2WO9A

Mmp12 complex with a beta hydroxy carboxylic acid
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
b'GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACROPHAGE METALLOELASTASE
publication title The Identification of Beta-Hydroxy Carboxylic Acids as Selective Mmp-12 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 47
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2wo9A00
2QPJA 4EFSA 1JAQA 4ILWD 2I47A 1CQRA 1ROSA 1R1JA 3N2UA 1Y0VA 1OS2A 1RM8A 456CA 1MMQA 2KRJA 1FM1A 1SRPA 3F15A 3ZXHA 4GWNA 2EROA 3I7IA 4JA1A 1R1IA 3RTTA 3VTGA 2AYKA 4G9LA 3DSLA 4GWMA 3EDHA 2DW0A 1GO7P 4GQLA 5I4OA 1RMZA 5D7WA 1ZS0A 1SLNA 2E2DA 2W14A 3OHLA 1IAEA 3HYGA 5BOYA 4DPEA 4AYKA 3G5CA 3KECA 4JPAA 3LK8A 4PKVA 3KEJA 5CXAA 1UMTA 2XS4A 3O64A 2OXWA 3LQBA 4FVLA 1AKLA 2OY2A 1XUCA 2D1OA 5BPAA 1QJJA 4DF9A 1BUDA 3F16A 3LMCA 2J0TA 1I73A 4PKRA 4PKQA 966CA 1I1IP 3EDGA 1CXVA 3LILA 3AIGA 3AYKA 1I76A 830CA 1USNA 3EWJA 4PKWA 4Q1LA 3LIKA 1HFSA 1S4BP 3RTSA 4GF1A 1K7IA 1PWUA 1KUIA 4H1QA 4WK7A 1PWPA 2JIHA 1QUAA 5D3CA 1H71P 1CIZA 5D1TA 1L6JA 2W13A 1KBCA 1OM8A 1G4KA 4AUOA 1ZP5A 2RJPA 1K7GA 3HY9A 4CTHA 2W12A 3LE9A 1C7KA 3B92A 3LUMA 3EDIA 4IUWA 3KRYA 2K9CA 3LJGA 1ASTA 3F18A 4PKUA 1JJ9A 2ERPA 4FU4A 3LUNA 1ATLA 3HDAP 1BQOA 5D1UA 4GR3A 1MNCA 2X3AA 2E3XA 4GR8A 3U1RA 1MMPA 2FV5A 3TSKA 3G42A 1EUBA 1G49A 1J7NA 3F19A 1MMRA 1Y8JA 4XM7A 5I2ZA 3LJTA 1R55A 4J4MA 1PWWA 1SATA 1CGLA 3Q2HA 1D8MA 3HB2P 4JP4A 3TS4A 4H82A 1IADA 1SMPA 2HU6A 4PKSA 4FXYP 4DD8A 1YP1A 4L6TA 3DL1A 4H84A 3I7GA 1IABA 2OVZA 2JNPA 1SU3A 3EHXA 1KAPP 4HMAA 3VI1A 1CGEA 2JT6A 4XM6A 2L0RA 2WO9A 1Q3AA 1ZXCA 1SLMA 1JAOA 2OW0A 2OW2A 2FV9A 2CLTA 1FLSA 2DDYA 5B5PA 3N2VA 2RJQA 3CKIA 2TCLA 4IJOA 2X3BA 1UEAA 1XURA 2XS3A 5I12A 4H76A 4I35A 4AXQA 1HOVA 1EB6A 1JK3A 4H3XA 1GXDA 2MLRA 3O2XA 3AYUA 3NX7A 3LKAA 3MA2A 1BIWA 2WOAA 4H2EA 2Z2DA 2J83A 1PWQA 2N8RA 1GE6A 5D2BA 4H30A 3OHOA 1JIWP 2ERQA 4L63A 3DNGA 5JMYA 1G12A 2K2GA 2SRTA 1KUHA 2A8HA 2YIGA 2D1NA 4A3WA 2USNA 1JAPA 3LJZA 2DDFA 1GO8P 3UVCA 3LIRA 4WZVA 3Q2GA 5BOTA 2WO8A 1BKCE 1R54A 1Z3JA 2Y6CA 5I43A 1JIZA 2O36A 1D8FA 1BZSA 4I03A 4ON1A 3HBVP 3DPFA 3EHYA 2X3CA 2O3EA 1C8TA 4QKZA 3LGPA 4H49A 4PKTA 1DMTA 3HDBA 2OXZA 1G05A 1ZXVA 3V96B 2MZEA 3GBOA 4G0DA 4JQGA 3TT4A 1BKCI 4XBHA 1WNIA 1XFWA 1XFUA 1JKYA 1ND1A 1UMSA 1KUFA 4GUYA 2OW1A 4GR0A 1KUKA 3HY7A 3F1AA 5I0LA 4ZR5A 1IAAA 2JT5A 2MZHA 3LQ0A 1HY7A 1YQYA 2Y6DA 2AIGP 3ZUKA 3F17A 3TVCA 3B8ZA 3ELMA 1O0TA 1XFZA 1BM6A 1OMJA 1BKCA 1BSWA 4HX3A 1CGFA 4XCTA 2DW2A 3HBUP 1FBLA 1GKCA 2POJA 1BQQM 1C3IA 1DTHA 2X7MA 3LEAA 4DV8A 1UTZA 4AIGA 2OXUA 2YB9A 1AF0A 4A7BA 1QJIA 2PJTA 4WF6A 1HV5A 3E8RA 1ZVXA 3USNA 5CUHA 2MLSA 4WKIA 3B2ZA 1QIAA 1OS9A 4WKEA 2V4BA 5L7FA 3KHIA 1D5JA 5LABA 1K7QA 3KEKA 4R3VA 1JANA 3KWVC 5D1SA 