2WONA

Crystal structure of uk-453061 bound to hiv-1 reverse transcriptase (wild-type).
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Lersivirine: A Non-Nucleoside Reverse Transcriptase Inhibitor with Activity Against Drug- Resistant Human Immunodeficiency Virus-1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2wonA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wonA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wonA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wonA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2wonA05
3L2VA 2OPPA 4OJRA 3OLBA 4FJ5A 1RAJA 3V1OA 4XO0A 2IM2A 4FJKA 3DLEA 3GIMA 4R8UA 1HYSB 1JXEA 2RKIB 2B5JA 3KK2B 3ZT4A 1C0MA 3HPGA 4O55A 4AHTA 3AVCA 1WSEA 3LWMA 5HROA 5KG6A 4J2EA 2HNYA 3HKWA 2BR0A 4IH7A 2EX3A 2AQ4A 1QTMA 2OA8A 3V6DB 1TKTA 1TP7A 4BDPA 4BE0A 3V9UA 1LWCA 2YNIA 2FJWA 1S5JA 1CLQA 4CESA 3L3UA 1S1UB 2RPIA 4RZRA 4RW4B 4K8ZA 3LP3A 1N6QA 3TVKA 3QIOA 3M8SA 5F9NA 4NLVA 2XHBA 2EC0A 1TL1A 4JLHA 3S3MA 3QNNA 4IH5A 4M45A 2E4LA 1RTJA 3PHEA 3HJFA 3JYTA 1KHWA 3V81B 3Q8RB 5DLFA 2AGOA 3HVWA 3T19A 5EU7A 1S9EB 3IRXA 4FS2A 3ZT3A 1DLOA 1S9FA 4RW6A 4LH4A 1BL3A 1UWBB 3BDPA 2IM1A 4LH5A 2ZD1B 3I0RB 4NYZA 4Q0BB 3MFIA 4ZPCA 1ZYQA 4CJLA 4IRDA 3DOKA 2XGQA 2WOMB 2XI2A 3UIQA 1F21A 5HBMA 1ASWA 3MEGB 5I3UA 4LQ3A 3VQSA 4GW6A 2HNDB 5J2MB 4CFBA 3LPTA 1TK0A 4W5NA 2FVCA 3SI6A 4NLOA 5KG5A 2HHVA 2E6MA 5I42A 1XI1A 1TV6A 2X6NA 2WCXA 4M95A 4M3RA 3IG1A 2R8HA 3ZSXA 1C1BB 5KGWA 2JEIA 4FCYA 1RT7A 1LW0A 1XR7A 1QS4A 4K4VA 2ZKUA 4O4GA 3IS9B 4ED2A 4JS5A 3MECA 3PW5A 1UA1A 5KFBA 2X78A 3P5JA 3H5UA 3EY1A 4KKOA 2IM3A 3CDUA 1HJRA 1KFSA 5J2PA 4KV8B 4JUZA 1ASVA 1SH3A 3FFIB 1IKYB 4CE9A 3U6FA 1NKEA 4DTNA 2WRMA 4J2AA 4I9QA 1DTTB 2BRLA 5KFTA 3MXIA 4I2QA 1T3NA 4UQGA 3RRGA 1QE1A 4OL8A 4NCAA 4RUCA 4F4YA 3KLGB 4K8XA 3M9NB 1NK4A 5HRPA 3NH0A 1J53A 2FBYA 3DYAB 5FDLA 4LSLA 4Y1CA 2B43A 4DSEA 2BQRA 3T5HA 1UOCA 3DRPA 1VSLA 2KZMA 1LWEA 1CXQA 5KFAA 3JSMB 5KFWA 2XY7A 3MR6A 2AWZA 5C5JA 3O3GA 3SUQA 4J9SA 2FLLA 3LP2A 2R8KA 1RTIB 2IC3A 4QAGA 5KG3A 1B9FA 4PWDB 3RWUA 2D5RA 1HQUB 4NYNA 4NLXA 4AHVA 3MEEA 1U45A 3O3FA 3NGDA 3AV9A 4CJ3A 3RTVA 3PY8A 3OLAA 4PUOA 3UDLA 4QWCA 4DTSA 4AHCA 2FBXA 3VQDA 4ID5A 3T5KA 5CYQA 4DTMA 5F9LA 5J2QB 4CF0A 4CJKA 3OYAA 2F8TA 3OYBA 4O3QA 5KFSA 4MIBA 4FXDA 1SL2A 1ZBLA 1RT2B 4O3OA 1TVRA 3N6MA 4TY8A 1SUQB 3KLFA 2G8UA 5KRSA 2E6LA 1S49A 4ICLB 4CIGA 3FDSA 3U3YA 4I7FB 2YNHA 2XC9A 4I9LA 4K4YA 3EYZA 3HVTB 4CIEA 2G8FA 1JLAA 4CCHA 1HARA 3EZ5A 4DLEA 2IS3A 3V1RA 4DQQA 4IFYA 3FSIA 5FRNA 2VA3A 4F3OA 5KT4A 4Y1DA 5KFYA 1YTUA 4ECSA 4ECXA 4FJMA 1DTQB 2B5JB 5KFIA 4ECWA 3QZ7A 4CF8A 4TYAA 2KTQA 4BE2A 3S3OA 2CKWA 3SV4A 3CJ3A 3HXMA 5HROB 3PX6A 3ZT0A 1HYSA 1XHXA 4OGEA 4CGJA 3NF6A 5KFVA 1TKXB 2WTFA 1U48A 1Z26A 1TKTB 1JLFA 2OPQA 2V0NA 1LWCB 4CJUA 2YNIB 3I5CA 3S9HA 1A5XA 1S6PB 2D3ZA 1KLMA 3CWJA 1S6QA 5KFJA 3EPGA 4KHYA 2KW4A 5L1JA 2GUIA 2FBVA 2XY5A 5KTQA 1N6QB 1I39A 4RNFA 4O3NA 5J2NA 4H4OB 5DG9A 3VQAA 1N4LA 3SCXA 1S1UA 4CEOA 1TL1B 4DFMA 5KI6A 4DQIA 1IKXA 4GC6A 1VSKA 4RG8A 3JYTB 3BSNA 2AGQA 4J9PA 4JRPA 3D0PA 4CGHA 3RAQA 3AA4A 3IRXB 1T05A 1DLOB 2ZQBA 4TSXA 4FK0A 4ECVA 3V81A 1CSJA 4RW6B 4ECZA 3G6XA 1JXBA 3KHGA 4KHNA 4CJRA 1RDAA 5KG2A 1S0MA 3FRZA 4RNOA 4CJPA 3GV5B 2BRKA 4MK9A 4IOBA 3DOKB 1WSJA 3OYCA 1YT3A 4FLZA 3I0RA 2KQ2A 5HBMB 1T03A 4AILC 4TYBA 2DY4A 3ALYA 5I3UB 4URQU 4Q44A 2ATLA 1S0NA 5L1LA 4Y2CA 2FVQA 5F8MA 4E7HA 5I42B 3MEGA 1TV6B 3P1GA 5J2MA 4CIFA 2O4GA 3MTKA 5KFKA 1QAIA 3AO2A 2BANA 4Q45A 5KT3A 4O5BA 2RF2B 2UUWA 3VQ8A 1RT7B 2IJFA 5HRNA 4ZPBA 3TI0A 1X1PA 4OLBA 3Q8PB 4O4GB 4XPCA 3NCIA 3RRHA 3MECB 3NBPA 4OGCA 4CFDA 1C1BA 1TAQA 2B6AB 3QETA 4IRKA 3ULDA 3OL6A 3LP1B 3E51A 4J9RA 4IFVB 2ETJA 2DPJA 3Q8QB 4KKOB 4AHSA 4FZXC 3IGVA 3TARA 3CFOA 4IH6A 1RA7A 4ZMMA 2GC8A 3C6UA 4LSNA 4C8LA 5KFFA 2Q3SA 4CHOA 1HPZB 2GIRA 3CVKA 1KLNA 3KKRA 4LD0A 1NJYA 1TKDA 4I2QB 3OS0A 3FFIA 1QE1B 3ZSQA 3L2RA 3QNOA 5HLFA 3KOAA 4AHUA 2J6TA 1WSGA 3MR5A 4FK2A 3G10A 3OS2A 4PA1A 3DRRA 4FZYA 5FDLB 4CEZA 5KFRA 2W8LA 3RMBA 4LSLB 4DTPA 5JUMA 4O3PA 1JL2A 2BQUA 3QEPA 1IH7A 4O3RA 4N76A 1C0UB 2QV6A 1RBVA 2YNGA 4Z4HA 4F8RA 4YQWA 1FKOA 4NRUA 3SPZA 3NAEA 3G6YA 4Q8EA 2YV0X 4M3YA 3SNNA 4DQRA 4KREA 4MIAA 2XCAA 2IC3B 4OKJA 5JS1A 1RDRA 2DFFA 3HP9A 4IDKB 3VQ6A 1RT5B 3LZIA 1JLBA 4H8KA 3DLRA 3MEEB 4N41A 3V9WA 2FJXA 3GQCA 1NHVA 2AX0A 4B9UA 3PX0A 3OYFA 1U49A 4IQXA 4ED7A 3OL7A 4B9VA 4QOZB 1QSYA 3SQ4A 3VQ9A 4KFBA 2JEJA 4M3ZA 1RYSA 4OLAA 1VRTB 2XGPA 3PVXA 1S1XA 4QWEA 1TVRB 4HUEA 2XWYA 3KLFB 2Z1JA 4F2SA 2IAJA 2IA6A 3K5MA 4B9MA 4CECA 1QAJA 3V6JA 5J2QA 2YNHB 3FQLA 1D5AA 1VSDA 2G8KA 3KD5E 4ED8A 3CDWA 3L2UA 1SKWA 1LWFA 2W9AA 3TAPA 2VWKA 1NKCA 4IFYB 4I7FA 1S1VA 4DG1B 3K57A 1JL1A 3HM9A 3M8RA 2WB4A 4HYKA 2VG7A 3PX4A 2R2RA 2HWIA 3SUPA 2HHTA 3NFAA 2ILZA 2XCPA 3ZT1A 3VA0A 1NK5A 3RMAA 4DFPA 2R2SA 4KHWA 1DTQA 3ZSVA 4MK8A 3QINA 4EP4A 3PO5A 1JLFB 2OPQB 1RA6A 2ILYA 4J9NA 4J2DA 3RR8A 1KLMB 2IGIA 1TKXA 4YNQA 1S6QB 2G8IA 2ASJA 4EBEA 4FJNA 1S6PA 3HYFA 3CQ8A 5J2NB 4CJVA 1HRHA 2R8GA 3ASMA 4FK4A 1IKXB 3MR3A 4CFCA 4HUFA 2FLPA 4KHRA 