2WONA

Crystal structure of uk-453061 bound to hiv-1 reverse transcriptase (wild-type).
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Lersivirine: A Non-Nucleoside Reverse Transcriptase Inhibitor with Activity Against Drug- Resistant Human Immunodeficiency Virus-1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2wonA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wonA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wonA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wonA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2wonA05
2E9ZA 3OVNA 4ECVA 5HLFA 3KLEB 4RUAA 4ZP6A 4W5QA 1RTDB 4IG0A 2IC3B 4TLRA 4O3NA 4GC7A 1CLQA 4N76A 3DM2B 2G8KA 4FK4A 4K4ZA 2OPRA 3C6UB 1L3UA 4FJGA 5HROA 2RPIA 1KHVA 5EWGA 2XCPA 1I39A 4Q5VA 1JLCA 1WSHA 4J9KA 3TARA 3ISND 3M8PB 3RMBA 5DQGA 3IN5A 1EETB 2OPPA 3HYFA 2WOMA 2VWJA 4AHUA 5DLFA 1BISA 5J2MB 2W8KA 1TKXA 3HO1A 1HPZB 2Z1IA 4FM2A 3VQ6A 3OLBA 4DLEA 4DQRA 4FJ7A 3KK1B 2XC9A 1KLNA 3BQ2A 3QGIA 2P5OA 3H4BA 4WYLA 3ZT0A 2F8SA 3O3GA 1DLOA 3SFGA 1IKXA 2HHXA 3ZT2A 4IH5A 3QGGA 3V1OA 4RW4B 3DOLA 5C24B 1C1BA 5DLGA 3MEGB 3WNHA 5KFCA 4TSXA 2HMIB 4B3OA 3OYDA 3I0RB 1XR5A 1HYVA 3LP2A 4H4OA 1MU2B 1DTTA 4KRFA 4DL4A 1ZBFA 3MEDB 4K4TA 3NAHA 1A5WA 4CF9A 3OL6A 2IAJA 4WFXA 1K1QA 3OYNA 3KHLA 3MR3A 4FBTA 5F8NA 1NJYA 4O4RA 4KFBB 4KHSA 5L9XA 4Q8EA 2C22A 1TL3B 4EP5A 5KFOA 5D3GB 1SV5B 1J53A 3OYGA 4Q0BB 5HBMA 3CWJA 4Q8FA 2ASJA 1FK9B 3KLHA 4BDPA 4NYFA 4H4MA 1VSKA 5I3UA 4RG8A 4CHQA 4CK3A 2KZMA 2UVRA 3HKWA 1HQUA 4RUCA 3OHAA 3TAMA 1LW2A 4CJPA 4DLGA 4MIBA 4KI4A 4LSLA 1N56A 1WSGA 1S5JA 1LWEA 1J9AA 3TWHA 3DLKA 5KG1A 4B9NA 4KAIA 1Q9XA 4ED6A 1GX5A 3BSOA 1S0NA 3RMDA 1NK7A 4CESA 2ZKUA 3DRSA 2ZE2A 4RNOA 1NK0A 3SUPA 3LAMA 4MK7A 5HRPA 2D0CA 3KLFA 2G8FA 4MIAA 1Q9YA 4XPEA 2KQ2A 2W9CA 3Q8QB 2IA6A 3NMAA 2FVCA 4IRDA 1RBRA 4BACA 1TVRA 1Y97A 2R2TA 4PUOA 1JLAB 3L2RA 4I9LA 3KHHA 3TAGA 4WXOA 2BQ3A 4ECZA 1TK5A 2HNYB 2YNFB 2FLPA 2F96A 3AO5A 3A2FA 1D0EA 4RNMA 3O3HA 4O0JA 4FM1A 3SUQA 2I1RA 5CY4A 3IS9B 5CZ2A 4FJXA 3SQ1A 3KJVA 4DMNA 4Z4IA 4LH5A 2R2SA 3OSNA 4ED1A 1D8YA 1HNVB 1HYSA 4FLXA 4KKOB 1RT1A 4OL8A 4Q45A 3DRPA 