4PJBB 3TJEH 4D0CA 5ILTH 1E9OB 3SOBH 1KT2A 4HWZB 3FRUA 2UZIL 4XNZC 5FYLD 3I9AA 2E4TA 2E8ZA 1IARB 2DI7A 2PWDA 2V5MA 3VH8B 1AE6H 3UBXI 2HG0A 1GS8A 4DQOH 1NCAL 4KJWC 2ZXDA 1FL5A 3WGUB 5JQ6H 5IT2H 2V7NB 5EUOB 5AKTA 4AT6A 4KZ0A 4LGRB 3V9CA 5AB2A 1NGYA 1I9JH 2FJSA 4JAMB 3VXTB 1B9KA 1F1AA 3RA7L 2G75A 2OM5A 2WLIB 4JFUA 1QUPA 3C5JA 2AQ3A 3VFNA 3FTGB 4V1DA 3F01A 3SDDD 3QI9D 5AFAA 1YY8A 5K9QG 1BQHG 2BJML 4EN3A 4XWGL 4FNLH 5CP7B 3K1DA 1A4JB 1FPTL 2CDFB 2G2PA 3FQNA 3LN5B 1XR8B 3VSQA 1MAMH 3QDJA 3C6EA 1YUKB 2E27H 1N4XH 2H1XA 5AVWB 3CHRA 1RCYA 4U6VH 4FRWA 1GC1L 4FEIA 4LSDA 1HL5A 3QUZA 5E9NA 3FRPA 2PO6C 3CLFL 2MPVA 1KV3A 1RPQA 3H4HA 1U3NA 4HUWB 4TPRH 2J56A 4ZNEE 3REVB 4Y4HD 4AV5A 1GGBL 2ICEB 4PM1A 1UGNA 1DUYB 3D0VA 4YR6A 3O3DA 2X3AA 2ZP0T 5DDHA 2AK4A 3AGVA 1J5DA 4DNLA 2IH3B 1R3IL 4PRNB 2PPAA 1B0WA 1S9XB 3KVQA 1S7RB 3ZMRA 4HZLB 4UTAA 1NPNA 1YDPB 3UO8B 1DQIA 2X4NB 2HFEB 5AVQB 5GSVB 1TETL 2CM6A 4H20L 3L6FB 4HIPA 4JFFA 5GHWL 3UAJC 4YSAA 5B39A 5IEHA 2CBMA 3G08B 2ALWA 1N5YH 1JBJA 4BQBA 3Q3GA 4YWGH 4HJEA 1QW9A 3OPZH 5AB1A 3S3JA 1TNMA 3MGAA 2MPAH 3L3OA 5AOLA 4QHLB 1FVEA 2CR6A 4OGYL 4QXWA 4MAYB 1CXLA 4NO0B 1RJZA 3CDZA 3QO1A 4HU8A 1H8LA 5TQ2H 1RZGB 1GR7A 3SY6A 2B9AA 1X5MA 3IN0A 4NI3A 1K4DA 1H6TA 4L1BA 4C83A 1B0RA 1T7VA 1IGIL 2VMDA 2X42A 5DR5L 1TG8A 1ECZA 2W0FB 4F8OA 1PSKH 3BGFB 1VHPA 3L48A 3ARFD 5E8EA 4HEPG 3L9YA 5ANMA 4YZWA 2Y7NA 4Y9EA 5DJCA 5L4IA 2BO0A 3QC6X 4MCNA 4N0RA 5CZXC 1MFVA 4QY8A 3HG1E 3QFJD 1YNTF 3VM7A 4I0PC 3P3YA 2J6EA 2ZONA 1AKPA 2F8XC 4OZGE 5F7HA 2HRHA 3HE7D 4AQOA 5CLZA 2FBJL 3QR0A 2VITB 1AC0A 3VGEA 4HOWA 2PNDA 5I8OL 1MJUH 1I1CA 3NJNA 4XP9H 2VLJE 3NJKA 1N2RB 5EC2B 4AL8C 3NFSH 1QPKA 4JKPH 4HWEH 4UMGA 3VI3B 3RWDB 1MCKA 5BUAA 3NJXA 4KRLB 4POZC 3PQYB 4F9LA 7PAZA 5GGTH 4ZXBB 1J86A 3UEQA 1WFJA 4KMTH 1JK8B 4ZQKA 1KYFA 3TONA 2ED7A 4BZ2L 4FLSA 3ZTJH 3F83A 5C09A 1QEWA 4BFBD 2VLKB 3DVGA 3PYCA 4GRLB 1BFVL 4N26A 1PKOA 3V6OE 1EFXB 2OMNA 3SPCA 4F7EA 3WXWH 2H5UA 4Y4FD 5MERB 2HT4D 2VXQL 2YAQA 1ZT1A 3BZEB 2Q7AA 2NY1B 5ELIA 3HJ0A 3ROLA 2L3BA 1WH0A 5ERWB 2Y07H 2TRYA 4ZYKB 4RIRB 1SXAA 3GSUB 4R2GD 3CZKA 2V4LA 4Y5YC 3RWJB 4LCWE 4E41A 5K9JL 4LLMB 5KSUB 2ED8A 1BQRA 3G5ZB 1IQDB 3FULA 3MO1A 4NM4L 3ZL4L 2DQEL 3KPMA 2QGDA 4I9XA 2FL5A 2XN9A 4G43B 2OYKA 1J5CA 1M42A 4ZUVB 4LBEB 4PIBA 4A66A 1G9MC 2WXQA 5IROC 4P46A 1T0OA 1USZA 3HUJB 5FCUH 2HMID 1RZJC 2P5PA 3I2CH 4BZ1H 4DUWA 1F4WH 2AV7B 3LYRA 4EPSA 1N70A 5DUPL 3EYSL 3EJYD 4UT6A 3KS0J 3U4BL 4IGBB 4YPJA 5FEBA 1I3RB 1TFPA 1CLCA 2GBTA 4IRSD 1SY6H 4XNYH 3PWLA 1FE8H 2EJ1A 3ABMB 4WFED 3E6HB 3QIUD 1XD0A 4JM2B 2OMYA 1RUKL 4GNKB 3RI5K 4R96B 1FWXA 4X9HA 3BDYL 2GKIA 3QG6B 2RMNA 5ISZE 2CXGA 1CBVL 1JK8A 1RMFH 4HMDA 4PJ8B 1LE9B 4WTQA 4ANXA 4Q9QL 3QJZA 1GJIA 4JFZH 1OIOA 5TH2A 4I18A 3PJNA 3T2QA 4ZFZB 1O5DT 5D2NE 3H4FA 2HRLA 3IDIB 3F7VB 2YQ2A 3T9WA 4FQQB 1CFVL 1ETJA 