2WONA

Crystal structure of uk-453061 bound to hiv-1 reverse transcriptase (wild-type).
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lersivirine: A Non-Nucleoside Reverse Transcriptase Inhibitor with Activity Against Drug- Resistant Human Immunodeficiency Virus-1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2wonA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wonA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wonA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wonA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2wonA05
2WTFA 3S3MA 3IG1B 4H54A 3DLRA 3LPUA 2W9CB 2IM3A 3FFIB 4F4ZA 4IG0B 2FVCA 4M94A 4I2QB 4OPJA 3C6UB 1CSJA 3NBPB 5KT3A 4F4XA 3OYIA 2FVSA 4RW6A 2D0CA 4MKAA 5J2NA 3H4DA 2WONA 2ASJA 2GUIA 1TL3A 2R2TA 3H98A 3DLHA 3AVNA 3D45A 5HP1A 2W7PA 5J2MA 4DL5A 4RW9B 1REVA 3PJXA 2VA2A 2HHSA 2HHWA 4M41A 3OYFA 4ID1A 1TQLA 4EBCA 4KHQA 3OLAA 2JC0A 4DTOA 4IFVA 5KFWA 3OYNA 2X6NA 1SKWA 4QWAA 3ZT3A 5KG7A 1IKXB 4IRCA 5HP1B 5FDLB 4IH7A 3OL9A 2VWJA 2IA6A 4I2PB 4MK7A 4WZQA 5DGBA 5T7BA 1DTTA 3D0PA 3PX6A 2C2RA 4FJGA 4J9NA 4W5RA 4J9QA 1ZBLA 5KFKA 2FVRA 4J2BA 3DYAB 4NRUA 1DTQB 4EEYA 3L2UA 2D3ZA 1TAUA 2KZZA 4CJSA 1S1UA 3WNFA 2XY8A 3T19A 3C6TA 1NJYA 3LAKA 2D3UA 3KD5E 4PQUA 1C1AA 4NYZA 4DLGA 3DRRA 4EBEA 1LWEA 2PY5A 2ASLA 2QK9A 1BIUA 3V9ZA 4RW4B 2JEFA 2HHVA 2ASDA 3GILA 4JV1A 3M8QB 1LWCB 5F8MA 5I42A 2WK4A 3RB4A 3AO3A 4L8RB 3MEDB 3PW0A 4B9UA 3K2PA 4DFMA 1TKZB 3NGZA 2A1SA 2XI3A 3IS9B 4KFBA 2X74A 4FLWA 4DTUA 4YMEA 4O4RA 1K1SA 1B9DA 3HYFA 2VWKA 4Z4EA 1EETA 2EC0A 3P1GA 3CJ2A 3PVXA 1C0TA 4RW8B 3IN5A 3E01B 4E0DA 4KREA 2WOMB 1HPZA 4NLRA 3F9KA 1S1XB 5KG5A 1G15A 4CECA 1IKWA 4WFZA 4CF1A 3QEXA 3QIPB 3TAGA 2BGGA 4J9RA 3SUQA 2P51A 4QWBA 3OLBA 2KTQA 4C8NA 4CCHA 1VSDA 1TL1B 3MR2A 4DTPA 1N48A 4CIEA 1WSHA 1ZBUA 4PWDB 1S9EA 2VG5B 3LP0A 3T3FA 3VQSA 4J2AA 2IM2A 4IH5A 2FVPA 1RT7A 3D28A 2R8KA 1KRPA 3DLEA 4MIBA 4H4OB 4ECQA 3TQ1A 4N5SA 2D5RA 1FKPB 3KK1A 3KTQA 3D5MA 3OS2A 4WYLA 1HJRA 3VQCA 5KT5A 4I7FB 4F4KA 2UUTA 4OKJA 3OS1A 2FJWA 1TK8A 1RA6A 2YNFA 1EX4A 2C22A 3KLGA 1QE1B 4BDYA 4FJJA 4MKBA 4DU4A 1RT4A 1DTQA 2XO7A 3H08A 4ID5B 4JRQA 4XO0A 3ZSQA 5DLGA 3SI6A 3O3GA 4TSXA 4FS2A 4M3YA 4HCCA 5F8GA 2OPQB 4WFXA 1HNIA 3H5UA 2R8JA 3OJSA 1U49A 4DG1B 2UVWA 3KLGB 1TP7A 3HT3A 4C8OA 3SPYA 1LWEB 3OSPA 1W0HA 2VG6B 2FJVA 2W42A 1RNHA 4KAZA 4IR9A 2Q3SA 3JSMA 1KVBA 2IAJB 1NOZA 4F4WA 1C1CA 3L3UA 2EX3A 2J6UA 4J9PA 4NLUA 3AO2A 4YR0A 4IRKA 2IMWP 3S9HA 1RT2B 4HYKA 2F8SA 4E3SA 2GIQA 3THVA 2HVIA 1KHVA 3RTVA 3DLEB 3K59A 3AVMA 4ED8A 4KKOB 4FBTA 3VQ4A 3WNEA 5KGWA 2PYLA 2HNYA 4RNHA 1HNVA 3LALA 3MR6A 1C1BA 2BRLA 2IDOA 4BE2A 1I3AA 1RT7B 1VSMA 5DG8A 3L3VA 4LH4A 3MEGB 4W5TA 1RCHA 4XIUA 3QEVA 3K5OA 1RTJB 3CFRA 1Z25A 3TAEA 4FXDA 3T5HA 5L1KA 1KLMB 3JYTA 4B8AB 3NH2A 3SFGA 1TL1A 1VRTB 2OPSB 4QCLA 1RT5B 2WONB 3KHLA 1RDDA 1S6QA 3CFPA 1S1WB 3RR8A 3MEEA 4EZ9A 3CYMA 3VQ8A 1GOBA 5L1LA 1JXLA 4IG3A 4Y34A 2JEIA 4NCAA 3H5XA 3QIPA 2AWZA 3O4QA 3SUPA 4TY9A 4NYFA 2OPPB 2FBYA 3U6FA 1VK0A 4FLVA 1KVAA 4KI4A 5KG0A 4NCBA 3AVFA 4DL4A 1ZTTA 3DM2B 2W9BB 4B9SA 3G6YA 2B5JA 4MK8A 3KD1E 1S1TB 3QLHB 3V9WA 4DL6A 1W9HA 4M3ZA 1JLAA 4ZP6A 2HHUA 2ILYA 4FM1A 1HNIB 5KFAA 3QIDA 1IKVB 2DFFA 1SL2A 4Q0BA 3NGIA 1S0MA 1TAQA 1X1PA 3CDUA 1YT3A 2YNIA 4DFPA 4CHYA 1LW0B 5HROB 4AHTA 4KV8A 3LP3A 3KLFB 3SQ1A 3ZT4A 1FKOB 4FM2A 2HWIA 3BSAA 2O4GA 3ZSXA 5HRNA 1RTJA 4AILC 1UA0A 5KFDA 4KRFA 4WE1B 3VQDA 4JRPA 3AVIA 3MEDA 4E7JA 4CJQA 1LW0A 5HROA 3OYKA 5KT6A 1TKZA 4CGHA 3VQ6A 5KRTA 4PUOB 5KG2A 3IRXA 1RTDB 4QOZB 5L9XA 4AHUA 3AVBA 3KHRA 3PW7A 3MTKA 2QV6A 3DOKB 3QGHA 4K50A 3CDEA 5CYMA 3CVKA 3NFAA 4BE0A 4ZPAA 2ATLA 4FW2A 3DYAA 4KB1A 5EDWA 5C24A 4NLTA 5SWMA 4J2DA 3ICLA 3OYCA 5J2NB 2O5DA 4KFBB 1EXQA 1FXXA 3I0SA 4R5PA 1DTTB 4KI6A 2BRKA 1FK9B 1XC9A 4TLRA 5HRSA 5KFGA 3KKSA 2IBKA 3M8QA 4FYDA 1VSHA 4CERA 1B92A 3FQKA 3RB0A 1D9FA 1N56A 1VRTA 5KFLA 4CJ3A 2IAJA 3LP2B 1X9MA 1JXBA 3I0SB 4R5PB 1QUVA 4FZYA 1WLJA 1X9SA 3GIIA 2P5OA 3ULDA 3N6MA 1QAJA 3M8PA 3HP9A 4ZTFA 5KFHA 3PX0A 2IJNA 4DSFA 1UOCA 1F21A 1JLQA 1B9FA 3QERA 4ECZA 2R2UA 4I2QA 4PUOA 2WCXA 4URQU 3AVHA 3DLGB 5FRMA 1S9GA 3BQ0A 4E7LA 4LSLA 1TKTA 3QO9A 4M3RA 5J1EA 2JC1A 2B43A 4DL7A 3SUNA 2D0AA 5F9LA 2XWYA 4QW8A 3CWJA 5KFTA 4RUCA 4R0EA 4FJ9A 4KSEB 4IBNA 2JEJA 1SH0A 4FW1A 4N76A 4Q8EA 4PWDA 4U7CA 4F8RA 1NHUA 4FJ8A 3HJFA 1C0UA 2B4JA 4ZP9A 1RTDA 1ASUA 3QGGA 2E9TA 1HRHA 4Y2CA 2W9AA 3HHKA 4C8KA 1SV5A 2BE2B 4CHOA 4YR2A 4DQRA 3T5LA 2DFHA 4F2SA 1A5XA 1BI4A 1NK8A 1RBTA 4ED0A 1QE1A 3OS0A 2IS3A 1VRUA 4ECUA 3HL8A 4O5BA 4NLSA 4CJVA 4FJLA 1RTHB 3V6DA 1LWFA 1TV6B 4H4MB 4C8MA 3KK2B 3NGDA 3HKWA 3ZT1A 5JS2A 1NJZA 3G0ZA 4Z4HA 1NKBA 2FBXA 2VG6A 4DL3A 2CKWA 5J2PA 4H4OA 3DOKA 4LQ9A 4Z0UA 2IM1A 4RW6B 3BQ1A 3KJVB 4B3OA 1T7PA 1RBRA 4KO0B 3DRSB 1TKXA 3L2QA 3OYAA 4AHCA 2HMIA 2HW3A 1QHTA 1WSFA 3I5BA 3M8PB 4K8ZA 4ZVHA 4IH6A 4IFYA 2BQRA 3PUFA 1ZETA 2BR0A 1K1QA 4O55A 1S0NA 4W5QA 3V9UA 2DY4A 3KLIA 1HPZB 3RMCA 2G8KA 5KRSA 4FJMA 2DPIA 2UVRA 1NJXA 3O3FA 1Z4UA 4IG0A 1JLFA 1K6YA 1EP4A 1HMVA 3OHBA 4DTNA 4DSLA 2RDIA 4OKEA 3MFIA 4HUFA 