1XFYA 1BUVM 1YOUA 5CZMA 2DW1A 3WV1A 1XFXA 1GE5A 3L0TA 3P1VA 3L0VA 2W15A 1O0QA 4L19A 1XUDA 1IACA 1Y93A 1GE7A 2OW9A 1MMBA 1GKDA 4XM8A 2JSDA 3P24A 1QICA 1XFVA 1QIBA 1CAQA 1YCMA 4JIJA 1HTDA 1B8YA 1ZTQA 5L79A 1A86A 1G9KA 3BA0A 1UTTA 5H8XA 1EAKA 1OM7A 1JH1A 1OM6A 3SHIA 3WV3A 5I3MA 3DPEA 1D7XA 4FXQA 2OVXA 3K7NA 2OI0A 1IAGA 1R1HA 3EDZA 1B3DA 1HFCA 2CKIA 5B5OA 3KMEA 3KMCA 3WV2A 1OO9A 4IN9A 1A85A 1PWVA 2OZRA 3DWBA 2OY4A 2W0DA 3ZVSA 3K7LA 1CK7A 1AYKA 1KUGA 2MZIA
chains in the Genus database with same CATH superfamily
2QPJA 4EFSA 1JAQA 4ILWD 2I47A 1CQRA 1ROSA 1R1JA 3N2UA 1Y0VA 1OS2A 1RM8A 456CA 1MMQA 2KRJA 1FM1A 1SRPA 3F15A 3ZXHA 4GWNA 2EROA 3I7IA 4JA1A 1R1IA 3RTTA 3VTGA 2AYKA 4G9LA 3DSLA 4GWMA 3EDHA 2DW0A 1GO7P 4GQLA 5I4OA 1RMZA 5D7WA 1ZS0A 1SLNA 2E2DA 2W14A 3OHLA 1IAEA 3HYGA 5BOYA 4DPEA 4AYKA 3G5CA 3KECA 4JPAA 3LK8A 4PKVA 3KEJA 5CXAA 1UMTA 2XS4A 3O64A 2OXWA 3LQBA 4FVLA 1AKLA 2YUFA 2OY2A 1XUCA 2D1OA 5BPAA 1QJJA 4DF9A 1BUDA 3F16A 3LMCA 2J0TA 1I73A 4PKRA 4PKQA 966CA 1I1IP 3EDGA 1CXVA 3LILA 3AIGA 3AYKA 1I76A 3DTKA 830CA 1USNA 3EWJA 4PKWA 4Q1LA 3LIKA 1HFSA 1S4BP 3RTSA 4GF1A 1K7IA 1PWUA 1KUIA 4H1QA 4WK7A 1PWPA 2JIHA 1QUAA 5D3CA 1H71P 1CIZA 5D1TA 1L6JA 2W13A 1KBCA 1OM8A 1G4KA 4AUOA 1ZP5A 2RJPA 1K7GA 3DTIA 3HY9A 4CTHA 2W12A 3LE9A 1C7KA 3B92A 3LUMA 3EDIA 4IUWA 3KRYA 2K9CA 3LJGA 1ASTA 3F18A 4PKUA 1JJ9A 2ERPA 4FU4A 3LUNA 1ATLA 3HDAP 1BQOA 5D1UA 4GR3A 1MNCA 2X3AA 2E3XA 4GR8A 3U1RA 1MMPA 2FV5A 3TSKA 3G42A 1XAXA 1EUBA 1G49A 1J7NA 3F19A 1MMRA 1Y8JA 4XM7A 5I2ZA 3LJTA 1R55A 4J4MA 1PWWA 1SATA 1CGLA 3Q2HA 3HB2P 1D8MA 4JP4A 1TVIA 4H82A 3TS4A 1IADA 1SMPA 2HU6A 4PKSA 4FXYP 4DD8A 1YP1A 4L6TA 3DL1A 4H84A 3I7GA 1IABA 2OVZA 2JNPA 1SU3A 3EHXA 1KAPP 4HMAA 3VI1A 1CGEA 2JT6A 4XM6A 2L0RA 2WO9A 1Q3AA 1ZXCA 1SLMA 1JAOA 2OW0A 2OW2A 2FV9A 2CLTA 1FLSA 2DDYA 5B5PA 3N2VA 2RJQA 3CKIA 2TCLA 4IJOA 2X3BA 1UEAA 1XURA 2XS3A 5I12A 4H76A 4I35A 4AXQA 1HOVA 1EB6A 1JK3A 4H3XA 4L7AA 1GXDA 2MLRA 3O2XA 3AYUA 3NX7A 3LKAA 3MA2A 1BIWA 2WOAA 4H2EA 2Z2DA 2J83A 1PWQA 2N8RA 1GE6A 5D2BA 4H30A 3OHOA 1JIWP 2ERQA 4L63A 3DNGA 5JMYA 1G12A 2K2GA 2SRTA 1KUHA 2A8HA 2YIGA 2D1NA 4A3WA 2USNA 1JAPA 3LJZA 2DDFA 1GO8P 3UVCA 3LIRA 4WZVA 3Q2GA 5BOTA 2WO8A 1BKCE 1R54A 1Z3JA 2Y6CA 5I43A 1JIZA 2O36A 1D8FA 1BZSA 4I03A 4ON1A 3HBVP 3DPFA 3EHYA 2X3CA 2O3EA 1C8TA 4QKZA 3LGPA 4H49A 4PKTA 1DMTA 3HDBA 2OXZA 1G05A 1ZXVA 3V96B 2MZEA 3GBOA 4G0DA 4JQGA 3TT4A 1BKCI 4XBHA 1WNIA 1XFWA 1XFUA 1JKYA 1ND1A 1UMSA 1KUFA 4GUYA 2OW1A 4GR0A 1KUKA 3HY7A 3F1AA 5I0LA 4ZR5A 1IAAA 2JT5A 2MZHA 3LQ0A 1HY7A 1YQYA 2Y6DA 2AIGP 3ZUKA 3F17A 3TVCA 3B8ZA 3ELMA 1O0TA 1XFZA 1BM6A 1OMJA 1BKCA 1BSWA 4HX3A 1CGFA 4XCTA 2DW2A 3HBUP 1FBLA 1GKCA 2POJA 1BQQM 1C3IA 1DTHA 2X7MA 3LEAA 4DV8A 1UTZA 4AIGA 2OXUA 2YB9A 1AF0A 4A7BA 1QJIA 