4JY4B 5IBLD 4M6OH 1VGKB 1NLBL 3G9VA 4X5XA 1WG3A 3HB3D 4KRPC 1L0QA 1N64L 2DQUL 5SWQA 3DSFH 2AK1L 3EG9B 3V0WH 2WTRA 4NKIH 3L9EA 3ULVE 3MMEA 4G7VL 1KNOB 1NCCH 4GY4A 1KF9B 3O41B 3UZEA 4EZLA 1RV6X 1LHZA 4UZSA 3MLRL 5IB3A 3TBYB 1G7LA 3TZVB 5E8EB 3L3KB 3B37A 3HG1A 3H9SA 2Y5TA 2EINB 2K8QA 4PRDA 2P4AB 2BC4B 2CA4A 2VL4A 3AU1A 3GBMH 4NZUH 4G1MA 2QLVB 3ZDZE 2H26B 1BBJA 43CAA 3FB6A 1M6OB 4L8DB 4XP1H 2IV9A 3AXLA 3D87B 1QBBA 3NMEA 4L29B 3L3OB 1IAOB 2GJZA 2DQCH 4L3CA 5C0FB 1FCGA 3EO1A 4JO4H 3LH2L 5CJXA 1ZS2A 2BNRE 4GS7B 4J3UA 4X5LA 4FX5A 5FCUL 2UVFA 1WZMA 2Q7YB 1IC7L 2P8MB 2Z31D 1CU4H 4TNWF 2XSKA 4WI9A 5KOVC 4B3EA 2WP3O 3QIBA 1P6WA 2V7HB 4S2SB 4MFHA 2QPDB 1PVHA 4NGHH 2K4AA 2OKMA 3HI5H 5AOMA 4MQXC 5F7FA 4GAFB 2BDNH 3HBQA 1R9FA 1L7TH 5DDHB 4R8WL 1E3ZA 3UCQA 1C9SA 1KPUB 3FTYA 5D5ME 3TTSA 3MBWB 4HKBB 1RVFH 3NIGB 4PJFA 9CGTA 5I18L 1I8MB 4KMLB 1W16A 2EDWA 4OI9A 1S7XA 4WJG3 3FN0L 4FULA 3DVIA 1DBML 4X6BA 3WJLA 4HD9A 1WC7A 1VFMA 3V5HB 5CJOH 2CUHA 1RZFL 3RJDA 2YBRB 4BHUI 1G7MB 5FGBC 5GJTH 1GH7A 2X4SB 2YEVB 4A2LA 3JV6B 3FF8A 4NP4H 3L2MA 1D5BA 4KK8D 3WIFA 3HFFA 4R4BA 3C60C 1UWEH 2VLKD 4WK0B 3NEXA 4GUOA 1NC2A 4HWEL 3JWDL 3K6SB 4PGCA 1QSEE 3QUYC 3HZ3A 1EDQA 1FL3A 3G6JB 2WO2B 3RTQD 1JGLH 3WNIA 3D51A 1AGBB 4EI0A 5A2CA 3APCA 2EIDA 5DMYA 3WTUA 1RMFL 2HH0L 2WUCH 1A4AA 4M3HA 1AZUA 2NSQA 3ATAA 1DCEA 4DO4A 1INQA 4GMTL 1ROCA 3DTDA 2UXFA 3ESNA 3T4AB 3WYRA 5IWLA 1G0DA 4I48B 2E9IA 3MRFB 2V3FA 4AT6B 1LEIA 1MJJA 4PD4J 1ONQB 5G4MA 5I24A 5T3XD 2IDTA 4Z7VA 1RERA 3HLKA 1U36A 5HHPB 5BZDA 3ZHLA 3E1ZA 3ULUF 3ARPA 3HI1B 4HSCX 1XBDA 3OHXB 2GG1A 3FT3B 3H54A 1TZHA 4G8EA 4OF3A 3QEUB 4WTWA 2JJSC 2JNZA 2CHWA 3OSKA 1FLRL 3UX9B 2FYYB 5IMOB 2AP2A 3FFDB 5FGCE 3MV11 4HC1A 2YXVA 1TJHH 3S96A 1UG9A 3QDME 4R7DB 2GFBA 1UM4H 3HS0B 1J1PL 1WZKA 5IREA 1WAEA 5A6IA 4ODWA 5L4JA 4JM2D 1AS8A 4OV5A 3JVGC 3UTSD 1TPXC 3PWPE 1T80A 4PWGA 4X50A 4CDHA 4CSPA 1II4E 1SHMA 1DBAH 5B3JF 4JRYA 2XETA 3MX0A 1BAFL 1HZHL 2L04A 3RB5A 3S4SG 3UGEA 1UD6A 3K6DA 2Z64C 5DTFB 4R9HA 3CFMA 5KVDH 1CQKA 1SEBB 1UKTA 1Z9MA 4XN5A 5HI3C 4CVUA 3LEXA 4W9ZA 4EQ3A 5I0XA 1CXFA 5ACZB 5CJQL 2QZ5A 5DD5H 1PW3A 2LAAA 1GA2A 2ITFA 5KYUA 3FTUA 4YPGA 4FQ1L 3ARBC 2C3GA 1G9HA 4RDQF 3T0EC 1LLAA 1M71A 3LEVH 3X3FL 5DD6B 1P9MC 5HGHA 2ALAA 5DQDH 2YZ8A 4JY6A 4R3SA 4ZW8A 4IBYA 4OH2A 1NSNL 1KIUB 3JWDH 3QB7C 2ICWB 2CBOA 1CFTB 2ZE0A 4RDQG 1WCBB 1AXIB 3FH5A 4JRYD 4Z95H 1T5XB 5CWSA 1WPCA 4KNTA 5D7JC 1EDHA 1S7UB 1TVHB 3R4DA 1FNAA 4XCYB 4RMSA 2X4QA 5B38A 2K45A 4EZJA 4ABVA 3CXHJ 1EZVX 3KS0H 1Q90A 2YD1A 3IDYC 2X1OA 1H0DA 4FKEA 1EK3A 1CURA 4X4MA 4LNVA 1PBYA 3PGCB 4NRXA 5GS3A 1CVSC 5JIKA 3TO4B 4DP8X 3F6IA 4G6FB 1H0DB 3OG4B 1EJOH 1Q0YH 1R5WB 3H7BA 4HFUH 2BSBA 4S0TD 2EH7L 2IG2H 4ONGH 4U49A 3TS8A 1A22B 2X3CA 4AYFB 4HWBA 1NBVH 1U8MA 2YPKB 3DIFA 3V5KB 1A4BA 5DZ9A 1FAKT 2RFXB 5D70H 3TXAA 4Z7OB 4LSVL 