4FJIA 4H4OA 4F50A 3AVIA 1T05B 4RNNA 4F4KA 2HB5A 1N56A 3KTQA 2PZSA 4M41A 1WAJA 1X9MA 3NF8A 1RT4B 4U6PA 4BWJA 1S97A 5DK5A 1HYZA 3VQBA 3H5YA 3BQ2A 4DL7A 4FVMA 4IG0B 3RB3A 1ZBHA 3QYYA 1T03B 4IKAA 2HHSA 3RBEA 2OYQA 4CEFA 4FLUA 4XPEA 3G86A 3M8PA 1U4BA 3CJ2A 3HVRA 5KT6A 4ECTA 3GV8B 3ZSZA 4ELVA 3AVJA 3H5SA 4QWDA 3BSOA 3AVHA 2BANB 2GIQA 2D3UA 4ECYA 5KT2A 3HT3A 1NHUA 3KK3A 3NBPB 1RTHB 2RF2A 3AVAA 5JS2A 5J1EA 2VA2A 1ZBIA 3HHKA 3UQSA 4FZZA 1EX4A 3SQ0A 1J5OA 2B6AA 4FJXA 4FLYA 3LP1A 3C6UB 4IFVA 3DLGA 4LSNB 3H2LA 1G15A 1QSSA 3DRSB 1NK7A 1NK8A 3PV8A 4CJ5A 4ZVHA 3KLIA 3AVGA 5L1KA 2I5JA 1FKPA 1HPZA 4Y3CA 4CJWA 3PR5B 1RBUA 1S48A 3ZSYA 4CK2A 5HLFB 4K4SA 1RBSA 3SFGA 2HNZA 1UA0A 3KLEA 2J6UA 2OZMA 1ZTTA 2PY5A 3DRRB 3CIZA 4YR2A 3KMQA 4E7LA 3GIKA 4H54A 3ICLA 4CJEA 1L3TA 3HVAA 4B9TA 1JLCB 5F8HA 3H4DA 2JEGA 2YNGB 1CZ9A 3ZSWA 4DFKA 1FKOB 5KG4A 3TQ1A 4DU1A 4PQUA 5F8JA 3T5LA 4DQPA 1C0UA 4DSJA 1EP4A 1FK9A 2A1RA 4O3SA 4FW1A 4KI6A 4E7IA 1ZBUA 1W0HA 5DQHA 4CERA 4JV1A 1JLBB 3GIJA 5SZTA 1GX5A 4ZTJA 1JKHA 4NLYA 1QHTA 4Z4GA 4FM2A 5DG7A 3OSNA 5EWFA 4IDKA 1JLEB 1RT5A 4GVMA 4DTJA 3OSPA 1D9DA 4PY5A 4QCLA 3P83D 1NJXA 1K6YA 3V4IA 3VQ4A 4B8AB 2G8WA 1RNHA 4KFBB 3L8BA 2UVWA 1KRPA 3NAIA 3PW7A 4DL3A 1S1XB 1XWLA 4M3XA 5KGXA 4MFBA 2IAJB 4KAIA 4W5TA 2WHOA 4NLDA 4HHTA 4KPYA 3V6HA 3U3GA 1VRTA 4FBUA 4KHMA 3QZ8A 4WE1B 3MAQA 3OJUA 1TK8A 2YHAA 4DQSA 3BREA 1LWFB 4IRCA 4H4MA 3EZUA 2AU0A 2RN2A 3OYEA 3C6TA 1S1VB 3ISNC 1HNIA 4CJQA 4Z0UA 2P51A 2VG7B 2W42A 3OYHA 3OHAA 3LDSA 4DL2A 1C1CB 2HAIA 4KTWA 4N5SA 2BE2B 1Q9YA 1S9GA 3PJWA 4DG1A 4EO6A 4FW2A 4CEAA 4TN2A 4ED3A 4DFJA 1U04A 2W9BA 5HRRA 3KJVB 2DFEA 3NGYA 3VQ7A 1GOAA 3BGRA 3N6LA 1J54A 4WFYA 3SI8A 3RB6A 3VQ5A 1Z25A 1GOBA 4CGDA 2IMWP 2JC0A 4OPKA 3NH2A 3D28A 1IG9A 3KHHA 1VSIA 3AA3A 4B9LA 2C28A 2W9CA 1WSIA 3VQEA 4YP3A 2Z1IA 1LW2A 3VQQA 5EDWA 4IBNA 2HMIA 3GYNA 3S3NA 1JLGA 4J9OA 3AA2A 4BDZA 2XY8A 4AHRA 4AH9A 3NAHA 4JV0A 3H40A 1REVA 4NLPA 5C24B 4TQRA 4DS5A 2D41A 4OPJA 3CYMA 3AVKA 3I0SA 4KB0A 1RTDA 5KT7A 4CJTA 1WLJA 1L5UA 5F8IA 4OVLA 3OYGA 3D5MA 3WNFA 5HP1A 4KB7A 5DQGA 4NZ0A 1QQCA 3WNHA 1TL3A 3IAYA 4B3OB 1ZBFA 4CK1A 2JLEA 1SKRA 3DLBA 1J9AA 5C42B 1RT4A 3HK2A 4FJLA 4CHYA 1SV5A 4ED6A 4KTZA 3DM2A 3M8PB 4URGA 4IG0A 1KVCA 4FJ7A 1MU2A 5KFMA 2UVRA 1IKWA 3RB4A 3TAEA 1RT3A 3KHLA 4B9SA 3MEDA 2AX1A 3CJ0A 4B8CA 3TWHA 2V4RA 3NH1A 3IN5A 3CDEA 4XIUA 2XO7A 3OYJA 3G6VA 1OS5A 3OYNA 4K4UA 1U47A 3KK3B 1CXUA 5EUHA 1EXQA 2UVUA 3SFUA 5J1EB 4BWMA 2YKMB 1VSEA 1K1SA 1RTHA 1J5OB 4YFUA 4FBTA 3VQCA 3NKYA 4J9QA 1RBRA 4KHSA 3PJXA 3DLGB 1C0TA 3QGGA 3C94A 4E0DA 4B9NA 1U09A 4K4TA 5C25B 1JIHA 4G1QB 3V6KA 1B92A 3DOLA 4J2BA 3KLIB 2R2UA 3IGNA 1BQNA 5KFZA 5CZ1A 2R7YA 2I5JB 1FKPB 3SUNA 3DRSA 3UPFA 1WSHA 4FJJA 4HCBA 2VG5A 4NCGA 3TANA 4L8RB 3MFHA 1D9FA 4ZVGA 3MF5A 4FJ9A 2HNZB 1Q8IA 3KLEB 3N6NA 1SH0A 3O4QA 1WNEA 3F73A 5DMRA 4DWIA 3AVNA 4F4WA 2ZE2A 1VSJA 4G3IA 5CZ2A 2P1JA 4LQ9A 4J9MA 3PUFA 3NHGA 1EETA 1BISA 3NF7A 1C1AA 3RMDA 4KO0B 1RDDA 1XC9A 1TK5A 3DI6A 4PQUB 5F8NA 2D7SA 1EP4B 1JLCA 5KG0A 1FK9B 3RAXA 4QPXA 4O44B 3LALA 3K2PA 3M9MB 3PW4A 1WN7A 3AO5A 1NJZA 3KKSA 1JKHB 4CEEA 1S1TB 4ZP9A 1D0EA 4OKEA 4EP5A 4IR1A 4MKAA 4EO8A 3KK1B 1BHLA 3V4IB 5KFHA 1BGXT 4O0IA 1S1WA 5CY4A 5KFGA 1RT6A 3TABA 5F8GA 1MMLA 4C8MA 1HQEA 2XY6A 1JLEA 3TAQA 4WYLA 3AO4A 3AVMA 5DGAA 2ASLA 4IG3A 3NE6A 1RYRA 2QK9A 4KHQA 2R8JA 4MFBB 4O4RA 5E41A 1YTAA 2I1RA 3O3HA 1KFDA 4ELUA 4BDYA 2FVRA 2IM0A 4C8NA 2EHGA 4DF4A 2LSNA 5KG7A 3QEIA 4H4MB 3RBDA 3K5LA 1BI4A 4ZTFA 1BQMB 3C6TB 3TAFA 2V9WA 4M42A 4WE1A 4DSFA 1EKEA 1HNIB 2J6SA 4FS1A 4X2BA 2F8EX 2C2RA 2YNFB 3OYKA 4HTUA 4EEYA 4ZP6A 1S9GB 4E3SA 4FJ8A 1NJWA 2IJNA 5KFOA 3K5OA 4B08A 4E7JA 2HVHA 1JLQA 2W9BB 4NLUA 3T1AA 1C1CA 3Q8SB 2BE2A 1VSMA 4ZVFA 4EZ9A 3L3VA 1B9DA 4NLGA 2HHWA 3BGRB 2VG6A 4WXOA 5KFLA 2W7PA 4DSKA 3KJVA 4QWAA 1S4FA 4LY7A 4MKBA 1KHVA 1NNDA 2W9CB 1LW2B 4M3UA 1GX6A 2ITGA 5KFCA 2HMIB 4K4XA 3AO1A 3ZCMA 2Y1IA 1ASUA 1JLGB 3QIPA 4CJSA 3VN5A 3K5NA 4HUGA 2DTUA 4W5RA 3V1QA 4FLWA 1TAUA 1REVB 4Q8FA 4CF2A 2Y1JA 5KFQA 4KAZA 3KNAA 3I0SB 2AJQA 1VSHA 1RTDB 3CG7A 2KFNA 3SUOA 2C22A 4ZHRA 5KFNA 3DLKA 2E9TA 1R0AA 3AVLA 3GIIA 4IKFA 3UR0A 5C24A 1HMVA 5HP1B 1FXXA 5EWGA 3LPUA 4N56A 5F8LA 1TL3B 1RDBA 5K14A 4K4ZA 3I5BA 2DFHA 4CEBA 4FLTA 2QKKA 1TQLA 4B3OA 1SV5B 3HP6A 2PYJA 5DQIA 3DM2B 1WAFA 2V4QA 4OKKA 2WONA 3C95A 1MU2B 5JXSA 3MXMA 5C42A 4HCCA 4J9KA 1IKWB 3PW2A 4WFZA 2W8KA 2WK4A 4Z4FA 1RT3B 2XRIA 4CHNA 3HL8A 3MEDB 3KHRA 1T8EA 4FJHA 1RILA 4CEDA 1TGOA 4CEQA 4JRQA 4CHQA 4DL5A 1TKZA 4KTQA 4EYHB 3H08A 2AGPA 1L3UA 3BSCA 3H59A 2Z1GA 1IM4A 3DLHA 1SL0A 3I5AA 4U7CA 4ZP7A 4R5PA 1N48A 1IO2A 4I2PA 4TQSA 2R8IA 4HVJA 4FYDA 3QEWA 1VRUA 2YKMA 3DMJA 4E1NA 1N5YA 1C0TB 3QESA 1SL1A 4RW9B 4ZP8A 4RW8A 4URSA 4Q43A 1RDCA 4CF1A 4FLVA 3OYDA 2D0BA 4EBCA 2F96A 3DOLB 4BACA 1BQNB 3NDKA 5DG8A 2F8SA 3CFRA 4NLWA 2BGGA 2FBTA 3I8DA 4DL6A 1WSFA 3OVNA 4DU3A 2VG5B 4NCGB 5C25A 4G1QA 2OPRA 1BIUA 3THVA 3QGIA 2QE5A 5KFXA 3BQ0A 1I3AA 2YHBA 2QXFA 4YMEA 4ID1A 3SPYA 4J9LA 2ZE2B 2O4IA 3DDKA 5FRMA 1EETB 3M8QA 1KCFA 2E9RX 4TY9A 2BQ3A 4Q5VA 3E01A 4DTUA 