3V4IA 3V6HA 4KTZA 4M3TA 4ZTJA 2PY5A 1EP4A 4MK8A 3VQEA 2RDJA 2HW3A 2ASLA 3D0PA 2KW4A 4IRCA 4YP3A 4DSKA 1U49A 4AH9A 4QAGA 3RRHA 4ECUA 3EYZA 4QW9A 4URSA 4FM0A 4KTQA 3HSTB 4JS4A 3LP3A 4FK0A 1YT3A 2YNGB 3ITHB 3MR2A 4IRKA 5KFNA 4E7IA 4CIEA 2IS3A 5FROA 2BGGA 4ELTA 1S1TA 1BQNA 3AA2A 1RTIB 3PO4A 3QIPA 1N4LA 1N6QA 4FLYA 1EXQA 1LAWA 3G10A 5DMRA 4KHWA 3Q8SB 1C1AA 3KK3B 4M3WA 4I2PA 3DLHA 1FKPA 1N5YB 1JLQB 4NCBA 2G8UA 1IKWB 2CKWA 4Y1DA 3LANA 4DG1A 3SUNA 2FBVA 3QIOA 3CFPA 4HHTA 3UQSA 1EX4A 2WCXA 4NYZA 3AVNA 4B9SA 2W8LA 2BR0A 2Z1JA 4Q43A 4CJKA 3AA5X 3NCIA 2XCAA 4NLYA 4FJ9A 4DWIA 4F4ZA 4FLVA 3ASMA 1RT4B 4CEBA 4FW1A 2IJFA 3AA3A 4NLDA 1J5OB 2Z1GA 3OY9A 3LP1B 1IO2A 4KAZA 3ALYA 5KT7A 4NRUA 1KRPA 2VG7A 1Z26A 4I2QA 1G15A 1RDAA 1IKVB 2I5JB 4BE1A 3SV3A 1HJRA 3KMQA 2OZSA 4TY8B 4DS5A 2V4RA 4DTXA 5KFQA 3PZPA 1KSPA 3NH1A 4YR0A 4RW6A 2OPSA 4R8UA 5KFUA 4EO8A 2ASDA 5CYMA 2ETJA 5HLFB 4IG0B 3KK2A 4F2SA 4Y2AA 4CJVA 4J2AA 3EPIA 3I0SA 1ZETA 2OPRB 4KTWA 4IDKA 1JLEA 5HROB 3HP9A 3VA0A 1NKCA 2JEJA 3LZIA 3L3UA 1S0MA 1WSEA 4J9MA 1S1XA 3LALA 2OPPB 1ASWA 3PW4A 2WOMB 3V9WA 2VG5A 3V81A 2XWYA 3OYAA 5KG7A 4O44A 1ASUA 4DEZA 5CYQA 2YKNA 4QCLA 4EBEA 4CEDA 2R7YA 1KCFA 1JLGA 2P51A 1RTHA 1S1WA 4LH4A 1BGXT 3HXMA 1DLOB 1IKXB 2BRLA 2IJNA 3T5JA 4XO0A 3NHGA 1T03A 1RT6B 4ZP9A 1C1BB 4O4GA 3K58A 3ZSXA 1ASVA 1A5VA 3TI0A 3T5HA 1S1VA 3PY8A 3O3FA 4B3OB 1QQCA 1BCOA 4DFPA 3SZ2A 5KG4A 4FK2A 4FJMA 2HHTA 2XY8A 2A1RA 3LP2B 3E01A 4H4OB 3KLIA 1DTTB 3BSAA 3UDLA 2OYQA 3V1RA 1NJXA 5J2QA 4KHQA 1RDRA 1KTQA 3ZSYA 1S9GA 3IG1A 3CM5A 1BI4B 3I5CA 4C8OA 4J2DA 4NLGA 1SUQB 4F4YA 3DRRA 4K8XA 1GOAA 1ZBUA 4ICLA 4DFMA 4FJNA 4C8NA 3KNAA 4O5BA 4O55A 2P1JA 2RF2A 3KIOA 4N41A 4DQQA 2EHGA 4ID1A 4WXWA 1LAVA 2BE2A 2IGIA 5HP1A 2IM3A 4ELVA 3RR7A 2FJXA 5HBMB 1TL1B 5KFHA 2X74A 4NLTA 2J6TA 3KLHB 4FJ8A 4H4MB 1TKTA 2D3ZA 4RNFA 3RBEA 4FVMA 2VG6A 1BL3A 3HHKA 4HUGA 5DGBA 1HQUB 4F4KA 3VQQA 2XRIA 4E19A 3TAMB 1LW2B 1WN7A 4LSLB 3GIKA 3ZCMA 4IR1A 4QWAA 3JSMA 3BGRB 2FJWA 1BIZA 1LWEB 1UAXA 3QLHB 2JGUA 1RAJA 2QE5A 3NBPA 1NJWA 3PX6A 3DLRA 4JUZA 3HP6A 1U47A 3QERA 1NOZA 4IBNA 3N6LA 4H8KA 3DRSB 2WTFA 3M9MB 1TAQA 4CFAA 4LQ9A 