3SD2A 3QAZB 4JHBA 3BYTA 5F3BA 5I71B 4KK6D 2SEBA 3MV8A 5KW9L 1F6LL 4QF1B 5TE4L 1ET8A 2F1BA 4FFYH 2OW7A 1SQMA 5HYFA 1HL8A 5HGHB 3LNIA 4AIOA 2VB5A 5CZVH 2EDJA 2WINB 2UVEA 3SY0A 3ZO0A 3UJIL 2WBKA 2XQBH 1OAYL 1NGWB 3MV7D 4HK3J 4NM8H 5DTFA 3GSXA 2IQAB 5B8CB 2NY3C 3CHOA 3MV8D 2AHIA 2N4IA 4KROD 4UM8A 2AJVH 3DV4B 5CEXB 2CNZA 3G5WA 3ZDXF 4DPAX 1A6WH 2CRIA 1H8NA 4ADGA 3U9UA 3WL9B 2ZF9A 3L95B 1XGYH 4QLWA 3LKNA 4JO2L 5C6WH 4YE4L 3KDPB 5JHBA 2ZUQC 2VQ4A 1INDL 1B0GA 4JQXC 4APQB 2XV0A 1U8NA 3PGDB 2UXGA 1GHFL 4P2QD 4ZTOH 2PLTA 1NM9A 4ENEC 4LESA 4QRFA 1YYLH 2E9BA 5DJ0B 2AITA 5IM7B 3U30B 4K9EH 1A1MA 4NJ9H 1U41A 2B1AH 4Y9BA 3OHXA 5FC9A 1BPLB 3RUGB 2EAEA 3ZL2A 2AXJA 4ZSOA 3OZ9H 1IBBA 1HL4A 2JQAA 3Q44A 1NDMA 4IOFD 5C0AE 4AE1A 2V3DA 4YHYC 2BJMH 5J5EA 1IGTB 4U3HA 4YSCA 3TA4D 4ZMPA 2NY6D 4NIKB 1A0QL 2H2PC 3FCBA 3QWNA 1OARH 3KDMB 3QJFA 4H13C 3OKEA 5FO7A 3QORA 2ZCHH 1HU8A 1LEIB 2CAKA 3FF7A 1DCLA 3TYGL 1TQCC 5HHVL 4B7IA 2DKUA 4JNXA 4H88H 5EIIB 5IMKB 1YECL 1FYHB 2D8KA 3QCVH 5F9OH 1PLGH 3K6SA 5LQBH 2BY2A 1FGVL 1XHHA 2BS71 3QA3A 2HTLC 1JS4A 4FG2A 4F2MB 5J89A 2ZOKA 3HC0B 3OSVA 4O02H 1A9EB 3RIAK 1BOGB 4U4IA 5I76A 1UWYA 4OV6F 2O5YH 1RK0B 1AQHA 2B59A 3DBSA 2ADJB 1T66D 1MCIA 3LRGA 3WTXA 2E5EA 4FFWD 4MXWL 5CGYC 3VI3E 5F96H 3QPQD 1YEFL 1EJ6A 3FO1A 4MNGE 3SJVE 1P69B 2VDRL 3RFRA 4GO9A 3TBWB 5D72L 4ZK8A 5JHDD 4PRID 4APXB 5JXAH 1QKZL 2NW3B 1HINL 1TTFA 3C09C 3ESUF 3ARRA 4QYAA 5C3TA 1I8MA 1H3VA 1DJSA 4UMSA 5TGBB 5BVPL 3ZMEA 5TDNB 3D8MA 3FW6A 2XXGA 4WWKA 3QWOA 1EIBA 4W9DC 1QFUH 3GF8A 3UBHA 4Z3GA 3MLSH 5LGYA 4F2EA 4N1CA 3AM8C 1MOEA 3GB7B 5AZUA 1BP3B 3A6CH 3FO2A 5I1AA 1VKXB 4D9QE 3LEVL 3ZKXC 5JW4Q 3T6VA 5C0FA 2J8UB 4DGYL 1JHLL 5CR8A 4MASA 3HR6A 2X9ZA 1KBGH 4DP2X 3FMGL 3DK0A 2WWKO 5I8KH 1IEHA 3QIUA 3T8XA 3BZ4B 5C0RH 5AYTA 4NNPL 3RTQA 1RZIA 4EUPB 5C9KA 4RSVA 1L4IA 4C56A 3WO3B 3QJUB 3UERA 2AAAA 3HG0A 1NC2D 4N6RA 3DX9B 4S1DC 1JZ2A 2YD0A 1BD2B 1KEMH 3KLQA 2DQJH 1IT9H 1ZANH 1X6NA 4DERA 3E0GA 1RAMA 4PRDB 1U8KB 4OFIA 3QZWA 1S7WB 4W70A 3S5LB 3LKPA 1ZVYA 2NCMA 4MA8L 5JQ6L 2Z91B 2VAJA 3GXNA 5G5DB 1Q0XH 2APTA 3HG1B 4JDVA 5BJTB 5IB1B 3ZKND 1VGEH 4M1DH 5KBKA 3TCTA 5JOFA 4HJIA 2D03H 2AXFA 3C12A 2R1XA 3NN8B 4ONHB 5HDRA 3TBCA 3KYOA 4LKXA 3ZJAA 3MV9E 3HE6B 2IBZX 4X9YA 5ES4B 3HC4H 3BISA 5DYOB 3UC0H 1NMAL 4M4PA 4R97C 3TV3H 2V2XA 4AQ1B 1R4XA 3S8WA 3B9DA 2LU7A 4J3SA 4AENB 1FZMA 1OK0A 1GGYA 2WLMA 1URZA 4IK6A 3V52H 3X12B 4OFYD 5KBLA 1X6LA 3HMXH 2RR3A 2EC8A 3N41F 3N40P 1IKOP 2TRHA 4UV4H 1ZVSB 1FYTA 3EBIA 3U6RA 5K9OB 2CO3A 2GT9B 2DQEH 4IKKA 5E24E 3NESA 1NGQH 2I7OA 4IIQC 4OM0H 4XT1C 3LNDA 3K72A 4KZEH 2IGFH 5CAYB 4AKOA 2QJDA 2IGLA 3US9A 1XD1A 3BSZL 1WT5A 1MIMH 2E6JA 2VL5A 1QSED 1JUFB 3JV4A 3O8XA 1H5BC 4BH7A 4YN3A 3C8HA 3F84A 5JW5B 1ZSHA 4ABQA 1HYSD 1SLVA 2Z92A 3HEIB 4KXDA 4IGBA 4JREC 3H9SD 3RZCD 2XICA 2F5AL 2XWEA 1A7PL 1MW2A 4D8OA 