2PJTA 4WF6A 1HV5A 3E8RA 1ZVXA 3USNA 5CUHA 2MLSA 4WKIA 3B2ZA 1QIAA 1OS9A 4WKEA 2V4BA 5L7FA 3KHIA 1D5JA 5LABA 1K7QA 3KEKA 4R3VA 1JANA 3KWVC 5D1SA 1XFYA 1BUVM 1YOUA 5CZMA 2DW1A 3WV1A 1XFXA 1GE5A 3L0TA 3P1VA 3L0VA 2W15A 1O0QA 4L19A 1XUDA 1IACA 1Y93A 1OZ9A 1GE7A 2OW9A 1MMBA 1GKDA 4XM8A 2JSDA 3P24A 1QICA 1XFVA 1QIBA 1CAQA 1YCMA 4JIJA 1HTDA 1B8YA 1ZTQA 5L79A 1A86A 1G9KA 3BA0A 1UTTA 5H8XA 1EAKA 1OM7A 1JH1A 3DTEA 1XM5A 1OM6A 3SHIA 3WV3A 5I3MA 3DPEA 1D7XA 4FXQA 2OVXA 3K7NA 2OI0A 1IAGA 1R1HA 3EDZA 1B3DA 1HFCA 2CKIA 5B5OA 3KMEA 3KMCA 3WV2A 1OO9A 4IN9A 1A85A 1PWVA 2OZRA 3DWBA 2OY4A 2W0DA 3ZVSA 3K7LA 1CK7A 1AYKA 1KUGA 2MZIA
chains in the Genus database with same CATH topology
2QPJA 4EFSA 1JAQA 4ILWD 2I47A 1CQRA 1ROSA 1R1JA 3N2UA 1Y0VA 1OS2A 1RM8A 456CA 1MMQA 2KRJA 1FM1A 1SRPA 3F15A 3ZXHA 4GWNA 2EROA 3I7IA 4JA1A 1R1IA 3RTTA 3VTGA 2AYKA 4G9LA 3DSLA 4GWMA 3EDHA 2DW0A 1GO7P 4GQLA 5I4OA 1RMZA 5D7WA 1ZS0A 1SLNA 2E2DA 2W14A 3OHLA 1IAEA 3HYGA 5BOYA 4DPEA 4AYKA 3G5CA 3KECA 4JPAA 3LK8A 4PKVA 3KEJA 5CXAA 1UMTA 2XS4A 3O64A 2OXWA 3LQBA 4FVLA 1AKLA 2YUFA 2OY2A 1XUCA 2D1OA 5BPAA 1QJJA 4DF9A 1BUDA 3F16A 3LMCA 2J0TA 1I73A 4PKRA 4PKQA 966CA 1I1IP 3EDGA 1CXVA 3LILA 3AIGA 3AYKA 1I76A 3DTKA 830CA 1USNA 3EWJA 4PKWA 4Q1LA 3LIKA 1HFSA 1S4BP 3RTSA 4GF1A 1K7IA 1PWUA 1KUIA 4H1QA 4WK7A 1PWPA 2JIHA 1QUAA 5D3CA 1H71P 1CIZA 5D1TA 1L6JA 2W13A 1KBCA 1OM8A 1G4KA 4AUOA 1ZP5A 2RJPA 1K7GA 3DTIA 3HY9A 4CTHA 2W12A 3LE9A 1C7KA 3B92A 3LUMA 3EDIA 4IUWA 3KRYA 2K9CA 3LJGA 1ASTA 3F18A 4PKUA 1JJ9A 2ERPA 4FU4A 3LUNA 1ATLA 3HDAP 1BQOA 5D1UA 4GR3A 1MNCA 2X3AA 2E3XA 4GR8A 3U1RA 1MMPA 2FV5A 3TSKA 3G42A 1EUBA 1G49A 1J7NA 3F19A 1MMRA 1Y8JA 4XM7A 5I2ZA 3LJTA 1R55A 4J4MA 1PWWA 1SATA 1CGLA 3Q2HA 1D8MA 3HB2P 4JP4A 3TS4A 4H82A 1IADA 1SMPA 2HU6A 4PKSA 4FXYP 4DD8A 1YP1A 4L6TA 3DL1A 4H84A 3I7GA 1IABA 2OVZA 2JNPA 1SU3A 3EHXA 1KAPP 4HMAA 3VI1A 1CGEA 2JT6A 4XM6A 2L0RA 2WO9A 1Q3AA 1ZXCA 1SLMA 1JAOA 2OW0A 2OW2A 2FV9A 2CLTA 1FLSA 2DDYA 5B5PA 3N2VA 2RJQA 3CKIA 2TCLA 4IJOA 2X3BA 1UEAA 1XURA 2XS3A 5I12A 4H76A 4I35A 4AXQA 1HOVA 1EB6A 1JK3A 4H3XA 4L7AA 1GXDA 2MLRA 3O2XA 3AYUA 3NX7A 3LKAA 3MA2A 1BIWA 2WOAA 4H2EA 2Z2DA 2J83A 1PWQA 2N8RA 1GE6A 5D2BA 4H30A 3OHOA 1JIWP 2ERQA 4L63A 3DNGA 5JMYA 1G12A 2K2GA 2SRTA 1KUHA 2A8HA 2YIGA 2D1NA 4A3WA 2USNA 1JAPA 3LJZA 2DDFA 1GO8P 3UVCA 3LIRA 4WZVA 3Q2GA 5BOTA 2WO8A 1BKCE 1R54A 1Z3JA 2Y6CA 5I43A 1JIZA 2O36A 1D8FA 1BZSA 4I03A 4ON1A 3HBVP 3DPFA 3EHYA 2X3CA 2O3EA 1C8TA 4QKZA 3LGPA 4H49A 4PKTA 1DMTA 3HDBA 2OXZA 1G05A 1ZXVA 3V96B 2MZEA 3GBOA 4G0DA 4JQGA 3TT4A 1BKCI 4XBHA 1WNIA 1XFWA 1XFUA 1JKYA 1ND1A 1UMSA 1KUFA 4GUYA 2OW1A 4GR0A 1KUKA 3HY7A 3F1AA 5I0LA 4ZR5A 1IAAA 2JT5A 2MZHA 3LQ0A 1HY7A 1YQYA 2Y6DA 2AIGP 3ZUKA 3F17A 3TVCA 3B8ZA 3ELMA 1O0TA 1XFZA 1BM6A 