4E7HA 3GIMA 4NLDA 1MU2B 5C5JA 5J2QB 5KFUA 2XY7A 4FJKA 4FK0A 4QWEA 1JLCA 4TQRA 4ED6A 2EHGA 3CO9A 4M45A 1MMLA 3MEGA 4MQ3A 1BCOA 4F50A 1WSEA 1S48A 1RYSA 4QWDA 3KLEB 1RT5A 4EP4A 2UUWA 5KG3A 3O3HA 4CEQA 5DQIA 4FCYA 4NLPA 2YHBA 4NLQA 2OYQA 3TWHA 4ECWA 2IC3B 3MR5A 4NCGB 1RDAA 3GV5B 1D1UA 3MXIA 3G6XA 5KFNA 4RW9A 4CIGA 4IR1A 2OZMA 4URGA 1S5JA 4ELUA 3CFOA 4KHYA 4FK4A 4TN2A 5C42B 1GX5A 4WYWA 3VQAA 4DQIA 4M3WA 3CJ5A 2A1RA 4CJFA 4I2PA 4B9VA 4ZVFA 1TL3B 4IG3B 2GC8A 4MIAA 2D7SA 5KT7A 3AVJA 3S3NA 3NH1A 1ASWA 3OYJA 4BWJA 2BE2A 3RMBA 1EP4B 4TYAA 4ED1A 4M42A 3V81A 3VQ9A 2UVVA 2E6MA 5CYQA 2OZSA 3VN5A 3V1RA 3TI0A 1TKDA 4C8LA 1LAWA 4LSNA 4Z4FA 4CHZA 2AGPA 4DQSA 2FLLA 4HUGA 3KLVA 5CYMB 3I5AA 2R8HA 4B08A 1D0EA 4DSJA 3NF9A 2F96A 3GV8B 3GIKA 5I42B 3RRHA 1JLEA 1RDCA 2XY5A 4FS1A 3NF8A 2ALZA 4O4GB 4MFBA 5KTQA 1D9DA 1HYSA 2R8IA 4KB0A 2VA3A 3OYBA 2G8HA 4DFJA 3ASMA 4DU3A 3S3OA 2J6SA 1UAXA 3H2LA 2KFZA 4CJEA 4M3UA 1GX6A 4J9MA 5HLFB 4CFBA 3Q8QB 4M3XA 3QGIA 4ZVGA 1RBVA 3TAMB 1BISA 1RDRA 2Z1HA 4E19A 3A2FA 3AVCA 3KLFA 2HWHA 1VSIA 2OA8A 1IKWB 3NGYA 5KFCA 3PO5A 3GIJA 4BDZA 3L2VA 4BE1A 1XI1A 3LZJA 1XR7A 2CJQA 2AX1A 4N47A 2HHTA 2E9ZA 3H59A 4IQXA 5D3GB 4KTZA 4KHRA 4DSKA 3SUOA 4DTMA 2JEGA 5C24B 5CYQB 3OSNA 3HVTB 4K8XA 1RILA 3F73A 2V4QA 3NAIA 1KLNA 3KNAA 2DFEA 1QTMA 2JLEA 4W5NA 1JLBB 1A5VA 4ECXA 1JLGB 5T14A 4MH8A 2W8LA 1Q9XA 1BQNB 4O4GA 3EYZA 1I39A 4ID5A 1U48A 1QAIA 2XY6A 3G6VA 1SUQB 2FLNA 4XPCA 3L2RA 2FBTA 4CIFA 3V9SA 3AV9A 4FBUA 1J9AA 2FVQA 3KIOA 4BDPA 1S4FA 3EZ5A 4DQPA 4GW6A 3SV3A 2YNGB 3ISND 5CZ2A 3E51A 4NLYA 1IKYA 3DLKA 3SFUA 3LANA 1RBUA 2G8FA 3MECB 3ZSRA 4NLGA 2AGOA 2UVUA 3HVRA 1S6QB 3DLGA 1GOCA 2HMIB 3NMAA 3LP2A 1HYSB 3NCIA 3QESA 3PW4A 4HKQA 3BREA 2ETJA 4OKKA 3VQEA 1U09A 4Q45A 4JUZA 5CY4A 3HPOA 2OPQA 4HVJA 2P1JA 4KBIA 3AA3A 4CE9A 3OYGA 4ZMMA 3KHGA 4CEEA 4YFUA 4CEDA 2XI2A 3HVWA 1BIZA 1SKRA 1WNEA 3OYEA 1L3UA 3SI8A 4E7KA 1HYZA 4IDKB 5DLFA 3HXMA 1REVB 4RW7B 1WAJA 4ZPDA 3BSCA 3M9OB 4CFAA 3M9MB 2BANB 4ED7A 1J5OB 4KKOA 1CXQA 3EY1A 4K4YA 3I8DA 2C28A 1VSKA 3U3GA 3WNGA 3LWLA 4G1QB 1JX4A 2YKMB 3MXMA 4KAIA 3DI6B 4DEZA 3TAFA 4M3TA 3EPIA 4GC7A 4DU1A 3RB3A 3IG1A 3CJ0A 2W7OA 4FJIA 3GYNA 1HMVB 4OL8A 2AGQA 2YNIB 2XRIA 4RU9A 2ATQA 3NBPA 1NK0A 4ZP7A 1X9WA 1WSGA 4B9NA 1RTIB 3PR4A 1WNSA 3KOAA 4EP5A 4IRDA 1S1WA 4FZZA 1S1VB 1J53A 3KLIB 4FJ7A 1O1WA 3NAHA 5F9NA 1L3VA 4CHQA 1JLAB 3PZPA 1KHWA 4Z4CA 3ZSZA 4DFKA 2YNGA 4Q43A 4Z4IA 4LH5A 2XHBA 2GV9A 3BR9A 3DM2A 1JLCB 2BQUA 2YKMA 2AU0A 4I7FA 5KGXA 3OJUA 4CF2A 4FLTA 2OH2A 3LAMA 4K4ZA 3KLHB 1KVCA 3CG7A 3LP1B 4TYBA 5KFMA 3E01A 4CF0A 1NKCA 2QKBA 2WHOA 2RF2B 4DF8A 4BWMA 1S1VA 2Y1JA 4O44A 4WXOA 1Z26A 1Y97A 3H5SA 4RNMA 4Y2AA 2RDJA 1T03B 4QWCA 1NHVA 4K4TA 2F8TA 2YNHB 4NLVA 2V9WA 3BSOA 4WXWA 1N4LA 2R2SA 3RR7A 3SQ0A 2J6TA 5DGAA 4O44B 3MAQA 2ILZA 3QIOA 1FKPA 3KK1B 4O3RA 3OYLA 1RTIA 4CJKA 3NHGA 1HQUB 3Q8RB 4ELTA 5J1EB 4DTRA 4KO0A 1XHZA 1NK4A 3CJ3A 3EPGA 1U04A 3M8SA 3I5CA 4QAGA 2W9CA 3DMJB 1ZBIA 3KLHA 1BQMA 1L3TA 5F8HA 4Q44A 2RN2A 3BJYA 2FBVA 3SCXA 5KFIA 5C25A 3BSNA 4DTXA 1LW2A 5JUMA 3CJ4A 5EUHA 3JSMB 5KFZA 1KCFA 4J2EA 3LZIA 2I5JB 1ITGA 3TANA 1C6VA 1SL1A 1RT1A 1T8EA 4ED3A 1N5YB 3T5JA 1JIHA 4ZVEA 2G8UA 3QO9B 2VG7B 4F3TA 4R8UB 4WFYA 4CGGA 4PY5A 3AA5X 5HRPA 1S6PA 5I3UB 4TY8A 1VRUB 3ZT0A 3UDLA 3OYDA 2ZD1B 1JLQB 1QQCA 3QETA 5HBMB 3KJVA 3OVNA 3ZSYA 3B6PA 1S1UB 3B6OA 3BDPA 2KQ2A 4RZRA 3HPHA 4ZHRB 4K4SA 2Z1GA 3HK2A 4OLAA 3AVKA 1R0AA 3V1OA 5J2QA 5KT4A 5EU7A 1NJWA 3IAYA 5KT2A 1N6QB 1NK7A 2YKNA 4FM0A 1VSFA 4KHWA 2RF2A 4CJUA 3QINA 5K14A 3K58A 1TK0A 1HQEA 4FJXA 4JV2A 4CEOA 4LSLB 2D41A 3K5MA 1RT2A 3ZSOA 4R8UA 3K57A 3G10A 3K5LA 2O4IA 4KHSA 3FSIA 4DLEA 1IKYB 3DLKB 1OS5A 4EZ6A 4ELVA 4OGCA 4AHVA 4DF4A 3FDSA 3AO4A 3NH0A 2AQ4A 2G8IA 1LAVA 1NK6A 4AHSA 3NE6A 1LWFB 4O3OA 1RTHA 1SUQA 3V6DB 4RNNA 3IS9A 4AHRA 2R8GA 2G8WA 4UQGA 3CDWA 3H40A 3VQBA 1S6PB 5I3UA 5KFPA 1BQMB 4LD0A 1TVRA 3BGRA 3RAQA 1NNDA 3WNHA 5KFYA 1JLBA 3OL6A 5HBMA 3SYZA 3V4IB 3MECA 4NLXA 2QKKA 2OPSA 3QZ8A 4DTSA 4CJRA 3AA2A 1QSYA 4K4WA 2WRMA 5FROA 2E6LA 2B6AA 1XR5A 5F8JA 1RBSA 3OL8A 2VG7A 3G86A 3OYHA 3DOLA 1KSPA 3KK2A 4DQQA 4YP3A 4CFDA 1VSLA 2E4LA 2OPPA 4DS5A 3EZUA 3HM9A 5HLFA 4DMNA 2FJXA 2IM0A 3KHHA 1ZTWA 3BQ2A 5D3GA 3OL7A 4O3SA 4W5OA 2HNDA 4QPXA 4U6PA 4LY7A 4B9MA 3NKYA 4FLZA 1S1TA 3QLHA 1C0UB 4RW7A 1IKVA 1TVRB 1W25A 1T03A 5HRRA 4RW4A 5KFBA 4E89A 4PA1A 1SKSA 2XC9A 2XGPA 1KLMA 3JYTB 3Q8PB 4ICLA 4RUAA 3DRPB 3PHEA 4FK2A 4LSNB 1WSIA 4K4UA 3C95A 1HNVB 3DRSA 2IC3A 4HHTA 3LDSA 3VA3A 2AX0A 1T05A 3ZT2A 2BANA 2ZKUA 2HVHA 3OYMA 4FLUA 3V4IA 3GV7B 2JGUA 3RBDA 4NLOA 4EYIB 3RMDA 1ZYQA 2WOMA 3PW5A 4HUEA 3ZSWA 3V9XA 5KFRA 1N5YA 2VG5A 3LP0B 2W9BA 4N41A 1S97A 4IDKA 1R0AB 2XCAA 4CJ5A 3SPZA 1JL2A 5JS1A 5KG6A 4CJ4A 2RKIB 2HHQA 4CK2A 2BDPA 5DG7A 1JLEB 5F8IA 4NYNA 1L5UA 4ZP8A 5K14B 2FLPA 2GIRA 2FC0A 2HB5A 1S1XA 3QZ7A 4Q5VA 3RWUA 1SV5B 3Q8SB 4FVMA 3VQQA 2YNHA 3FFIA 4X2BA 1BGXT 1VSEA 1RT4B 4FJHA 3QEWA 5KG1A 5DQHA 4GC6A 1TKTB 1D8YA 1DLOA 1S9GB 3TAQA 4OPKA 1YVFA 3K5NA 4FLYA 1HQEB 5J2MB 1EKEA 4EYHB 3NDKA 1NK9A 4DG1A 2IOCA 3ITHB 4CF9A 2AJQA 