2WO9A

Mmp12 complex with a beta hydroxy carboxylic acid
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACROPHAGE METALLOELASTASE
publication title The Identification of Beta-Hydroxy Carboxylic Acids as Selective Mmp-12 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 47
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2wo9A00
4AYKA 2OW9A 2JT6A 5CUHA 3P1VA 4WZVA 1L6JA 1OM7A 3BA0A 2O3EA 1OM6A 2V4BA 3EHXA 3I7IA 3ZVSA 5I3MA 4H30A 1HTDA 2DW2A 2JNPA 4PKWA 1BUVM 3AIGA 1QUAA 4JIJA 2RJQA 1GO7P 4H49A 3EDGA 5D7WA 2ERQA 3VTGA 966CA 1MNCA 1SLMA 3LMCA 4XM8A 1CAQA 1SLNA 3DWBA 1KUGA 4H1QA 4DPEA 3KWVC 1B8YA 1G49A 2RJPA 3MA2A 1ASTA 4H82A 3KMEA 3U1RA 4H3XA 4FU4A 1SU3A 1GKDA 1ZXCA 1EB6A 1J7NA 4IJOA 5BOYA 3TT4A 1BM6A 5D1TA 4I35A 1SMPA 1OO9A 3LILA 4AUOA 3L0VA 2YB9A 4XM7A 2OVZA 1BQOA 3E8RA 1UTZA 1KAPP 1GE7A 1ZP5A 1SRPA 1JIZA 3B8ZA 4J4MA 2WOAA 1MMPA 2JSDA 3LIRA 3KRYA 3NX7A 2ERPA 3WV3A 1DTHA 4JP4A 5I12A 3LQBA 1CGEA 3Q2GA 4L6TA 1BKCI 2KRJA 2OI0A 1XFXA 1OS2A 1C8TA 3F18A 1HV5A 2E3XA 3VI1A 2X3AA 4A3WA 4GWNA 5I43A 4JA1A 3O64A 1BSWA 1G05A 2N8RA 2OXUA 5BPAA 3LJZA 1G4KA 2W12A 1KUFA 4ON1A 4G0DA 2JIHA 4HMAA 1IACA 4XCTA 3EDHA 5B5OA 1IABA 4FVLA 4L19A 5B5PA 5BOTA 1OM8A 1GE5A 2W14A 1CQRA 3WV2A 3LEAA 1G9KA 2L0RA 2JT5A 3WV1A 1YP1A 1A86A 1O0QA 3N2UA 1UTTA 5L79A 2W13A 1UEAA 2MZIA 2MZEA 3LJTA 1BQQM 4IUWA 4DF9A 3KMCA 2X7MA 3LUNA 4JQGA 1EAKA 3DNGA 4Q1LA 2E2DA 3AYKA 4FXYP 1KUKA 3ZUKA 5I4OA 2OZRA 2FV9A 2PJTA 2HU6A 4H76A 4WK7A 3CKIA 1G12A 2OY2A 1CXVA 1OS9A 1QJIA 4XM6A 2Z2DA 1PWVA 5CXAA 2X3CA 5CZMA 1GO8P 3KEKA 1CGLA 1O0TA 3G5CA 1I76A 3N2VA 1K7QA 2A8HA 2EROA 4GUYA 3K7NA 3B2ZA 3GBOA 3LIKA 1YCMA 1D7XA 2Y6DA 1MMRA 1PWQA 1I73A 2K9CA 3HB2P 4DV8A 3G42A 1D8FA 3ELMA 1I1IP 4R3VA 2USNA 1R1HA 2TCLA 1GE6A 4XBHA 2DW1A 1XURA 5JMYA 2XS3A 1IAEA 1A85A 2Y6CA 3LUMA 1Q3AA 3HY9A 3LQ0A 1USNA 1ZS0A 1HFCA 1SATA 3LJGA 5D1SA 4GWMA 1UMSA 4WF6A 4GR8A 4FXQA 1BIWA 3KEJA 3EWJA 2OW1A 4GR3A 2O36A 4GF1A 3F17A 1FLSA 1ZXVA 5I0LA 1JJ9A 2OW2A 1QIBA 1PWUA 3P24A 1AYKA 1ROSA 2CKIA 5H8XA 4EFSA 1MMQA 3DPFA 2POJA 1JK3A 1IAAA 2K2GA 2W15A 3LKAA 1ZVXA 1KBCA 2OY4A 3EDZA 1JAQA 3KHIA 4PKRA 4PKTA 4CTHA 5D1UA 3O2XA 1ND1A 2J83A 2DDYA 5D2BA 1JKYA 830CA 1BUDA 2OXZA 1Y8JA 4AXQA 4H84A 3EDIA 3RTTA 1PWWA 4DD8A 2D1NA 4ILWD 3F16A 3L0TA 3HDBA 1PWPA 2FV5A 3OHOA 5D3CA 1IAGA 3DPEA 3HYGA 1KUHA 5I2ZA 2MLRA 2OW0A 4WKEA 1B3DA 1D8MA 4PKSA 1FBLA 1AKLA 4PKUA 1JIWP 3F1AA 2OVXA 4JPAA 3TS4A 1ZTQA 2DW0A 1BKCE 2YIGA 2AYKA 1R1IA 1GXDA 1XUCA 1BKCA 1RMZA 3HY7A 2SRTA 1JAOA 3LE9A 3HBVP 1UMTA 456CA 1IADA 1C3IA 3ZXHA 3V96B 3DL1A 1ATLA 1CGFA 1R55A 1JAPA 4AIGA 1AF0A 1R1JA 1BZSA 3TVCA 1DMTA 1Z3JA 1HOVA 1H71P 2WO9A 1YOUA 3B92A 4HX3A 3DSLA 4WKIA 1QJJA 1XUDA 5LABA 4IN9A 1HFSA 4GR0A 3LK8A 1WNIA 2D1OA 2MLSA 1QICA 