1OMJA 1BKCA 1BSWA 4HX3A 1CGFA 4XCTA 2DW2A 3HBUP 1FBLA 1GKCA 2POJA 1BQQM 1C3IA 1DTHA 2X7MA 3LEAA 4DV8A 1UTZA 4AIGA 2OXUA 2YB9A 1AF0A 4A7BA 1QJIA 2PJTA 4WF6A 1HV5A 3E8RA 1ZVXA 3USNA 5CUHA 2MLSA 4WKIA 3B2ZA 1QIAA 1OS9A 4WKEA 2V4BA 5L7FA 3KHIA 1D5JA 5LABA 1K7QA 3KEKA 4R3VA 1JANA 3KWVC 5D1SA 1XFYA 1BUVM 1YOUA 5CZMA 2DW1A 3WV1A 1XFXA 1GE5A 3L0TA 3P1VA 3L0VA 2W15A 1O0QA 4L19A 1XUDA 1IACA 1Y93A 1GE7A 2OW9A 1MMBA 1GKDA 4XM8A 2JSDA 3P24A 1QICA 1XFVA 1QIBA 1CAQA 1YCMA 4JIJA 1HTDA 1B8YA 1ZTQA 5L79A 1A86A 1G9KA 3BA0A 1UTTA 5H8XA 1EAKA 1OM7A 1JH1A 3DTEA 1OM6A 3SHIA 3WV3A 5I3MA 3DPEA 1D7XA 4FXQA 2OVXA 3K7NA 2OI0A 1IAGA 1R1HA 3EDZA 1B3DA 1HFCA 2CKIA 5B5OA 3KMEA 3KMCA 3WV2A 1OO9A 4IN9A 1A85A 1PWVA 2OZRA 3DWBA 2OY4A 2W0DA 3ZVSA 3K7LA 1CK7A 1AYKA 1KUGA 2MZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QPJ A;  4EFS A;  1JAQ A;  4ILW D;  2I47 A;  1CQR A;  1ROS A;  1R1J A;  3N2U A;  1Y0V A;  1OS2 A;  1RM8 A;  456C A;  1MMQ A;  2KRJ A;  1FM1 A;  1SRP A;  3F15 A;  3ZXH A;  4GWN A;  2ERO A;  3I7I A;  4JA1 A;  1R1I A;  3RTT A;  3VTG A;  2AYK A;  4G9L A;  3DSL A;  4GWM A;  3EDH A;  2DW0 A;  1GO7 P;  4GQL A;  5I4O A;  1RMZ A;  5D7W A;  1ZS0 A;  1SLN A;  2E2D A;  2W14 A;  3OHL A;  1IAE A;  3HYG A;  5BOY A;  4DPE A;  4AYK A;  3G5C A;  3KEC A;  4JPA A;  3LK8 A;  4PKV A;  3KEJ A;  5CXA A;  1UMT A;  2XS4 A;  3O64 A;  2OXW A;  3LQB A;  4FVL A;  1AKL A;  2OY2 A;  1XUC A;  2D1O A;  5BPA A;  1QJJ A;  4DF9 A;  1BUD A;  3F16 A;  3LMC A;  2J0T A;  1I73 A;  4PKR A;  4PKQ A;  966C A;  1I1I P;  3EDG A;  1CXV A;  3LIL A;  3AIG A;  3AYK A;  1I76 A;  830C A;  1USN A;  3EWJ A;  4PKW A;  4Q1L A;  3LIK A;  1HFS A;  1S4B P;  3RTS A;  4GF1 A;  1K7I A;  1PWU A;  1KUI A;  4H1Q A;  4WK7 A;  1PWP A;  2JIH A;  1QUA A;  5D3C A;  1H71 P;  1CIZ A;  5D1T A;  1L6J A;  2W13 A;  1KBC A;  1OM8 A;  1G4K A;  4AUO A;  1ZP5 A;  2RJP A;  1K7G A;  3HY9 A;  4CTH A;  2W12 A;  3LE9 A;  1C7K A;  3B92 A;  3LUM A;  3EDI A;  4IUW A;  3KRY A;  2K9C A;  3LJG A;  1AST A;  3F18 A;  4PKU A;  1JJ9 A;  2ERP A;  4FU4 A;  3LUN A;  1ATL A;  3HDA P;  1BQO A;  5D1U A;  4GR3 A;  1MNC A;  2X3A A;  2E3X A;  4GR8 A;  3U1R A;  1MMP A;  2FV5 A;  3TSK A;  3G42 A;  1EUB A;  1G49 A;  1J7N A;  3F19 A;  1MMR A;  1Y8J A;  4XM7 A;  5I2Z A;  3LJT A;  1R55 A;  4J4M A;  1PWW A;  1SAT A;  1CGL A;  3Q2H A;  1D8M A;  3HB2 P;  4JP4 A;  3TS4 A;  4H82 A;  1IAD A;  1SMP A;  2HU6 A;  4PKS A;  4FXY P;  4DD8 A;  1YP1 A;  4L6T A;  3DL1 A;  4H84 A;  3I7G A;  1IAB A;  2OVZ A;  2JNP A;  1SU3 A;  3EHX A;  1KAP P;  4HMA A;  3VI1 A;  1CGE A;  2JT6 A;  4XM6 A;  2L0R A;  2WO9 A;  1Q3A A;  1ZXC A;  1SLM A;  1JAO A;  2OW0 A;  2OW2 A;  2FV9 A;  2CLT A;  1FLS A;  2DDY A;  5B5P A;  3N2V A;  2RJQ A;  3CKI A;  2TCL