4ED2A 5KFOA 3CQ8A 4IFVB 1NK5A 4YNQA 4BACA 3PO4A 3P5JA 5DG9A 4WE1A 4LQ3A 2R7YA 3KLEA 2B5JB 3QNOA 4YR3A 2R2RA 3I0RA 5SZTA 2G8VA 1NKEA 4TXSA 2OPRB 1RYRA 4Q8FA 4HCBA 3UPFA 4TQSA 4XPEA 3RMAA 5KFEA 2QXFA 3RRGA 3DI6A 2E9RX 3SZ2A 2IJFA 4RNOA 1IG9A 3UIQA 5DMRA 1YTUA 5KFFA 3C6UA 4G3IA 4CF8A 1KFSA 4IKAA 1ZBFA 3O4NA 4O3PA 4KV8B 3OY9A 4OLBA 2DTUA 4CHPA 2ZE2B 2F8EX 3MFHA 4ECVA 3QEPA 3TR8A 1RAJA 3N6NA 1RT6A 1S49A 4OGEA 4KTQA 2KW4A 1ZBHA 3U3YA 2YKNB 1IM4A 3MR3A 1XR6A 3L2WA 5C25B 4URSA 3IGNA 1U47A 1S9EB 1BHLA 1MU2A 1C1BB 1RT6B 4H8KA 3UQSA 1TKXB 4CGFA 4DSIA 2KZMA 3HO1A 1TV6A 4H4MA 3KMSA 3OHAA 1TGOA 3T1AA 4CK1A 4M95A 1S0OA 4FLXA 4DTJA 1TK5A 4CK3A 1C2PA 4ECYA 5J2PB 4TY8B 4F4YA 1IO2A 4OVLA 1JLGA 5KFQA 5F8LA 2HNZA 3V6KA 3AO5A 4OJRA 2IGIA 1RT3A 2PYJA 1WSJA 3P83D 4IOBA 1LV5A 4CESA 2KFNA 3H5YA 4JLHA 3IGVA 2RPIA 3C6TB 4CEZA 1J54A 1HYVA 3CM6A 4RNFA 4CJPA 3DLBA 1XHXA 4IFYB 4ZPBA 2Y1IA 4KE5A 3TAPA 3KKRA 1RT3B 2I1RA 1LWCA 4QW9A 3SQ4A 5CZ1A 3AA4A 2P5GA 1WAFA 4AH9A 3KMQA 3QYYA 5L1IA 3TAMA 2ZE2A 1UWBB 1IKXA 4CJWA 3NF6A 3NAEA 3ALYA 5EWEA 1IH7A 2Z1IA 1DLOB 3NF7A 4JS5A 3DDKA 4KHMA 3MXJA 5EWGA 3KK3B 2XGQA 1D5AA 3VQ5A 1UA1A 1YTAA 3DRRB 4J9KA 3M9NB 4CHNA 1JXEA 3V6HA 3VQ7A 3T5KA 3TARA 3V81B 4ECSA 4J9LA 4ZPCA 1LW2B 1C1CB 5KFJA 3ISNC 4Z4GA 5KI6A 1QSSA 4CEBA 4EBDA 2NUBA 3PY8A 2QE5A 4NCGA 1HQUA 3MEEB 1T3NA 3ZSVA 4PQUB 3LP1A 1BCMA 4B8CA 3BGRB 2C2EA 3N6LA 1J5OA 3MF5A 1U4BA 3CIZA 4N56A 4E7IA 1BL3A 2C2DA 3HP6A 3I0RB 4G1QA 3FQLA 1KTQA 2HHXA 4ZHRA 4KHUA 3RAXA 3KK3A 1CXUA 1JKHA 4CEAA 2YNFB 1RA7A 4O0JA 3FRZA 4WZMA 3C94A 2X78A 3ITHA 4GMJB 4CEFA 2HNYB 4KTWA 4Q0BB 4DWIA 1YVUA 4ECRA 4HTUA 3H4BA 3HSTB 3SNNA 4CJTA 3IRXB 4GVMA 3SV4A 4J9SA 4Y1CA 4Y1DA 4JS4A 2GBZA 3QEIA 2HAIA 4K4VA 4F3OA 1C0MA 3L8BA 2ZQBA 5KFVA 5FRNA 3UR0A 1RT1B 5DQGA 4DL2A 3AVAA 4CGJA 4ICLB 2HNZB 5EWFA 4F2RA 3HVTA 2D0BA 1GOAA 3LWMA 3V1QA 2XCPA 1VSJA 1CZBA 3AVGA 4J9OA 4MK9A 3PR5B 3DMJA 4NLWA 4YQWA 5F8NA 4DSEA 1U45A 1A5WA 1S9FA 1XWLA 2ZD1A 4IKFA 1JL1A 2RKIA 2W8KA 3SQ2A 4CGIA 1FK9A 4RG8A 1S10A 5L1JA 3PW2A 3QNNA 4I9QA 1Q8IA 4CGDA 4K4XA 3AO1A 4O3QA 3TVKA 2ITGA 5C42A 5KFXA 1FKOA 1Q9YA 1SH3A 4O0IA 3DRPA 4FJNA 2B6AB 2V4RA 5JXSA 4Y3CA 1JLFB 1HARA 1RDBA 3VQPA 2LSNA 1L3SA 2X6SA 1QS4A 4JV0A 4CJLA 1KFDA 4ZTJA 1BI4B 1SH2A 4O3NA 1QSLA 4FZXC 1SL0A 3SJJA 1CZ9A 1CLQA 1BQNA 2WB4A 2YV0X 4FJ5A 3RBEA 5FDLA 4MFBB 4KPYA 4KB7A 4CFCA 1I6JA 4NRTA 1NOYA 4EO8A 4E1MA 4EO6A 1JKHB 4I9LA 2YHAA 1N6QA 3DOLB 4ECTA 3NL0A 1ASVA 1T94A 5E41A 2BQ3A 3PX4A 3TABA 3HVAA 4NZ0A 3M8RA 4B3OB 4DS4A 3CM5A 2PZSA 5KG4A 1UWBA 3AVLA 3V6JA 4B9TA 3PV8A 2HNDB 3LPTA 3PJWA 1T05B 5DK5A 2V0NA 1WN7A 1EETB 2Z1JA 4E1NA 3ZCMA 3HPGA 3GQCA 1C0TB 4RW8A 2DPJA 2OPRA 4KHNA 3RB6A 3VA0A 2I5JA 4B9LA 5KFSA
chains in the Genus database with same CATH superfamily
2WTFA 4H54A 1X4GA 2C3PA 1JCEA 3CQXA 3FFIB 4M94A 4DN0A 4OPJA 3C6UB 1CSJA 2FHJD 2C2MB 1IR1A 1QAYA 5C0YA 5J2NA 3MMBB 2WONA 2ASJA 2R2TA 3AVNA 1S6OA 2KDOA 3Q2TC 4DL5A 3DN9A 4OPAA 3Q7BA 4BC4A 2CA9A 3O9TA 4YORA 1DZ5A 5AXNA 3NGKA 3KWMA 4IOAQ 4QR1A 2H5IB 4IFVA 2CWKA 2NYHA 4M63C 3OFEA 5KFWA 2X6NA 2E5LJ 1HNWJ 4J9VA 3OL9A 2VWJA 1N36F 4IOCL 3M6WA 4MK7A 5T7BA 3D0PA 3PX6A 4Q7AA 2MZ1A 5K8MA 1JJCB 2M88A 3QMLA 1F60B 1TFYA 2WBMA 4IO9Q 3RUBL 4JKAA 3L2UA 2DIUA 3AJ2A 2ZM6K 3IM8A 2KZZA 1XIQA 1S1UA 4CJSA 2IRYA 2XY8A 4X65K 3OT9A 3C6TA 3M6GA 2PAVA 1LK7A 4DLGA 3J81Y 1ATRA 2PY5A 1BIUA 2JEFA 3R6LB 3VF4A 2BZ2A 1LWCB 4JAXA 5F8MA 1SXLA 3R1XA 1BWVA 3PW0A 4B9UA 4HDHA 1FJCA 4WCEL 3NGZA 2NPFA 5DO2A 4BRLA 2A1SA 1X0FA 1FI4A 3MM9B 1T95A 3VHQA 5CZVA 4EGLA 2MZRA 2Q1NA 4CI6A 2A41A 1RI7A 4CLWA 1ZM2A 4Z4EA 2HRUA 2VONA 3P1GA 1VQ7S 3EMTA 3IUCA 4RW8B 1LCUA 2DRAA 4E0DA 3ZFVA 4UY8O 4RWWA 3BBCA 2DNPA 3A5OC 1G15A 3AJ1A 1PCAA 4WFZA 4CF1A 3HI0A 4M8LA 4OHYA 1K47A 2QG9B 4UT4A 2H3EB 2MKSA 2PN6A 4O8UA 4QWBA 4FWNA 4BRIA 2ZOFA 4DV3J 1VHIA 1TL1B 3W63A 2QEXN 3PYEA 3CCLN 2VG5B 3LP0A 2DY9A 1VK3A 2FVPA 2DR8A 1RT7A 3THTA 2C3UA 2UYTA 2XLKA 4BC9A 2R8KA 3M2VA 1N5SA 3DLEA 1ZA1B 2P6SA 1N0VC 3CUNA 4MYTA 1FWKA 3KTQA 4LSZB 2LYVA 4WYLA 4DV7F 4CWBA 4B1VA 4FWMA 2J9DE 4KBOA 2UUTA 1GLDG 3DLLL 2IY5B 1G6BA 4IJNA 4NXNK 4OZ2A 3M6UA 4FJJA 4ILRA 2YX1A 4CW7B 3H08A 2R4FA 4X4OA 3O6WA 4MIWA 3GP9A 5DLGA 3D2EA 3D66A 5D8HB 5F8GA 1IWAA 3H5UA 3CJ7A 5B8HA 3OJSA 1U49A 4DR6K 4U7BA 2V5HG 3OSPA 2FJVA 3BZQA 1RNHA 3IWNC 4Z7CA 2Q3SA 1U6ZA 1Y7PA 3W2VA 2VQFJ 2EX3A 4JI1K 2EWHA 1U1MA 2ZH4A 2F8SA 3VETA 3K2YA 5L8RC 4UY8T 1FTRA 5HVFA 3DLEB 1IM6A 3O3LA 3AB2B 3UKUA 3WNEA 2HNYA 4UW2A 2E2NA 3J7YP 3MR6A 1C1BA 3IM9A 2IDOA 1U0HA 4BE2A 1R8HA 3MD3A 1HWUA 3HMJG 3MEGB 3CJTA 2N7YA 5AZJB 5IQ6A 4XIUA 1RTJB 3TUIC 3TAEA 2H9ZA 1VRTB 4QCLA 2MKKA 3AAQA 3KUHA 3I56S 4LF6F 2J9DA 1TUVA 1S6QA 3W61A 1S1WB 4JI6J 3L4QA 2HQGA 2JEIA 4MO5A 3TEHB 3P3DA 4GV3A 4WFNL 2OPPB 1Q7YO 5E26A 1YBAA 4AF1A 2VV5A 1NU0A 2ASPA 2HHHJ 4CZCA 1KVAA 2RU3A 3J7AP 2C42A 5MLCQ 4I6YA 4DUYF 4NCBA 1ZPVA 5IT9Y 1AB8A 1H73A 1ZTTA 2B5JA 4ZN1A 2DNOA 3FZBA 2FPHX 2O8DB 4JI2K 4EU0A 3LM2A 4NEYA 4M3ZA 1JLAA 1U26A 1ZM3A 3WEEA 4CT9A 3LDPA 2DFFA 1SL2A 1RCOB 3BZKA 1TAQA 1W7WA 2KXFA 1X1PA 3I55S 3ETMA 