3Q2HA 3OHLA 4G9LA 5L7FA 2MZHA 1GKCA 1XFYA 1XFVA 3KECA 4I03A 4H2EA 2X3BA 3EHYA 1MMBA 1JANA 2WO8A 3F15A 3AYUA 3UVCA 3TSKA 1CK7A 1QIAA 3USNA 1XFUA 3F19A 1D5JA 1JH1A 4PKQA 1KUIA 1RM8A 1OMJA 2W0DA 1K7IA 1S4BP 4A7BA 1Y93A 3K7LA 2DDFA 3RTSA 2QPJA 4GQLA 4ZR5A 3HDAP 1R54A 2OXWA 2J0TA 2XS4A 4QKZA 1C7KA 1EUBA 1Y0VA 3SHIA 1K7GA 1YQYA 2CLTA 3HBUP 3LGPA 1FM1A 1XFZA 3I7GA 1XFWA 2I47A 1CIZA 4PKVA 1HY7A 4L63A 2AIGP
chains in the Genus database with same CATH superfamily
4AYKA 2OW9A 2JT6A 5CUHA 3P1VA 4WZVA 1L6JA 1OM7A 3BA0A 2O3EA 1OM6A 2V4BA 3DTKA 3EHXA 3I7IA 3ZVSA 5I3MA 4H30A 1HTDA 2DW2A 2JNPA 4PKWA 1BUVM 3AIGA 1QUAA 4JIJA 2RJQA 1GO7P 4H49A 3EDGA 5D7WA 2ERQA 3VTGA 966CA 1MNCA 1SLMA 3LMCA 4XM8A 1CAQA 1SLNA 3DWBA 1KUGA 4H1QA 4DPEA 3KWVC 1B8YA 1G49A 2RJPA 3MA2A 1ASTA 4H82A 3KMEA 3U1RA 4H3XA 4FU4A 1SU3A 1GKDA 1ZXCA 1EB6A 1J7NA 4IJOA 5BOYA 3TT4A 1BM6A 5D1TA 4I35A 1SMPA 1OO9A 3LILA 4AUOA 3L0VA 2YB9A 4XM7A 2OVZA 1BQOA 3E8RA 1UTZA 1KAPP 1GE7A 1ZP5A 1SRPA 1JIZA 3B8ZA 4J4MA 2WOAA 1MMPA 2JSDA 3LIRA 3KRYA 3NX7A 2ERPA 3WV3A 1DTHA 4JP4A 5I12A 3LQBA 1CGEA 3DTIA 3Q2GA 4L6TA 1BKCI 2KRJA 2OI0A 1XFXA 1OS2A 1C8TA 3F18A 1HV5A 2E3XA 3VI1A 2X3AA 4A3WA 4GWNA 5I43A 4JA1A 3O64A 1BSWA 1G05A 2N8RA 2OXUA 5BPAA 3LJZA 1G4KA 2W12A 1KUFA 4ON1A 4G0DA 2JIHA 4HMAA 1IACA 4XCTA 3EDHA 5B5OA 1IABA 4FVLA 4L19A 5B5PA 5BOTA 1OM8A 1GE5A 2W14A 1CQRA 3DTEA 3WV2A 3LEAA 1G9KA 2L0RA 2JT5A 3WV1A 1YP1A 1A86A 1O0QA 3N2UA 1UTTA 5L79A 2W13A 1UEAA 2MZIA 2MZEA 3LJTA 1BQQM 4IUWA 4DF9A 3KMCA 2X7MA 3LUNA 4JQGA 1EAKA 3DNGA 4Q1LA 2E2DA 3AYKA 4FXYP 1KUKA 3ZUKA 5I4OA 1OZ9A 2OZRA 2FV9A 2PJTA 2HU6A 4H76A 4WK7A 3CKIA 1G12A 2OY2A 1CXVA 1OS9A 1QJIA 4XM6A 2Z2DA 1PWVA 5CXAA 2X3CA 5CZMA 1GO8P 3KEKA 1CGLA 2YUFA 1O0TA 3G5CA 1I76A 3N2VA 1K7QA 2A8HA 2EROA 4GUYA 3K7NA 3B2ZA 3GBOA 3LIKA 1YCMA 1D7XA 2Y6DA 1MMRA 1PWQA 1I73A 2K9CA 3HB2P 4DV8A 3G42A 1D8FA 3ELMA 1I1IP 4R3VA 2USNA 1R1HA 2TCLA 1GE6A 4XBHA 2DW1A 1XURA 5JMYA 2XS3A 1IAEA 1A85A 2Y6CA 3LUMA 1Q3AA 3HY9A 3LQ0A 1USNA 1ZS0A 1HFCA 1SATA 3LJGA 5D1SA 4GWMA 1UMSA 4WF6A 4GR8A 4FXQA 1BIWA 3KEJA 3EWJA 2OW1A 4GR3A 2O36A 4GF1A 3F17A 1FLSA 1ZXVA 5I0LA 1JJ9A 2OW2A 1QIBA 1PWUA 3P24A 1AYKA 1ROSA 2CKIA 5H8XA 4EFSA 1MMQA 3DPFA 2POJA 1JK3A 4L7AA 1IAAA 2K2GA 2W15A 3LKAA 1ZVXA 1KBCA 2OY4A 3EDZA 1JAQA 3KHIA 4PKRA 4PKTA 4CTHA 5D1UA 3O2XA 1ND1A 2J83A 2DDYA 5D2BA 1JKYA 830CA 1BUDA 2OXZA 1XAXA 1Y8JA 4AXQA 4H84A 3EDIA 3RTTA 1PWWA 4DD8A 2D1NA 4ILWD 3F16A 3L0TA 3HDBA 1PWPA 2FV5A 3OHOA 5D3CA 1IAGA 3DPEA 3HYGA 1KUHA 5I2ZA 2MLRA 2OW0A 4WKEA 1B3DA 1D8MA 4PKSA 1FBLA 1AKLA 4PKUA 1JIWP 3F1AA 2OVXA 4JPAA 3TS4A 1ZTQA 2DW0A 1BKCE 2YIGA 2AYKA 1R1IA 1GXDA 1XUCA 1BKCA 1RMZA 3HY7A 2SRTA 1JAOA 3LE9A 3HBVP 1UMTA 456CA 1IADA 1C3IA 3ZXHA 3V96B 3DL1A 1ATLA 1CGFA 1R55A 1JAPA 