A;  4IJO A;  2X3B A;  1UEA A;  1XUR A;  2XS3 A;  5I12 A;  4H76 A;  4I35 A;  4AXQ A;  1HOV A;  1EB6 A;  1JK3 A;  4H3X A;  1GXD A;  2MLR A;  3O2X A;  3AYU A;  3NX7 A;  3LKA A;  3MA2 A;  1BIW A;  2WOA A;  4H2E A;  2Z2D A;  2J83 A;  1PWQ A;  2N8R A;  1GE6 A;  5D2B A;  4H30 A;  3OHO A;  1JIW P;  2ERQ A;  4L63 A;  3DNG A;  5JMY A;  1G12 A;  2K2G A;  2SRT A;  1KUH A;  2A8H A;  2YIG A;  2D1N A;  4A3W A;  2USN A;  1JAP A;  3LJZ A;  2DDF A;  1GO8 P;  3UVC A;  3LIR A;  4WZV A;  3Q2G A;  5BOT A;  2WO8 A;  1BKC E;  1R54 A;  1Z3J A;  2Y6C A;  5I43 A;  1JIZ A;  2O36 A;  1D8F A;  1BZS A;  4I03 A;  4ON1 A;  3HBV P;  3DPF A;  3EHY A;  2X3C A;  2O3E A;  1C8T A;  4QKZ A;  3LGP A;  4H49 A;  4PKT A;  1DMT A;  3HDB A;  2OXZ A;  1G05 A;  1ZXV A;  3V96 B;  2MZE A;  3GBO A;  4G0D A;  4JQG A;  3TT4 A;  1BKC I;  4XBH A;  1WNI A;  1XFW A;  1XFU A;  1JKY A;  1ND1 A;  1UMS A;  1KUF A;  4GUY A;  2OW1 A;  4GR0 A;  1KUK A;  3HY7 A;  3F1A A;  5I0L A;  4ZR5 A;  1IAA A;  2JT5 A;  2MZH A;  3LQ0 A;  1HY7 A;  1YQY A;  2Y6D A;  2AIG P;  3ZUK A;  3F17 A;  3TVC A;  3B8Z A;  3ELM A;  1O0T A;  1XFZ A;  1BM6 A;  1OMJ A;  1BKC A;  1BSW A;  4HX3 A;  1CGF A;  4XCT A;  2DW2 A;  3HBU P;  1FBL A;  1GKC A;  2POJ A;  1BQQ M;  1C3I A;  1DTH A;  2X7M A;  3LEA A;  4DV8 A;  1UTZ A;  4AIG A;  2OXU A;  2YB9 A;  1AF0 A;  4A7B A;  1QJI A;  2PJT A;  4WF6 A;  1HV5 A;  3E8R A;  1ZVX A;  3USN A;  5CUH A;  2MLS A;  4WKI A;  3B2Z A;  1QIA A;  1OS9 A;  4WKE A;  2V4B A;  5L7F A;  3KHI A;  1D5J A;  5LAB A;  1K7Q A;  3KEK A;  4R3V A;  1JAN A;  3KWV C;  5D1S A;  1XFY A;  1BUV M;  1YOU A;  5CZM A;  2DW1 A;  3WV1 A;  1XFX A;  1GE5 A;  3L0T A;  3P1V A;  3L0V A;  2W15 A;  1O0Q A;  4L19 A;  1XUD A;  1IAC A;  1Y93 A;  1GE7 A;  2OW9 A;  1MMB A;  1GKD A;  4XM8 A;  2JSD A;  3P24 A;  1QIC A;  1XFV A;  1QIB A;  1CAQ A;  1YCM A;  4JIJ A;  1HTD A;  1B8Y A;  1ZTQ A;  5L79 A;  1A86 A;  1G9K A;  3BA0 A;  1UTT A;  5H8X A;  1EAK A;  1OM7 A;  1JH1 A;  1OM6 A;  3SHI A;  3WV3 A;  5I3M A;  3DPE A;  1D7X A;  4FXQ A;  2OVX A;  3K7N A;  2OI0 A;  1IAG A;  1R1H A;  3EDZ A;  1B3D A;  1HFC A;  2CKI A;  5B5O A;  3KME A;  3KMC A;  3WV2 A;  1OO9 A;  4IN9 A;  1A85 A;  1PWV A;  2OZR A;  3DWB A;  2OY4 A;  2W0D A;  3ZVS A;  3K7L A;  1CK7 A;  1AYK A;  1KUG A;  2MZI A; 
#chains in the Genus database with same CATH topology