4JI7J 2A6OA 3IR7B 5EOYA 1WDTA 2GJFA 1DKGD 5AQGA 4DPWA 3F56A 3BSAA 1XQIA 2WZ1A 2O4GA 3HHLD 3RU0A 2FQQB 2QA2A 5KFDA 4LF9K 4WE1B 4MDAA 1KBRA 3AVIA 4K25A 1NH7A 3VQ6A 5KRTA 4PUOB 2D0OA 3ZZUA 5FD1A 1CQMA 2H51B 4AHUA 4B3MK 2YPZA 3AVBA 3GFHA 2YKOA 3OA9A 4FOIA 4DR7F 1YTYA 5CYMA 2YPYA 2XS5A 2UUBJ 3AT1B 1T3VA 3UE5A 3OYCA 5J2NB 2O5DA 4KFBB 4BS2A 1RHUB 4FPBA 1DTTB 2VJVA 3R1LA 2HS3A 2DHHA 1RU1A 3J81O 2LXIA 4ID8A 3G4SN 1M5OC 3L95X 4TLRA 4P52A 5KFGA 3WIVA 4NA1A 3KKSA 3ZETA 2VBWA 1CJTB 4CERA 2UUCJ 4W90B 2I7PA 3RB0A 1D9FA 2VWBA 2EG2A 3IRWP 1N56A 2IAJA 2XMWA 2M70A 4USWA 4CLLA 4IO9L 3FCVA 1WLJA 1YHQS 1OSDA 3N6MA 1QAJA 3VF0B 2RQ4A 3CC4S 4LIRA 1RWPB 2WC9A 2O8BA 2K7JA 4BC2A 2IJNA 4DSFA 4OFZA 4ECZA 2V51B 1ZPWX 1HKAA 3K9KA 4JI3K 4PUOA 3HBTA 4PQAA 2V7ZA 2BE7D 3VTHA 1H0HB 3K89A 4YHHF 1WD6A 4RR5A 2QT7A 2LA6A 2VUGA 2D0AA 1YJTA 5BR9A 2J0SD 4DUYJ 3WDOA 4R0EA 4KSEB 1SJQA 2JEJA 4IBNA 2AHOB 1SH0A 3ZEUB 4YB1P 4QZVB 1NSKL 4BR4A 4XTTA 4PWDA 4F8RA 1P6TA 3HJFA 2YH1A 3QGGA 2XB2D 1HRHA 1YGYA 2W9AA 2CJBA 2CZVC 4ZA1A 4YR2A 1NK8A 4ILHA 2DNHA 2RB7A 3BF4A 4DN9A 2RQMA 2LLZA 4NLSA 2LEPA 4CJVA 3ID6A 1R43A 3BN7A 1LWFA 3VVTA 4RPFA 5BYSA 3KK2B 3TNVA 5DM7L 2ZNYA 3UCGA 1NJZA 2LXFA 3G0ZA 3C15A 4TLQA 4WF9Q 4MLHA 4H4OA 4ZPWR 1P9QC 4LQ9A 2IM1A 4RW6B 1GLBG 4B3OA 2N4DA 2P8IA 5HK4A 2AT1B 2VIHA 5D4OA 3L2QA 4Z94A 2HMIA 3UCUP 4RO0A 2HW3A 2EEYA 2D74B 3M8PB 4K8ZA 4CH7A 3UW1A 4IH6A 1CVJA 3C14A 1RTZA 3PUFA 5DM6Q 1H1VA 4O55A 1KS2A 2A10A 4JHDB 3D54A 4F7VA 2QLWA 4CT8A 3RMCA 2G8KA 2AA4A 5E0OA 4QIVA 1JQGA 3JQKA 2DPIA 4FJMA 1NJXA 2UXBF 1BQXA 1HBUB 1JLFA 1FTCA 3UKUB 4P2FA 4V1Ak 1Q86O 4DSLA 4DTNA 3O5TB 3P5BP 1BUXA 2QLFB 5C5JA 5J2QB 3BZCA 3CO9A 4IEIA 4DPXA 3QICA 3R7SB 1S48A 2AZ3A 3KLEB 1XUPO 3FCHA 4EP4A 3MM5B 2UUWA 1YITN 4NLPA 4NLQA 1AT1B 2OYQA 1Z2LA 1RACB 2QJ3A 2HRTA 4M5HA 3MR5A 2BXJA 1B0VA 3MXIA 5KFNA 1FT8A 4CIGA 3FBBA 2PEHA 1F5BA 2ABYA 1M90T 3FE1A 4TN2A 1AXQA 2QIFA 2AJ2A 4BGBA 4M3WA 5DJBA 4E98A 1H7XA 1TL3B 1BHNA 2D7SA 5AJ3F 1NMDA 3C16A 2DNMA 3HTVA 4BWJA 1HLWA 4RX6A 1V4SA 3RMBA 4I0WA 5LMUK 1MMDA 3FZFA 3MM5A 3LPEA 2A3ZA 1RWMB 1F2GA 4CZMA 4PG4A 3VQ9A 2UVVA 1NO8A 1TKDA 1LAWA 2H54B 3F41A 4WJBA 1N32K 2AGPA 5IC4B 5BN9A 1V4TA 4C11A 4OQJA 1F5AA 2JDJA 4HUGA 4OHZA 5H1SQ 4B08A 1HR0K 3GSDA 5I42B 3RRHA 4A46A 4FS1A 2HS4A 4V19X 4F4AA 5KTQA 2PFUA 4K59A 1D9DA 4KB0A 3A8JA 5E3QA 1BDGA 2CNKB 3SBTA 2VFTA 3ETOA 8RUCA 5EX3A 4CJEA 3PTWA 2KG1A 4NYOA 2EWSA 5HLFB 5ETMA 3QGIA 1K8AT 1EJ7L 1K73T 2V2QA 3TAMB 5FLXO 3W5YA 3AVCA 5AXLA 2HWHA 2H48B 5B0FA 3A8KA 4NMLA 1H72C 1XI1A 1RADB 2GELA 4C48A 3NVMA 4G1IA 2AF6A 3OXLA 1IBLF 3TTDA 4KHRA 3SUOA 4USJC 4X65F 3VZHA 2JEGA 1NZAA 4H4KC 3MMAA 3OSNA 3G71N 3FZ2A 3NAIA 1KLNA 4QIWD 1MA9B 4W98A 3VESA 3ZZOA 1RUSA 4UF4A 2M4MA 2HFVA 1JLBB 1PSDA 1NEEA 2OELA 2Q1LA 5T14A 4P2XA 2I2YA 5AQPA 1S6UA 5HMXA 1U48A 1I39A 1EQMA 5GAGP 1Z6RA 5CABA 2DXFA 3KIOA 3MUMP 3NMUA 4AXIA 2E2OA 1FVQA 3H20A 3ISND 3LANA 3SFUA 3EGWB 2APOA 4B3RK 4X64K 1S6QB 5M1KA 1Y00A 2CFXA 3NMAA 3LP2A 1AFIA 3NCIA 4HKQA 4OHWA 3VQEA 2KG0A 2HURA 4Q45A 3HPOA 5CY4A 2P1JA 4KBIA 5EN1A 2B9YA 2NUHA 3R6GB 3OYGA 2JWKA 3CJBA 4YOWA 3KHGA 4WU2A 2PA3A 3PIPQ 2QA4G 5C12A 1M1HA 2F8HA 4BRCA 1PBUA 2OMOA 3HVWA 2P9KB 1SKRA 1BIZA 2ZHBA 5A8WB 1ICEB 3ZZPA 1L3UA 1YJ9N 3FNNA 4YDUA 3SI8A 3A5NC 2HFSA 2WTUA 2HIQA 1WAJA 1TUGB 2R7UA 3M9MB 4ED7A 4KKOA 1ZA2B 5C2FA 1B99A 2VQEF 1Y64A 3JTNA 2C28A 1VSKA 1OH5A 3QSYB 1NM2A 3WNGA 3LWLA 1JX4A 2ZM6J 2YKMB 3DI6B 4GC7A 3IG1A 2WVEA 2W7OA 4PPZA 3FMBA 4J9UE 4JI0F 1BA0A 1X4DA 2XRIA 2ATQA 3CCUN 4U9RA 4ZP7A 4I6WA 4DU8A 3NGSA 3PR4A 3VGTA 2A5XA 1YITS 1J53A 3KLIB 3K8WA 1UCNA 1GFWB 2YX4A 4DV5F 2P2CB 3ZSZA 4JI3J 3NGRA 3B4MA 4K43A 3IBFB 2HWTA 3HF5A 3TWZA 3WQPA 3W3SA 2XHBA 2D1CA 5U47A 1VIXA 2OSRA 2YKMA 4C0HA 3H2VE 1WHWA 2MGZA 1W2IA 1Y11A 4PG7A 4U7UD 1ROFA 4BRFA 3VAFA 4FLTA 3MX2A 2M0GB 5AQQA 4JI2F 2R7WA 2NLXA 3IKMA 4TYBA 4B3SJ 3JQJA 1I94F 4QS7A 3D67A 2QKBA 2NRHA 2RF2B 1RCXB 1U7LA 2W2QP 3CQYA 2QMXA 4NXNF 2YX7A 4AE5A 2GZOA 2VICA 4X66F 1Y97A 2R42A 4RNMA 4LF8J 1T03B 1B70B 3WBZA 1MWZA 4FN5A 1U1RA 4A8FA 1NG9A 4UQTA 2R2SA 3RR7A 2IDEA 3BBFA 4LFCK 3CCQN 1FKPA 3KK1B 2DJWA 4HEA9 4JD2A 1HQUB 1KTVA 1NK4A 4OI2A 1DHMA 4AT1B 1CULB 2NXUA 2FHKA 2UUAK 4DV3K 5F8HA 4Q44A 3UFCX 5KFIA 3D7EO 4CBWA 5JUMA 2P9GA 3DGPB 2CJYB 1N5YB 2ZZMA 3T5JA 1ZH5A 4ZVEA 3PACA 4WFNQ 3R2CJ 3HSJA 4HHJA 2VG7B 3TQEA 2BEFA 4WFYA 5I3UB 1I51B 1V6HA 2HMPA 4WP8A 2R7VA 1CJVB 4TY8A 1BUPA 4DV7J 5HMZA 1LXNA 1JLQB 1QQCA 2JVOA 1NGFA 5D15A 3C0BA 3MCAB 1RHJB 3WC2A 3B6PA 2UUBF 1QZ5A 1S1UB 4FF3A 1HHTP 2NR0A 2XG8A 3BDPA 5IT4A 3HPHA 1BMQB 4ZHRB 5EGYA 4IQMA 2G2YA 3AVKA 2QSFA 1O13A 4B1XB 4ZCIA 1N6QB 9RUBA 5JLHA 4WTOB 3D2FB 3J7YI 2YKNA 3WHIA 4FWSA 5K14A 3K58A 5ADXH 5KOXA 2D41A 1HBOA 3ZSOA 3OFHA 3K57A 2XNRA 4KHSA 3T7ZA 4DLEA 3FVYA 4EZ6A 3GYGA 4WP9A 3L7UA 1XBWA 1CJKB 2MQLA 1FDDA 5AQVA 4OX9J 2MSTA 4ISEA 1U1PA 1RZMA 5GIPA 2EG1A 1KN6A 4ILJA 2YHYA 4JI7K 5I3UA 2CZ9A 4LD0A 4JKFA 1NNDA 3WNHA 2DKOB 2PMWA 1QVGM 2QKKA 4RWTA 2OPSA 2DEIA 2J4RA 3PSFA 1VQLS 1ZS6A 2E6LA 5F8JA 1S59A 3OYHA 3DOLA 3GYXB 1AROP 4CJ7A 2NUUG 2E2QA 