3IGVA 3ZT4A 3K5OA 3HVAA 5KFZA 2X78A 2C2RA 1JLBA 2FVQA 4Q44A 1RDDA 5HRRA 5KFYA 1K6YA 5KG3A 5DK5A 3TAFA 3V6KA 4RW9B 1TVRB 4PUOB 4E3SA 1RA7A 3NGDA 1T05A 4CJ3A 1QHTA 4K8ZA 3CYMA 3VQCA 1BCMA 3WNFA 3L2QA 1JKHB 4K50A 4G1QA 1X9WA 1WNSA 3P5JA 4CF2A 4EZ9A 1C2PA 1YTAA 4FS1A 1TK8A 2G8IA 3OYJA 4DQIA 1JL1A 4NLXA 4KV8A 4OKKA 4QWBA 1FKOA 2ATQA 2F8EX 4CK1A 3KJVB 2BDPA 3LZJA 4ZPCA 1RT2A 5KFSA 4CHZA 5KFBA 1C1CA 1HYSB 3H98A 1RT1B 3L8BA 3DRPB 1R0AA 3ICLA 2IBKA 1S1UB 1RDBA 4CCHA 1EP4B 3V6JA 3OYEA 1RNHA 5J2NA 4FLZA 3VN5A 1L3TA 4ZVHA 3NF7A 3IAYA 4CHOA 4WE1A 4CJFA 4I7FA 2OPQB 5JS1A 4ZPBA 2E6LA 2Q3SA 2HAIA 3AO4A 4Z0UA 4FJJA 1L5UA 1A5XA 1S1TB 1BQNB 2R8GA 1N6QB 2X6NA 3VA3A 3VQ7A 4CJRA 4AHCA 4QPXA 3VQSA 4OVLA 1QSLA 3BR9A 2XY7A 3S9HA 4TQRA 1BQMB 5KFAA 3GIJA 4E1NA 4I2PB 4C8KA 5KT5A 1FKPB 1WSIA 3DOKA 3JYTA 3QESA 4PQUA 3RB0A 3QEPA 5KT4A 3SQ0A 3RRGA 1SKSA 1NHUA 5KT2A 3LPTA 2O4IA 2FBXA 4WFYA 2Z1HA 4E7KA 3LP0A 2R8HA 4ZMMA 5FDLA 2DFEA 4O0IA 4DTSA 1S6PA 2FBTA 1LWCA 1QE1A 5J2PA 3WNGA 3DLGA 4ZP8A 4AHTA 1D9FA 1YVUA 4J9QA 2FVSA 3B6OA 3NF8A 3UR0A 3NF9A 4M94A 4M42A 3GYNA 4RW8B 4AHRA 4ECYA 3ZT1A 1X9SA 4IQXA 2JLEA 5HRSA 5J1EA 1XR7A 3V9XA 4BWJA 2WB4A 3G86A 3OS0A 3OHBA 1IG9A 3AVGA 1S9EA 3M8QB 3QIDA 3H40A 2OPSB 1RTJA 3KOAA 5CYMB 4CJEA 1XHZA 2A1SA 4YR3A 4KHRA 3H08A 3S3OA 2DPJA 2OZMA 1WSFA 3I0SB 3HVTA 2JEFA 4J9NA 2ALZA 5F8IA 4IDKB 1JLEB 1T8EA 1VSDA 1KLMA 4JLHA 3VQAA 4CIFA 3QNOA 4KB1A 2BANA 2HNZA 4CF0A 4DL2A 4CGGA 4DTNA 3AVKA 2GIRA 4LD0A 1S1XB 1YTUA 3H5YA 4GVMA 1TAUA 2J6SA 3HM9A 3QO9B 4W5NA 2VG5B 3V81B 5E41A 2D0AA 3KD1E 4J9SA 5CYQB 2VA3A 3DMJA 3O4NA 3D5MA 4M41A 1JLGB 4ED3A 2ILZA 4HTUA 2AWZA 5KG2A 3QZ7A 1WSJA 1S1WB 3HPOA 1TGOA 1U09A 1GOCA 4OLBA 1HMVA 4CERA 3AO3A 5KFLA 4ED0A 4CHNA 1T03B 4O4GB 2FBYA 3K5NA 4KB0A 2YHAA 1WLJA 1LWFB 3L2VA 2X6SA 3M8RA 5F8GA 5KGWA 1S1VB 4FW2A 3NH2A 1VRUA 1XR6A 1MMLA 3E01B 3KLIB 1X1PA 1CZBA 4CECA 3G6VA 5J2QB 2WHOA 3THVA 5EWEA 3PW0A 4EYIB 4KHNA 1S9GB 4EP4A 1D5AA 1WAFA 4JRPA 2IMWP 1CXQA 2R8JA 3TQ1A 1NK8A 5C42A 2AQ4A 1I3AA 4ID5B 3T19A 3CJ0A 5KI6A 4ICLB 3AVJA 1TV6A 5DQIA 3KLEA 4B9TA 1RTDA 2IC3A 5JXSA 5KFEA 4DTUA 4HCCA 2HNDA 2RF2B 4F3TA 