2E7MA 4FC3E 3ARFB 2JLPA 3B9KC 3TCLA 3VD3A 1KJ2H 1HSAA 1HTYA 5FGRA 4EMZA 4H2AA 3RIFK 3ARFA 5EDXA 2IGFL 2A9DA 4R7NB 3S37L 2BZCA 5I5RA 4BK8A 3RWJA 4E41B 4YEEA 2BP8B 2NNCA 1OAKL 1B3JA 2R2CA 4L1HA 4X98A 1PZ3A 4Z7QE 2GBAA 4B9FA 5JPMB 3WIHH 2CR0A 3HN5A 2WVVA 2VN7A 3DI3B 3G5ZA 2QHRL 3MO1B 3FONA 2W65A 3LRHA 2MOVA 4F1SA 5DMGD 4GQZA 3TT1H 1HH9B 4G80A 5C6PB 2BMKA 3CC5A 1EV2E 3KYMA 2JKRM 2A4ZA 2R2HB 2VJXA 3PP4L 5GS0L 1QW8A 2KUTA 2DMKA 5AZEH 1DUZA 5HVFB 1JYVA 1HZHH 4UB0L 5CKAA 5E6YA 1WAAE 1GGTA 4ZXBA 5E4OA 1MAJA 2PR4H 3P4MB 4GBXC 4UTBH 5C08E 3MRNA 1LO5B 1UD3A 3FCGA 3RGBA 4YDIH 5J1SC 2YXWA 3N44B 3BIKB 4N90E 4ZW5A 1WFMA 3QUXB 5HXMA 1R5VA 4CW1A 4ZQKB 1JZFA 3V95A 1WAAF 3X2QB 4YFEA 1TU2A 1OO2A 3NZSA 3GS4A 1J0IA 2CCLA 5IVNA 1FZMB 1CYGA 3BZFB 5F7AA 2PKDA 5C0BB 3FPXA 4QY8B 2NZ1A 3NJIA 2MOQA 5DJ2A 4Y4HA 3NK3A 1FNSH 4JFXB 4P9HH 3APNA 1NMCC 3BUBA 4TMPA 3EDJA 2AXFB 1Y07A 3V7AE 3EOTL 1KB5L 4Z78B 5FXCH 4JCWA 4N8CL 4RDBA 1F8TL 4RGND 1OGTA 2WCPA 1S7WA 1MCNA 5DJCB 3FC8A 3FB5A 1G9EA 5DC4B 4HBCH 3UTQB 4J1UB 1M7DA 3O45B 1YNLH 4PRBB 5E70A 2L7UA 1RI8A 2IPUG 2HUEA 1L6ZA 3IGUA 2DMGA 1FNGB 5LXVA 3A6CL 4TNWK 4TQIA 3QI9A 3KAAA 2HWZL 2PW2B 4AL8L 5C6TL 4UT9A 2EE9A 3Q3GB 1E9QA 4N8PA 4DHLA 4B9JA 5IUCA 1BVNP 2DLFH 4JFFB 2EYSB 4KZEL 3PCYA 5SV3A 4CKVX 5C09D 4HZLA 2AQSA 5J1TC 1WICA 4OU3A 3I85A 5B1JC 4M8RA 3P4LA 5JMOC 3FO2B 3IFOB 4ZZKA 3BGMB 4N0YL 1B4JH 5G2NA 5KVGE 4YHYB 2RAMA 1HVXA 2WBJC 3LSOB 4PJEF 5B39G 4X7DC 4NPJA 1ORSA 5AW5B 4ZOBA 3PJSB 1QATA 1OAQL 4NPYA 4ZUUB 3UJIH 1Z5LA 2BVTA 1QQDA 3L3DA 3V4VB 4BFJA 1HHIB 4MQ7A 4W6YB 4V11A 4XPGL 1ZLSL 5EEZA 4JHWL 3HE7A 4TOYL 4AX3A 3DX3A 4MSWB 2E46A 5AZEL 4AIZB 4MB4A 2EO7A 1PEZA 3FRPB 1CIDA 1UZ8B 1QP1A 4PGZA 2DOCA 4YXLH 2Y36L 4WAFA 3GXIA 2EE2A 5C0CD 4NO5A 4MD0A 2TSBA 3K80A 5C86A 2HSIA 2DJUA 3QG7H 5EF0A 4WO4D 3VXUA 3IMBA 3MACH 2GIMA 3MOBL 5KSAB 2WXKA 3FQNB 3LN5A 3CZUB 5MENE 5EO0A 2EUWA 2NLJB 2PYED 4OCXH 5D7KD 1J87A 1OY3B 2FO1A 1AOHA 1E4XI 1VRSA 3F7PC 3MJ9H 3WD5H 2A83B 5AYUL 3L3JA 4NCC1 3AT8A 2CUMA 1K72A 3BH8B 2WM0A 4ZNCD 1R3IH 2WQSA 3QDGD 2C7UB 2GJ6E 2DJSA 4JUSA 1NC4B 2WLZA 5F0MB 4UINH 1NMBH 4CVWA 3A4DA 3OKKB 4NZRH 1SEQL 1JV5A 1NGZB 1DJGA 4XMLH 3IDYB 1SVZA 2QVFB 3R19A 5I1IH 3O4OC 5FO7B 5CU9A 4EAEA 3FOMA 5FAAA 5K9KB 1YNKH 5D1XE 2MEJB 1CXEA 1AKJA 1NGYB 1SQ2N 5TF1H 1ZSDA 4AMXA 1ZLWK 1NINA 1G5AA 4B41A 5EUOA 4FNUA 2JJTA 2XN2A 4NPKA 1DQKA 1FL5B 3QIBC 4ALAL 3GXFA 1AYRA 4PJ5B 1AO7D 3M86A 2F5AH 4Y89A 1UB5A 4WI6A 3V0IA 4F7KA 2QSVA 3G5VA 5ICXA 2CIKA 3NJMA 4HSAC 3HHSA 5ABZA 4OGQC 1T04B 4I3RH 2JJSA 4Q58C 2FJGA 3WN5B 1E9OA 1AC6A 1A3LL 3M6DA 3RNKA 1HOCA 2WMPB 1YEWA 1HDMA 1WIPA 3SKUD 3PGDA 1OSYA 1L0XA 5DF0A 3RX7A 4ORZC 4AVIA 1P4LA 1M6UA 4K7FB 3QUZD 4PJ6A 5FA3A 1UXWA 3IE9A 5EUOF 4OF8A 3MLYL 2DEWX 1K3IA 4Z0BH 4JDTH 2WYTA 3GDBA 2OL3B 1YNTA 3QDJD 5T5FA 1HNFA 2XWDA 4FXKA 4U0QB 1JP5A 