1CPZA 3CDBA 1R8PA 4CFDA 3GPAA 2HHHK 2OPPA 2I0XA 1ZBSA 1UPPA 3C6AA 2ZBPA 3C14B 3HM9A 3MD1A 5HLFA 4O8KA 1RDUA 5LMNJ 2RH3A 3OL7A 1LWXA 4ZPTR 2VOPA 2ASMA 4JI4K 2CDRB 4RL1A 4QPXA 2EFQA 4BR2A 3NKYA 4FLZA 1RWUA 3QLHA 4USVA 3JS9A 5HRRA 2NCKL 5KFBA 3V2UC 4DR1K 4DR6F 3TSPA 2XC9A 2XGPA 1P1TA 4BRQA 2DXDA 1HNWK 4QU7A 5E3AA 2EC2A 4K4UA 3EE9A 2HEKA 1GLEG 3DRSA 2CNOB 1WUUA 5AQTA 4LF5K 3VA3A 4OZNA 2A2CA 2AX0A 4OYAA 1WC1A 4X66K 2BA9A 1CS4B 5F3TA 3BO4A 4DR7K 2AD9A 3OYMA 5I3PA 4FLUA 3RBDA 2Z2MA 1OY9A 2IBOA 4NLOA 3NS5A 1WBDA 2WOMA 3MPUB 5KFRA 2CNLB 2ZUGA 5B0BA 2VG5A 3LP0B 2W25A 1R0AB 2FJDB 3VERA 3GU0A 1F6TA 2XCAA 4PKGA 4KY3A 2HHQA 4CK2A 2XEXA 5DG7A 1HNXK 5F8IA 1FRJA 2J0WA 4JV5F 2KJWA 4OYIA 1LNQA 2FLPA 2GIRA 3RWUA 1Q5VA 1T11A 2EI5A 2ROPA 2UXCF 3VGLA 2K7KA 3D0IE 4A8YA 2R7XA 3O5BA 4K5RA 4EHUA 1B7FA 1VSEA 3QEWA 5KG1A 3CD5A 3FZHA 4WBFA 2ZWPA 3M7VA 2CYYA 3VEYA 3TAQA 1KVKA 3K5NA 4CLKA 1HQEB 4L3NA 3MX5A 4YB6A 3ZC4A 5TKYA 3NDKA 1W7AA 2E7XA 3BKUA 3G82B 5GMKa 5KFOA 2P9PA 3EXYA 1P9YA 3PO4A 4LQ3A 1LEOA 3EVOA 3O9RA 2B5JB 4TXSA 1RYRA 4BR5A 3EDQB 4Q8FA 2ERRA 2VHGA 4QR2A 4B02A 4DZDA 3M2UA 1E6YB 1FJGJ 3OTBA 3UIQA 2XLIA 4LRDA 1UVNA 1ATNA 4IKAA 1H7WA 3O4NA 4O3PA 2GGPA 2R7QA 4ZVSB 3MMJA 1GMVA 1WTFA 2ZE2B 3H1QA 1RAJA 3N6NA 4JNEA 1E3MA 1FWLA 1ZBHA 5D4LA 4NXNJ 3T1YK 2ZH5A 1IM4A 1O6XA 4PZVA 5C10A 5HVHA 4H0YB 5FPEA 4QYRA 3UD3P 1S9EB 5H1SV 1OH7A 2QC3A 4GNIA 1TKXB 1NB2A 3J80O 3CJAA 3OHAA 2B9EA 4CK1A 4DTJA 3CCSS 5IWAJ 1WOSA 1TL7B 4WCEQ 2F4VK 5A2QY 5C15A 2QN6B 4DV0J 3UNYA 5F8LA 2DPNA 2IGIA 5AQFA 3NS7B 2PYJA 4BRMA 2YKAA 1WSJA 4CESA 4FWLA 4AL6A 4JI1J 3H5YA 1NGDA 3TR5A 3IGVA 2RPIA 3C6TB 3CJRA 5KPTA 4RNFA 3M2UB 2F9DA 3ILJA 4CO3A 4ZKAA 4WYBA 2EFPA 4HI1A 1ULRA 2I1RA 4NI2B 1UVIA 3LUYA 3KMQA 1NHKL 3R6MA 3KG0A 2AYGA 3ALYA 1KONA 1IH7A 3DDKA 3IMXA 2WSCC 5EWGA 5AFUA 2EFGA 3VQ5A 1GEHA 2MXYA 4CHNA 1NBEB 1YJWN 3V6HA 3SBMA 2GFFA 2CQDA 3V81B 5B0GA 1H2UX 4J9LA 2F5GA 4JB8B 4ILLA 5CHCB 4RCHA 3QDKA 2HF3A 1P1LA 2ZBQA 1MROA 5AQYA 2VC1A 4BC5A 3R5DA 4YOVA 1H74A 2HBKA 2KI2A 2EFVA 3BB5A 1HQUA 3MEEB 4P74A 4LFCJ 2VZ9A 3ZETB 2OEKA 3MF5A 4DU7A 3CTRA 2QW9A 4IZ9A 4WK1A 2C2DA 4A59A 1F9HA 3I0RB 1SIWB 4KQZA 1M5SA 1OPIA 4ZHRA 2B8QA 3RAXA 4KHUA 3KK3A 3G2XA 1JKHA 4H4KA 2QMWA 2G2ZA 5AXMA 3GWCA 2P9NA 3GB0A 3D0GE 3CPWR 2FF6A 4Q0BB 3H3NO 3CO0P 2CPXA 4W4MA 4DX6A 4OI3A 4CLSA 2LA4A 3SNNA 3MHYA 4B1YB 2V8PA 3MZIA 4BRGA 2ZC3A 5TKWA 2FB0A 3QWPA 3FEYB 3DRYA 3CJ9A 4FPAA 4JI0K 3CMEN 2DISA 4FSVA 1QVGR 5DQGA 3QFWA 3MUVP 4DL2A 3AVAA 2E7WA 2PEBA 2D0BA 4H5WA 3SEOA 1VSJA 4LUBA 2B9WA 3D2EB 2HBJA 3AVGA 2CDQA 1XQSC 2XBPA 2QFJA 1SJFA 1A5WA 1S9FA 2VQEK 3HI9A 2ZD1A 2VGNA 4RG8A 1S10A 5L1JA 3PW2A 4EWTA 2YWGA 2QX0A 3POTB 4IOCQ 2QM1A 4K4XA 4NI2A 1NNEA 4O3QA 3TVKA 4CP5A 4B3MJ 3SAFA 2AYEA 1PAUB 1FKOA 2MJUA 3GJRB 2GAGC 1SH3A 1KAXA 3DRPA 3J7ZO 4FVUA 3BM7A 5BRFA 2V4RA 2XSJB 5JXSA 2WFBA 2ADBA 2BE9B 1JLFB 1B4SA 3D7SB 1YRXA 1KFDA 1G7CB 1RHKB 1XMQJ 3VEWA 3SJJA 5HSPA 3PIPL 2NRZA 1CLQA 5T41A 4FJ5A 3H3OB 1EKRA 3LOUA 4HHUA 1VQ4S 2YTCA 3ENQA 4KB7A 1OYEA 2HBQB 1WC5A 3D6HB 4EO8A 4NMXA 1JKHB 4I9LA 3NL0A 4DBQA 3HZGA 3CEDA 3PDNA 1FNXH 1T94A 4WK3A 3CF5L 1FFWB 2MHEA 5DETA 5MLCV 4Z37A 3AD9C 4LFBK 4B3OB 1HBOB 3ZZYA 2DO4A 1IUJA 1UWBA 5DS7A 4DR4F 3M4XA 1NB7A 1T05B 1UTAA 2Z1JA 3ZCMA 3HPGA 3OPKA 2ASYA 2DPJA 1JNRB 4KHNA 1WHVA 4P9SA 1HD1A 2ZH3A 5JMVA 5C7PA 2G4BA 1S77D 2ZJPQ 4CQ1A 2IM3A 3LTOA 3ZX2A 2FZCB 1TU0B 2V94A 4PCQA 2CXEA 3VQTA 2MB0B 2FVSA 3VR1A 4MKAA 3H4DA 2GUIA 1TL3A 3DLHA 3H98A 4PL7A 2HKEA 3G8SA 5HP1A 3U1NA 2L08A 2XSJA 4DV1F 3L7OA 3FEXB 3PXGa 4M41A 5BN8A 3OYFA 4ID1A 2AJ1A 4KHQA 3OLAA 2JC0A 4DTOA 3CJKA 4DHYA 3OXFA 3T69A 3ZT3A 2YWEA 5KG7A 2P9UA 4IRCA 4HDGA 1EX8A 2NNWA 5A6WA 2E5LF 1WG5A 2IA6A 1YZ6A 4WZQA 3PLAA 2EVZA 3DDNA 4B3RJ 1XNQJ 4K41A 2C2RA 1NGAA 5AJ3K 4J9NA 4B3MF 4CZHA 2MQMA 3DYAB 1D09B 4ZVTB 1TAUA 3A3PB 1N0UA 5I4MA 2PI4A 4J90A 5AQHA 3DCAA 2VQEJ 3DRRA 1XMOK 4EBEA 4DHVA 2QK9A 1X4EA 3V9ZA 3O9QA 4RW4B 2VQFK 4ZVQB 3G82A 2DHGA 5I42A 3J7ZT 3MEDB 5LSLA 1WEZA 3MM7A 3VEVA 2QZ8A 5GAEP 2GIFA 3PEJA 2K1RA 3CF5Q 4KFBA 4JI0J 2BV3A 4K7QA 2GVDB 4FYWB 1K1SA 2VWKA 1EETA 2EC0A 1CC7A 3CCEN 3PVXA 3IN5A 1FD2A 3E01B 4RLEA 4XH5A 2NRVA 4LF1A 3OVSA 3W9HA 1HPZA 2CGJA 1G1XA 3F9KA 4CO1A 1N33J 5KG5A 4CECA 2W01A 1XK8A 3QEXA 5HJXA 4KH0B 1HKBA 5K20B 4IJAA 1RAFB 4H5VA 3SUQA 3PHTA 2P51A 2P9CA 4Y28C 4C8NA 4NXMJ 1VSDA 2W6LA 2VPWB 3MCNA 3MR2A 1DQ8A 5T7LB 1N48A 2YWKA 4CIEA 4FWOA 1ZBUA 4P75A 5A8RA 1FNMA 4JI2J 3VQSA 1DGKN 2IM2A 2JZ5A 3EN9A 1X5SA 2V2ZA 4MDBA 1JCFA 3VGUA 1IQZA 4ECQA 3BH6B 2D5RA 5BPLA 4GKKF 3VTIA 4PHTX 1FRXA 1SC1B 4USHA 5AJ3J 2D69A 6FD1A 3NNHA 1CEZA 2BM0A 1NSQA 4F4KA 3OS1A 4OKJA 2FJWA 3AD8C 4PL8A 2FSKA 2EBGA 3H2UB 3HHLA 2YNFA 3HD2A 3KLGA 3AAWB 4MKBA 4DU4A 2EFNA 2XO7A 2P9KA 4ID5B 4FYYB 4NYPA 1PYTA 1F5CA 5HQMA 3O3GA 2E66A 4FS2A 4CNZA 3KXDA 5FLXY 4HCCA 2OPQB 1F2HA 4DG1B 4C8OA 1TP7A 3SPYA 1LWEB 4ZCLA 2W42A 4WIIA 2O8EB 3MM8A 3JSMA 1F3FA 1NOZA 3J80Y 2VQFF 3AH6A 3L3UA 1R6YA 4J9PA 3KK7A 4NLUA 4YR0A 4IRKA 2IMWP 5IWAK 3CW2C 1PYOB 5ETQA 1TZ0A 1BD6A 3RTVA 4GY2B 2IDLA 3OTEA 3AVMA 3W1YC 4KKOB 