3C6UA 2BE2B 3CFOA 5HP1B 4OPKA 1DTQA 2DFHA 3RWUA 4J9RA 4OGEA 3KMSA 4FZZA 3FQKA 3ZSRA 1TK0A 3GV7B 2YKMB 2F8TA 3K2PA 2VG6B 5DG7A 1EETA 2D3UA 3LWMA 1CZ9A 3EZUA 4URGA 4WFZA 3GQCA 2D0BA 2R2RA 4LSNA 5J2MA 2W9BA 3JSMB 4CEEA 4CEZA 4L8RB 3N6MA 4NRTA 2GC8A 2V0NA 1T94A 3CDUA 3BSNA 3KK1A 4CGJA 3ZSZA 3NBPB 4HVJA 2JEIA 3OYMA 4RW7A 3C95A 4KSEB 3DLBA 4FJHA 2QKBA 3AO1A 4Y2CA 4EBCA 2BQUA 1U45A 1QAJA 1KVAA 1ZBIA 1EKEA 2KFZA 4CIGA 4F8RA 5T14A 3K5MA 4JV0A 1KFDA 4CFDA 3D45A 1VSFA 1RT5B 5KG0A 3QEIA 2HWIA 1JLBB 2E6MA 3I0RA 1ZTTA 2GIQA 4FLUA 3DI6A 5F9LA 1MU2A 4F4WA 5DG9A 3AVAA 3MEDA 1D1UA 1T05B 1RA6A 4YNQA 4OPJA 3SJJA 3DYAB 4TXSA 4PA1A 4E7HA 3OS2A 1S4FA 4O3OA 5DQHA 4G1QB 4KFBA 1XI1A 5I42B 2WONB 3FQLA 1U48A 4FJ5A 1HNIA 3UIQA 4KV8B 2HVIA 4M3RA 3QINA 3GIMA 3B6PA 4IKAA 3QNNA 3S3NA 4K4WA 2QV6A 4C8MA 3IGNA 3AVMA 4U6PA 4Q0BA 1RT2B 4R5PA 3V6DA 4KB7A 4FJKA 4DTRA 3NFAA 1C1CB 4FBUA 1O1WA 1R0AB 4RNHA 4TQSA 1N48A 3OLAA 1JLCB 5J2NB 3NH0A 3EZ5A 4YQWA 4RU9A 4DF8A 3QETA 3KHGA 2HB5A 4ZPDA 4HUFA 4DU4A 3U3YA 5KRTA 4N47A 3RTVA 1X9MA 2VWKA 5C25A 4NCGA 1TKXB 1QAIA 4B9VA 4CJWA 3RR8A 3L3VA 3RB6A 3PW7A 3SI6A 1SL1A 2OA8A 2JEGA 4LY7A 4FS2A 4M3XA 1UA1A 3F73A 4KREA 4JRQA 3OYHA 4NLVA 5KFJA 4OGCA 3I5AA 1XWLA 2D5RA 4N56A 1U4BA 5EDWA 3DOLB 4MKAA 3DOKB 4URQU 1VSIA 3JYTB 2FVPA 2AGOA 4TYBA 4DL6A 4B08A 1WNEA 4AHVA 3OYFA 4B9MA 5F9NA 5DGAA 3ZSQA 1CSJA 3IRXA 2YNFA 2ZD1A 2W9AA 4M95A 2IAJB 3KHRA 2EX3A 1KHWA 3OYLA 3BQ1A 2B5JA 4CGFA 3K57A 3PR5B 3V9UA 2FLLA 4CJLA 3F9KA 1QE1B 3TVKA 5J2PB 1REVA 2RDIA 3PW5A 3IS9A 5F8LA 2C2DA 2Y1IA 3QEXA 4ECQA 4BWMA 5F8HA 1SKRA 4KE5A 4B9UA 5F8JA 4H54A 4MK9A 4CEOA 3NGZA 1NNDA 2B6AA 4C8LA 4O3SA 1BHLA 1L3VA 4B8CA 2R2UA 3TR8A 5KFWA 5KG6A 3GV8B 5I3UB 1S9EB 4KI6A 4DTJA 3I5BA 4QWEA 5T7BA 4AHSA 3TABA 3SPYA 3AVLA 3GV5B 5JUMA 4CK2A 1JLFA 4WZMA 5KFXA 2UUTA 3M9NB 5K14A 4ELUA 3MR5A 2YNHA 4O3PA 3MXIA 2GBZA 1KLMB 2IM2A 3ITHA 3RBDA 3DLKB 3G6YA 4PY5A 4DTMA 4F4XA 2HNZB 1NK6A 2W42A 4FJIA 2D7SA 2O4GA 3AVFA 1NJZA 5KFKA 3RAXA 3KK3A 1HARA 4MKBA 2B4JA 2ZE2B 2RKIA 1N5YA 4CE9A 1UWBA 4NLSA 1VK0A 3SQ4A 3MECA 4IFVA 4DSEA 3KLFB 3O4QA 3KLVA 3LWLA 2W9CB 3CM6A 3HVWA 4IKFA 1S97A 