4YE0A 1P84J 1SN0A 2Q3AA 3FQRA 2LU4A 4M1GH 1CI5A 4DH2A 4KWUA 1CPUA 4XPTH 3ILDA 3KVPA 5JXED 2OMXA 1A4KB 2L7EA 3FHEA 2GK2A 4JKNA 5F1SA 4F92B 2O5ZL 3VGFA 1JVOA 3QR2A 3UP6A 2H7WA 3TN0B 1TJHL 4EI5D 3SJVD 2A0LD 5EU7C 5EU6E 3KPOA 5LBSH 1JTOA 5KSVB 2KMWA 2IALB 2ZOOA 1OLZA 4OQ1A 4YDLC 1U33A 3U7YH 2XVLA 4U0RC 3TZVC 3UACA 3S35H 1U8IB 1IM9B 5BPPA 2E7BA 3VG0H 4L5FL 1NOLA 2G5UA 1GYAA 4LP4A 4Z7VE 3AITA 3IFPB 2VDNB 2XA8L 4OLVH 4NKQB 3T65B 4C55A 1F2XK 3JYCA 1NIFA 2PMZA 2NY4C 4M7JH 4CVZA 4NRXB 4MXQC 4Y5VB 1RSYA 1T3FA 1UUNA 3TVMD 3V0VA 2X5PA 1DANU 1LWJA 3MRHA 1MHCB 3LKQB 2C4FT 3FBQA 1GPOL 2HX9A 3ULUC 4U1GB 1HCFX 4UQ3B 7CGTA 3G6DH 1NKGA 2QR0B 3EJZD 1LVEA 1D6EB 1K8IB 1ODUA 4LOVA 2VR4A 2VW6A 4AYSA 4Y5YB 4NZTH 2WXMA 4FQ1H 4XNMB 2F5BL 5TE7H 1IM3D 2LGNA 2DWXA 3CFKB 5ICYB 1NMBL 1C08A 3BPOC 3LD8C 4XPAL 3NZ8A 1KGYE 4NSKA 4OSUH 3RX8A 2EXYD 1SM3L 1ZLWH 1WGOA 2CCVA 4OZFG 1O7DE 2PYFB 2CG9X 5HDOA 1DJWA 3PREA 4J3OD 4PB9L 5EBMA 2ARJQ 4FKHA 2WWMD 5HGBB 2DLIA 2IPTH 1VEMA 4M00A 2VLLA 2WXJA 5KYUB 2I9TB 3DOIA 2UYLB 3DO7B 4U6TA 5F88A 5JHLL 2YAHA 3D3VE 4X9FA 5CO1A 5ESQA 2F54D 3LEXB 3ARBA 3STZB 2FBOJ 5I30L 4K8RL 1NCAH 1R33A 4Q56A 4Y8AA 5FFOA 2AJSH 3ETSA 3R8BB 4FMKA 1IFRA 5EIVA 2ATPA 3PAYA 1CVRA 4WO4B 2K9FB 3QEQD 5EOTA 4ZFGH 2RH0A 5BZWB 1E4XL 1HQRB 1DBJL 1XF3A 1IC7H 3F7YA 3QDMA 1RZKH 5E6SB 3B3IB 1MW3A 1SJEB 3WAJA 1YEKH 4AV4A 4OV5B 1QPXA 1JF6A 3BP5B 1T0MB 4JFDE 2PPFA 4GFTB 2E7LC 4YBQC 3OVUB 2AJ3A 4JHUA 4AY0A 4XCEB 4ODVH 1XGUA 2ATKA 2C9PA 5KSBA 3MROA 4Q14A 1JHKL 4GRLC 5C8JA 4YWGL 3DURA 4AQEB 3ZHDA 2C7FA 2EEDA 5CHNB 2NUPA 3ARTA 4KHTL 2O5XL 3TPUA 4MCYA 3U2SB 1FDLH 5AKSA 2FAUA 4YX2L 1OP9A 2EH8H 4NQCA 1G1KA 5CP3H 2C9XA 3HBZA 1A2YA 4Z7VB 2VDOB 2F53A 5MP6H 4PJIA 4HGKC 3EJUA 1AQKL 2EECA 1MFUA 3EYQC 2FX8H 1KTLA 4YO0B 3PNRB 4LIQE 1JNLL 2W81C 3UBXB 2GHZA 2EIKB 1KGIA 4YE4H 3T4AA 3FRPG 4HULB 5AG8A 4GRMA 5BO1H 5CILL 2CLRA 5DQJB 3LIZL 4KKLD 5FKPB 1XB8A 1H15A 3CDGB 4L5FH 1TYEB 3SGKC 3PL6D 2I32A 1F4XL 2MRYA 4PB0H 5C0JB 4PJ7A 4MD5A 5T3ZL 2R7EB 1AQDA 1CE1L 3MC0A 3PWJB 1S5IH 3GJFA 5AOJA 1E5ZA 1BD2D 2AJXL 4ANUA 3DO4A 3BWZA 3FCTA 2OSYA 5F7DB 1NFDF 1TYRA 1G7MA 4Y7OC 2BRRL 4JRWA 3WJLC 1OCRB 5CLWA 3BEVA 1NAKL 1FH2A 1OTSD 3FU7A 5JORB 1F00I 3OKLB 3MLVH 3NVQA 4LVOC 2MCG1 1I7RA 2BWIA 2DQGL 4LLQA 1HIMH 2D3NA 5C7XH 2HVKB 2X09A 3QQ9D 4L4TB 1G7HA 2BIQA 2XQBL 1IGIH 1BGXH 3VW3H 4QT5B 4G42A 4OZIE 1C8PA 4MJ5A 5IW1B 5K1JA 4F2FA 3LKSA 5IBTL 4O2CA 4P3CH 2X0WA 2Z65C 5J0BA 3J2PA 3EGSB 4HZ1A 4ZFGL 1QACA 1UC6A 1XO8A 2JELH 2ZX7A 3GJEA 4EO5A 2V2WB 1GZQB 1J1OL 2AEQH 2WUBH 2GCYA 4Z7QB 1TTRA 5IB4B 1FG9C 2ZPKH 1WTGT 1BFTA 4G70B 4TUKL 3CZEA 3NIFF 5IR1A 4PGBA 2X2YA 2WANA 4NM4H 3ZL4H 2OR9H 4Z7QF 5E0FA 3VFSA 2QHRH 1KEML 3EYVA 2JKLA 2HKAA 3P0VL 2WNKA 2CA3A 3RFZC 2P47B 2ZT9C 2WV3A 3KLAB 4DPBX 15C8H 1CG9A 3II1A 1BQLH 3RVTC 3LB6C 4HKXA 3D08A 3C6LC 1NH6A 