4JKBA 3VQ4A 2NXNA 2DGVA 2PYLA 5E2QA 2RVJA 2BJ1A 4JBCA 2HZVA 3BR8A 3VAMA 2WVCA 3SMSA 4HVZA 1I3AA 1VOMA 1RT7B 1P8GA 1RBAA 1VSMA 4KH1B 5DG8A 1WDDA 1RCHA 3K5OA 2VCPA 1GMWD 4OJ1A 3BN4A 3T5HA 5L1KA 4B8AB 5LMUF 3NH2A 3POTA 1TL1A 1WOOA 4HT5A 1RT5B 1VQ8N 3KHLA 3GJTB 2JVRA 4ED5A 4X4RA 3MEEA 4EZ9A 4LIWA 2XMAA 4M5DA 4Y34A 4JI6F 3W7BA 3ENWA 2BKNA 2X1AA 1R59O 2YBVA 2KYZA 4L76A 4OX9F 2O8BB 2HHHF 3UDVA 1UFKA 1VK0A 4FLVA 2DH9A 4KI4A 1D8ZA 4JKGB 3H0PA 3AVFA 2H4YB 1XMOJ 1FDBA 4MK8A 3UWTA 3KD1E 5D0GA 3QLHB 2NRWA 3V9WA 3EZOA 5GAEI 2LXUA 2HHUA 5KFAA 4BBYA 1YXQA 1BC6A 4GKJF 3CMQA 4Q0BA 3NGIA 1S0MA 2BH1A 1GLAG 2XULA 3CC2N 1TL4A 1U0SA 3OXGA 1FEEA 4DFPA 1LW0B 4AHTA 2GQQA 3LP3A 3KLFB 4MAKA 4PG8A 2UP1A 3ZT4A 3CD6S 1FKOB 1U2RA 2HZCA 2DRDA 4LFAF 3WXJA 3FBEA 4C6AA 3C6HA 4L3QA 3R5AA 5HANA 1UA0A 1Q82O 3FGVA 1QZ6A 2Q0UA 4CJQA 1MG7A 1LW0A 2CPJA 3OYKA 5KT6A 1TKZA 2UUAJ 3FCWA 3J7AN 3M05A 4Y6IA 3SSQA 2NLWA 3FZLA 3MM6A 3PW7A 3MK6A 1HLUA 2QV6A 4K50A 5A8KA 3CDEA 3CVKA 3CPWM 2W24A 4DR5K 4FW2A 3DU6A 2HRYA 4KB1A 5C24A 5BRHA 1EO1A 4USTA 4J2DA 4F9OA 2OD6A 1IBMF 1FE4A 3QQCD 1EXQA 1FXXA 1VQMS 5ADZA 4KI6A 1MN9A 1XC9A 2JL9A 2KH9A 2F8MA 1KR4A 5AQLA 2BJ3A 2V8VA 4OMFG 2GMJA 2Z58B 4PRFA 3QBXA 1R27B 3W60A 4R5PB 4LF9J 3TZXA 7AT1B 1G4CA 2MQOA 4LRFA 2QLBB 5KFHA 5JVGL 2P9LB 1UOCA 5DDQC 5JMNA 1JLQA 3A5MC 2UXCJ 5IOLA 2WSEC 2WCXA 4PWUA 3C16B 3IFRA 3CJ8A 4ENOA 4DR1F 3O9SA 4DR2K 4DJBA 4Y2IA 4QW8A 1LFWA 5B0DA 1UMJA 1T6DA 2UV8A 4FW1A 3UKRB 3WXKA 4ZP9A 1HPMA 4LFAK 1VLYA 3MMVA 3HHKA 3WQUA 3PRDA 2EBEA 2BE2B 4DQRA 5AXKA 1A5XA 3ZNJ1 2HYIB 4ED0A 3OS0A 2IS3A 3W3DA 3HL8A 4O5BA 1Q7YT 3CDAA 2B4VA 4BROA 3THXA 3NGDA 2UU9F 5JS2A 2FUG9 2K1RB 3NWGA 1GNKA 4GVBB 1EWQA 1NKBA 2B56A 2N3LA 3IP0A 2X1FA 4U96A 3DOKA 4DDFA 2QLXA 3MN5A 4Z0UA 2C3YA 3KJVB 3ZNUA 1T7PA 1RBRA 2SXLA 3DRSB 1Z1ZA 1TKXA 4QIFA 2ZVSA 4DR2J 5HMYA 3OYAA 4DUZF 4ILMA 3QJPA 2QTWA 2AMCB 1Y4ZB 1E4FT 1ZETA 2BR0A 2MQQA 3LM9A 1VHXA 1S0NA 5IWAF 1F0XA 3V9UA 4LBIA 3KLIA 4DV0F 1HPZB 3DGVA 4DCJB 5KRSA 1MWQA 3O3FA 4OZLA 3ZTOA 2B8PA 3JSYA 1HFEL 3W64A 4DB3A 4OLPA 1VQKN 4EFAC 4OKEA 4E7HA 4XEIA 3EWGA 2LEAA 3H42A 2NXJA 3CI5A 1MU2B 5KFUA 2XY7A 4FK0A 2MZQA 1U0HB 4TQRA 2OAUA 4M45A 3PCOB 4OV1A 3MEGA 3GMGA 4MQ3A 3NCQA 5C2DA 5KG3A 3O3HA 4C2MA 3OVAA 2BYCA 3TWHA 2XO6A 3CC2S 5AZIA 4DR1J 4ECWA 2PC6A 3GV5B 3H8YA 3PIOQ 3G6XA 1OVYA 6AT1B 3GLJA 4IR1A 2OZMA 4NOHA 3CFOA 3VGVA 5C42B 1RGIA 3VQAA 1IBCB 3CJ5A 3NCRA 4B9VA 3E8OA 4M5DB 3S3NA 1N34J 1ASWA 3OYJA 3SLCA 1UFLA 5IXUA 1ZZNA 3V81A 2V2KA 2OZSA 3VN5A 2IPOB 3TI0A 4M5KA 2JSXA 1DQ9A 4LSNA 2PA8D 3MMBA 2HVDA 3KHYA 3CCLS 1KAYA 4B3TK 2FLLA 5SUHA 3TJAA 3I5AA 1D0EA 1VQ6N 4L3KA 1IR2A 3DOMB 3NF9A 3GV8B 2BW7A 2ZJPL 1JLEA 1KEKA 3NF8A 3JAMY 4MFBA 3NNAA 2B51A 4ZN3A 2KT3A 1HYSA 2R8IA 2MLZA 2VA3A 2O67A 2ZHAA 2CH5A 2QWPA 3LGMA 5CE3A 1UAXA 3D1HA 1F3VA 3G87A 3MPWA 4LR7A 4EIAA 1YHQN 2GO8A 2YQ0A 4M3XA 4LFAJ 3CCVN 1GXLA 3TUPA 3E1YA 4X4UA 4E19A 3MN9A 2CGLA 4UZBA 4X4PA 3RSEB 4GRSA 2ZBCA 4BDZA 3L2VA 1T9TA 2HZAA 1OWXA 1GXTA 3UNGC 1M90O 2AX1A 2IHR1 2BTFA 3WXIA 1NGBA 4N47A 2HHTA 2E9ZA 3H59A 1C4CA 4PAAA 5D3GB 2KN4A 4DSKA 1YI2N 2OLWA 5CYQB 3VAJA 1BG3A 2V4QA 5KPRA 4DCOB 2DFEA 3DC2A 4BR9A 1TUUA 4L73A 1QTMA 4W5NA 3Q0AA 1A5VA 5JICA 2DXEA 2E1RA 1HNZJ 5E3CA 1Q9XA 4BREA 3MPYA 4DPTA 1JB0C 2BABA 3UB5A 1RWNB 3UI3A 3W5ZA 2RAQA 2FBTA 1XNRF 3AV9A 6FDRA 3O08A 1J9AA 2FVQA 1VHFA 2Z2LA 3EZ5A 3SV3A 3P49B 2F4VF 4GW6A 1T3OA 2CGKA 2YNGB 3E51A 3AY0A 4JKGA 3CMAN 3ZSRA 4NLGA 4IDHA 2AGOA 1KQGB 3HVRA 3DLGA 1J2VA 2HMIB 3QGPA 2YQ3A 4OKKA 4JUZA 1WG4A 2OPQA 2X3DA 5AQKA 1BXNA 2L48A 1B64A 3F0NA 5ELZA 2XI2A 1V3ZA 4BRHA 4WWSA 1Z05A 2HGMA 3CCMN 2X1BA 3SSSA 1UZHA 5HL7Q 1HYZA 4KT0C 2VYPA 4RW7B 3BSCA 2ZOGA 1ZXOA 1JXVA 3E9OA 3M9OB 5CXTA 1T0TV 4ED4A 2E1PA 2QLJB 4MJKA 5AQRA 1K0TA 1ELOA 5DDRC 5B0CA 2ZWOA 1VQKS 3I8DA 3TTFA 1AW0A 3ZZTA 4KAIA 3TAFA 3VZIA 4M3TA 3EPIA 3RB3A 2G1HA 4F26A 2OANA 3GYNA 4OL8A 5GAEU 3M2RA 2L9DA 5F0UA 4RU9A 3NBPA 2EFOA 1NK0A 5AE1A 4ERDA 4X64F 2WBNA 4B9NA 1RTIB 2DB1A 4EP5A 4FZZA 1S1WA 4P7TA 1LQ9A 4IEEA 3NAHA 1L3VA 5HL7L 5LSRA 2ZH7A 3FBFA 4DFKA 1NGCA 1HWKA 3B8HA 4LH5A 2ZZNA 3G6EN 3EXCX 3CCJN 3DM2A 2O8FA 4N7TA 2HK2A 2FYXA 4FPRA 3ENHA 1HNZK 2IVNA 2CUYA 4KH6A 2PD1A 3AAPA 4K4ZA 1CLFA 3DXKB 1Y9OA 3VWSA 4BG8A 3E01A 4YB7A 4CF0A 3J7A1 4C8ZA 4BWMA 4NEZA 2ADCA 4FF1A 4O44A 2HHPA 4X66J 5F0XA 1QTNB 1SKUB 1O51A 2K3KA 3DLJA 3CMES 3SCLE 2VFVA 1NHVA 3CJSA 4KGKA 1OIAA 1HL6A 4JOUA 3BSOA 2GHWA 3E9PA 2YHXA 1VQ6S 4QIGA 5DGAA 4O44B 2DT9A 2K3IA 1TELA 3BBBA 3L9ZA 4O3RA 2JRSA 1DFDA 1TL5A 3W62A 3Q8RB 5J1EB 3D6RA 4KO0A 4PKDB 3JSRA 2D0PA 2FSJA 1XHZA 5K8NA 3EPGA 4H5NA 1YZ7A 4NXMK 3DXKA 1ZBIA 1UAWA 1S7IA 3ZZRA 4AM7A 4A8SA 2NZCA 3M1VA 4B1UB 2RRBA 3CCRN 2CPZA 3CJ4A 5KFZA 2I5JB 2P6TA 3TANA 1RT1A 4ZIVA 4YN3B 3PKMA 1JIHA 2MKIA 1I94K 4HR2A 4JI8J 1SAZA 3BYPA 2XQCA 3AA5X 5HRPA 2V6AA 2X3GA 5CAAA 1RAOA 1VRUB 3ZT0A 2MMYA 3OYDA 3C66A 1H6KX 3KJVA 2P9LA 4OX7A 1N88A 2PT0A 2AYBA 3CCWA 3B6OA 2M7SA 3Q8UA 1WJ9A 2KQ2A 7FDRA 4K4SA 3QBCA 1R0AA 4RTFD 3I96A 1KC8T 1FEHA 1X0PA 9ATCB 5KT4A 4CZKA 3W9JA 1JJ4A 4TU8A 5KT2A 4ZVUB 4FWPA 