3Q8RB 1S6QA 4J9PA 1C6VA 4EO6A 4CEAA 4E1MA 2HVHA 1ZYQA 5L1KA 3VQ9A 1HMVB 4ED2A 3T1AA 3H59A 1RT4A 3VQPA 3FFIA 5HRNA 3LP1A 2XO7A 3SI8A 2KZZA 2WK4A 4F2RA 3NL0A 4Z4CA 1IKVA 1VRUB 5SZTA 4HUEA 2HHSA 5FRMA 1VSJA 4DFKA 1SH3A 3CDWA 1QUVA 2QXFA 4WYWA 4CHPA 3C6TA 1QSYA 4TY8A 1S48A 1VRTA 1W0HA 5C42B 3V4IB 2ZQBA 4DTOA 1S49A 1LV5A 1TV6B 4NLOA 2C2EA 2HNDB 3DDKA 3NF6A 3NE6A 2IDOA 4ZVGA 1JXEA 4GW6A 2DPIA 1DTQB 3KLGA 3T3FA 1RT3A 1NOYA 4F3OA 4IH7A 3P83D 3M8SA 2FJVA 3QGHA 3MR6A 4NLUA 3BJYA 2R8IA 3QIPB 1HQEA 1B9DA 1LW0A 4K4SA 2W9BB 4LSNB 3CQ8A 4CGHA 3PJWA 5CZ1A 3BSCA 4ZPAA 4E7JA 3M9OB 2UVWA 4M3UA 2UVVA 5KFGA 2HHQA 3G6XA 2QK9A 4DG1B 3GIIA 4ECTA 2AGPA 4RW7B 4G3IA 2PYLA 3VQDA 3H2LA 3MFIA 1WAJA 2G8HA 1ZTWA 2XHBA 3GILA 4TN2A 2KTQA 1RCHA 1RT6A 2RN2A 4ECWA 1NK9A 1Q8IA 2GV9A 3AVBA 1C0UA 1VSEA 1VSHA 2XGPA 4OKJA 3KD5E 5KT6A 3H5UA 4J9OA 3G0ZA 3PUFA 1TKZA 3DI6B 2IM0A 4KO0A 3NDKA 2VG7B 4J2BA 2E9TA 3HPGA 3SCXA 4I2QB 3I8DA 1TP7A 3NKYA 2DFFA 2HHUA 2O5DA 1C0TA 4DSIA 3CJ5A 1BI4A 1F21A 3BREA 3PX4A 3P1GA 3D28A 4XPCA 4ZHRA 1SUQA 4O3RA 4B8AB 4ZP7A 4KHMA 4FLTA 3CDEA 4DSJA 3RB3A 3MTKA 1HNIB 4O3QA 5KFTA 3OS1A 4FYDA 4RW6B 4R8UB 1IKYA 3AA4A 2EC0A 5KRSA 2G8VA 3KK2B 3T5KA 2W7OA 1S10A 4BE2A 4DU3A 4EYHB 2UVUA 2NUBA 4R5PB 3V6DB 4CHYA 4ECSA 4GC6A 3TANA 4FJLA 1TL1A 3K59A 5SWMA 1NK4A 1J54A 3BDPA 4FLWA 4ZTFA 4F50A 4W5RA 2R8KA 3RMAA 4ZVEA 2WRMA 4MH8A 3MXMA 3SNNA 3L2WA 3UPFA 1Z25A 4IFYA 2E4LA 3BGRA 3FDSA 2XY6A 1KFSA 4O44B 1RT7A 1HRHA 3QLHA 4DFJA 5C25B 2YKNB 4NCGB 1L3SA 4E0DA 4OLAA 3C94A 4IH6A 1IM4A 4NZ0A 3CIZA 3HJFA 1QSSA 1RTHB 4N5SA 3Q8PB 4KHYA 2OH2A 3AVIA 4NLRA 2ATLA 2VA2A 1SL2A 4CJ4A 3T5LA 3KTQA 3MEEA 1OS5A 3MFHA 3VQ8A 4PWDA 4IR9A 3TAPA 1FXXA 4MFBA 1NKEA 4RW9A 2KFNA 3DLEA 2FLNA 2Y1JA 4HKQA 4OKEA 3IRXB 5KFIA 4CJUA 3TAEA 1S0OA 3PV8A 2ZD1B 1JKHA 5KFFA 1CXUA 4IG3A 4DS4A 3IG1B 2B5JB 3CO9A 2PYJA 3SV4A 3E51A 1RBUA 2YNIA 1VSLA 1REVB 3DRRB 3OJUA 4FCYA 4I9QA 2CJQA 3PR4A 4AILC 3NAIA 5C5JA 3AVHA 4M3YA 3DM2A 2PZSA 5KTQA 4K4XA 2B6AB 3CG7A 4GMJB 4E7LA 1S1UA 4CF1A 3V1QA 3M8PA 5KT3A 4Z4GA 1TKTB 4EEYA 3U3GA 3WNEA 3HPHA 2OPQA 4KHUA 1ZBLA 1JLFB 4J9LA 3MAQA 3OL9A 4CFBA 5K14B 2B43A 