3PW0A 1RT1A 3DI6B 3ITHA 2HHXA 3QO9B 2B4JA 4KO0A 3LAKA 4NLSA 2ASDA 4CHZA 2O5DA 1LV5A 3FQKA 5CYMA 4ZPAA 1C6VA 3LZJA 4HKQA 4ZPDA 1UAXA 4NLRA 3OY9A 4F2RA 1NK6A 3CO9A 4O44A 4BE1A 1O1WA 4E19A 3LAMA 3SQ2A 3AVFA 3V9SA 4ED1A 4JS4A 3BSAA 2UVVA 4ECRA 2RDJA 1S1WB 1RT6B 1S1TA 4GC7A 1HQEB 3KK1A 5D3GA 2OPSB 4RW7B 3TAGA 3V9ZA 1X9SA 3LP0A 3OJSA 3HPHA 4IG3B 4Z4CA 5T14A 2FC0A 2A1SA 4RUAA 2HHUA 3KLHA 1LAVA 1A5VA 2YKNA 2BDPA 4CJ4A 2G8HA 3ZT2A 2R2TA 3QIDA 4W5OA 4RU9A 2XI3A 4WZMA 3ISND 1BI4B 4CGFA 1SKSA 1NOYA 4IR9A 2RDIA 1HNVA 1L3SA 3QLHA 3T5JA 3NGIA 5KRTA 1JX4A 1BQMA 4DSIA 3TAMA 4C8KA 1JLQB 3V9XA 4QW8A 5DGBA 2YNFA 4KHUA 1RCHA 4QW9A 3OL8A 3HO1A 3OL9A 3PO4A 3M9OB 2VG6B 5KFUA 4NYFA 1IKVA 4Y2AA 1CZBA 3L2WA 2OPPB 4DF8A 3DLEB 2IOCA 4CK3A 3QIPB 4ECQA 3QGHA 4R8UB 1D1UA 4MH8A 4R0EA 4FM0A 4DU4A 4ZHRB 2GBZA 3DLKB 4QWBA 1R0AB 3H98A 2HNYB 3OYMA 2RKIA 3KK2A 4Y34A 2HW3A 2IBKA 2ALZA 3A2FA 4DLGA 1HMVB 3NF9A 2JC1A 5KG1A 5T7BA 4KB1A 1I6JA 2C2DA 5K14B 4ZVEA 3V6DA 2FJVA 3OS1A 3O4NA 3CFPA 4WYWA 4M3WA 4EZ6A 1Y97A 3OYLA 1RBTA 4E1MA 3VA3A 1NKBA 2WONB 1RTJB 4RW4A 4W5QA 1K1QA 1SH2A 1KSPA 4M3TA 1T94A 4NCBA 1W9HA 4KSEB 3BJYA 3KLVA 2HVIA 4WFXA 3KMSA 1TKZB 3BQ1A 2FVSA 5DLGA 3LWLA 2FLNA 2NUBA 3HSTB 1S9EA 3CJ5A 3BR9A 3EPIA 4ED0A 1C2PA 4MQ3A 2E9ZA 3GV7B 4R5PB 4FJGA 3HPOA 1XR6A 1UWBA 4I2PB 4K50A 2ZD1A 3MXJA 4CJFA 4FLXA 4Q0BA 4K4WA 4FM1A 1VRUB 4YR3A 4E7KA 3DMJB 3L2QA 2WOMA 1N5YB 3CM5A 3B6OA 4RW8B 2PYLA 4DSLA 3WNGA 2HNDA 3AO3A 2CJQA 1D8YA 3K58A 4F4ZA 3TR8A 1JXLA 3MR2A 1LAWA 2Z1HA 4GMJB 3VQPA 1Q9XA 3IG1B 2VWJA 4CFAA 5KT5A 4MK7A 2ATQA 3KIOA 4RW9A 2KFZA 1HYVA 1LW0B 2W7OA 4KI4A 2OPRB 1Z4UA 2UUTA 3K59A 3F9KA 1BCMA 3T3FA 1XHZA 5KFDA 2D0AA 4EBDA 1QSLA 1GOCA 2GV9A 5KFEA 1ITGA 3KD1E 1S0OA 2DPIA 3SQ1A 3IS9A 3RR7A 2IDOA 1WNSA 5J2PB 4DTOA 3M8QB 4DEZA 4RNHA 3RMCA 1KTQA 4ELTA 3E01B 4M94A 1T7PA 1RT1B 1A5WA 3ITHB 2OH2A 3CM6A 1NK9A 2HWHA 4JV2A 4KV8A 3G0ZA 1KVBA 2QKBA 5L1IA 1IKYA 5CYMB 3QO9A 3H4BA 2HHQA 2D0CA 4NLQA 3WNEA 1DTTA 1ZTWA 1XR5A 1YVUA 4WXWA 2G8VA 1YVFA 3NGZA 5L9XA 4CHPA 3PR4A 1KVAA 3CJ4A 4NLTA 2P5OA 3SJJA 4DTRA 3KLGA 1QUVA 5SWMA 3DRPB 4YR0A 1VSFA 1LWEB 4KBIA 2X74A 1NK0A 5D3GB 3DYAA 3ZSRA 3LP0B 4C8OA 2P5GA 2OZSA 3LANA 2X6SA 3KLHB 3QERA 4ECUA 3LP2B 3AA5X 3AVBA 3NMAA 1W25A 4KRFA 2YKNB 3PZPA 3JSMA 2OPSA 4RW7A 4CF9A 4DMNA 4RNMA 4N47A 1X9WA 5EWEA 3SYZA 4KE5A 2KZZA 4NRTA 1RTIA 1S10A 1NOZA 4DS4A 4Z4IA 4PWDA 2C2EA 3SV3A 4CGGA 1HNVB 1HQUA 3QEVA 4PUOB 3QLHB 2JEFA 1BCOA 4ID5B 4Z4EA 4TXSA 3TAMB 4DL4A 1BIZA 1L3VA 5CYQB 3QEXA 3NL0A 2JGUA 3SZ2A 3GILA 1ZETA 3B6PA 3OHBA 5HRSA 4F3TA 4TY8B 4CGIA 4TLRA 2FVPA 1IKVB 4E89A 1RT2A 4WZQA 3H5XA 4EYIB 1JLAB 1SUQA 5KFPA 3OYIA 1VK0A 4ICLA 3RB0A 3ZSOA 4DTXA 3D45A 5FROA 3HVTA 4F4XA 4O0JA
chains in the Genus database with same CATH superfamily
4PYDA 2P9GA 1NGBA 3L2VA 4UW2A 4OJRA 3EGNA 3V1OA 4DR7F 4X4UA 2RD5C 1HYSB 1JXEA 3BN7A 2PMZD 3IWXA 2VH7A 3QBWA 1C0MA 4CIOA 4O55A 2RILA 5IC6B 1WSEA 3O6WA 2UYTA 4CD3A 2HNYA 3HKWA 4IH7A 5U47A 4ATNA 2AQ4A 2OCEA 3W62A 3V6DB 2QN6B 1VQON 2OA8A 1ZAWA 3CJKB 1LWCA 3V9UA 2YNIA 4QIEA 2CPHA 1CLQA 3B4MA 1O13A 3R5DA 1TUVA 1OH8A 1ZM4A 2Z2LA 1SJ1A 1VJWA 4RW4B 4TNOA 5T7LA 2BKOA 1PCAA 3QIOA 1XNRJ 2OTLS 5LXYA 1JB0C 2UZAA 3T7ZA 2EC0A 1TL1A 4JLHA 4BR0A 1WEZA 3QNNA 4IH5A 3J81O 5E3AA 3JYTA 3CMEN 3J7YP 4OJGA 5DM6Q 3Q8RB 2AGOA 4M5LA 4NOHA 5C2GA 3UNYA 2MSTA 4CZEA 1BL3A 2R7RA 1GXLA 3ONQA 2CWXA 1NZAA 4ZIVA 4LH5A 4Q0BB 3F56A 3MFIA 2XMTA 5AQUA 4BY9C 3CCEN 5C0YA 2O8CB 5HBMA 4LF8J 5I3UA 1PBAA 4GW6A 4PXCA 5KG5A 1NGAA 3FBBA 4IO1A 2AV5A 1VR6A 5DDPC 2QIFA 1M90T 4M95A 4M5HA 4QR2A 1C1BB 5KGWA 3T1HJ 2YHXA 4DPXA 1LW0A 4CLUA 3AY9A 1D9AA 4UOCA 3OR1B 2MZ1A 2MLYA 2F4VF 1ZM3A 4JS5A 2FDNA 2W1BA 1M5VC 3C6HA 5AQWA 3MDQA 3PW5A 3MWBA 2EWHA 2ZGYA 4ZS6A 2UXBJ 2XSFA 3DHXA 3OTOJ 2HBYB 4F0MA 4JUZA 4WCEQ 2PC6A 2CQIA 4H4KC 3FFIB 2Q79A 3GFHA 1Q82O 4ZVQB 3AHPA 9RUBA 1WHVA 1Y4ZB 2HAFA 1QE1A 3LO3A 3GG0A 2MDAA 2IRYA 4RUCA 4ZLJA 3L9ZA 4K8XA 1DARA 3EM1A 4GO5X 4ZN3A 1TMMA 5DM7L 1BWFO 2DO0A 5FDLA 2WFBA 3MHYA 3B8HA 3IO1A 1RWMB 3GG1A 2EXUA 3T5HA 2RIJA 3GU0A 2FF3B 5GMEA 4L73A 5KFWA 2XY7A 2YH1A 4B3MJ 1HLUA 2J0QD 4ITSA 2F1FA 1VLYA 4KH0B 4J9SA 3EE8A 5BPNA 4F4AA 1RTIB 2HVZA 3TO8A 2AF6A 3W2VB 3L4BC 1B9FA 1TUYA 1XQIA 3B54A 4P6QA 2D5RA 1YQHA 1T3VA 3LPYA 1J6ZA 2PN6A 2ZJRL 3Q8YA 1TYQA 1IWAA 3NGDA 2YY3A 1Q7YT 3PACA 4ZVPB 1KS2A 2DHSA 3OLAA 4PUOA 2G0JA 1HWUA 2YKOA 4QYZK 4MAKA 3FR0A 3VQDA 1YJWS 4V19S 4DTMA 1NDCA 4BQLA 4X65K 1E4FT 5HN0A 2HRYA 3R6LB 5J2QB 2B9EA 1EZZB 4CJKA 1FESA 3OYBA 4O3QA 3OTDA 3FCWA 3GE1A 1SUQB 1MDUB 2E6LA 1D8ZA 2V2KA 4LFAJ 3FDSA 4USWA 3BS9A 1RWVB 4K4YA 3HVTB 2V67A 1PIEA 3EZ5A 4DQQA 2V50A 5EHHA 3V1RA 1H7WA 2EFVA 4DKWA 2DCUB 3CD7A 1LKZA 1SI9A 1FFSB 4TYAA 2R9LA 2CKWA 3SV4A 1N0VC 3CJ3A 3M8WA 3W63A 1HYSA 1Q86O 5ADZA 5KFVA 1TKXB 2WTFA 1U48A 1TKTB 2OPQA 2UUAJ 3I5CA 2B9XA 1XUPO 4BR5A 4OYWA 1KLMA 4J90A 3J81U 2W4CA 1HLWA 4KHYA 1NJIO 3HOSA 5KTQA 2AEMA 1I39A 1F0XA 2H48B 4O3NA 3R27A 4CEOA 4DFMA 1WKJA 1VSKA 4J9PA 2UXDK 1YGYA 1B70B 4CGHA 2DGTA 1S72S 4FK0A 4QIWD 4ECVA 3R2CJ 2LXUA 1R8CA 3BKFA 1UVIA 5B0CA 