 2QPJ A;  4EFS A;  1JAQ A;  4ILW D;  2I47 A;  1CQR A;  1ROS A;  1R1J A;  3N2U A;  1Y0V A;  1OS2 A;  1RM8 A;  456C A;  1MMQ A;  2KRJ A;  1FM1 A;  1SRP A;  3F15 A;  3ZXH A;  4GWN A;  2ERO A;  3I7I A;  4JA1 A;  1R1I A;  3RTT A;  3VTG A;  2AYK A;  4G9L A;  3DSL A;  4GWM A;  3EDH A;  2DW0 A;  1GO7 P;  4GQL A;  5I4O A;  1RMZ A;  5D7W A;  1ZS0 A;  1SLN A;  2E2D A;  2W14 A;  3OHL A;  1IAE A;  3HYG A;  5BOY A;  4DPE A;  4AYK A;  3G5C A;  3KEC A;  4JPA A;  3LK8 A;  4PKV A;  3KEJ A;  5CXA A;  1UMT A;  2XS4 A;  3O64 A;  2OXW A;  3LQB A;  4FVL A;  1AKL A;  2YUF A;  2OY2 A;  1XUC A;  2D1O A;  5BPA A;  1QJJ A;  4DF9 A;  1BUD A;  3F16 A;  3LMC A;  2J0T A;  1I73 A;  4PKR A;  4PKQ A;  966C A;  1I1I P;  3EDG A;  1CXV A;  3LIL A;  3AIG A;  3AYK A;  1I76 A;  3DTK A;  830C A;  1USN A;  3EWJ A;  4PKW A;  4Q1L A;  3LIK A;  1HFS A;  1S4B P;  3RTS A;  4GF1 A;  1K7I A;  1PWU A;  1KUI A;  4H1Q A;  4WK7 A;  1PWP A;  2JIH A;  1QUA A;  5D3C A;  1H71 P;  1CIZ A;  5D1T A;  1L6J A;  2W13 A;  1KBC A;  1OM8 A;  1G4K A;  4AUO A;  1ZP5 A;  2RJP A;  1K7G A;  3DTI A;  3HY9 A;  4CTH A;  2W12 A;  3LE9 A;  1C7K A;  3B92 A;  3LUM A;  3EDI A;  4IUW A;  3KRY A;  2K9C A;  3LJG A;  1AST A;  3F18 A;  4PKU A;  1JJ9 A;  2ERP A;  4FU4 A;  3LUN A;  1ATL A;  3HDA P;  1BQO A;  5D1U A;  4GR3 A;  1MNC A;  2X3A A;  2E3X A;  4GR8 A;  3U1R A;  1MMP A;  2FV5 A;  3TSK A;  3G42 A;  1XAX A;  1EUB A;  1G49 A;  1J7N A;  3F19 A;  1MMR A;  1Y8J A;  4XM7 A;  5I2Z A;  3LJT A;  1R55 A;  4J4M A;  1PWW A;  1SAT A;  1CGL A;  3Q2H A;  3HB2 P;  1D8M A;  4JP4 A;  1TVI A;  4H82 A;  3TS4 A;  1IAD A;  1SMP A;  2HU6 A;  4PKS A;  4FXY P;  4DD8 A;  1YP1 A;  4L6T A;  3DL1 A;  4H84 A;  3I7G A;  1IAB A;  2OVZ A;  2JNP A;  1SU3 A;  3EHX A;  1KAP P;  4HMA A;  3VI1 A;  1CGE A;  2JT6 A;  4XM6 A;  2L0R A;  2WO9 A;  1Q3A A;  1ZXC A;  1SLM A;  1JAO A;  2OW0 A;  2OW2 A;  2FV9 A;  2CLT A;  1FLS A;  2DDY A;  5B5P A;  3N2V A;  2RJQ A;  3CKI A;  2TCL A;  4IJO A;  2X3B A;  1UEA A;  1XUR A;  2XS3 A;  5I12 A;  4H76 A;  4I35 A;  4AXQ A;  1HOV A;  1EB6 A;  1JK3 A;  4H3X A;  4L7A A;  1GXD A;  2MLR A;  3O2X A;  3AYU A;  3NX7 A;  3LKA A;  3MA2 A;  1BIW A;  2WOA A;  4H2E A;  2Z2D A;  2J83 A;  1PWQ A;  2N8R A;  1GE6 A;  5D2B A;  4H30 A;  3OHO A;  1JIW P;  2ERQ A;  4L63 A;  3DNG A;  5JMY A;  1G12 A;  2K2G A;  2SRT A;  1KUH A;  2A8H A;  2YIG A;  2D1N A;  4A3W A;  2USN A;  1JAP A;  3LJZ A;  2DDF A;  1GO8 P;  3UVC A;  3LIR A;  4WZV A;  3Q2G A;  5BOT A;  2WO8 A;  1BKC E;  1R54 A;  1Z3J A;  2Y6C A;  5I43 A;  1JIZ A;  2O36 A;  1D8F A;  1BZS A;  4I03 A;  4ON1 A;  3HBV P;  3DPF A;  3EHY A;  2X3C A;  2O3E A;  1C8T A;  4QKZ A;  3LGP A;  4H49 A;  4PKT A;  1DMT A;  3HDB A;  2OXZ A;  1G05 A;  1ZXV A;  3V96 B;  2MZE A;  3GBO A;  4G0D A;  4JQG A;  3TT4 A;  1BKC I;  4XBH A;  1WNI A;  1XFW A;  1XFU A;  1JKY A;  1ND1 A;  1UMS A;  1KUF A;  4GUY A;  2OW1 A;  4GR0 A;  1KUK A;  3HY7 A;  3F1A A;  5I0L A;  4ZR5 A;  1IAA A;  2JT5 A;  2MZH A;  3LQ0 A;  1HY7 A;  1YQY A;  2Y6D A;  2AIG P;  3ZUK A;  3F17 A;  3TVC A;  3B8Z A;  3ELM A;  1O0T A;  1XFZ A;  1BM6 A;  1OMJ A;  1BKC A;  1BSW A;  4HX3 A;  1CGF A;  4XCT