4IOBA 4KBIA 1HYZA 2YNHB 2BQRA 1RBTA 2FC0A 1HPZA 2QKKA 4NYNA 3S3MA 1SH0A 3SQ2A 3U6FA 1NK5A 4YR2A 2V4QA 4DL7A 1RILA 3OJSA 4CJTA 4CEFA 4BDYA 2GUIA 4Z4EA 2YHBA 1UOCA 1T3NA 1BQMA 4RW4A 2UUWA 5C24A 5KFMA 2RKIB 1UWBB 3MEGA 5KFPA 4CGIA 4BDZA 3MECB 4IFVB 2HMIA 2E9RX 1JX4A 4CJ5A 1TKDA 3MXJA 3SUOA 1YVFA 1RYSA 4CJSA 1S6QB 3PO5A 3VQBA 4QWCA 3OL8A 3AV9A 5DG8A 4FZXC 3HL8A 5JS2A 3FSIA 3BQ0A 5KFDA 3OYIA 3FFIB 1TQLA 3TAQA 2D41A 5FRNA 1JIHA 1TL3A 5EUHA 3QEWA 1D9DA 4R0EA 5KGXA 4RW8A 4DQPA 1FKOB 4KPYA 3HK2A 5D3GA 1SV5A 3ULDA 3RB4A 3C6TB 4K4YA 4DU1A 1FK9A 3NGYA 2FVRA 1VRTB 5EWFA 4DSLA 1ZBHA 4YFUA 3M8QA 2HHWA 2DTUA 4NCAA 4JV1A 3LDSA 2P5GA 4FZYA 3HT3A 3ZSVA 3HVRA 1T7PA 4WE1B 4I7FB 1RDCA 4K4VA 1S9FA 3KLGB 3SPZA 1RT3B 4ECXA 1W9HA 3OYKA 4J2EA 1JL2A 1RBSA 3NGIA 4CJQA 4DQSA 1ITGA 1KVCA 3QO9A 1C0MA 1HQEB 1LW0B 2BRKA 1K1SA 2ITGA 3RMCA 3CJ3A 4Z4FA 4CGDA 3VQ4A 4ED7A 4W5OA 2HHVA 2IM1A 3LPUA 1NHVA 2YV0X 1GX6A 4RZRA 4PQUB 1IH7A 5F8MA 4HYKA 1SH2A 4Y3CA 1NKBA 4DL5A 1JLAA 3N6NA 3NAEA 4ECRA 4MQ3A 4ZVFA 1KVBA 4DSFA 3H5XA 4NLWA 1B9FA 2HNYA 1QTMA 3V9SA 3LP0B 4U7CA 5FDLB 4DF4A 3EY1A 1S6PB 1LWFA 3AO2A 1C0UB 1LWCB 3QZ8A 1SL0A 4B9LA 3OYCA 3DLGB 1TKZB 4KO0B 2HWHA 3QYYA 4Y34A 3ZSOA 4M3ZA 2DY4A 4M45A 4QW8A 1C0TB 4RNNA 3PW2A 3SYZA 1U04A 1HNVA 4QWDA 4KKOA 3PJXA 4ZHRB 5J1EB 2IOCA 4JS5A 3OL7A 4ID5A 4YMEA 3QEVA 2AJQA 2XI2A 4TY9A 3V9ZA 3OYBA 2JC1A 3RAQA 3SFUA 1IKYB 1RTJB 4DL3A 3L2UA 4CFCA 1W25A 3FRZA 1JXLA 2C28A 5KFVA 4NLQA 2XY5A 4OJRA 3HVTB 3CJ2A 4HCBA 3PHEA 2J6UA 2YNGA 1GOBA 3EPGA 1BIUA 2YKMA 2XGQA 2AGQA 2ILYA 3CFRA 2BANB 1RTIA 2AX1A 3VQ5A 3ZT3A 2JC0A 4X2BA 1RBVA 4IFYB 2AU0A 5EU7A 3CJ4A 3OSPA 4LQ3A 4EZ6A 1RT7B 1JLQA 3ISNC 1IKWA 4CEQA 1Z4UA 1JXBA 3H5SA 4Y1CA 3DMJB 3KKRA 4JV2A 4EBDA 3ZSWA 1VSMA 2G8WA 2V9WA 3KKSA 2AX0A 3CVKA 4W5TA 4ED8A 4FXDA 4CF8A 1RYRA 5KG5A 3AVCA 1UA0A 4QOZB 4Z4HA 1RT5A 1J5OA 1SKWA 3MEEB 3H4DA 4PWDB 4K4UA 3LAKA 4MFBB 4XIUA 2W7PA 1B92A 3PX0A 2LSNA 3DLEB 3PVXA 5KFRA 4BE0A 2I5JA 1I6JA 4DTPA 3DYAA 5L1IA 5L1JA 3K5LA 2XI3A 5L1LA 4NLPA 4IG3B 4WZQA 5I42A 4TYAA 1QS4A 4E89A 2WONA 3MF5A 1XC9A 4UQGA 1XHXA 2YNIB
chains in the Genus database with same CATH superfamily