4JYAK 2A40A 3PNIA 1WTFA 2UUCF 2AA4A 1BQXA 4F7VA 4CJPA 2YWFA 1U6ZA 2BRKA 3OV7A 2GWJA 4IOBA 3DOKB 4RO0A 3TVYA 3OYCA 4AILC 1EKRA 2WC9A 5GMDA 1IBKF 2R7SA 4ES3A 7AT1B 2CNLB 3NCQA 1Y9OA 2JLFA 1I1GA 3FZLA 3MTKA 5KFKA 1QAIA 3GJTB 3MM7B 4P10A 2V4JA 4JK7A 5F1XA 6FDRA 3CF5Q 4ZPBA 1WC1A 4Z94A 3MECB 4FOEA 3NBPA 1C1BA 4EGLA 4BRPA 5GIPA 3OL6A 1MN9A 2Q43A 3BZCA 3OR1A 2O8BB 2J8AA 3FC9A 4MDBA 4JI7F 3DXKA 2MZJA 5DS7A 4B17A 1M1KT 2NUHA 4AHSA 4FZXC 2VU5A 2P9NA 2MQLA 1RA7A 2XYGB 3M3ZA 4CHOA 1ILYA 2P9EA 2DIUA 4YOXA 1YJ9S 4LD0A 4M5NA 1M1GA 3VAGA 4I2QB 3FFIA 1QZ6A 2IVNA 5AQFA 1X4CA 3UWTA 2E2NA 2E5HA 3ZNUA 5IS2A 4KHPJ 2CH6A 1DZ5A 1QJHA 5KOWA 2QEXN 4PA1A 3DRRA 3C66A 4DTPA 2E20A 5JUMA 2VGMA 2BQUA 1IH7A 1G7CB 1N5TA 4F8RA 3SBTA 2XBPA 3IR6B 4M3YA 2DD8S 2LQ8A 4KREA 3M30A 5H1SV 2RHSB 2Z8QA 5F3ZA 4LFBK 1RDRA 1UW4A 2XEXA 2XM3A 3LZIA 3A5NC 1HBUB 3DLRA 3MEEB 1V4TA 3V9WA 6AT1B 3W2VA 2FJXA 1FRHA 2AX0A 5HVFA 4IQXA 2NCKL 1QSYA 3KXDA 3KG0A 3VQ9A 4PKGA 1RHJB 2L9WA 2JWLA 3WXMB 3W8GA 1Y5NB 3PDNA 4ERDA 1KQFB 1ZAVA 2WBMA 3QFWA 4HUEA 3KLFB 2I0XA 2H5IB 5J2QA 2XMAA 1RHQB 3JQKA 2G8KA 1F5CA 4OLOA 4ED8A 1LWFA 3N79A 1UMJA 2L3MA 2KM8C 1S1VA 3K57A 1JL1A 3K17A 5C12A 3SCLE 2WB4A 2HHTA 4CZMA 2ILZA 3KWGA 1BE4A 4BG9A 1ROFA 1VQ5N 5IWAK 2A6OA 1T9YA 4KR0B 3J81Y 4MK8A 2RMLA 2DGSA 3EXCX 1CULB 1JLFB 5DM6L 1IBLJ 3Q8VA 4CH7A 2OMLA 1H6KX 1RA6A 2ILYA 2CJXB 2DRDA 2D3O1 1TKXA 3W65A 4YNQA 5E26A 2UXCK 4GKKK 2ASJA 2CQHA 2WSEC 2FXUA 3TX0A 3HYFA 2HS3A 4CJVA 1HRHA 3QT8A 1IKXB 2ZC4A 2V5HG 4OZNA 3OVSA 4HUFA 5LL6Z 1WG1A 4BC5A 3M05A 2WZ1A 3R5JB 3PYFA 5D0GA 4LREA 4GO7X 4BG8A 3IBFB 1YLXA 2G1HA 5LSRA 3A3OB 3FZMA 3JSBA 1X9MA 4JKHA 1S97A 2HSEB 2DJWA 2QX0A 2Z0GA 2HYIB 4CM0A 4K5RA 4CH0S 2A6AA 5DRKA 3RB3A 1ZBHA 2KLAA 1U1MA 4IOXA 3BBBA 1MMNA 3W2WB 4RWTA 2DHXA 4CEFA 4GVBA 4UY85 3ZZUA 4RWXA 3ZSZA 2IHR1 2GAGC 4QWDA 3CQYA 5I9EB 3NLCA 2BANB 1OY9A 2F4FA 2GIQA 4WCEL 2VIHA 3VEOA 5H9EK 2H3GX 1WDDA 1CVJA 5KT2A 3HT3A 3HSZA 1RABB 2MKJA 4OZJA 1RTHB 4ZIWA 3AVAA 1BA0A 5LJ5Y 2KO1A 2MPUA 4BRCA 1ZBIA 1Q81O 3SQ0A 1NPPA 4FLYA 2PGCA 1KOHA 2LA4A 3TP2A 4DDFA 5B0EA 1G15A 3DRSB 3U4LA 3PV8A 4CJ5A 4ZLLA 2Y9HA 4ZVHA 4F04B 3KLIA 1SIWB 2Q31A 4PZVA 1Q79A 2I5JA 3D2EA 4Y3CA 4QPTA 1X4GA 3GE9A 5BPMA 4BR9A 4J8FA 3GWCA 3M6UA 3KLEA 1ZTTA 2PY5A 1HD1A 5FPEA 4YR2A 3VZHA 2E1ZA 4WFNL 4E7LA 4I6MB 5AQKA 3UD3P 4B1UB 2QW9A 2MKCA 3EGZA 2H5JB 3NWRA 3PSFA 3P6YC 3KZBA 4B9TA 1VC5A 2JEGA 1FO1A 2NLWA 3L0QA 1PILA 2XS5A 5KG4A 3HF5A 1EWRA 3TQ1A 2O66A 4PQUA 2I8EA 2ZM6K 2R7UA 1EP4A 1WOQA 3IP0A 4O3SA 2ZH5A 1AW0A 2O8DA 1ZBUA 5DQHA 5HMZA 1SPBP 5B8HA 3GIJA 4ZTJA 1VBXA 4Z4GA 1F5AA 2MJNA 4H4KA 3SSSA 1RAGB 3WX4A 5BR9A 5EWFA 1JLEB 2YPZA 3OSPA 1D9DA 4PY5A 1DKGD 3VERA 5IZHA 2VOOA 3NOCA 1RNHA 2UU9J 2QWMA 4JI8J 2DNOA 2NRZA 3HOTA 1KRPA 3DNCA 4AUKA 3NAIA 4DL3A 1S1XB 3THPA 4BQZA 1VYAA 2H1YA 4KAIA 1JJCB 5CZVA 1KVKA 2QWQA 3W60A 4WE1B 3MAQA 3N5BA 2YHAA 3BREA 2H51B 2AU0A 3MPVA 1S76D 3C6TA 4IJAA 4Z0UA 4LRDA 2P51A 4DL2A 2AYEA 2HAIA 1Q9YA 4LBHA 3LM2A 2PA3A 4ED3A 3VAHA 4JV5F 2VODA 4RJVA 3KJVB 3H0PA 1XNQJ 1FRLA 3LL3A 4L75A 4MO5A 1Z25A 1IR0A 3IFEA 2MTLA 4LF6F 2LECA 2FTRA 2P9LB 2KHOA 3FK4A 1V9OA 4A2AA 3UKUB 4DUYF 4MYUA 4IBNA 2YHYA 2MLXA 3S3NA 1JLGA 4DV7K 2XY8A 4IEEA 4AHRA 4NA1A 3NAHA 4NLPA 2KM8B 3P49B 3MM6B 1CJKB 3CULA 3AVKA 3I0SA 3MM5B 3UI3A 1RTDA 2H9ZA 5HP1A 2VQFK 1UJ6A 1I94K 3I4HX 1ZBFA 5AJ3F 3CQXA 2G2YA 5H9FJ 3DLBA 4A8OA 3CF5L 2HS0A 3R6MA 1P8GA 3Q89A 1SV5A 4KTZA 2I2YA 3A0IX 1ZPVA 3W2WA 1SQGA 2P2CB 3KHLA 4WF9L 2BOPA 2AX1A 3Q2TC 2ASOA 3N4WA 3DU5A 2V4RA 3IN5A 3CDEA 1O5JA 2XO7A 3G6VA 1G2EA 1U47A 3O5TB 3NS7B 4LF7J 4JKAA 5LY3A 2K7KA 4LRCA 1PKUA 2EWSA 2ZH6A 4BR7A 2YKMB 3KFWX 2VONA 2GJ2A 1RTHA 2NYIA 4YFUA 3D0HE 4FBTA 2OSRA 5LM7E 3NKYA 3H42A 5A8RB 5JMNA 3DLGB 4DPTA 2VQEF 5AQNA 3VQTA 4DPOA 3QSIA 1U09A 2JLGA 2PAVA 3IGNA 3O9SA 1Q5VA 3Q2SC 4LBIA 4USTA 4DCJB 2R7YA 3DRSA 3UPFA 1FWLA 4HCBA 4NCGA 5G4DA 2XG8A 1OSDA 2HNZB 1Q8IA 3TEGA 3I4PA 3AD8C 1WNEA 1HPMA 5A6PA 4G3IA 3CXCM 2ALYB 1FTRA 4DV1F 5GAHP 1EETA 3CD6N 1P1LA 4KO0B 2V2VA 4R0JA 2D4WA 4JI1F 2YWEA 4RX6A 1FK9B 5CD4A 1WSRA 3QRPA 2C3UA 1X7VA 3M9MB 4P7VA 2BBEA 1RP5A 1NGGA 4CEEA 1JKHB 4QZVB 1WG5A 3AFGA 3G8TA 1S1TB 3RRKA 1D0EA 2NXNA 3SAHA 1S77D 1BGXT 1ZA1B 1S1WA 3V5RA 3ILIA 1V5VA 1MMLA 2VV5A 3DOMA 1IVZA 1JLEA 3IAM9 1HHTP 3TAQA 4WYLA 3GL1A 1RYRA 3BGOP 2C3OA 1Y3KA 2BJDA 1MA9B 4MFBB 4O4RA 1YTAA 2ZH9A 1YXQA 1PG5B 3F44A 4DR3K 5JICA 2DVIA 3QEIA 3VGTA 3RBDA 1LWXA 4I4BA 1BQMB 2DR6A 1HNXJ 2HF4A 4WE1A 4DSFA 1HNIB 5ELZA 5IT0A 3MTJA 2ZFHA 2J6SA 3BYRA 3B8AX 4FS1A 4MTPA 2F8EX 1FRJA 3OYKA 4HTUA 1S9GB 5IQ6A 1JLQA 4QU7A 4NLUA 2KH9A 2JOQA 1YZ6A 3T1AA 2AYMA 1VSMA 1KQGB 3MMAB 3T6JA 1ELOA 2HHWA 2V2ZA 3CCUN 3UCUP 3KJVA 2A6MA 2OAUA 1H2UX 1NNDA 2W9CB 3WQUA 2QLWA 3MPWA 1HNWJ 1S79A 1QQNA 5KFCA 4IOAQ 1ASUA 3I82A 1FVQA 1NG9A 3VN5A 4LF8F 4W5RA 2DTUA 3V1QA 2RS8A 4FNIA 1TAUA 1REVB 3G6EN 2AJQA 1VSHA 3CG7A 3SUOA 3TA1A 3LPEA 1R0AA 2C2MB 4X62J 3CE8A 2G0CA 3WQTA 1LK5A 1FFWB 1PJ6A 1BUPA 3BZKA 3LPUA 3T1HF 1WBDA 1HWKA 3IR7B 4UF4A 4N56A 5FPMA 5CE3A 1TL3B 1U02A 1FW6A 5K14A 4K4ZA 2IYGA 3TUJC 