4V2BA 4S11A 3RIAF 5DD3H 2I9LA 5HYJA 4BKLB 2CD0A 4GBXB 3OMNB 4XOBA 1WA0X 3TWCH 4EE2A 3GMLB 1F3DH 1F86A 3K2UL 2ENJA 1ESOA 3HJEA 2ESVA 4YHPA 1GGCH 5M7QA 4X4XA 5C0GA 3L3KA 2MH4A 1JWSA 1CDJA 4GKNA 3UDWC 2GSIB 1X5GA 5CNHA 1RZKC 2NR6D 3WHE1 4MJ4A 4P4KC 2ROYA 3BD5A 1FLTX 3FQ4A 3PWPA 1N26A 4LPCA 1IFHH 2EDXA 5F2FA 3WEXB 1EGJL 4PJHB 4ZO6A 4PJIE 4PP1C 5CSZA 2JI1A 1YSOA 5DEFA 1VGKA 3U6XS 3VWKB 5L9DH 5L6YL 4LU5H 1ETZA 1FNEB 3P77B 4KH2A 4P5MA 5ECJE 4CRPA 3GMQA 3PP3H 2L0DA 3QG7L 4ZFZA 4PJDF 3D33A 3KNBB 3DC0A 3LXUX 5EF3A 1F4YH 1BF2A 3BQUA 1PPIA 3V7AG 4LLWB 1XSIA 1LE9A 1E6JL 3CVHA 3IB4A 5IVZB 1M2VB 4OGXH 3EYSH 4IHBA 4AMWA 1GGIL 3UL4A 2YBGA 1VEPA 5KVDE 3EIFA 4PSRA 5TE4H 1QTYT 2X4UB 4WFGD 1L5GA 2V5TA 3T08A 4QD2E 5DU7A 3NIFB 4ORGA 5EH1A 5IJVA 1BMWA 4ONOA 2F1EA 3DTUB 4U1IA 4PLNC 4JHZA 2P24B 1KEGL 4IKNA 2V6HA 3KPQA 4MA7L 1EMTL 1PG7H 3MJ7A 1IKFH 4H40A 4L23A 1H5BA 5EC1B 4ODXA 4WEBL 5E00A 3PJLA 1I85C 4LF3B 2OYLA 4U33A 4DP5X 3DWTA 2JK5B 3HUJA 2OZ4L 4NDMA 1EERB 3JTTA 1IAKB 1AHWB 2Z8WC 1PTZA 3AREA 3F00A 3PWVA 1YYMH 4GQPH 5DLML 1X5ZA 2QQQA 3U4EB 3LKRA 1UWGH 3ZKQD 1I1YA 4I3RL 4I77L 1XZWA 1QBLL 1HZKA 1U0QA 1KGXA 3ECUA 3BDXA 5HYJE 4IBTA 2PXYA 3SGJA 3ECQA 2FB4L 3V9EA 4PWJA 5IHUH 4JFOA 4PJGF 3TWCL 1ITCA 4Z0XB 1YPZF 3BUDA 2WSKA 2F58L 1FVCB 2ZXCA 4JRYE 5IW3A 2CLZA 4E5XB 2DY2A 3MRBB 3DX8B 2HRGA 1KJ3L 4UQBA 1RZ7L 3PHSA 4JB9H 5EEUA 4JFED 4OM1L 4YUEH 2HLAA 1FNSL 2BPBA 4LASH 1DFXA 2GJ6B 5H2BB 1V3JA 5I66A 2F18A 5HYQA 2UZYB 4FQJL 3GPSA 1VZHA 4J6IA 1L9MA 4AQ8A 4HH8A 3HG2A 2YKKA 5I5MA 5IB5A 3B2XA 4NZRL 3QXUA 4BRVA 5CGMA 3AB0C 1QFHA 5T5NG 2AJVL 5TPWH 1DQJA 5CCJA 5L8LB 2HFFA 3KJ6L 4XRCA 3P9MA 5DJAA 4YSSA 3IGLA 2E76C 2VM3A 1FJ1A 1L9NA 3AMLA 3CFTA 3B9VA 5T1KA 4ZX3A 3GHEH 5KVGL 3NCYP 2DM4A 5HHMB 5AW4B 2VZTA 3SPIA 1OEZW 2ENPA 3SCMA 2XG4B 2VDKH 1I1FB 3P0GB 3U46A 2J20A 1E67A 1SXCA 3K6IA 4MMYB 2LLNA 4KMQA 4I18C 4YGVA 4R0LB 4GRWF 4XP6L 3DGDA 2DYPA 1E5BA 3PABB 1XZ0A 4DKTA 2WWOA 2VW7A 3D12B 3FQXA 4HPOH 1FLRH 4M4RB 4D9LL 4LCYA 1B2WH 4DEPC 1B0RB 2WLLB 1I1YB 1K4DB 3AJ7A 2CKBB 2MHAA 5FB8B 4IBSA 5ILTL 1AGEB 3PHOB 3QO1B 3MZTA 4G9FD 4LVEA 3QUMB 5CS7A 3WFEL 1ZT7B 5B4MC 3CLEH 4ODSL 2JK5A 3TF4A 3LVEA 3KM2A 2VLJD 5IB2A 1DL7L 1QNZH 2JKJA 2VXUH 2ZXBA 4QOKD 5E00B 3BD3A 3X3GL 3B2VL 2BNUB 3U7AA 3KMDA 3ASOB 3KPQB 5F7EH 4P5TD 4F58H 1UXLA 1HKLH 3WU1A 4N20A 1MWAA 3IRZA 1J9TA 3C6LD 5JYMA 3LB6D 5FV2A 3I6KB 3V6FA 3FB7A 3C6LB 4I3SH 4TQ8A 1DZ0A 4Z76B 1ZV5A 2Y69B 3MYZA 4M62L 4BH8A 4G7VH 2X0VA 1RZJL 4LRIA 1LK3H 3LIZA 4L3FA 4BSWB 2CLVA 1UZ6F 1H3TA 3REVA 2Q20A 1AACA 5FM5O 4G5ZH 1AXTH 1QNZL 5A2KH 1IGML 4FHJA 2QZQA 1BJ1J 1FZOA 1MWAL 3B2VH 3CZFA 1CF8L 4IU2B 2VO5A 2EDBA 4XN4A 1CT8B 2X05A 1AR1B 2AZUA 2Q5BA 4GSDH 4G3YH 4DGVL 1FNEA 2CHNA 3P77A 4JZOA 4RFNB 1KBVA 2CLVB 2YO3A 4OTXL 2P42B 5JIQA 4AJYV 1S8DB 4DZ8B 1G87A 1NFIA 2VE6A 5HHQB 2O26U 4O4YH 