A;  2DW2 A;  3HBU P;  1FBL A;  1GKC A;  2POJ A;  1BQQ M;  1C3I A;  1DTH A;  2X7M A;  3LEA A;  4DV8 A;  1UTZ A;  4AIG A;  2OXU A;  2YB9 A;  1AF0 A;  4A7B A;  1QJI A;  2PJT A;  4WF6 A;  1HV5 A;  3E8R A;  1ZVX A;  3USN A;  5CUH A;  2MLS A;  4WKI A;  3B2Z A;  1QIA A;  1OS9 A;  4WKE A;  2V4B A;  5L7F A;  3KHI A;  1D5J A;  5LAB A;  1K7Q A;  3KEK A;  4R3V A;  1JAN A;  3KWV C;  5D1S A;  1XFY A;  1BUV M;  1YOU A;  5CZM A;  2DW1 A;  3WV1 A;  1XFX A;  1GE5 A;  3L0T A;  3P1V A;  3L0V A;  2W15 A;  1O0Q A;  4L19 A;  1XUD A;  1IAC A;  1Y93 A;  1OZ9 A;  1GE7 A;  2OW9 A;  1MMB A;  1GKD A;  4XM8 A;  2JSD A;  3P24 A;  1QIC A;  1XFV A;  1QIB A;  1CAQ A;  1YCM A;  4JIJ A;  1HTD A;  1B8Y A;  1ZTQ A;  5L79 A;  1A86 A;  1G9K A;  3BA0 A;  1UTT A;  5H8X A;  1EAK A;  1OM7 A;  1JH1 A;  3DTE A;  1XM5 A;  1OM6 A;  3SHI A;  3WV3 A;  5I3M A;  3DPE A;  1D7X A;  4FXQ A;  2OVX A;  3K7N A;  2OI0 A;  1IAG A;  1R1H A;  3EDZ A;  1B3D A;  1HFC A;  2CKI A;  5B5O A;  3KME A;  3KMC A;  3WV2 A;  1OO9 A;  4IN9 A;  1A85 A;  1PWV A;  2OZR A;  3DWB A;  2OY4 A;  2W0D A;  3ZVS A;  3K7L A;  1CK7 A;  1AYK A;  1KUG A;  2MZI A; 
#chains in the Genus database with same CATH homology
 2QPJ A;  4EFS A;  1JAQ A;  4ILW D;  2I47 A;  1CQR A;  1ROS A;  1R1J A;  3N2U A;  1Y0V A;  1OS2 A;  1RM8 A;  456C A;  1MMQ A;  2KRJ A;  1FM1 A;  1SRP A;  3F15 A;  3ZXH A;  4GWN A;  2ERO A;  3I7I A;  4JA1 A;  1R1I A;  3RTT A;  3VTG A;  2AYK A;  4G9L A;  3DSL A;  4GWM A;  3EDH A;  2DW0 A;  1GO7 P;  4GQL A;  5I4O A;  1RMZ A;  5D7W A;  1ZS0 A;  1SLN A;  2E2D A;  2W14 A;  3OHL A;  1IAE A;  3HYG A;  5BOY A;  4DPE A;  4AYK A;  3G5C A;  3KEC A;  4JPA A;  3LK8 A;  4PKV A;  3KEJ A;  5CXA A;  1UMT A;  2XS4 A;  3O64 A;  2OXW A;  3LQB A;  4FVL A;  1AKL A;  2YUF A;  2OY2 A;  1XUC A;  2D1O A;  5BPA A;  1QJJ A;  4DF9 A;  1BUD A;  3F16 A;  3LMC A;  2J0T A;  1I73 A;  4PKR A;  4PKQ A;  966C A;  1I1I P;  3EDG A;  1CXV A;  3LIL A;  3AIG A;  3AYK A;  1I76 A;  3DTK A;  830C A;  1USN A;  3EWJ A;  4PKW A;  4Q1L A;  3LIK A;  1HFS A;  1S4B P;  3RTS A;  4GF1 A;  1K7I A;  1PWU A;  1KUI A;  4H1Q A;  4WK7 A;  1PWP A;  2JIH A;  1QUA A;  5D3C A;  1H71 P;  1CIZ A;  5D1T A;  1L6J A;  2W13 A;  1KBC A;  1OM8 A;  1G4K A;  4AUO A;  1ZP5 A;  2RJP A;  1K7G A;  3DTI A;  3HY9 A;  4CTH A;  2W12 A;  3LE9 A;  1C7K A;  3B92 A;  3LUM A;  3EDI A;  4IUW A;  3KRY A;  2K9C A;  3LJG A;  1AST A;  3F18 A;  4PKU A;  1JJ9 A;  2ERP A;  4FU4 A;  3LUN A;  1ATL A;  3HDA P;  1BQO A;  5D1U A;  4GR3 A;  1MNC A;  2X3A A;  2E3X A;  4GR8 A;  3U1R A;  1MMP A;  2FV5 A;  3TSK A;  3G42 A;  1EUB A;  1G49 A;  1J7N A;  3F19 A;  1MMR A;  1Y8J A;  4XM7 A;  5I2Z A;  3LJT A;  1R55 A;  4J4M A;  1PWW A;  1SAT A;  1CGL A;  3Q2H A;  1D8M A;  3HB2 P;  