3I5BA 5E3PA 2DEIA 4CEBA 3NG8A 3BF3A 2OEJA 3EE9A 1N36K 2V4QA 4Y2MA 4OKKA 3OTOF 3OTBA 4I6WA 2H4WB 3EXYA 3PW2A 2W8KA 3HSDA 5EVZA 4LR7A 4CRJA 2V8HA 3HL8A 3CHWA 3UFCX 3P4UB 4FJHA 1T9TA 3E9LA 4CEDA 1TGOA 5D6GA 3JS9A 4LIRA 3R5AA 1F9FA 5K8PA 3BSCA 2DGWA 2Z1GA 3A3PB 1IM4A 2DNHA 3DLHA 4V19X 1SL0A 4U7CA 3MX2A 2QLBB 1CJTB 4YB1P 1YI2S 3UKRA 1YRUA 1IBCB 3EN9A 5F3TA 4WTYA 1QAXA 1VRUA 2YKMA 3ISZA 4E1NA 1N5YA 3QESA 4DR1J 1JMTA 2IY5B 3M2VB 4ZP8A 4RW8A 2CPYA 4B3MF 1SJRA 4NXMJ 1HBNA 2GTDA 3NDKA 5DG8A 1TUGB 3CFRA 3I8DA 2QRRA 1NO8A 1U2VA 1XEZA 3THVA 2QE5A 3BPSP 4WJBA 5IV3A 1GLBG 2YHBA 2XQCA 1GNKA 1W26A 2Q1LA 3A4TA 2GO8A 5AXMA 2F4VK 5GAGU 1KCFA 3BGLA 2BQ3A 3CSKA 3PW0A 2H5EA 1H2VZ 1R8HA 5E33A 3KKFA 3QO9B 5IFMA 4KO0A 4DR5F 1OVYA 3LAKA 1BMQB 4LFAF 1H0HB 2V7YA 4OO1J 3LZJA 4HKQA 4NLRA 2A10A 4BE1A 3LAMA 3KG1A 3AVFA 2DRBA 4YOWA 3E9PA 4ED1A 4JS4A 1Z05A 1VQMS 2RDJA 3FEXB 2MKKA 1S1TA 3LH2S 1HQEB 3A8KA 1SAZA 5JMVA 3A8EA 5LOQA 1X9SA 3V9ZA 3OJSA 4CD1A 4IG3B 4CO5A 2FC0A 4K8RA 4RUAA 4CLTA 3MZIA 1LAVA 3T1YJ 2V8VA 4W5OA 4RU9A 4ZLNA 1BI4B 4NE9C 2ZVSA 3G96A 2RDIA 1EKSA 2GMHA 4KGMA 4UY8T 1NGJA 2B51A 3FBFA 1S57A 5C2DA 3NGIA 5KRTA 4HI1A 1BQMA 4A61A 3HMJG 1IV0A 3AB2B 2H4YB 3EEQA 3PKYA 4QW9A 3PCOB 3CJTA 3E1YA 1T0TV 3PO4A 3QBCA 2XMWA 2ZVIA 4XDCA 5KFUA 1NHKL 3J7Z5 2EG1A 4Y2AA 2Q36A 5CHCB 1FT8A 3DLEB 3AQOA 2IOCA 5M1OA 3H7HB 4ECQA 3QGHA 2DPNA 5KQDA 4ZOSA 2BMBA 5EN1A 4F25A 1GXUA 1P90A 2DHHA 2RKIA 1F2HA 2HW3A 2ALZA 4DLGA 1FJCA 5FPNA 2ADBA 1R31A 2J8SA 4OHVA 4RWWA 4ZVEA 4DBQA 1RWUA 4AF1A 3ZZOA 4G65A 3SCKE 4WYWA 4M3WA 1NMEB 3O5BA 3QJPA 1FX4A 2PA8D 3CCZA 1RBTA 2CPFA 3MM8A 1NKBA 3O9UA 2J7KA 2PDAA 1RTJB 2CJAA 2ZWOA 1NGEA 4W5QA 1E4GT 4C0HA 4C48A 1T94A 3TA2A 1W9HA 3OPKA 3KLVA 2WVBA 2E1RA 2HVIA 3B82A 4CJ7A 2EC2A 4LBPA 1QQMA 4WFXA 1VQOS 2B7CB 2RVJA 1FXLA 4DXLA 4OHWA 2B4OA 3QT7A 4WIQA 1S9EA 3TZXA 1U2RA 3ZEUA 3CJ5A 1AA1B 4MQ3A 4WK3A 5BN8A 4CT9A 1Y5IB 4FJGA 4ALZA 3GG4A 1YRTA 3MXJA 4FLXA 1XIQA 2GX9A 3RU0A 3L2QA 3CMES 1DQ9A 5B0AA 4V19J 2LFVA 1X31C 5HL7Q 3WNGA 1IBKK 2CJQA 1D8YA 4ANEA 3TR8A 3LUYA 3MR2A 1LAWA 2Z1HA 3IG1B 2VWJA 5KT5A 3EVWA 1X0PA 3M2VA 4J9VA 4J37A 1F9HA 1Z2ZA 4EBDA 1QSLA 3I8BA 1GOCA 4PHTX 2GV9A 3CCES 2QLJB 6FD1A 1TUUA 4G6VB 2DPIA 3IS9A 4DTOA 4OX8A 4DEZA 2G0IA 3A8JA 4M94A 4JI7K 4EU0A 4NXNF 4MO4A 2HQCA 4OYIA 2ZJQQ 1H2TZ 4HEA9 4QYRA 2QKBA 1GLAG 3KWIA 2W40A 2K06A 4PPDA 5CYMB 3QO9A 2D0CA 3WNEA 4OZLA 4NI2A 1XR5A 4JKBA 4QR0A 4JK9A 3OXLA 5DDQC 1VQNS 1KVAA 2HBJA 5GMKa 4GY2B 2G1DA 4G1IA 4M5KA 5SWMA 3DRPB 4YR0A 1VSFA 3N9UC 3HD2A 3MMCB 2ADCA 3OXFA 1S22A 1NK0A 3QNWB 1CQNA 4IEIA 5TKYA 4TU9A 4CQ1A 1P9QC 2HQGA 3P45B 4ECUA 2O8EB 3HI0A 1W25A 4XH5A 1AUSL 1HKCA 4YY3J 4DMNA 5E3QA 1IBLF 4M7YA 4N47A 3J7A1 3SDEA 2EK6A 2E5LJ 4GKJF 2C2EA 3THWB 3SV3A 4CGGA 4DX7A 1HNVB 4JI4J 1U0HA 1OWXA 3AGRA 2QGFB 4TXSA 2VD3A 3VV2B 2AYBA 5CYQB 2JGUA 3SZ2A 3D2FA 3ULHA 3B6PA 4QBUA 1X5TA 3OHBA 2Z2YB 4F3TA 4WQ4C 4TY8B 2P9SA 2GIFA 1HKGA 2OUGA 3RSEB 2E2PA 3OYIA 2YWGA 2CADA 2NRWA 4ANDA 1GFWB 3MK6A 3VENA 2C3PA 1RAEB 3O9QA 2B4VA 4FP9A 4F4XA 3UD5A 2V52B 5HQMA 3OLBA 1RAJA 4FJKA 3HFKA 3DLEA 1FD2A 3WBZA 1UVJA 1KAXA 3QWPA 4KGVB 3W0LA 5AXKA 2J4RA 2DNNA 2XMUA 1KEKA 3C8YA 4USJC 5KG6A 1RBOB 1U1QA 4NASA 4IJNA 1S72N 5E3RA 2EI5A 1Y7PA 2MHEA 4BE0A 2FJWA 3ZETA 4PCQA 4DX5A 4A5AA 3PRBA 2QLFB 1T9VA 3L09A 4N8NA 2RPIA 4RZRA 4K8ZA 1HKBA 3TVKA 2QLXA 3SAFA 2XHBA 3R1HA 3S3MA 2AEFA 2BZ2A 4CI0B 4CZHA 2YCHA 2E4LA 1RTJA 3HJFA 3BH6B 3HLUA 5DLFA 2HLUA 4WP3A 4FS2A 3ZT3A 2ZDOA 4OHXA 1M0SA 1S9FA 1Q4RA 2CZ9A 4C97A 3LTOA 4RW6A 3IDHA 2ZD1B 3I0RB 4Y0WA 3OTEA 4NYZA 2KB2A 4ZN1A 5GAGP 2JH3A 2CVEA 4IRDA 2WOMB 3AODA 2MQOA 3HFVA 1YKWA 2VPYB 1F21A 2GEMA 2E44A 5A6WA 3ZZYA 3HFZB 3WX8A 2HNDB 4CFBA 3CCJN 1TK0A 2R7QA 3SI6A 2YX4A 5D4OA 2E7XA 2DR8A 5I42A 1XI1A 1TV6A 4N7TA 3CUNA 4M3RA 3IG1A 2V8PA 2Z56B 3GSIA 2JEIA 1RZMA 4AL5A 4K4VA 2GAHC 4O4GA 4CO1A 1C0GA 3PJ9A 1JCGA 1N8RT 4PG5A 3IKMA 2YWWA 5KFBA 2UU9F 3G8QA 4JI8F 2UUBJ 4HDGA 1GTHA 2BE7D 3I87A 4KKOA 2IM3A 1QHAA 3CDUA 4XDDA 4LVOP 3R5CA 1ASVA 4OV1A 3DFEA 3QRQA 3U6FA 3SMPA 3GIRA 1DTTB 2HPUA 5KFTA 4BRKA 3CCQN 1T9XA 4NCAA 1AZSA 4NWBA 3VGLA 2GGPB 5DZ6A 4F4YA 3KLGB 3A1YG 3JSYA 1J53A 2FBYA 3DYAB 4H03B 4JI2J 4M63C 2BQRA 1TUWA 3CCSS 4H0XB 2CWKA 3SK3A 3DRPA 2KZMA 1VDHA 2AJ2A 1MWYA 5AE2A 2AHOB 1CXQA 4IOCQ 1WKKA 1V6HA 5KFAA 3JSMB 2K2PA 2NSCA 3MR6A 2AWZA 1JJ2R 3SUQA 2FLLA 2DGUA 3UN5A 4DOZA 2R8KA 4USVA 3RWUA 2RT3A 2HGMA 4YB7A 1H74A 2YX7A 1S5ZA 4LF9J 1UPPA 3AV9A 4CJ3A 5L38A 3QMLA 4NMLA 2IMOA 3UDLA 1C0FA 2XMJA 1CLFA 4DTSA 2HVDA 5AE3A 1GH8A 5CYQA 1FRIA 2EPIA 4O8UA 4E98A 4L3KA 1UVLA 3CO0P 2QMUB 1ZXOA 2W2PP 3NGRA 1SL2A 1ZBLA 1RT2B 1SXLA 3N6MA 4TY8A 4C9DA 2N4CA 3L95X 4I7FB 1RAIB 1RHRB 2JNJA 1HBOA 4EHTA 4CCHA 4WPAA 4DX6A 4IFYA 3FSIA 3CCWA 4Y1DA 3Q83A 3D6MB 1RCOB 2I38A 4U9RA 1SC1B 1SQKA 1J5EJ 2B5JB 4CZKA 3DDIA 4OMFG 3QZ7A 2KTQA 4BE2A 2DNRA 5HROB 4JV5K 3P96A 4O0NA 1XHXA 1Q7LB 4RKUC 5LSOA 1RQ0A 2GELA 3IUCA 1N32J 2DRAA 4LF7F 3TTFA 4CJUA 3HCXA 4DV0K 4JD2A 3OBIA 4LF6K 3H6EA 2LVWA 3RVCA 2H65B 1S6QA 2HFZA 3N4PA 1N54B 1N6QB 4DUYK 4RNFA 3NXZA 2A2DA 2DXDA 