3R27A 1IQTA 1MWMA 2QA4G 1U1QA 4JI7J 4ZP6A 2IC3B 3HSGA 1RLCL 4GC7A 3DM2B 2G8KA 4K4ZA 3CCJN 5EWGA 5FLXU 2XCPA 3OXLA 4FZVA 3MWBA 4Q5VA 2OEMA 2DH9A 3TARA 3KZBA 4IJAA 2VJVA 5DQGA 3CXCR 1KR4A 1VQMS 3IN5A 2OPPA 2AHOB 3KWGA 3HYFA 4YB6A 2VWJA 3LDQA 1RWWB 1EIYB 1BISA 5DZ7A 4BG8A 4U67Q 2W8KA 4PG5A 2C3OA 5BYQA 1BUXA 2VIHA 4WFNQ 4QS8A 2QYGA 3D6TB 2HLTA 3BQ2A 1YRUA 3QGIA 4WYLA 3HFZB 3ZT0A 1B7FA 2R4FA 1YLXA 4RLEA 3GBTA 1IQZA 2H5EA 1PIEA 1FEEA 1N36J 3MEGB 4U8VA 1RDUA 3CJ1A 3WNHA 3IA0A 5AQRA 1FESA 1T0TV 4B3OA 3JQKA 3OYDA 2X7IA 1HYVA 4KT0C 2AEFA 3LP2A 1VQ5N 1IWGA 1FX2A 1OSCA 4CLUA 5BR8J 3OD2A 3CCWA 1O8BA 4USHA 3N5BA 4KBOA 4FWMA 4CF9A 3OVSA 3GOIA 2IAJA 3B4MA 4WFXA 2FHOB 4YDUC 3KHLA 2C42A 2VQEJ 4OI0A 4KHSA 1U6ZA 3H0PA 4F3MA 1PC5A 5H9EK 5KFOA 5CYJA 4H0YB 4ENOA 5D3GB 3EUNA 1Q81O 4Q0BB 1Q78A 3CD6N 3BBBA 3O44A 1FK9B 1VQNS 1UJ5A 3LGMA 3Q2SC 3B8AX 1XUPO 2E88A 4CHQA 2YX6A 4CK3A 1HQUA 4LT6A 1YJTA 3MM7A 4N77A 3BF1A 2JWNA 4MIBA 1EB0A 1J9AA 3UCGA 3VEWA 5AZJB 3SCIE 4OZ1A 2W2MP 4ZN3A 1JK9B 2D3OR 4G6VB 4B9NA 2YBVA 2GS8A 2VD3A 4WFAL 3RMDA 4CESA 2ZE2A 1S7IA 3FCVA 3LAMA 4M5HA 3CCQN 4JI4F 1V3SA 4FYYB 2G8FA 4ANCA 4YUDA 1NNEA 3L3CA 2AV5A 4DU8A 1RK8A 4QYZJ 3D2FB 2MQMA 2BX6A 1Y97A 4JI6F 1TU0B 1JLAB 2Z2ZA 1DQAA 3AXMA 3H3NO 1EARA 4ECZA 2HBLA 1IJJA 2NYHA 4I56A 2ZEJA 4W98A 5HQ8A 2F96A 1OKJA 4ETZA 2DJWA 3QRPA 4RNMA 1DARA 4Y2IA 3VAMA 5CY4A 3ONQA 4FJXA 1VDHA 4J9UE 4OI4A 2HRYA 4XH1A 3TWZA 3OSNA 3JQMA 2ZGYA 1RT1A 3DRPA 1SAZA 1WC0A 2I6WA 3T69A 4NA3A 2HS3A 3VQEA 4FKXA 3WQTA 2ASLA 4LF9F 1FRIA 2KW4A 3N5FA 4B17A 4AH9A 4A59A 3EYZA 4URSA 4B1WB 1J5EF 4JI4K 1UEVA 3ET6A 4X66F 1YT3A 3ITHB 4IRKA 3MWPA 3QFHA 4CIEA 4ELTA 4MLEA 3DRYA 3WXMB 3WDOA 4OZ0A 3PO4A 3QIPA 1N4LA 1UFLA 4OYMA 4JI6K 2MHEA 2BABA 2WSCC 1VISA 4AQYJ 2KT3A 4NXMJ 5CXTA 4JK8A 4FPAA 3G71S 4M3WA 3W64A 4IYQA 1IKWB 4LRFA 4Y1DA 2PA8D 2QFIA 3QIOA 2MZSA 1WD6A 4HHTA 1EX4A 3KWIA 2ZGZA 2Y8YA 2Z1JA 3NCIA 4NLYA 5LJVA 1U24A 3TA2A 1GAOA 3F0NA 3ASMA 1RT4B 4FW1A 2D9PA 3M2UA 1J5OB 3DDNA 2Z1GA 5EGYA 1ZPWX 2A18A 4C98A 3QFWA 5L9NA 3AD7C 3AD9C 1TMJA 2HQDA 4LF9K 5KPTA 1KTVA 2JHEA 3SMPA 1HJRA 1J5EK 2AJ0A 4CT9A 4C9DA 