4AIGA 1AF0A 1R1JA 1BZSA 3TVCA 1DMTA 1TVIA 1Z3JA 1H71P 1HOVA 2WO9A 1YOUA 3B92A 4HX3A 3DSLA 4WKIA 1QJJA 1XUDA 5LABA 1XM5A 4IN9A 1HFSA 4GR0A 3LK8A 1WNIA 2D1OA 2MLSA 1QICA 3Q2HA 3OHLA 4G9LA 5L7FA 2MZHA 1GKCA 1XFYA 1XFVA 3KECA 4I03A 4H2EA 2X3BA 3EHYA 1MMBA 1JANA 2WO8A 3F15A 3AYUA 3UVCA 3TSKA 1CK7A 1QIAA 3USNA 1XFUA 3F19A 1D5JA 1JH1A 4PKQA 1KUIA 1RM8A 1OMJA 2W0DA 1K7IA 1S4BP 4A7BA 1Y93A 3K7LA 2DDFA 3RTSA 2QPJA 4GQLA 4ZR5A 3HDAP 1R54A 2OXWA 2J0TA 2XS4A 4QKZA 1C7KA 1EUBA 1Y0VA 3SHIA 1K7GA 1YQYA 2CLTA 3HBUP 3LGPA 1FM1A 1XFZA 3I7GA 1XFWA 2I47A 1CIZA 4PKVA 1HY7A 4L63A 2AIGP
chains in the Genus database with same CATH topology
4AYKA 2OW9A 2JT6A 5CUHA 3P1VA 4WZVA 1L6JA 1OM7A 3BA0A 2O3EA 1OM6A 2V4BA 3DTKA 3EHXA 3I7IA 3ZVSA 5I3MA 4H30A 1HTDA 2DW2A 2JNPA 4PKWA 1BUVM 3AIGA 1QUAA 4JIJA 2RJQA 1GO7P 4H49A 3EDGA 5D7WA 2ERQA 3VTGA 966CA 1MNCA 1SLMA 3LMCA 4XM8A 1CAQA 1SLNA 3DWBA 1KUGA 4H1QA 4DPEA 3KWVC 1B8YA 1G49A 2RJPA 3MA2A 1ASTA 4H82A 3KMEA 3U1RA 4H3XA 4FU4A 1SU3A 1GKDA 1ZXCA 1EB6A 1J7NA 4IJOA 5BOYA 3TT4A 1BM6A 5D1TA 4I35A 1SMPA 1OO9A 3LILA 4AUOA 3L0VA 2YB9A 4XM7A 2OVZA 1BQOA 3E8RA 1UTZA 1KAPP 1GE7A 1ZP5A 1SRPA 1JIZA 3B8ZA 4J4MA 2WOAA 1MMPA 2JSDA 3LIRA 3KRYA 3NX7A 2ERPA 3WV3A 1DTHA 4JP4A 5I12A 3LQBA 1CGEA 3DTIA 3Q2GA 4L6TA 1BKCI 2KRJA 2OI0A 1XFXA 1OS2A 1C8TA 3F18A 1HV5A 2E3XA 3VI1A 2X3AA 4A3WA 4GWNA 5I43A 4JA1A 3O64A 1BSWA 1G05A 2N8RA 2OXUA 5BPAA 3LJZA 1G4KA 2W12A 1KUFA 4ON1A 4G0DA 2JIHA 4HMAA 1IACA 4XCTA 3EDHA 5B5OA 1IABA 4FVLA 4L19A 5B5PA 5BOTA 1OM8A 1GE5A 2W14A 1CQRA 3DTEA 3WV2A 3LEAA 1G9KA 2L0RA 2JT5A 3WV1A 1YP1A 1A86A 1O0QA 3N2UA 1UTTA 5L79A 2W13A 1UEAA 2MZIA 2MZEA 3LJTA 1BQQM 4IUWA 4DF9A 3KMCA 2X7MA 3LUNA 4JQGA 1EAKA 3DNGA 4Q1LA 2E2DA 3AYKA 4FXYP 1KUKA 3ZUKA 5I4OA 2OZRA 2FV9A 2PJTA 2HU6A 4H76A 4WK7A 3CKIA 1G12A 2OY2A 1CXVA 1OS9A 1QJIA 4XM6A 2Z2DA 1PWVA 5CXAA 2X3CA 5CZMA 1GO8P 3KEKA 1CGLA 2YUFA 1O0TA 3G5CA 1I76A 3N2VA 1K7QA 2A8HA 2EROA 4GUYA 3K7NA 3B2ZA 3GBOA 3LIKA 1YCMA 1D7XA 2Y6DA 1MMRA 1PWQA 1I73A 2K9CA 3HB2P 4DV8A 3G42A 1D8FA 3ELMA 1I1IP 4R3VA 2USNA 1R1HA 2TCLA 1GE6A 4XBHA 2DW1A 1XURA 5JMYA 2XS3A 1IAEA 1A85A 2Y6CA 3LUMA 1Q3AA 3HY9A 3LQ0A 1USNA 1ZS0A 1HFCA 1SATA 3LJGA 5D1SA 4GWMA 1UMSA 4WF6A 4GR8A 4FXQA 1BIWA 3KEJA 3EWJA 2OW1A 4GR3A 2O36A 4GF1A 3F17A 1FLSA 1ZXVA 5I0LA 1JJ9A 2OW2A 1QIBA 1PWUA 3P24A 1AYKA 1ROSA 2CKIA 5H8XA 4EFSA 1MMQA 3DPFA 2POJA 1JK3A 4L7AA 1IAAA 2K2GA 2W15A 3LKAA 1ZVXA 1KBCA 2OY4A 3EDZA 1JAQA 3KHIA 4PKRA 4PKTA 4CTHA 5D1UA 3O2XA 1ND1A 2J83A 2DDYA 5D2BA 1JKYA 830CA 1BUDA 2OXZA 1Y8JA 4AXQA 4H84A 3EDIA 3RTTA 1PWWA 4DD8A 2D1NA 4ILWD 3F16A 3L0TA 3HDBA 1PWPA 2FV5A 3OHOA 5D3CA 1IAGA 3DPEA 3HYGA 1KUHA 5I2ZA 2MLRA 2OW0A 4WKEA 1B3DA 1D8MA 4PKSA 1FBLA 1AKLA 4PKUA 1JIWP 3F1AA 2OVXA 4JPAA 3TS4A 