5J2NA 4H4OB 3TYTA 5DG9A 2E66A 1R27B 1MWZA 1HUXA 4GC6A 5IQQA 3BSNA 1NM1A 3OVBA 3RAQA 3AA4A 5HL7L 1RKIA 3IRXB 1T05A 1DLOB 4JYAF 1OH7A 1I51B 4CI6A 1NWKA 2IVOA 3E8OA 4Y65A 1CSJA 2HFUA 1ZA2B 4PYAA 2GHVC 2HFVA 3IWNC 2P9UB 1RDAA 1S0MA 3RBZA 4RNOA 3J7YI 3JB9k 1B3TA 5I3PA 3UE2A 4CLPA 4ZPWR 3QAEA 2RE2A 2YTCA 5I4MA 5ETNA 1YT3A 3I0RA 1T03A 2YQ0A 2KFYA 4C7QA 3GSDA 3MDFA 2F63A 2VASA 5L1LA 4Y2CA 4C11B 3RUBL 2NQPA 3TW0A 4E7HA 4CNZA 1WDTA 3QT5A 2O4GA 1F3VA 4IXCA 1YSJA 3AO2A 5KT3A 1AFIA 1O6XA 3TJ9A 3VQ8A 1RT7B 2IJFA 3AT1B 1OY6A 5HRNA 1X1PA 2A3JA 3Q8PB 2DNGA 2KRBA 5JLFA 3RRHA 5ETQA 4CFDA 1VS3A 1TAQA 4CT8A 2DR5A 3EWGA 4JK8A 3E51A 2VBYA 4UQTA 2LA6A 3Q8QB 3P5BP 4Y2IA 5LMNK 3J7ZT 1GLCG 3TARA 5BRDA 4IH6A 1GMUA 3M2RB 2VQEK 2NYHA 3CVKA 4JI0J 1EJ7L 2ZHAA 3KKRA 4JKDA 3BGFA 2MKHA 1SC4B 2EFOA 4CLFA 3VGKA 4ES2A 1K44A 4KYZA 1NGHA 4HACA 2VPZB 1HNXF 2CPIA 3ZSQA 5D4PA 5HLFA 3HZ6A 2L9NA 2J6TA 4DHVA 4FK2A 3CDBA 4CDIA 3TZWA 2Z2MA 3ZFVA 4FZYA 3V4MA 2FSNA 4LSLB 4USUA 4DV1K 4O3PA 4ED5A 1C0UB 2EVZA 2QV6A 4G9ZA 2PBDA 3F5TA 3H1QA 1TL5A 1OH6A 4JI1K 1M5HA 3CCRN 4DQRA 2IC3B 2VC0A 2QFJA 4OX6A 3HP9A 1HNWF 1FRMA 1JLBA 3KUEA 2HIQA 4N41A 3LDOA 1JNZB 4P2FA 2NREA 4B9UA 1U49A 4DJBA 1CJUB 2HWTA 3OL7A 4NLCA 1OMSA 2J9EA 2JEJA 3FGUA 3OUYB 1RYSA 2W01A 1KNZA 4HVZA 3GR1A 4FYXB 3TWZA 1UCNA 4QWEA 3CB4A 1TVRB 2R3VA 2XWYA 1P9YA 2Z1JA 4DR6J 4UTGA 3DRXA 2HQ3A 2IA6A 3VGSA 4CECA 3MAHA 3V6JA 2YNHB 1GTEA 2HFSA 7FD1A 1HX1A 1FXRA 4I7FA 1FX2A 1APSA 1VI7A 3M8RA 5IWAF 2VG7A 4FF3A 3SUPA 3NFAA 3CD5A 3D9BA 4K5SA 1IJEB 3QGPA 1NK5A 3EGWB 1GAOA 3S41A 4DFPA 1A0OB 4EP4A 3PO5A 3HHNB 1N33J 5HVGA 2B56A 3DJCA 3KG4A 1NGDA 3NCRA 1S3XA 4J9NA 4ILGB 2J76E 3RR8A 3O2IA 1R89A 2G8IA 1UEKA 1SQFA 4WQ4A 4NPOA 4EBEA 2CJKA 4DR1F 3PLAA 4LF8K 4CZCA 4NXMF 1Y11A 3JXOA 2YQ3A 2WAQD 4FJIA 2YJFA 4H4OA 4ILMA 3AVIA 4AXJA 2W4PA 4RNNA 1N56A 3KTQA 1B0TA 3T1HK 4YOVA 1NPRA 3ENHA 2N4DA 3NF8A 4U6PA 4BWJA 5DK5A 3ULEB 1QDUB 4DL7A 2IDLA 1CBKA 2GQ2A 4IO9Q 3IWLA 1KOOA 2UXBK 2M70A 5L46A 3BV8A 3H1VX 2OYQA 2J7WA 3OTOK 4FLUA 4XPEA 4JKEA 3M8PA 1U4BA 3HVRA 2VJUA 2CQ3A 2ZH1A 2MLZA 3UE5A 1ACMB 2IVPA 3BSOA 1Q82T 3G8SA 4NMXA 3Q22A 4ECYA 4PG6A 4CW7B 5C10A 1DHMA 3THXB 2CQ0A 2ROPA 2CPZA 1NHUA 1X60A 4RBTA 3KK3A 1U7LA 3C65A 5J1EA 4FKXA 3X1LB 3CJRA 2O3DA 4FWNA 2E5IA 3BYPA 2C2NA 3C6UB 3T1YF 4LSNB 4B3MK 4OYAA 2ZH2A 3UN2A 2Q1NA 4GV3A 1JWWA 4IOCL 5ETTA 3DGPB 1RBUA 1S48A 4CK2A 4K4SA 3K8WA 3F2KA 4USIA 1UA0A 3TX8A 5M1FA 1Q0NA 3HTVA 1URNA 3TTCA 3KMQA 2GV1A 3GIKA 1IWGA 2YX6A 2E7VA 4M7XA 1JLCB 3NVMA 3A5LC 2YNGB 1Q78A 3UN3A 1CZ9A 1FKOB 2X51A 4KH6A 4CYUB 5IT9O 3OT9A 3PYEA 3TU5A 1NBWA 1C0UA 4PKIA 3R7NB 3OD2A 4FWKA 4LFAK 4A8FA 2XLKA 4OJHA 1NAQA 5SZTA 3DCAA 3TTDA 2CG8A 4ISFA 4NLYA 4CM2A 3CD6S 4OQJA 5DG7A 1VOMA 3CDAA 1QUPA 4GVMA 1NJXA 2XMMA 2A2CA 4FF4A 2B9WA 1UJ4A 4KFBB 3L8BA 2BJ1A 1CS4B 5CH7B 5M1PA 2P9CA 2OSQA 2WVDA 3R7BB 2G9OA 1GLJO 3PXGa 1SC3B 1E6VB 1Q86T 2IAJB 4W5TA 2WHOA 2OELA 4NLDA 4KPYA 1HNZJ 2GVZA 1HKAA 4FBUA 2UUAK 4BC9A 4ZJQA 1JCEA 4M63A 1U6BA 1S7HA 3EL2A 2P6TA 3G25A 2M4MA 4DV4J 3NVKA 5HMWA 4WP8A 1KVJA 3M1VB 1NJIT 4C98A 2IVFB 4QIVA 3TPQA 3D6HB 2WUSA 1VQ6N 2BE2B 3D0IE 3PJWA 4FW2A 2A41A 5AZIB 1HW9A 3OVAA 1U04A 2W9BA 4NLBA 3NGYA 4JI3J 4HTLA 5ETVA 1CC7A 1GOAA 2XSJA 4CGDA 1GOBA 2IIHA 3N4QA 2IMWP 2JC0A 3AA9A 1DQ8A 3KHHA 1UEVA 4HLBA 3IFRA 2B0GA 4B1VA 1WSIA 4YP3A 1Q8LA 3WHIA 3EMTA 2HMIA 2VYPA 3CCLN 3HT0A 3AA2A 3K0SA 4JV0A 3CJCA 3H40A 3PFEA 5C24B 2DGQA 4RCHA 2VQFF 3VETA 4KB0A 3QQCD 5KT7A 4I0WA 3CCUS 5CD4H 5F8IA 3UVJA 2G2OA 2HZAA 3US5A 3FMBA 3PTWA 4KB7A 2SXLA 5BN9A 2OHDA 5L39A 4OV6A 1S59A 1HW8A 3IAYA 4YOUA 4CK1A 2CRLA 4EK2A 2B8QA 2JLEA 1SKRA 3C3LA 5GAEI 1J9AA 3CIMA 2ROGA 3K7RA 4BR2A 5C42B 3G6ES 3WEEA 4CHYA 4P73A 4LR8A 3QT6A 1NSQA 3DM2A 3ULEA 1RB0A 4URGA 4FJ7A 2UVRA 1U2CA 1WHXA 2WSCC 4JN4A 5A2QO 2C1EB 1RT3A 2Y3YA 4HI2A 3GJRB 2JL9A 2KJWA 2YH0A 1GLDG 4TU8A 4B8CA 3TWHA 3NH1A 3W64A 4HTIA 4J5OA 4XIUA 3OYJA 3OYNA 4K4UA 4KHPK 1CXUA 5EUHA 5AZJB 1EXQA 3JQMA 3W66A 2MZSA 3THXA 2OFHX 2K1RA 1J5OB 1SVDA 4KH4A 4J9QA 1C0TA 4E0DA 3CXCR 4B9NA 2CH5A 4G1QB 4IZ9A 3V6KA 3QWUA 3DOLA 1YZ7A 5CZ1A 4DV3J 1FKPB 3O80A 4PQAA 4L8RB 4JI4F 3DGVA 5M2UA 3MF5A 5E7OB 4FJ9A 1QM9A 3N6NA 1IR2A 3F73A 3H2VE 5B08A 4DWIA 1CEZA 1RHMB 5DMRA 5IT9U 1U25A 4C1NI 5CZ2A 1J2VA 3AAQA 3O6QA 1BISA 3NF7A 3RMDA 1WKLA 1RDDA 1KC8O 4ZJOA 1TK5A 3BR8A 3DI6A 3ETOA 5F0UA 5E84A 5KG0A 1JLCA 2E8AA 4H0TB 4QPXA 3LALA 3K2PA 3VGVA 1VQLN 3FSXA 1WN7A 3PIPQ 4YORA 1NJZA 4B9QA 3KKSA 1KP6A 5KPTA 3BZQA 4OKEA 3FZFA 5HQLA 3IMQJ 4MKAA 1FEHA 3LOUA 3VCDA 3V4IB 5KFHA 4O0IA 3PM9A 5CY4A 3J7ZO 5KFGA 2RUSA 5ETRA 4GRSA 5F8GA 3P5TL 3D1HA 2W2MP 4DN9A 2WW8A 4NEZA 1NNEA 1F60B 3AVMA 3NE6A 3D4JA 2FHKA 5B0DA 1GK8A 5FJ4A 3O3HA 3A12A 1W2BR 1IBLK 4ELUA 2CYYA 5LMUJ 4BDYA 1E6VA 1QTNB 2IM0A 4JKFA 2EHGA 4F3QA 5KG7A 2LSNA 2V8DA 4I6YA 4H4MB 2JWNA 1JCFA 1N34J 2V9WA 4KGZB 2V34A 2PEHA 3UDVA 2YPYA 4X2BA 3OFEA 2FY8A 1R8PA 4F36A 4Q2MA 4JI5F 3M1VA 3IR5B 4FJ8A 4WKRA 4YB5A 3K5OA 4PL8A 3BDEA 3JSRA 1RBAA 3Q8SB 2BE2A 2HHHJ 4EZ9A 3ILLA 3L3VA 2QWOA 2YWHA 1B9DA 4JHDB 3BGRB 2N7CA 3BEXA 2QA4G 