1P27B 2YY3A 1LKZA 1FNOA 3NCPA 5D6GA 4KGXB 2O01C 2HAFA 2YJEA 1VSFA 1N5QA 2JH3A 2IVPA 1HQEA 4OO1J 4JV2A 1UVLA 4LSLB 1CJUB 1VQPN 5ETTA 2ZHOA 2VOOA 3K5LA 1XMQF 1VR6A 2DD8S 4OGCA 3M8ZA 3UO0A 1YLXA 3AO4A 2AQ4A 2QWRA 1LAVA 2G8IA 2D9OA 1R8BA 4AHSA 3NE6A 2KRRA 4O3OA 4NLCA 2G8WA 4WFBL 1RJJA 1SB6A 3KUGA 3H40A 3VQBA 2WVBA 2IIHA 1S6PB 1TVRA 3RAQA 5KFYA 1JLBA 5HBMA 3SYZA 3V4IB 5LJVA 4NLXA 3GCWP 4ZIWA 3AA2A 4K4WA 4YY3F 1FRMA 2QFIA 2RNEA 1NGGA 2W2NP 5FROA 3A0IX 2RIJA 2B6AA 1XR5A 3OL8A 1UEUA 4ILGB 1KSPA 5IT0A 3I4PA 4M7YA 2Y1LB 3MWBA 4Q2MA 1YJWS 3QPIA 3U27A 4TNOA 2KKHA 2UXBK 5F2RA 4DS5A 2RUGA 2FJXA 1P90A 3BQ2A 2UU9J 1Q8BA 3W8GA 3B54A 3QB0A 4UOGA 4JK8A 4U6PA 4LY7A 2UXCK 3PYGA 3DXMB 1ESVA 1UJ6A 1TVRB 3PNIA 1W25A 2L3MA 1UW4A 3MTJA 1KLMA 3JYTB 1JJ2M 3QWUA 1A6LA 2Z56B 4FK2A 4GO5X 1HNVB 4J37A 3MM6B 3WUHA 2A0FB 1VBXA 4HHTA 1T44A 3LDSA 1Q1KA 3EDRB 1CULA 2BANA 1NDCA 2HVHA 1EQYA 2JGUA 3NS6A 3PFEA 3G25A 4ZLPA 5M1FA 5G0RB 4EYIB 3RMDA 3PW5A 3ZSWA 4DMZA 4OZ0A 4HTJA 1S97A 2XHWA 2K06A 4N41A 4CJ5A 3SPZA 5KG6A 3ZTSA 4DR5J 2DR9A 4CJ4A 1HNXF 2LQ5A 1ZM4A 5HI7A 4K0KK 1JLEB 1FFGB 1XTZA 2YWWA 2A3JA 3GR1A 4ZP8A 2IMOA 2KXHA 2QO3A 4AQYJ 1FRHA 4BVPA 4EK2A 3VAGA 1YKWA 2YNHA 2R7OA 4DV5K 2P9IA 1JK9B 2BMBA 4FJHA 4PKIA 2FD2A 4K2JA 4GC6A 1TKTB 3TUJC 1DLOA 1AZSA 5F1XA 1YVFA 1FDNA 4FLYA 1EKEA 3S1TA 2CQCA 3KJQB 2WSFC 3P5TL 3G9CA 4P2MA 1NAQA 4IFVB 5D4NA 4YNQA 5HN0A 2CQ2A 4GKKJ 5DG9A 4W92B 2DO0A 3KLEA 3T6JA 2W2PP 3QAUA 3TSUA 2OPRB 4A62A 5E3PA 4XPEA 3RMAA 4USMA 5KFEA 1HWIA 4JP8A 3RRGA 3IAM9 5GVQA 2E9RX 3SZ2A 2IJFA 1MSWD 2M2BA 4RNOA 1IG9A 5KFFA 1ZBFA 3A3OB 4QYZJ 3OY9A 2FDNA 3FFKB 5LT5A 3W65A 3TR8A 4OGEA 4NA3A 1HWLA 2JOQA 4KHPK 2PGCA 2E88A 2B4OA 2HF4A 3DNCA 4NL5A 1XR6A 2BVZA 3L2WA 1UVMA 3OW2M 5E33A 4URSA 1XERA 4EI2A 2ZDOA 1BHLA 3I6PA 1X31C 1SBRA 4H8KA 4TVAB 4CGFA 5D0HA 5IV3A 1TV6A 4H4MA 3MDFA 1WEXA 4M95A 4FLXA 2WUSA 2FHMA 1VQPS 4DR4K 1U1LA 2QYGA 4ECYA 1IO2A 2PMZD 4OVLA 3NGTA 3WX4A 2NRTA 3QFUA 3O1LA 1RT3A 3CJKB 1RAAB 3P83D 3CT9A 1LV5A 5AQXA 1Q81T 2KFNA 3GE1A 3R8YA 2P9SB 2CJAA 4DR5F 2BW2A 4CVNE 1HYVA 3AARA 4OV6A 3CCMS 1U2VB 1XHXA 5A8KB 1YVNA 5EHHA 4DR7J 4KE5A 3TAPA 4Y2KA 2HBYB 4ETZA 4JI8F 3BF3A 2HOEA 5CZ1A 1VQ9S 4BVOA 5IZHA 2KM8B 4AH9A 3QYYA 4P7VA 1IKXA 3NF6A 3OFGA 3NAEA 5EWEA 2Z1IA 2QGFB 2ZF5O 4X4VA 3EVMA 3IXQA 3DRRB 4J9KA 3M9NB 3BGLA 3SCJE 2FHOB 4NX9A 2M9KA 4ECSA 1HD0A 1RSCA 5A8WA 1XN9A 3GBTA 2LQBA 3ISNC 2QL9B 1VC5A 1BOTO 4Y2MA 2NUBA 1N8RT 3ZZ0A 1M1KT 2QE5A 3PY8A 3ZSVA 2E44A 3LP1A 4DV5J 4GKJJ 1FWPA 2HLUA 1VBKA 3BGRB 2C2EA 1PIEA 2DGWA 1J5OA 2Y8WA 2HLTA 4EHTA 4WTYA 1BL3A 4YOEA 1RP5A 2YH0A 1UZDA 2F1FA 1IR0A 2EXUA 3FQLA 4O0NA 2MZSA 5AZJA 2VFSA 3NEKA 2OFHX 3PG9A 4PR6A 3QT5A 5AQZA 2YNFB 1RA7A 3N0VA 2MZJA 1K44A 5FLXU 4B3SK 3HDSA 4WZMA 2MY7A 3TTCA 3ITHA 3R3TA 2U1AA 2HNYB 3P8BB 3K8VA 1T9WA 1Y10A 3NVKA 2Y1RI 1SC3B 2Q2RA 2W2MP 3H4BA 1KVIA 3IRXB 4H5RA 3SV4A 4J9SA 4NZ7A 4Y1CA 4YOXA 2OIHA 2W4PA 1EWRA 2QWMA 3CB4A 4ZVPB 1UPMB 4K4VA 3L8BA 2LKZA 2ZQBA 2E5GA 2ROEA 1VYAA 2E7VA 3UR0A 1HI8A 5IV4A 2OGUA 1GOAA 5T7LA 2C2OB 3V1QA 5B09A 2A6MA 3GFYA 4LRCA 2HFUA 3DLLQ 1PG5B 4DSEA 5F8NA 3AODA 3KJNB 1OH8A 2WVDA 1XWLA 2RKIA 1DBDA 1FK9A 3QNNA 4I9QA 2E5JA 4CGDA 2E2PA 2GWKA 2HIYA 5LOQA 1YAGA 2ITGA 3U9DA 5C42A 5KFXA 1Q9YA 3P39A 1YF5L 1C4AA 2VF3A 3CC4N 1IBLJ 5AE2A 2CQ3A 1S12A 3OUYB 2L9NA 4JI6K 2IVFB 2O8CA 1HARA 3JB9k 3CSKA 1RDBA 4JKDA 2LSNA 1NUEA 1N33K 4QPTA 5DZ6A 2X6SA 4JV0A 4ZTJA 4DV0K 4O3NA 4LT6A 2KFYA 2ZJQL 1CZ9A 2V9KA 4YUDA 2WB4A 3RBEA 3BO2A 5FDLA 3IR6B 4MFBB 1K8AO 4UTGA 3M32B 4M5LA 4NRTA 1TFWA 2D1KA 2YHAA 3BKTA 2E5IA 1ASVA 1NM1A 3WT0A 5FIIA 5GAHP 3Q8YA 1TMJA 4AFFA 2BQ3A 5A6PA 4LF9F 3MUTP 3VALA 2PZSA 2M5YA 2FJEB 2OTLS 2Q66A 1J5EK 3V6JA 1R8AA 1IG8A 1VQ5N 4B9QA 2QWQA 1RWWB 4PPDA 2HBZB 2YQ1A 2ZH6A 3FZKA 3HSGA 1Q95G 4IWVA 1VQNS 2ZGZA 2OHDA 1NPPA 2I5JA 2LU2A 2O3DA 4B9LA 1FJ7A 3O2IA 3FGUA 4C23A 4DV2J 3IG1B 5GAGU 2MQ8A 3I9ZA 2DNNA 3LPUA 2W9CB 5D77A 2V34A 2R9LA 3GG1A 1VQ8S 2BOPA 4F4XA 3AOCA 4RW6A 2D0CA 2MQNA 2AIRB 2RRNA 4CIOA 3RVCA 5BYQA 8ATCB 2BJDA 2CADA 1WTBA 5J2MA 4EFHA 1NMEB 2PSZA 4RW9B 3PJXA 3HULA 2HHWA 4U8YA 4QQBA 3SDEA 1PAEX 4P71A 3OYNA 2BJ8A 1SKWA 4QWAA 1B3TA 5FDLB 3T1HK 4IH7A 1QJHA 4K42A 4I2PB 2XHCA 5DGBA 4Y0FA 2UUCF 2BUNA 2P5VA 1XMQK 4FJGA 4W5RA 1XMBA 1HBUA 4J9QA 3TO8A 1S72N 4J2BA 4NRUA 3ZX0A 1DTQB 3KUEA 2D3ZA 3C3LA 4K0KJ 3C7NA 3WNFA 1UEVA 3T19A 4FWKA 1WKLA 3LAKA 3KD5E 4PQUA 1C1AA 2ASLA 3EUNA 1JMTA 4JI5J 2HHVA 3GILA 4JV1A 1YJUA 2PIIA 3O6QA 2WK4A 3RB4A 4GV9A 1HHQA 4HHHA 2NSCA 4L8RB 3HFVA 4CTAB 1AYEA 3K2PA 3IWXA 1TKZB 2RHSB 3VEZA 1X4FA 3IS9B 3CC7S 1MLAA 3A1YG 1B9DA 3HYFA 5H9EK 4BLGA 3ZO7A 4LF8F 4BGAA 3DWLA 1APSA 2N82B 3DXSX 4NLRA 1S1XB 3UDCA 1IKWA 3L6QA 3G4SS 4A8KA 3TAGA 4J9RA 3OLBA 2KTQA 4JK9A 3BGFA 4D3GA 4JHDA 4DTPA 1NMNA 1WSHA 3L0QA 3JXOA 1HW9A 3T3FA 2UXDK 4J2AA 2P9SA 1X8DA 4IH5A 1RBLA 3HZEA 4DXLA 1N34K 4YS2A 4JEPA 1KRPA 4H0TB 4MIBA 4NWBA 3HOTA 4H4OB 1KP6A 2QWLA 5A2QU 3MWTA 3GONA 4FOEA 3BF1A 2COLA 3RZAA 1YSJA 3OS2A 1YX2A 3P4UB 5KT5A 2RE2A 4GVLA 4I7FB 3OV7A 1RA6A 3TJ8A 4EMDA 3C15B 2K8GA 4J8FA 3U7JA 