1YC8A 1F90H 1LK2B 1MVFA 1QBAA 3ISWA 1VERA 2PYEB 2Z1KA 2D03L 4TVUA 4ZW6A 1J9QA 2Y1YA 2DTMH 3V0GA 2YA1A 3CFJB 4S10A 4K7PH 4YDVA 3CH8A 4Y2NA 4ONGL 2CZNA 3ME0A 1IVLA 2Y06H 4X6EA 2YMXH 4MNGB 1OPOA 4DQAA 4EDXA 3LZRA 2OSLB 3O0RL 5F0LB 3V0JA 3PL6C 4AK1A 1UZGA 1P7QB 5GRZA 5F6HJ 1ADQA 3VH8A 5A1AA 4KKLC 1UJ3A 4XTRC 4DN4L 2W92A 3D69B 2VJ0A 2B20A 3UZVB 2LU3A 1YEJH 3V9FA 5EOQH 1FFOA 1W72A 2AVGA 4G6KH 1X5YA 5EBGA 2DLGA 5B1KA 2BCKB 3STBA 3DETC 1C5CH 4N8VB 5EU6B 1UM5H 4JO3H 5DQDL 4ZMOA 4QNPE 1BFOB 2BVUA 1I1FA 3U46B 3AWGA 4DVBA 1HSBB 3IPBA 2YQGA 2VN5A 1HHGA 5C2UB 3BZ5A 3BVUA 4Y1AA 2VC2L 3DVNB 4Y2OA 2FEEI 4PLOB 4GG6E 1QRNA 3BWAA 1JTPA 2VUKA 3OC5A 3SO3C 1TR7A 4MAUH 1NCGA 4OGAD 3F6JA 3ABZA 1JAEA 2D7OA 2Y7QA 1DL7H 4PW4A 5TDPA 3GIZL 1I9RL 3V0FA 4MB3A 3J27A 3ZBMA 5ICUA 4QTIH 2AEPL 1WWCA 4ZS7H 4QRPD 3CCHB 3FUNA 4LK4A 2FK9A 2JVUA 3V6ZA 3IFLL 4IHOA 5FECB 4I9WD 4OLZH 3D09A 1KPRB 3MRBA 5D7IF 3F85A 4KU1A 1MCOH 1HHHB 3O4LA 2EYRA 3EZ8A 2QV4A 2CLZB 1QUNA 2P3YA 2VXVL 4Z0XA 1CFQA 5I0YA 1AE6L 1O7DC 1YMHA 3MYJB 4U1JA 4DQOL 2LHAA 5CFHA 3WUZA 3OGCA 1I1AB 1K6QH 4FG6D 1MW0A 3E2HB 3IJ7A 3MNVB 1NCHA 3H42H 4NQED 1ORQA 1S7QB 3F58H 2CMRL 1DVFA 1I8KB 2IG2L 5MEQA 1J8RA 1IIKA 4FLOA 4OJYA 1D5XB 2EDNA 2EADA 1LL1A 1A0QH 2Y5QA 5EBWA 1CR9H 1SPDA 4PY7B 5C07E 4N2GA 1L9RA 1D9KA 1QBMH 5DC0A 3BPOB 3LD8B 3PF2A 3CVHL 4I89A 2FGWL 3O2DA 3RIFF 3OAUL 1H5BB 5EC1A 1OM3L 1JNHA 4GMTH 5LAXA 3LZFH 2OAAA 3OB8A 5JLZA 2OMWB 3O11A 4Z6AT 3W9EA 2ZWKA 2XFXA 2NY0B 3OWRA 4M8UA 4YL4A 5IJVB 4ALAC 1Z3RA 2BVQB 4A68A 2K1MA 4M5YH 5EA0H 4ALAH 2HWZH 1EGJH 2UXVA 3TVMC 3RGVC 3T3MB 3MLRH 5E6UB 3CLFH 4A39A 1N68A 2UWEB 3Q6FB 4FNTA 5EHFA 4WTXA 3QULB 1M2VA 1RHHB 1SBBA 5E1AA 3EOBA 4R5XA 4EKJA 5DHDA 1XSKA 3GO1H 1CFSB 3ZE2E 1AD0B 1HESA 1KXHA 2VN4A 3K6OA 4K15A 2YC1B 5I1DB 1KELH 4UI2A 4FZEH 4WI5A 2JIXA 5ISZB 2I7SA 4Q9QH 3GRWH 1JVKA 1Q94B 4QWWD 1DQDL 4LL4A 3DPBA 4LRNH 2C34A 4EI5C 1ZHKB 3CZJA 3GI8H 5C0AB 5K69A 4KX9A 3SBQA 2WO4A 5HPMB 1KYDA 3BVWA 2EZ0D 5KJ7E 1S78C 1Y7VA 4FQCL 4HJ1A 1PFCA 5DSCB 2DLTA 4I1PA 1KBPA 3S6CA 2L8AA 3HNTL 1UURA 4KDTA 4UOW1 2NSMA 4XXCA 4XMPL 5CMAB 3GKZA 4B96A 3BKML 1C08B 5C0GB 3D9AH 1WZ1L 5LN8A 3AWFA 3Q9QA 4P99A 4W6WB 4FA6A 5ALBH 1S9KC 3P4OB 2PO6A 3HRZC 3X1GA 4E42A 5CZVL 2EABA 1EHXA 5LAXB 5TFSH 1M4KA 4OCWL 1OPGL 1N59B 3MCYA 1G7PA 1IE4A 2YWZA 4NQEE 5E2UH 3RX9A 5EEVA 1D9KD 3L1GA 3M7OA 4Y5VA 1CZ8L 5F9OL 1MLBB 2XY1A 3T3PE 5I75B 3MNDA 3WBDA 2WYIA 1PX4A 5AW3B 3FH8A 4LU5L 1IEAB 1DVFD 4G7SB 1G1CA 1PLBA 5F7UA 3BE1L 4LHUB 2VGLM 3NJLA 4K94H 1CGYA 1Q9LB 2AKRB 1ZLVK 1DP0A 2G0LA 4ANKA 4XCNB 4YIQA 5IESL 2LU5A 3N6YA 4K7PX 3EJRA 3LKSB 5E9DD 5CLYA 4OFPA 4PS4L 5DUML 2NTSP 1FHGA 2A9CA 3GK8H 1E8WA 4Q6YA 3KPOB 2FUTA 4AGPA 3ECBB 4F7PA 3QNZB 5DK0A 5I74B 2AQRA 1SJVA 1F1DA 2DBLH 1BW8A 2K7PA 3EDEA 4QRPA 2R4SH 3GZOA 1QLEH 4X7EC 4L3EB 1OE3A 3VFGL 2ZNWA 2W59A 1DQQB 