5KFLA 4NYOA 2W7PA 5G0RA 1H1VA 3L3CA 1KHVA 2F3JA 1LW2B 3J8AA 1VQ9N 2ITGA 2PEBA 4K4XA 3LA0A 3QIPA 1FJGJ 4HUGA 3ZZRA 4FLWA 3W8PA 3FZKA 4IO9L 1XMQJ 5KFQA 4D3HA 4KAZA 2VUGA 2KFNA 1FKAF 4ZHRA 3DLKA 3M32A 5I3QA 3D68A 2DGVA 3S6EA 2P8IA 1ZBSA 5D77A 5C24A 1HMVA 2V2QA 4RTFD 2GMJA 4QIGA 4AFFA 2FSJA 5F8LA 1Y00A 2VFSA 3H3NO 2RQ4A 2KDOA 4KC5A 2XMKA 2J9CA 1N36F 2YHWA 2NZCA 5A2QU 1Q81T 2UUBF 2QKKA 4P2SA 1TQLA 1MN7A 3HHDA 5DQIA 2WONA 2Q66A 1MU2B 5C42A 1IKWB 2O8FA 1ATRA 2FHJA 3MEDB 3KHRA 1Y3JA 1V3RA 3AOAA 1RILA 4DR7J 1TKZA 4KTQA 3C7NB 4RUBA 1K8AO 3H08A 4GMKA 3H59A 2FHMA 2HS4A 3FJ2A 1E6YB 1ZZNA 1PJ5A 2VPXB 2PIIA 3K8VA 1WI8A 4BVPA 4M1KA 3R1LA 5BJRA 4C8ZA 5AZJA 1NBEB 3LGHA 3QEWA 3G71N 3DMJA 1PC4A 4PWWA 1SL1A 3EJMA 4URSA 2RRAA 4CF1A 4DR2J 3OYDA 2D0BA 4EBCA 2OANA 2CQBA 4BACA 2MSSA 1BQNB 2W41A 4NLWA 2BGGA 2FBTA 4DL6A 5IT9Y 2VG5B 2LEBA 4G1QA 4FWLA 4B1XB 3KJFB 3BQ0A 3MOJB 4LF9F 1B7YB 4BRHA 1RWKB 4J9LA 2ZE2B 1VQNN 3CCMN 1BLUA 1GT8A 3DDKA 1XC3A 2UU9K 4C3MA 4JI8K 2KVQE 1G99A 4A8XA 5AQLA 3BUZB 2IVMA 3O8WA 4DTUA 1NDKA 1BWEA 3MURP 3Q7CA 2CA9A 4H5TA 2QSFA 3TJAA 2ZBIA 2J7UA 4CHZA 1RUSA 2O5DA 2IRXA 2ZH8A 5KPZA 2D0PA 2RB7A 3P8BB 4M8LA 5K8MA 1IJJA 4ZPAA 5GAHI 4ZPDA 2MYFA 1YJNN 2FJBB 1B7FA 1O1WA 4E19A 3M2UB 5JVHQ 3Q8UA 4PKDB 5HATA 2NR0A 4ECRA 1G4CA 1H7XA 1RT6B 4GC7A 4Y2KA 1J5EF 2QL7B 3MCOA 1S6UA 3EVMA 2FZCB 4CO2A 3LP0A 2KG0A 4Z4CA 5T14A 2A1SA 2KHCA 5F41A 1XNQK 2CG4A 3P4IA 2L9DA 4QQBA 2HFOA 3QIDA 5AFUH 1RDWX 3ISND 4KIAA 2LDIA 3FUYA 5CR4A 1L3SA 2X3GA 5MLCQ 3QLHA 4X84A 4DV6J 4DSIA 5CYJA 1YHQN 4FPBA 4B3RJ 3HSCA 3FEZA 4A47A 4XEIA 3CCVN 1KQKA 3OL8A 4CLLA 4HWIA 1VQKN 3O1BA 1X4AA 3M9OB 2VG6B 3R3LA 4PG7A 2K3IA 3W3SA 2F9TA 3SCIE 4DV2F 5H9FK 1WBBA 4ZCKA 4DF8A 1HR0J 3DLJA 3U9ZA 2BW2A 2KU7A 3HD1A 5ADXA 4R8UB 1K73O 5C2CA 4U96A 5IOLA 4R0EA 4DU4A 1NB2A 2QFIA 5DO2A 2UV8A 4QWBA 3H98A 1OJ4A 1Q16B 2G2ZA 3GFXA 3T41A 1GXTA 4TU7A 1FWPA 5A2QY 5T7BA 3WXLA 4KB1A 1KBRA 4LF7K 3V6DA 3OS1A 3NY0A 3O4NA 3CFPA 5D15A 3CJKA 3TUIC 5CCMA 4EZ6A 3OYLA 4E1MA 2P9IB 3VA3A 2HLTA 3QSYB 2F7VA 1X4BA 4WFBQ 1UAWA 4RW4A 2MMYA 1SH2A 5A8WB 4JI0F 4KSEB 4PABA 3PYGA 3BJYA 1U1NA 2HK2A 1MW7A 2NUBA 4CO4A 4F0KA 1B0PA 3HSTB 3BR9A 3PHTA 4CVNE 1C2PA 5AQQA 2DK2A 3U27A 3NGTA 2E9ZA 3VPZA 3GV7B 4R5PB 3EDQB 2I6WA 4I2PB 4K50A 2CUYA 5BPLA 4U7UK 4NB4A 4CJFA 1XMOJ 4Q0BA 3P38A 3CJ1A 2HHPA 3LGNA 1KQSM 4E7KA 4YR3A 3BBFA 1NPKA 3R5GA 3CM5A 3ZC4A 2O8CA 4DSLA 1NH7A 2HOEA 3PSIA 3QFPA 2CQ4A 3EUNA 4FOIA 3VQPA 4GMJB 4FXVA 2AW0A 4MK7A 1Y5LB 3M6WA 4DN0A 3BF4A 2W7OA 2OPRB 1Z4UA 2UUTA 4NA3A 3K59A 3EX7B 3F9KA 1G3OA 1VFJA 1UWAA 4CP5A 3AD9C 1AYEA 1UZDA 1S0OA 3ZYYX 5E5NA 3RR7A 4OI1A 2IDOA 4YDDB 3CCJS 3M8QB 3AJ2A 4K43A 3NNAA 4HH0A 1KKHA 4RNHA 2UUCJ 3E01B 1RT1B 1A5WA 3ITHB 3CCSN 3OHRA 2XYPB 4JV2A 1MROB 4QR1A 1OH5A 2FY1A 2NXUA 3S7RA 3MPUB 3C16B 4UZCA 2XNQA 2HHQA 1ZTWA 2CQPA 5IC4B 2VWBA 1YVUA 4WXWA 2R7XA 2G8VA 1HNXK 5L9XA 4CHPA 1Q5YA 2P5OA 3G9CA 5AQTA 1RKJA 1CQMA 3M2UA 3M6XA 5D3GB 1OO0B 4D3GA 2XWXA 3HHLD 4GVEA 3THYB 2OTJN 2P5GA 2OZSA 3CW2C 2VFVA 3KLHB 2F5GA 1FI4A 4PR6A 3AA5X 2YKNB 3QATA 4CF9A 1LFPA 2PSZA 3CCQS 5EWEA 1ZH5A 1Z1ZA 4U8VA 3TEHB 2CDQA 4LF5J 4NRTA 1RTIA 3JS6A 5AQMA 2KT3A 2QWRA 4A62A 4EIAA 1FRXA 1HNWK 3CC4N 2WVEA 3FEYB 3IBCB 3UW1A 5IT4A 4ID5B 3TAMB 3CJQA 5B0FA 1BIZA 1L3VA 1FF2A 2C3YA 1CG2A 4A8WA 2KKHA 2ZBPA 3MMVA 4OIXA 3MUVP 4TLRA 2FVPA 3SQGB 1IKVB 3H5XA 3DXBA 1SUQA 3UR3C 3FKBA 2L41A 3D66A 3RB0A 4YN3B 4ZLPA 3D45A 3N5FA 2EG2A 3HVTA 1GQEA 4O0JA 3NCPA 4USKA 2K7JA 1URRA 2ZC3A 4JOUA 1DBDA 4FJ5A 2IM2A 2RRBA 3AAPA 3PFOA 3GIMA 4I6AA 4R8UA 5EX3A 1RU1A 1PAEX 3KK2B 3ZT4A 5ETOA 4H0YB 2A1BA 3AVCA 2DO4A 2BR0A 3MAAB 2EX3A 2MY7A 1QTMA 2QA4N 1TKTA 1TP7A 4BDPA 3D6FB 5DJBA 1S5JA 1FJ7A 4JI6J 3SQOP 3L3UA 5ITHA 3IM9A 1RFQA 4WTOB 3LP3A 2GX8A 2OD6A 1RAOA 3IM8A 4OI4A 5F9NA 4DR1K 4IFEA 4NLVA 4DUTA 3A5OC 2MEWA 4NXMK 4M45A 3PHEA 1KHWA 4PG4A 3HVWA 3AXMA 4NL5A 5EX0A 5EU7A 3NS6A 5E3CA 3MXHP 1KWMA 5C15A 3FFKB 4LRAA 5BYQA 1LEOA 3R9PA 1UWBB 1LCUA 3HHEA 1B99A 3GLJA 1SZ2A 2JSXA 1NU4A 4LVNP 2IVYA 4ZPCA 3AJDA 3DOKA 2XGQA 1R59O 5M2PA 4FPRA 3UIQA 2XLIA 2EBGA 3MEGB 4LQ3A 5J2MB 1XK8A 2KG1A 3LPTA 2KKZA 2Y0SD 4W5NA 3CD0A 4NLOA 2NS1B 5BXIA 2HHVA 4MT1A 1SC6A 2LQ5A 4ETXA 2WCXA 1X4EA 5AQXA 3MM7A 1RWWB 1XMBA 4DI6A 1H73A 2R8HA 3J7YU 2NPIA 1ZZFA 1QS4A 4PXBA 3MECA 3AH6A 5JVHL 2X78A 1JJHA 3GYGA 3P5JA 4KGXB 2E2QA 4JBCA 2IPOB 2O8BA 1KFSA 3W3DA 4KV8B 2R7WA 3T1YK 1X3MA 4V1Ak 4HR2A 1NLKL 1SH3A 1YJRA 4CTAB 3VMFB 2CNKB 1IKYB 2AD9A 2FD2A 2WRMA 4J2AA 2RQMA 1MROA 4I9QA 2HQIA 1KONA 2AJ1A 1IM6A 4FZVA 4DV4F 4ZPTR 4I2QA 1K8KB 5A76A 4UQGA 1HJOA 4OL8A 2YBVA 3H25A 3M9NB 1VK8A 3NH0A 2QWPA 2MKSA 3I32A 2B43A 2QC3A 4K0KJ 1UOCA 3G4SN 3R9LA 1VSLA 3POTB 7FDRA 3THYA 3HRGA 2XZTB 3W5ZA 5C5JA 3O3GA 1PGZA 2OIHA 1HBMB 1PYOB 4QAGA 4NO7A 3OFGA 4Y6IA 3RW6A 4AXIA 4PWDB 1HQUB 4NYNA 1TELA 4OZ0A 1HBUA 1WOOA 5DM7Q 3MEEA 3O3FA 1KXPA 3RG6A 4BGAA 2D69A 4KQZA 4ILLA 1BXNA 1YBUA 5SUHA 2E88A 2FBXA 3CCRS 4ID5A 2GCFA 5F9LA 1RAFB 4CF0A 3VOVA 3OYAA 5D0EA 2KXNB 4MIBA 2CJ9A 1X4FA 4P75A 2G8UA 3KLFA 5KRSA 4ICLB 3U3YA 3CPEA 2XC9A 4I9LA 