1ZTQA 2DW0A 1BKCE 2YIGA 2AYKA 1R1IA 1GXDA 1XUCA 1BKCA 1RMZA 3HY7A 2SRTA 1JAOA 3LE9A 3HBVP 1UMTA 456CA 1IADA 1C3IA 3ZXHA 3V96B 3DL1A 1ATLA 1CGFA 1R55A 1JAPA 4AIGA 1AF0A 1R1JA 1BZSA 3TVCA 1DMTA 1Z3JA 1HOVA 1H71P 2WO9A 1YOUA 3B92A 4HX3A 3DSLA 4WKIA 1QJJA 1XUDA 5LABA 4IN9A 1HFSA 4GR0A 3LK8A 1WNIA 2D1OA 2MLSA 1QICA 3Q2HA 3OHLA 4G9LA 5L7FA 2MZHA 1GKCA 1XFYA 1XFVA 3KECA 4I03A 4H2EA 2X3BA 3EHYA 1MMBA 1JANA 2WO8A 3F15A 3AYUA 3UVCA 3TSKA 1CK7A 1QIAA 3USNA 1XFUA 3F19A 1D5JA 1JH1A 4PKQA 1KUIA 1RM8A 1OMJA 2W0DA 1K7IA 1S4BP 4A7BA 1Y93A 3K7LA 2DDFA 3RTSA 2QPJA 4GQLA 4ZR5A 3HDAP 1R54A 2OXWA 2J0TA 2XS4A 4QKZA 1C7KA 1EUBA 1Y0VA 3SHIA 1K7GA 1YQYA 2CLTA 3HBUP 3LGPA 1FM1A 1XFZA 3I7GA 1XFWA 2I47A 1CIZA 4PKVA 1HY7A 4L63A 2AIGP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYK A;  2OW9 A;  2JT6 A;  5CUH A;  3P1V A;  4WZV A;  1L6J A;  1OM7 A;  3BA0 A;  2O3E A;  1OM6 A;  2V4B A;  3EHX A;  3I7I A;  3ZVS A;  5I3M A;  4H30 A;  1HTD A;  2DW2 A;  2JNP A;  4PKW A;  1BUV M;  3AIG A;  1QUA A;  4JIJ A;  2RJQ A;  1GO7 P;  4H49 A;  3EDG A;  5D7W A;  2ERQ A;  3VTG A;  966C A;  1MNC A;  1SLM A;  3LMC A;  4XM8 A;  1CAQ A;  1SLN A;  3DWB A;  1KUG A;  4H1Q A;  4DPE A;  3KWV C;  1B8Y A;  1G49 A;  2RJP A;  3MA2 A;  1AST A;  4H82 A;  3KME A;  3U1R A;  4H3X A;  4FU4 A;  1SU3 A;  1GKD A;  1ZXC A;  1EB6 A;  1J7N A;  4IJO A;  5BOY A;  3TT4 A;  1BM6 A;  5D1T A;  4I35 A;  1SMP A;  1OO9 A;  3LIL A;  4AUO A;  3L0V A;  2YB9 A;  4XM7 A;  2OVZ A;  1BQO A;  3E8R A;  1UTZ A;  1KAP P;  1GE7 A;  1ZP5 A;  1SRP A;  1JIZ A;  3B8Z A;  4J4M A;  2WOA A;  1MMP A;  2JSD A;  3LIR A;  3KRY A;  3NX7 A;  2ERP A;  3WV3 A;  1DTH A;  4JP4 A;  5I12 A;  3LQB A;  1CGE A;  3Q2G A;  4L6T A;  1BKC I;  2KRJ A;  2OI0 A;  1XFX A;  1OS2 A;  1C8T A;  3F18 A;  1HV5 A;  2E3X A;  3VI1 A;  2X3A A;  4A3W A;  4GWN A;  5I43 A;  4JA1 A;  3O64 A;  1BSW A;  1G05 A;  2N8R A;  2OXU A;  5BPA A;  3LJZ A;  1G4K A;  2W12 A;  1KUF A;  4ON1 A;  4G0D A;  2JIH A;  4HMA A;  1IAC A;  4XCT A;  3EDH A;  5B5O A;  1IAB A;  4FVL A;  4L19 A;  5B5P A;  5BOT A;  1OM8 A;  1GE5 A;  2W14 A;  1CQR A;  3WV2 A;  3LEA A;  1G9K A;  2L0R A;  2JT5 A;  3WV1 A;  1YP1 A;  1A86 A;  1O0Q A;  3N2U A;  1UTT A;  5L79 A;  2W13 A;  1UEA A;  2MZI A;  2MZE A;  3LJT A;  1BQQ M;  4IUW A;  4DF9 A;  3KMC A;  2X7M A;  3LUN A;  4JQG A;  1EAK A;  3DNG A;  4Q1L A;  2E2D A;  3AYK A;  4FXY P;  1KUK A;  3ZUK A;  5I4O A;  2OZR A;  2FV9 A;  2PJT A;  2HU6 A;  4H76 A;  4WK7 A;  3CKI A;  1G12 A;  2OY2 A;  1CXV A;  1OS9 A;  1QJI A;  4XM6 A;  2Z2D A;  1PWV A;  5CXA A;  2X3C A;  5CZM A;  1GO8 P;  3KEK A;  1CGL A;  1O0T A;  3G5C A;  1I76 A;  3N2V A;  1K7Q A;  2A8H A;  2ERO A;  4GUY A;  3K7N A;  3B2Z A;  3GBO A;  3LIK A;  1YCM A;  1D7X A;  