4L3ED 5E4EC 4MD4A 1GMIA 3RWIA 1HILB 1MIML 2C3VA 2CHDA 3NFSL 3VXSD 5KUKA 4HUKB 4BFIB 1ZY9A 4IQHA 4GPVA 4TQEH 1HILA 2C3VB 5ENWB 3SE8L 3ZRSA 3NGBB 4YHML 3ZZ1A 2MIZA 3FCTB 1F58L 4NUMA 4UU9A 3KPTA 4Y4KB 4M5YL 4IIZA 1BVOA 1UXWB 1QRNB 2A9NH 3OLDA 1E7UA 2IANA 1DVSA 4XXDA 2NSXA 4DVBB 1KCUL 5L2KB 2WN3A 1H15B 4FQIH 4HXAL 4P23D 4GXUN 3FOLA 2ICES 4TVPD 2AGJH 8CGTA 4LPXA 5GGRY 4QRRA 1IX2A 1I9EA 4KDWA 1F4WL 4QI3A 2WLKA 2FH8A 2B0SH 2OCJA 5IP4A 2FVNA 5E94A 2Z7UA 4OIIH 4BRJA 3VQ2C 4NQCB 3DGGA 4K8RC 2QFPA 4GP5B 3R1GH 4ICXA 2VN3A 5CXPA 1I1AC 4D0BB 1OVZA 4AXWA 4DZBA 4HJ0D 4JANA 1EO8H 2FT8A 4Q52A 1HCZA 5L6YH 1CMOA 3D18B 1DEEB 4G6ML 4HGWA 5J57B 1TEYA 4XCEA 1EHLH 1N8ZB 2WY3B 4CMHC 4WW1A 4D3CH 5MI0C 1LO3L 1MFEL 4IEFA 3VFVA 3BP5A 1RLWA 5BZXA 1R46A 3QZBA 3UH8A 3D0LB 1KFAL 5GJSL 4Y4KD 3DOSB 2CHXA 3VGDA 1JGEB 1FG2B 2NLJA 1RQ5A 3AQDA 3QDMB 3SBPA 2V9RA 1JNNH 1M56B 3QXVA 5IVOA 3LMJH 5CEYA 5J6HB 4JG0H 3MFFA 3GUTA 1JF5A 4RGNE 2YSSB 5C0AA 4XVUC 4TUUA 4ZDHA 1P7BA 4DGYH 2CBTA 3D85B 4ZMWA 4L2YA 4AW4A 4KI5F 1UB6A 2JKIS 5ESQB 5DMKB 2EUZA 3GXMA 4LAJH 3CDFA 3HG5A 4KXBA 3DO7A 3SPGA 4OI8A 4U6XA 3ARGD 4L3EE 2IAMC 3TH2T 2IOOA 5D1XD 1HHIA 1W80A 2YAOA 4ZS6C 3ILQC 4MNQA 5HI4D 5GSRA 3ZHFA 1J9CT 5I71C 3RL1A 4WU5B 3IDUA 5KVFE 2XQ0A 4MMXB 5DWUL 1FPTH 1XQ4A 4ZW7A 3ZE0B 1KYOJ 3A0OA 4E41E 5IQOA 4IKIA 5D1QD 1FZKB 3LSOA 2EDKA 4JRXB 1PY0A 1K8DA 5T3ZD 4Q4IA 1A7OH 2DJ4A 4ZX4A 3C6LA 5D7SH 4GBXD 1UH4A 3LNEA 2XBTA 1OAUL 3L3GA 4FQXD 5HHMD 4A37A 4YHLL 1I8IA 3BVVA 1JGDA 1D6EA 2VDOH 4WHTA 5FW7A 2AV1B 1NKOA 3LH2H 4HJUA 1WWBX 4OD1L 1A6PA 3FFCE 4WJ5A 4ONFH 4NOBA 3IU3A 1I4FB 1E6JH 2VLJA 1NUNB 4AYDC 3ZR5A 1FIGL 6PCYA 3OXSA 3UTPD 4PY7A 2HT2D 4DGIH 4AEIL 3D52A 2X89D 4B9PA 1I8UA 3QUMA 4OZIF 4OIIL 4XB8A 4MAYD 4RFEA 4NO0D 4TLSA 5ALCL 4XAWL 3HCVB 4TSCH 1NBQA 3EFOB 2G30A 3IT8D 4HFUL 4NQCE 4D0DA 3BCFA 5ANME 1HKFA 5DJZA 3FQXB 1XF1A 3ARDC 3Q8BA 5CBEA 2HN7A 4U3CA 3T6ZA 3B9KD 1OCOB 5KYYA 4TUOA 1ZTXL 2NY2C 1S6NA 1FO0A 4WFHE 1DFBH 4D8PA 1KTRL 2OMUA 3SBWC 5KJ4A 1KJMB 3RZCC 1JNJA 4NKIL 4R84A 2OJEB 3BFQG 3V4PA 1HFUA 4PRHA 4HD5A 2OZNA 4JFXA 1G9NH 4JGMA 4LSUL 3S5YA 3SCMD 3KL0A 4OT1H 4U3SA 4WJKB 4PJDB 3P0YL 4IIQB 2HLEB 2BSSA 2A3TA 3ARYA 1YMMD 2OXGB 5LB1A 1ASOA 1MVYA 1TU2B 1V7NH 4U1NB 2HFFB 4XRCB 3ZKSD 2YIHA 4CBZA 4DO5A 2E74C 2Y7QB 3L5IA 1TQBB 5DMIL 3QAZC 4MKMA 2HTKC 4OZHB 4W4OA 3DVNA 2XPYA 1XGYL 6FABH 1R47A 4RCAA 2A2QT 1ZAGA 1CLVA 3W56A 4UINL 2BOLA 2Z9TA 3CJJA 2ZOLB 5T3XL 3POCA 1KDJA 3MRDB 3NCBB 3VXQB 3T77A 2YGQA 1XT5A 3NFNB 2EKSA 1FFQA 5C0ND 4FXLA 4HS6A 4Y4FB 1G6RH 3DMMC 1UFGA 1D5IH 2APVA 3LPOA 1R24A 1NGQL 5MHSE 2J5LB 4Q9RL 2PXYB 3NPSC 5BOZG 5KZCB 4WW2C 3ZKNC 2ZICA 1RFDH 3G6AA 1T21A 2GJRA 1HHJA 2OTUB 3QGVA 1U91A 1QTSA 3BUIA 1IO4C 2FWUA 5FUZH 4HMEA 3THMH 2XTJE 2OX5B 3B83A 4CSZA 1N7MH 1LNUB 2ZJSH 4J2XA 4FCAA 1A6VL 1GKOA 2QPUA 4MDIB 2EDEA 1FV1B