4JP4 A;  3TS4 A;  4H82 A;  1IAD A;  1SMP A;  2HU6 A;  4PKS A;  4FXY P;  4DD8 A;  1YP1 A;  4L6T A;  3DL1 A;  4H84 A;  3I7G A;  1IAB A;  2OVZ A;  2JNP A;  1SU3 A;  3EHX A;  1KAP P;  4HMA A;  3VI1 A;  1CGE A;  2JT6 A;  4XM6 A;  2L0R A;  2WO9 A;  1Q3A A;  1ZXC A;  1SLM A;  1JAO A;  2OW0 A;  2OW2 A;  2FV9 A;  2CLT A;  1FLS A;  2DDY A;  5B5P A;  3N2V A;  2RJQ A;  3CKI A;  2TCL A;  4IJO A;  2X3B A;  1UEA A;  1XUR A;  2XS3 A;  5I12 A;  4H76 A;  4I35 A;  4AXQ A;  1HOV A;  1EB6 A;  1JK3 A;  4H3X A;  4L7A A;  1GXD A;  2MLR A;  3O2X A;  3AYU A;  3NX7 A;  3LKA A;  3MA2 A;  1BIW A;  2WOA A;  4H2E A;  2Z2D A;  2J83 A;  1PWQ A;  2N8R A;  1GE6 A;  5D2B A;  4H30 A;  3OHO A;  1JIW P;  2ERQ A;  4L63 A;  3DNG A;  5JMY A;  1G12 A;  2K2G A;  2SRT A;  1KUH A;  2A8H A;  2YIG A;  2D1N A;  4A3W A;  2USN A;  1JAP A;  3LJZ A;  2DDF A;  1GO8 P;  3UVC A;  3LIR A;  4WZV A;  3Q2G A;  5BOT A;  2WO8 A;  1BKC E;  1R54 A;  1Z3J A;  2Y6C A;  5I43 A;  1JIZ A;  2O36 A;  1D8F A;  1BZS A;  4I03 A;  4ON1 A;  3HBV P;  3DPF A;  3EHY A;  2X3C A;  2O3E A;  1C8T A;  4QKZ A;  3LGP A;  4H49 A;  4PKT A;  1DMT A;  3HDB A;  2OXZ A;  1G05 A;  1ZXV A;  3V96 B;  2MZE A;  3GBO A;  4G0D A;  4JQG A;  3TT4 A;  1BKC I;  4XBH A;  1WNI A;  1XFW A;  1XFU A;  1JKY A;  1ND1 A;  1UMS A;  1KUF A;  4GUY A;  2OW1 A;  4GR0 A;  1KUK A;  3HY7 A;  3F1A A;  5I0L A;  4ZR5 A;  1IAA A;  2JT5 A;  2MZH A;  3LQ0 A;  1HY7 A;  1YQY A;  2Y6D A;  2AIG P;  3ZUK A;  3F17 A;  3TVC A;  3B8Z A;  3ELM A;  1O0T A;  1XFZ A;  1BM6 A;  1OMJ A;  1BKC A;  1BSW A;  4HX3 A;  1CGF A;  4XCT A;  2DW2 A;  3HBU P;  1FBL A;  1GKC A;  2POJ A;  1BQQ M;  1C3I A;  1DTH A;  2X7M A;  3LEA A;  4DV8 A;  1UTZ A;  4AIG A;  2OXU A;  2YB9 A;  1AF0 A;  4A7B A;  1QJI A;  2PJT A;  4WF6 A;  1HV5 A;  3E8R A;  1ZVX A;  3USN A;  5CUH A;  2MLS A;  4WKI A;  3B2Z A;  1QIA A;  1OS9 A;  4WKE A;  2V4B A;  5L7F A;  3KHI A;  1D5J A;  5LAB A;  1K7Q A;  3KEK A;  4R3V A;  1JAN A;  3KWV C;  5D1S A;  1XFY A;  1BUV M;  1YOU A;  5CZM A;  2DW1 A;  3WV1 A;  1XFX A;  1GE5 A;  3L0T A;  3P1V A;  3L0V A;  2W15 A;  1O0Q A;  4L19 A;  1XUD A;  1IAC A;  1Y93 A;  1GE7 A;  2OW9 A;  1MMB A;  1GKD A;  4XM8 A;  2JSD A;  3P24 A;  1QIC A;  1XFV A;  1QIB A;  1CAQ A;  1YCM A;  4JIJ A;  1HTD A;  1B8Y A;  1ZTQ A;  5L79 A;  1A86 A;  1G9K A;  3BA0 A;  1UTT A;  5H8X A;  1EAK A;  1OM7 A;  1JH1 A;  3DTE A;  1OM6 A;  3SHI A;  3WV3 A;  5I3M A;  3DPE A;  1D7X A;  4FXQ A;  2OVX A;  3K7N A;  2OI0 A;  1IAG A;  1R1H A;  3EDZ A;  1B3D A;  1HFC A;  2CKI A;  5B5O A;  3KME A;  3KMC A;  3WV2 A;  1OO9 A;  4IN9 A;  1A85 A;  1PWV A;  2OZR A;  3DWB A;  2OY4 A;  2W0D A;  3ZVS A;  3K7L A;  1CK7 A;  1AYK A;  1KUG A;  2MZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...