2Y6D A;  1MMR A;  1PWQ A;  1I73 A;  2K9C A;  3HB2 P;  4DV8 A;  3G42 A;  1D8F A;  3ELM A;  1I1I P;  4R3V A;  2USN A;  1R1H A;  2TCL A;  1GE6 A;  4XBH A;  2DW1 A;  1XUR A;  5JMY A;  2XS3 A;  1IAE A;  1A85 A;  2Y6C A;  3LUM A;  1Q3A A;  3HY9 A;  3LQ0 A;  1USN A;  1ZS0 A;  1HFC A;  1SAT A;  3LJG A;  5D1S A;  4GWM A;  1UMS A;  4WF6 A;  4GR8 A;  4FXQ A;  1BIW A;  3KEJ A;  3EWJ A;  2OW1 A;  4GR3 A;  2O36 A;  4GF1 A;  3F17 A;  1FLS A;  1ZXV A;  5I0L A;  1JJ9 A;  2OW2 A;  1QIB A;  1PWU A;  3P24 A;  1AYK A;  1ROS A;  2CKI A;  5H8X A;  4EFS A;  1MMQ A;  3DPF A;  2POJ A;  1JK3 A;  1IAA A;  2K2G A;  2W15 A;  3LKA A;  1ZVX A;  1KBC A;  2OY4 A;  3EDZ A;  1JAQ A;  3KHI A;  4PKR A;  4PKT A;  4CTH A;  5D1U A;  3O2X A;  1ND1 A;  2J83 A;  2DDY A;  5D2B A;  1JKY A;  830C A;  1BUD A;  2OXZ A;  1Y8J A;  4AXQ A;  4H84 A;  3EDI A;  3RTT A;  1PWW A;  4DD8 A;  2D1N A;  4ILW D;  3F16 A;  3L0T A;  3HDB A;  1PWP A;  2FV5 A;  3OHO A;  5D3C A;  1IAG A;  3DPE A;  3HYG A;  1KUH A;  5I2Z A;  2MLR A;  2OW0 A;  4WKE A;  1B3D A;  1D8M A;  4PKS A;  1FBL A;  1AKL A;  4PKU A;  1JIW P;  3F1A A;  2OVX A;  4JPA A;  3TS4 A;  1ZTQ A;  2DW0 A;  1BKC E;  2YIG A;  2AYK A;  1R1I A;  1GXD A;  1XUC A;  1BKC A;  1RMZ A;  3HY7 A;  2SRT A;  1JAO A;  3LE9 A;  3HBV P;  1UMT A;  456C A;  1IAD A;  1C3I A;  3ZXH A;  3V96 B;  3DL1 A;  1ATL A;  1CGF A;  1R55 A;  1JAP A;  4AIG A;  1AF0 A;  1R1J A;  1BZS A;  3TVC A;  1DMT A;  1Z3J A;  1HOV A;  1H71 P;  2WO9 A;  1YOU A;  3B92 A;  4HX3 A;  3DSL A;  4WKI A;  1QJJ A;  1XUD A;  5LAB A;  4IN9 A;  1HFS A;  4GR0 A;  3LK8 A;  1WNI A;  2D1O A;  2MLS A;  1QIC A;  3Q2H A;  3OHL A;  4G9L A;  5L7F A;  2MZH A;  1GKC A;  1XFY A;  1XFV A;  3KEC A;  4I03 A;  4H2E A;  2X3B A;  3EHY A;  1MMB A;  1JAN A;  2WO8 A;  3F15 A;  3AYU A;  3UVC A;  3TSK A;  1CK7 A;  1QIA A;  3USN A;  1XFU A;  3F19 A;  1D5J A;  1JH1 A;  4PKQ A;  1KUI A;  1RM8 A;  1OMJ A;  2W0D A;  1K7I A;  1S4B P;  4A7B A;  1Y93 A;  3K7L A;  2DDF A;  3RTS A;  2QPJ A;  4GQL A;  4ZR5 A;  3HDA P;  1R54 A;  2OXW A;  2J0T A;  2XS4 A;  4QKZ A;  1C7K A;  1EUB A;  1Y0V A;  3SHI A;  1K7G A;  1YQY A;  2CLT A;  3HBU P;  3LGP A;  1FM1 A;  1XFZ A;  3I7G A;  1XFW A;  2I47 A;  1CIZ A;  4PKV A;  1HY7 A;  4L63 A;  2AIG P; 
#chains in the Genus database with same CATH topology
 4AYK A;  2OW9 A;  2JT6 A;  5CUH A;  3P1V A;  4WZV A;  1L6J A;  1OM7 A;  3BA0 A;  2O3E A;  1OM6 A;  2V4B A;  3DTK A;  3EHX A;  3I7I A;  3ZVS A;  5I3M A;  4H30 A;  1HTD A;  2DW2 A;  2JNP A;  4PKW A;  1BUV M;  3AIG A;  1QUA A;  4JIJ A;  2RJQ A;  1GO7 P;  4H49 A;  3EDG A;  5D7W A;  2ERQ A;  3VTG A;  966C A;  1MNC A;  1SLM A;  3LMC A;  4XM8 A;  1CAQ A;  1SLN A;  3DWB A;  1KUG A;  4H1Q A;  4DPE A;  3KWV C;  1B8Y