3D2FA 2HQ3A 2IVYA 1RT4A 4U67Q 2A1BA 2DGOA 5J1PA 1DAXA 3DAWA 4UZCA 1I1GA 3ZSQA 4YOTA 4FP9A 4TSXA 1VQ4N 4I1TA 4M3YA 3CPEA 3RRKA 2UVWA 3HT3A 2F40A 2X7IA 3GJSB 1W0HA 2VG6B 1RDWX 3THWB 4IR9A 3SQGA 3ADAC 1M5PC 4F4WA 1ZZFA 1UJ5A 4GV6A 2VKZG 2XTJP 3GE9A 3OTCA 2J6UA 5CD4H 3C65A 3MPVA 1HR0J 2GX8A 5EXWA 4E3SA 3MCSA 3QT7A 2GA7A 4MYUA 1SQFA 2GIQA 3D0HE 5HOOA 2WBRA 2HVIA 1KHVA 2ZM6F 1ZM9A 3K59A 3AOBA 3LW5C 1WOQA 2YI1A 2Z0GA 1VQSA 4FBTA 5KGWA 5DM6L 2BX6A 4RNHA 1CQNA 4ITSA 5I9EB 3LALA 2BRLA 1FHTA 4F0HA 4WFAQ 3L3VA 4LH4A 1OPZA 4W5TA 4YDUC 3CFRA 2J7WA 1OH6A 1CJTA 4BCAA 4FXDA 2EPIA 1SZ2A 1Z25A 4OJ3A 3CE8A 3SFGA 1URRA 1YG0A 2OPSB 3MCPA 4DV4J 1WF1A 1KKHA 1IJFB 5F3ZA 5D0EA 3MAAB 3CYMA 3VQ8A 1GOBA 4NCAA 3EE3A 4ANDA 3QIPA 2O8DA 1M0SA 3O4QA 5AQJA 1ILYA 2HVZA 4NYFA 1N54B 2FBYA 3U6FA 5ETNA 2KVIA 2XMKA 5KG0A 1I94J 4LBHA 5IQQA 1IWGA 4G65A 1N32F 2AKWB 1EQ0A 5A8RB 3DM2B 2W9BB 2O8FB 3G6YA 1RFQA 3ET6B 1S1TB 3PYFA 4FKXA 3ENAA 4M5NA 2ILYA 4P6QA 3QIDA 4QS9A 1RHMB 3L4IA 5B7WA 1MMNA 1YT3A 1OMSA 4DCPB 4Y65A 2MTLA 3VAHA 3UKRA 4CHYA 4IYQA 5AR0A 3SQ1A 4LF4F 3C46A 1QVFM 1YBTA 2QWOA 1DQAA 1F1BB 4FM2A 1UEKA 3ZSXA 1RTJA 3TZWA 2LP4A 1VFJA 2FSNA 4AQYK 3MEDA 4I69A 1H2VZ 2NRXA 4CGHA 3IRXA 2W4DA 2RSQA 2UU9K 2J7UA 5CR4A 3MTKA 3A4TA 1OQ3A 4LR8A 4QJVA 3NFAA 4BE0A 4ZPAA 2EK6A 3G6ES 3DYAA 1RLCL 5I3QA 4ZCMA 1M5KC 3W5XA 4OPHA 4DX7A 4CBXA 4NLTA 3I8BA 4I56A 1PC4A 2Y3YA 3K7RA 2JFKA 2V69A 1UP1A 4YB5A 3SCIE 3I0SA 2PMHA 1NPRA 2BRKA 1FK9B 3PM9A 4HT7A 1RWOB 5AFUH 4DV4K 3M8QA 4FYDA 2CQ0A 5GAHU 4F36A 3BY5A 3FQKA 3HLUA 2E1AA 3UR3C 3ENVA 2LDYA 1VRTA 2G13A 3W66A 1A7GE 1QUPA 3LP2B 2XS2A 1JXBA 3I0SB 3PRBA 4CO4A 1VJWA 2QEXS 1UVKA 2XNQA 4FZYA 2OJ3A 2GVDA 3GIIA 2P5OA 3ILLA 4J5OA 2IRUA 3HP9A 3I82A 1E6VA 5B0EA 1F21A 2F63A 3QERA 1K8KB 2VC0A 3EICA 2QL5B 4URQU 5FRMA 4E7LA 3R27A 1OVQA 4LSLA 1NGIA 2JC1A 1JJ2R 4DL7A 2V63A 4CLYA 1E6VB 1FE0A 1NRKA 2P9NB 1RKJA 3CWJA 4KIAA 5KFTA 3TA1A 2Y0BB 3G71S 3HSZA 4Q8EA 2CPYA 4U7CA 5K5MA 3BEXA 2B4JA 5IFMA 2E9TA 1IBMK 3BPSP 4Y2CA 3KYLA 1RGVA 3T5LA 2DFHA 2I7NA 1BI4A 1U6BA 1YJ7A 2GMLA 2I9SA 1RBTA 3RG6A 1QE1A 5JVGQ 4JYAJ 3QNWB 1O0PA 4ECUA 2ROGA 2XWXA 2MY8A 1RTHB 3V6DA 1TV6B 4H4MB 4C8MA 3LQVA 3I9V9 2C2ZB 1VQNN 3HKWA 3ZT1A 5GADI 3MM9A 1Y3KA 3S01A 4Z4HA 3QBWA 3NNCA 2FBXA 2BJ9A 2O66A 1HWJA 3ULHA 4JI1F 4DL3A 2CKWA 5J2PA 5ETKA 4C9DA 5LJ3Y 1WWHA 2EKYA 2YWHA 5GAHI 2RRAA 4B1WB 4RBUA 3I5BA 4DCHA 3US5A 2YKQA 3NOGA 1AUSL 2G1DA 3EKUA 4BQZA 2HGNA 4CYUB 2FXUA 2JJ4D 3I56N 5IC6B 5KPZA 2ZH9A 1KQSR 1XNQF 1HA1A 2UVRA 1Z4UA 3DRXA 2XZTB 4IG0A 3T1HF 1K6YA 4A57A 4DV7K 1VQLN 2C3OA 1HMVA 2F7VA 3BEGB 2W40A 1WSRA 3MFIA 2E1CA 4HUFA 2BACA 1S7HA 2E5HA 3GIMA 1VBYA 1O8BA 4DR3F 2DEJA 4FJKA 4QWEA 4CLTA 1JLCA 4ED6A 3KDOA 3GJQB 2V7YA 1IJEB 2JX2A 4ES1A 3BPDA 1REGX 3VF6A 4F50A 1WSEA 3CCUS 3GTYX 4QWDA 1EZZB 4IOXA 3OTOK 3GG4A 4FWRA 1VLOA 5DQIA 3EVWA 2YHBA 1N5TA 3I55N 1RWVB 2IC3B 3B4DA 1KXPA 5LXYA 3TX8A 4CRJA 3BGOP 4L75A 2KL8A 2DNZA 2VASA 4RW9A 3O8MA 4GMKA 2L9WA 1S5JA 3CC7N 4I6AA 4KHYA 3WIUA 2WB1D 3FSXA 1VI7A 3QRRA 1GX5A 4WYWA 3G8QA 3X1LB 3CXCM 1RAGB 4WKYA 4DQIA 5AQNA 4CJFA 1WELA 3BS9A 4JD2B 4JYAF 4ANEA 3B82A 2BE2A 3IC1A 3JXUA 1HIYA 2A42A 2J76E 5K9FA 3D1QA 2VFRA 4TYAA 4FZVA 4ED1A 4BRAA 5AE3A 1HKCA 3EO3A 5GMEA 1VBZA 2E6MA 1IJJA 1Q53A 3P38A 1V9OA 1MWKA 4C8LA 2F4FA 1H3DA 3R1HA 3RBXA 3L7PA 5E3RA 1VQMN 2R8HA 3CCQS 4DSJA 5HAOA 2XY5A 1PILA 2O1PA 4DUTA 2KJVA 1Q79A 4IFEA 3OR1B 3FMWA 2G8HA 3ASMA 4BQLA 1DY3A 2FIUA 2J6SA 4IXCA 3H2LA 4M3UA 1GX6A 3MXHP 4C4WA 4J9MA 3QT6A 2HSEB 3AGKA 3Q8QB 1DRZA 2PFFB 1WEYA 3OR1A 4TU7A 4LF5J 2Z1HA 3S41A 2CIMA 3A2FA 2BKPA 2OTJS 2OA8A 5KFCA 5E7OB 4NE9C 3PO5A 3SMZA 3GIJA 5CZXA 4BE1A 2G0IA 3HJVA 4DR3K 3LZJA 1FRIA 1KWMA 2CJQA 2B7BB 3R5JB 1QD1A 3HM8A 2GQCA 2CJKA 2OMLA 4K8RA 4DR4J 4DV6F 5IM0A 3O4WA 3AXMA 5C24B 3HVTB 4KGZB 4CZLA 2B0GA 1Q0NA 3OBWA 3KNAA 1D3WA 3AQOA 3U8XA 2H5JB 2FZKB 2VBYA 3TVZA 4WPAA 3H25A 4CZIA 4ECXA 1JLGB 4DQ8A 2Z2ZA 2MLXA 1BO5O 4MH8A 3D9BA 3M6VA 1QAIA 2YHWA 3G6VA 4XPCA 2CJ9A 2M3DA 4WFBQ 4CIFA 3V9SA 4FBUA 2GS8A 3Q83A 1S4FA 4C11B 4E1JA 3ONQA 4CDIA 5CZ2A 1IKYA 3DLKA 5GMDA 2CQGA 3JAMO 2G8FA 3M30B 5JJBA 2QRRA 2CVIA 1R31A 3DXBA 2R7TA 3QESA 3D3CJ 2OCEA 3I31A 3PW4A 2AJ4A 2CQHA 2GAHC 5M2UA 5LXRA 3OTOJ 4GVEA 4HVJA 4YDXA 3WQTA 3IAS9 2KLAA 1O5JA 3M3ZA 3EL2A 4CEEA 4JK7A 5H9FJ 4Y0WA 4PWWA 4CEDA 2L41A 5IT9O 2QA4N 2CQ4A 2B4PA 1WNEA 3TOQA 4ZITA 3TW0A 5C2GA 1VAZA 3K0SA 3X3UA 3LA0A 2UUBK 4IDKB 3HXMA 1FXLA 3ENOA 2OEJA 1VQ9N 1GLFO 1NLVA 3QMQA 1J5OB 2XYPB 2W1BA 2ALYB 2KKZA 3MN6A 4BR0A 1CXQA 5HATA 2GHVC 3HFKA 4K4YA 1G99A 3KWGA 2FY8A 3N4QA 3H45C 1HR0F 1NBWA 4DEZA 2CH6A 3F2KA 1V3RA 4DU1A 4AL7A 4FJIA 2DHSA 4HACA 4ZJQA 2AGQA 4WKRA 1R89A 2NXEA 1WSGA 1WNSA 3KOAA 4IRDA 1S1VB 4PXCA 4FJ7A 3U4LA 1Q8KA 1O1WA 5F9NA 3GL1A 2LDIA 1JLAB 1KHWA 4OX8A 1CJVA 3EM1A 1U1QA 2HQDA 1TYQB 2UXDF 2DNYA 4Q43A 4BRPA 2DGQA 1RLDA 3KZBA 2LQ8A 5AT1B 1F9FA 5LSOA 2ZOMA 3O1BA 1D9AA 1JLCB 2BQUA 1GXUA 2YJFA 4FWQA 2AU0A 3DDIA 5KGXA 3OTDA 4CF2A 4LFBF 2YCHA 4LRAA 4UOCA 1K9MT 1QLNA 3IA0A 1KVCA 2OEMA 3CG7A 3T9ZA 5L39A 1FRKA 4HH1A 3Q24A 5KFMA 3GSIA