5MAOA 2J9DE 1HARA 4DLEA 4KT0C 4P2MA 4BR4A 5CABA 2V51B 2VA3A 5FRNA 4CBWA 1YTUA 4ECSA 4ZVTB 5DDOC 4YOYA 4FYYB 4FJMA 1YITN 1DTQB 1GMWD 4ECWA 3FBCA 4WFBL 4C3LA 2Y1RI 4CF8A 4OYOA 2C2OB 2HBRB 2P9KB 4DZ6A 5ETPA 2HVEA 3PX6A 4DV0F 1SJ4P 3CMQA 2HBMA 1R43A 3MN6A 4CGJA 3PG9A 2HIYA 1Z26A 1CULA 5LXRA 1JLFA 3ENWA 2GQQA 1LWCB 4MLHA 2YNIB 3S9HA 3NNHA 4KY3A 4OX9J 3I6PA 5L9NA 2GUIA 1FNMA 1NSPA 2XY5A 5T7LB 4OJ1A 2DNZA 2MQQA 3SCXA 1N4LA 3TSQA 1TL1B 2Z57B 1IKXA 5HJXA 4RG8A 3JYTB 2AGQA 2M5YA 4YOTA 4X4NA 1P27B 4DV3F 4W92B 3VF4A 4FYWB 2ZQBA 4TSXA 1QY7A 2IFXA 3HJVA 2DNMA 5KPRA 4ECZA 2KT2A 3G6XA 1JXBA 3K2YA 3GCWP 3KHGA 4KHNA 4CJRA 3TZYA 2D0OA 2YX1A 3FRZA 1Q8BA 3JTOA 4MK9A 2XULA 2YKPA 4FLZA 4M5IA 2KQ2A 5HBMB 4TYBA 3ALYA 5I3UB 4URQU 3C0BA 3I56S 4W4MA 3MPDA 2ATLA 2FVQA 5F8MA 1VQ8N 3NNCA 4A46A 2HF3A 3MEGA 5GAGI 5J2MA 1EQYA 2VHGA 2MB0B 4A59A 4I1TA 2BANA 5ETMA 4K25A 4O5BA 1QLNA 2MQNA 2YXLA 5MLCV 4I64A 1U1PA 2PI4A 1RAAB 1NGIA 1VMBA 2EFPA 3NCIA 3JXUA 5LMNF 3ULDA 1X4HA 1WB9A 3WIVA 4QS7A 5AJ3J 1U1OA 2VFTA 3IGVA 2BXJA 5BR8J 4WYBA 4CBXA 5KFFA 1HPZB 2GIRA 4LJMA 1KLNA 5LMUF 2ASMA 1NJYA 3I9V9 3KNGA 2ZBRA 1TKDA 3ENVA 2JWKA 4B3TJ 2WBRA 3PRDA 2LCWA 2E5LK 3MWPA 1N34F 1QE1B 4IO8A 4DR4J 3L2RA 3QNOA 3KOAA 4JI4K 4OZ1A 1WSGA 2Z2ZA 3G10A 3OS2A 1K8KA 2IA0A 1ZM9A 5FDLB 3RMBA 5KFRA 5M1QA 2OO4A 4I6MA 1K0VA 4EHUA 3QEPA 2Y8WA 4O3RA 3SIPB 1FCAA 1RBVA 4YQWA 2ZWHA 4NRUA 3SPZA 1ICEB 5ETSA 3NAEA 3P31A 2MXYA 3EZOA 3R8YA 2N7YA 2YV0X 1EQ0A 2MZQA 1ULRA 4A8SA 4MIAA 5TKWA 3O4WA 5JS1A 3DRYA 2ZF5O 4IDKB 3WUHA 3VQ6A 1RT5B 2QM1A 3O3LA 4H8KA 1TYQB 4IQMA 1C4CA 1HI0P 1FJGF 3AXKA 3GQCA 2Q0UA 1NHVA 3PX0A 3OYFA 1XMQF 4B9VA 3L7OA 4QOZB 1Z6RA 2A3ZA 3SQ4A 4M3ZA 3K5PA 2H3EB 3AJ1A 5BRFA 1VRTB 1F1BB 1S1XA 2VKZG 3AAWB 2V94A 3EVOA 2ZUAA 1DJ0A 3ILJA 4F2SA 2HQFA 3K5MA 4S0MA 4GV9A 2VF3A 5D0RA 1QAJA 2KJVA 3U1MA 3KJQB 3FQLA 3O9RA 3CDWA 1SKWA 2X1FA 1XNRF 5BREA 2W9AA 3TAPA 2VWKA 4DG1B 2NZTA 3HM9A 1U6FA 3HDSA 4HYKA 3PX4A 2R2RA 4H5WA 4JI5K 1QVFR 2XCPA 4DUZJ 2OEKA 4ZDNA 4RPFA 3RMAA 2GVDB 3FBEA 2ZZMA 1DTQA 1TZ0A 3MPYA 9ATCB 2HRUA 1XTZA 3QINA 1NB7A 4ZVRB 2QYCA 2OPQB 2AJFE 2P9KA 1FERA 2DHAA 5GADI 1KLMB 4OI2A 2IGIA 2P9LA 3VF6A 1VQ6S 4A57A 3I55N 3UKUA 3AY0A 3CQ8A 2R8GA 2XHCA 3ASMA 4FK4A 2E1PA 3MR3A 4DR2F 1H72C 4YHHJ 2XZDB 3ZXWA 4X4RA 4KHRA 3MM6A 1CJKA 2CZ4A 3MM5A 1RLDA 3W5YA 1JQGA 1ATSA 4B3SJ 2Y1LB 2RHKA 2QXLA 4F26A 3CPWM 4M41A 1RWOB 1YIJN 4AQYJ 2BX6A 2PI5A 3ZZTA 2UXBF 1HYZA 1KTVA 3CCLS 3H5YA 3BQ2A 1UFLA 4FVMA 5AQZA 4IG0B 2JZ5A 2UUBK 3QICA 4IKAA 2KI2A 2HHSA 3RBEA 3SBGA 5LSLA 4A4JA 3MCPA 1R6VA 2FUG9 4ELVA 3CC2N 4CLKA 1HWIA 2V4JB 2BJEA 2D3UA 3FCHA 2FF6A 1FDAA 5CZXA 3BB5A 5GAEU 2E7WA 4ISEA 2V9KA 1HA1A 3NBPB 1FDNA 4O23A 5JS2A 1G1XA 1V3ZA 1AFJA 3HHKA 3UQSA 4OYPA 1EX4A 1AXQA 4JI2K 4OI3A 4EFHA 3DXKB 3OXGA 3D67A 2P9NB 1FXDA 5AQHA 5A8RA 2J5AA 3DLGA 3A13A 2BUPA 3H2LA 1QSSA 1NK7A 4Z7CA 2XMVA 4RUHA 2QO3A 8RUCA 3L4IA 3HZEA 1HPZA 1WHWA 4H0PA 3ZZPA 3ZSYA 2HKEA 3J7AN 1RBSA 4KJIA 3MMJA 3SFGA 1IBMJ 2HNZA 4LF9K 3M5RA 1YK9A 2J6UA 2QJ3A 2OZMA 4LF2A 4DV6F 3DRRB 3CIZA 3DLLQ 1RJJA 2NSBA 4FPAA 4H54A 4CJEA 1L3TA 1B64A 4B3RF 4BC3A 1OKJA 5F8HA 1WSVA 5F8JA 4DQPA 2QI2A 1FK9A 1VQSA 3ZTPA 3M30B 4FW1A 3N0VA 3G87A 3ZNJ1 1HR0F 1ATNA 2HBZB 5GINA 1JKHA 1QHTA 4UT4A 3OSNA 4PXDA 1T11A 4WFNQ 4IDKA 1RT5A 4QCLA 1XN9A 1K6YA 1MWKA 2M7SA 4B8AB 1FDBA 3R2DJ 3CERA 1J5EK 1RU2A 1HI1A 3NGSA 2ACMA 4LMZA 1EHWA 3BH7B 1MNEA 5LL6d 1VQLS 2UUAF 1JJ2M 3PW7A 3O1WA 2LU1A 4BRLA 1YJTA 4MFBA 1MLAA 3DAWA 3V6HA 1N32K 3U3GA 1VRTA 4LR9A 2DYAA 1TK8A 3MN5A 4DR5J 1WEXA 1LWFB 4IRCA 1M5KC 5LJVA 3EZUA 1S1VB 3ISNC 2VDHA 4OYBA 4H5RA 1HNIA 4CJQA 2O1PA 2ASYA 4ANCA 3OYHA 3LDSA 4CO3A 2XB2D 1C1CB 4N5SA 4X66J 1A9NB 2X7IA 1S9GA 3I9ZA 4DG1A 4EO6A 1J27A 4AM7A 4DFJA 2VZ9A 4JEPA 5HRRA 4BC4A 4FDFA 3TJ8A 2PT0A 2ZZTA 3MMAA 1YRXA 2BKNA 2OFGX 3LDLA 1H38A 1J54A 4WFYA 3SI8A 3D6TB 2GVDA 3CJ8A 3MGJA 2M8DB 5JJBA 4OPKA 3NH2A 1XMOF 1IG9A 4AT1B 1VSIA 3DN9A 1R8BA 2W9CA 4DV2K 2Z1IA 1ZAXA 5IM0B 4EWTA 3I96A 5FLXO 1TL7B 2V8GA 3GYNA 2V68A 4J9OA 3W61A 1U1RA 5DZ7A 1REGX 4X64J 1REVA 4TQRA 5EX5A 1U26A 4OPJA 1VHFA 1QVGR 3BEGB 4ES1A 1WLJA 4OVLA 1NSKL 2F65A 2FSKA 2X1GA 3D5MA 3WNFA 4KH5A 4BRAA 4BREA 3ENQA 5DQGA 2W7AA 1VQ9S 1NU0A 3WNHA 4P74A 1TL3A 4DQ8A 4B3OB 4AL6A 2CJYB 4KH1B 4I69A 2PMHA 3WT0A 2A5XA 4N77A 3HK2A 3PIOQ 4FJLA 2DH9A 2KYXA 2E1YA 5JLHA 4GVBB 4IG0A 1KVCA 5KFMA 3M7VA 2VBZA 3SAGA 1BO5O 3RB4A 3TAEA 4JI0K 1C4AA 1T02A 2RDDA 4B9SA 2ABYA 4KHPF 5AFUA 1UFWA 2R7VA 5HAOA 3AARA 4CH1A 1CJTA 3SFUA 4ILRA 4Q2LA 1M5OC 4BWMA 1Q18A 1OYEA 3SEOA 2QZ8A 1K1SA 2FJDB 1MSWD 1T44A 3S01A 3VQCA 3PJXA 1UFKA 3QGGA 2IRUA 2DBBA 3WXJA 1YJVA 2NZ4A 4YB6A 3UDCA 4WF9Q 1B92A 4J2BA 3KLIB 4LF5F 3NP5A 1ZOTA 3C6AA 2I5JB 3SUNA 3D2EB 2D74B 3VAJA 1F6TA 3TANA 5FD1A 3TOQA 2KYZA 1X3NA 3MFHA 3UO0A 4ZVGA 1D9FA 3KLEB 1RE1B 2ZBCA 2M52A 3G71S 2OD4A 3HI9A 2P1JA 2ZNZA 4J9MA 4ZK7M 2FB0A 3NGUA 4BBYA 3NHGA 1KAYA 1C1AA 4ZKAA 4PQUB 5F8NA 3BY5A 5HSPA 2GA7A 1EP4B 3RAXA 1WUUA 4DR6K 4EUVA 3RW7A 4FPIA 3VESA 2O8DB 3W1YC 3PW4A 3D3BJ 3D7EO 3CCMS 3D0GE 1CPZA 3GDQA 4ZP9A 3EKUA 1HI8A 1NDP