A;  1G49 A;  2RJP A;  3MA2 A;  1AST A;  4H82 A;  3KME A;  3U1R A;  4H3X A;  4FU4 A;  1SU3 A;  1GKD A;  1ZXC A;  1EB6 A;  1J7N A;  4IJO A;  5BOY A;  3TT4 A;  1BM6 A;  5D1T A;  4I35 A;  1SMP A;  1OO9 A;  3LIL A;  4AUO A;  3L0V A;  2YB9 A;  4XM7 A;  2OVZ A;  1BQO A;  3E8R A;  1UTZ A;  1KAP P;  1GE7 A;  1ZP5 A;  1SRP A;  1JIZ A;  3B8Z A;  4J4M A;  2WOA A;  1MMP A;  2JSD A;  3LIR A;  3KRY A;  3NX7 A;  2ERP A;  3WV3 A;  1DTH A;  4JP4 A;  5I12 A;  3LQB A;  1CGE A;  3DTI A;  3Q2G A;  4L6T A;  1BKC I;  2KRJ A;  2OI0 A;  1XFX A;  1OS2 A;  1C8T A;  3F18 A;  1HV5 A;  2E3X A;  3VI1 A;  2X3A A;  4A3W A;  4GWN A;  5I43 A;  4JA1 A;  3O64 A;  1BSW A;  1G05 A;  2N8R A;  2OXU A;  5BPA A;  3LJZ A;  1G4K A;  2W12 A;  1KUF A;  4ON1 A;  4G0D A;  2JIH A;  4HMA A;  1IAC A;  4XCT A;  3EDH A;  5B5O A;  1IAB A;  4FVL A;  4L19 A;  5B5P A;  5BOT A;  1OM8 A;  1GE5 A;  2W14 A;  1CQR A;  3DTE A;  3WV2 A;  3LEA A;  1G9K A;  2L0R A;  2JT5 A;  3WV1 A;  1YP1 A;  1A86 A;  1O0Q A;  3N2U A;  1UTT A;  5L79 A;  2W13 A;  1UEA A;  2MZI A;  2MZE A;  3LJT A;  1BQQ M;  4IUW A;  4DF9 A;  3KMC A;  2X7M A;  3LUN A;  4JQG A;  1EAK A;  3DNG A;  4Q1L A;  2E2D A;  3AYK A;  4FXY P;  1KUK A;  3ZUK A;  5I4O A;  1OZ9 A;  2OZR A;  2FV9 A;  2PJT A;  2HU6 A;  4H76 A;  4WK7 A;  3CKI A;  1G12 A;  2OY2 A;  1CXV A;  1OS9 A;  1QJI A;  4XM6 A;  2Z2D A;  1PWV A;  5CXA A;  2X3C A;  5CZM A;  1GO8 P;  3KEK A;  1CGL A;  2YUF A;  1O0T A;  3G5C A;  1I76 A;  3N2V A;  1K7Q A;  2A8H A;  2ERO A;  4GUY A;  3K7N A;  3B2Z A;  3GBO A;  3LIK A;  1YCM A;  1D7X A;  2Y6D A;  1MMR A;  1PWQ A;  1I73 A;  2K9C A;  3HB2 P;  4DV8 A;  3G42 A;  1D8F A;  3ELM A;  1I1I P;  4R3V A;  2USN A;  1R1H A;  2TCL A;  1GE6 A;  4XBH A;  2DW1 A;  1XUR A;  5JMY A;  2XS3 A;  1IAE A;  1A85 A;  2Y6C A;  3LUM A;  1Q3A A;  3HY9 A;  3LQ0 A;  1USN A;  1ZS0 A;  1HFC A;  1SAT A;  3LJG A;  5D1S A;  4GWM A;  1UMS A;  4WF6 A;  4GR8 A;  4FXQ A;  1BIW A;  3KEJ A;  3EWJ A;  2OW1 A;  4GR3 A;  2O36 A;  4GF1 A;  3F17 A;  1FLS A;  1ZXV A;  5I0L A;  1JJ9 A;  2OW2 A;  1QIB A;  1PWU A;  3P24 A;  1AYK A;  1ROS A;  2CKI A;  5H8X A;  4EFS A;  1MMQ A;  3DPF A;  2POJ A;  1JK3 A;  4L7A A;  1IAA A;  2K2G A;  2W15 A;  3LKA A;  1ZVX A;  1KBC A;  2OY4 A;  3EDZ A;  1JAQ A;  3KHI A;  4PKR A;  4PKT A;  4CTH A;  5D1U A;  3O2X A;  1ND1 A;  2J83 A;  2DDY A;  5D2B A;  1JKY A;  830C A;  1BUD A;  2OXZ A;  1XAX A;  1Y8J A;  4AXQ A;  4H84 A;  3EDI A;  3RTT A;  1PWW A;  4DD8 A;  2D1N A;  4ILW D;  3F16 A;  3L0T A;  3HDB A;  1PWP A;  2FV5 A;  3OHO A;  5D3C A;  1IAG A;  3DPE A;  3HYG A;  1KUH A;  5I2Z A;  2MLR A;  2OW0 A;  4WKE A;  1B3D A;  1D8M A;  4PKS A;  1FBL A;  1AKL A;  4PKU A;  1JIW P;  3F1A A;  2OVX A;  4JPA A;  3TS4 A;  1ZTQ A;  2DW0 A;  1BKC E;  2YIG A;  2AYK A;  1R1I A;  1GXD A;  1XUC A;  1BKC A;  1RMZ A;  3HY7 A;  2SRT A;  1JAO A;  3LE9 A;  3HBV P;  1UMT A;  456C A;  1IAD A;  1C3I A;  3ZXH A;  3V96 B;  3DL1 A;  1ATL A;  1CGF A;  1R55 A;  1JAP A;  4AIG A;  1AF0 A;  1R1J A;  1BZS A;  3TVC A;  1DMT A;  1TVI A;  1Z3J A;  1H71 P;  1HOV A;  2WO9 A;  1YOU A;  3B92 A;  4HX3 A;  3DSL A;  4WKI A;  1QJJ A;  1XUD A;  5LAB A;  1XM5 A;  4IN9 A;  1HFS A;  4GR0 A;  3LK8 A;  1WNI A;  2D1O A;  2MLS A;  1QIC A;  3Q2H A;  3OHL A;  4G9L A;  5L7F A;  2MZH A;  1GKC A;  1XFY A;  1XFV A;  3KEC A;  4I03 A;  4H2E A;  2X3B A;  3EHY A;  1MMB A;  1JAN A;  2WO8 A;  3F15 A;  3AYU A;  3UVC A;  3TSK A;  1CK7 A;  1QIA A;  3USN A;  1XFU A;  3F19 A;  1D5J A;  1JH1 A;  4PKQ A;  1KUI A;  1RM8 A;  1OMJ A;  2W0D A;  1K7I A;  1S4B P;  4A7B A;  1Y93 A;  3K7L A;  2DDF A;  3RTS A;  2QPJ A;  4GQL A;  4ZR5 A;  3HDA P;  1R54 A;  2OXW A;  2J0T A;  2XS4 A;  4QKZ A;  1C7K A;  1EUB A;  1Y0V A;  3SHI A;  1K7G A;  1YQY A;  2CLT A;  3HBU P;  3LGP A;  1FM1 A;  1XFZ A;  3I7G A;  1XFW A;  2I47 A;  1CIZ A;  4PKV A;  1HY7 A;  4L63 A;  2AIG P; 
#chains in the Genus database with same CATH homology
 4AYK A;  2OW9 A;  2JT6 A;  5CUH A;  3P1V A;  4WZV A;  1L6J A;  1OM7 A;  3BA0 A;  2O3E A;  1OM6 A;  2V4B A;  3DTK A;  3EHX A;  3I7I A;  3ZVS A;  5I3M A;  4H30 A;  1HTD A;  2DW2 A;  2JNP A;  4PKW A;  1BUV M;  3AIG A;  1QUA A;  4JIJ A;  2RJQ A;  1GO7 P;  4H49 A;  3EDG A;  5D7W A;  2ERQ A;  3VTG A;  966C A;  1MNC A;  1SLM A;  3LMC A;  4XM8 A;  1CAQ A;  1SLN A;  3DWB A;  1KUG A;  4H1Q A;  4DPE A;  3KWV C;  1B8Y A;  1G49 A;  2RJP A;  3MA2 A;  1AST A;  4H82 A;  3KME A;  3U1R A;  4H3X A;  4FU4 A;  1SU3 A;  1GKD A;  1ZXC A;  1EB6 A;  1J7N A;  4IJO A;  5BOY A;  3TT4 A;  1BM6 A;  5D1T A;  4I35 A;  1SMP A;  1OO9 A;  3LIL A;  4AUO A;  3L0V A;  2YB9 A;  4XM7 A;  2OVZ A;  1BQO A;  3E8R A;  1UTZ A;  1KAP P;  1GE7 A;  1ZP5 A;  1SRP A;  1JIZ A;  3B8Z A;  4J4M A;  2WOA A;  1MMP A;  2JSD A;  3LIR A;  3KRY A;  3NX7 A;  2ERP A;  3WV3 A;  1DTH A;  4JP4 A;  5I12 A;  3LQB A;  1CGE A;  3DTI A;  3Q2G A;  4L6T A;  1BKC I;  2KRJ A;  2OI0 A;  1XFX A;  1OS2 A;  1C8T A;  3F18 A;  1HV5 A;  2E3X A;  3VI1 A;  2X3A A;  4A3W A;  4GWN A;  5I43 A;  4JA1 A;  3O64 A;  1BSW A;  1G05 A;  2N8R A;  2OXU A;  5BPA A;  3LJZ A;  1G4K A;  2W12 A;  1KUF A;  4ON1 A;  4G0D A;  2JIH A;  4HMA A;  1IAC A;  4XCT A;  3EDH A;  5B5O A;  1IAB A;  4FVL A;  4L19 A;  5B5P A;  5BOT A;  1OM8 A;  1GE5 A;  2W14 A;  1CQR A;  3DTE A;  3WV2 A;  3LEA A;  1G9K A;  2L0R A;  2JT5 A;  3WV1 A;  1YP1 A;  1A86 A;  1O0Q A;  3N2U A;  1UTT A;  5L79 A;  2W13 A;  1UEA A;  2MZI A;  2MZE A;  3LJT A;  1BQQ M;  4IUW A;  4DF9 A;  3KMC A;  2X7M A;  3LUN A;  4JQG A;  1EAK A;  3DNG A;  4Q1L A;  2E2D A;  3AYK A;  4FXY P;  1KUK A;  3ZUK A;  5I4O A;  2OZR A;  2FV9 A;  2PJT A;  2HU6 A;  4H76 A;  4WK7 A;  3CKI A;  1G12 A;  2OY2 A;  1CXV A;  1OS9 A;  1QJI A;  4XM6 A;  2Z2D A;  1PWV A;  5CXA A;  2X3C A;  5CZM A;  1GO8 P;  3KEK A;  1CGL A;  2YUF A;  1O0T A;  3G5C A;  1I76 A;  3N2V A;  1K7Q A;  2A8H A;  2ERO A;  4GUY A;  3K7N A;  3B2Z A;  3GBO A;  3LIK A;  1YCM A;  1D7X A;  2Y6D A;  1MMR A;  1PWQ A;  1I73 A;  2K9C A;  3HB2 P;  4DV8 A;  3G42 A;  1D8F A;  3ELM A;  1I1I P;  4R3V A;  2USN A;  1R1H A;  2TCL A;  1GE6 A;  4XBH A;  2DW1 A;  1XUR A;  5JMY A;  2XS3 A;  1IAE A;  1A85 A;  2Y6C A;  3LUM A;  1Q3A A;  3HY9 A;  3LQ0 A;  1USN A;  1ZS0 A;  1HFC A;  1SAT A;  3LJG A;  5D1S A;  4GWM A;  1UMS A;  4WF6 A;  4GR8 A;  4FXQ A;  1BIW A;  3KEJ A;  3EWJ A;  2OW1 A;  4GR3 A;  2O36 A;  4GF1 A;  3F17 A;  1FLS A;  1ZXV A;  5I0L A;  1JJ9 A;  2OW2 A;  1QIB A;  1PWU A;  3P24 A;  1AYK A;  1ROS A;  2CKI A;  5H8X A;  4EFS A;  1MMQ A;  3DPF A;  2POJ A;  1JK3 A;  4L7A A;  1IAA A;  2K2G A;  2W15 A;  3LKA A;  1ZVX A;  1KBC A;  2OY4 A;  3EDZ A;  1JAQ A;  3KHI A;  4PKR A;  4PKT A;  4CTH A;  5D1U A;  3O2X A;  1ND1 A;  2J83 A;  2DDY A;  5D2B A;  1JKY A;  830C A;  1BUD A;  2OXZ A;  1Y8J A;  4AXQ A;  4H84 A;  3EDI A;  3RTT A;  1PWW A;  4DD8 A;  2D1N A;  4ILW D;  3F16 A;  3L0T A;  3HDB A;  1PWP A;  2FV5 A;  3OHO A;  5D3C A;  1IAG A;  3DPE A;  3HYG A;  1KUH A;  5I2Z A;  2MLR A;  2OW0 A;  4WKE A;  1B3D A;  1D8M A;  4PKS A;  1FBL A;  1AKL A;  4PKU A;  1JIW P;  3F1A A;  2OVX A;  4JPA A;  3TS4 A;  1ZTQ A;  2DW0 A;  1BKC E;  2YIG A;  2AYK A;  1R1I A;  1GXD A;  1XUC A;  1BKC A;  1RMZ A;  3HY7 A;  2SRT A;  1JAO A;  3LE9 A;  3HBV P;  1UMT A;  456C A;  1IAD A;  1C3I A;  3ZXH A;  3V96 B;  3DL1 A;  1ATL A;  1CGF A;  1R55 A;  1JAP A;  4AIG A;  1AF0 A;  1R1J A;  1BZS A;  3TVC A;  1DMT A;  1Z3J A;  1HOV A;  1H71 P;  2WO9 A;  1YOU A;  3B92 A;  4HX3 A;  3DSL A;  4WKI A;  1QJJ A;  1XUD A;  5LAB A;  4IN9 A;  1HFS A;  4GR0 A;  3LK8 A;  1WNI A;  2D1O A;  2MLS A;  1QIC A;  3Q2H A;  3OHL A;  4G9L A;  5L7F A;  2MZH A;  1GKC A;  1XFY A;  1XFV A;  3KEC A;  4I03 A;  4H2E A;  2X3B A;  3EHY A;  1MMB A;  1JAN A;  2WO8 A;  3F15 A;  3AYU A;  3UVC A;  3TSK A;  1CK7 A;  1QIA A;  3USN A;  1XFU A;  3F19 A;  1D5J A;  1JH1 A;  4PKQ A;  1KUI A;  1RM8 A;  1OMJ A;  2W0D A;  1K7I A;  1S4B P;  4A7B A;  1Y93 A;  3K7L A;  2DDF A;  3RTS A;  2QPJ A;  4GQL A;  4ZR5 A;  3HDA P;  1R54 A;  2OXW A;  2J0T A;  2XS4 A;  4QKZ A;  1C7K A;  1EUB A;  1Y0V A;  3SHI A;  1K7G A;  1YQY A;  2CLT A;  3HBU P;  3LGP A;  1FM1 A;  1XFZ A;  3I7G A;  1XFW A;  2I47 A;  1CIZ A;  4PKV A;  1HY7 A;  4L63 A;  2AIG P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...