3KFWX 5E5NA 3KMQA 3PEHA 1VCTA 2L41A 4X66K 2AZ3A 2NRXA 3QRRA 5KFQA 3J7YP 3NH1A 4YR0A 5K8OA 4RW6A 1QJHA 1HLWA 4EO8A 2KO1A 2YQ3A 3TVYA 1Z05A 4Y2AA 4CJVA 3UNGC 3I0SA 2XSJB 4KTWA 5HROB 1WSEA 4YHHF 3ZEUA 1XMQJ 4LF8J 2NZ4A 1TMMA 4DV5J 3SDEA 1TYQB 4O44A 2HKEA 2M52A 4ZIWA 2B9XA 5CYQA 3CJKA 4FP9A 4NZ6A 4UUWA 4CEDA 4IZ9A 4JI5F 3GYXB 4FNIA 1YK9A 3DLLQ 4IOAL 3CT9A 1RTHA 1MG7A 1S1WA 1E6VA 3CJ8A 4RPFA 3ENWA 4P72A 5IQ6A 4C3LA 2ZBQA 1FKAF 4XO0A 2HLUA 3KKFA 1RT6B 1C1BB 4O4GA 1K0TA 3ZSXA 2E5HA 1S57A 1S1VA 1VJWA 4ZCIA 4P75A 4FK2A 2HHTA 3VF2A 1VQON 3J7ZO 3OR2B 2AJ4A 1KTQA 1RDRA 2Z2YB 4JI1K 3G8SA 2BOAA 3IG1A 3NOCA 1BI4B 3CF5Q 4CZHA 2XM3A 4AL6A 4WK1A 1ATRA 4NLGA 1QZ6A 3S01A 4CLFA 3ENQA 2PMHA 4O55A 4KPCA 1PYSB 3AQOA 2RF2A 3TW0A 1F6TA 4N41A 1LAVA 1V5IB 2I9SA 2RAQA 3NEKA 1AZSB 3T1HK 3HD2A 5HBMB 4OYWA 4JI5K 3KLHB 4FJ8A 2YY3A 3CIMA 1TKTA 2D3ZA 4RNFA 2VG6A 1QDUB 3HHKA 2WVDA 1YDLA 3ZX0A 4DPYA 2XRIA 4OHWA 3TAMB 2AYMA 2XMKA 4YB7A 3MMBA 1BIZA 1U8WA 3GWCA 4MYUA 4TU8A 2JGUA 4JEPA 1N34J 3DLRA 4JUZA 3M8ZA 1U47A 5ETLA 3F9MA 1RU1A 1NOZA 3OTDA 4IBNA 3VESA 1P27B 4DV6F 1I51B 3TUZC 2WTFA 2Z2LA 3ZT4A 3K5OA 3HVAA 4DV2J 2X78A 4F67A 3ILOA 1JLBA 2P9GA 3FMBA 1RDDA 4XK8C 2QWQA 1ZBTA 4CZIA 4JYAJ 4CJ3A 4K8ZA 1WF0A 3CYMA 2CJYB 3G4SN 4G1QA 2DR7A 4IUFA 3P5JA 2UZAA 4CF2A 1QD1A 4FS1A 2G8IA 3OYJA 3L4BC 2R7WA 3U8XA 3US5A 2QMWA 2BMBA 2ADBA 4QWBA 1JJ2M 2ATQA 2F8EX 3MHYA 2BDPA 1WBDA 2EFPA 3NP5A 3LZJA 1RT2A 3ZTOA 4V1Ak 4M1KA 5KFBA 1KBRA 4DPXA 2ZUAA 3Q23A 3EDQB 3CCMS 2LYVA 3JSYA 4K2XA 5J2NA 2VYPA 4FLZA 4BBYA 2FZKB 4ZVHA 4FF1A 3IAYA 3KJNB 4DV6K 4I7FA 2NRTA 3A3OB 2Q3SA 4F3QA 5JICA 1RU2A 3AO4A 2UXDF 2GMLA 1S1TB 4DPOA 1WWHA 2AT1B 1N32F 2RT3A 3W9IA 2QL9B 4QPXA 4OVLA 3D4JA 3BR9A 3S9HA 3QJPA 3GIJA 4C8KA 2GQQA 1UPMB 4ZJLA 4H5RA 3JYTA 3W63A 1MSWD 3QEPA 4MDAA 2DNHA 5M1OA 2XYHB 2RE1A 3OR1B 5AQVA 4CZEA 4RO0A 1Q79A 2Z1HA 3LP0A 3I96A 2PT0A 1S6PA 1IR2A 2FBTA 1WOPA 1VQKN 3TZWA 1LWCA 1HD1A 3DXKB 3VENA 3O9TA 1S6OA 2FVSA 3NF9A 4BVOA 4AHRA 2JVOA 4ER8A 4ECYA 1YX2A 1X9SA 1YJWN 4LFAF 1X4FA 3QJJA 3OBWA 1M1KO 4CLWA 5J1EA 1A0OB 3VEOA 2UXDK 3V9XA 2O8FA 3HMJG 3OHBA 1HBMB 5AXNA 2GWJA 2W40A 4LRBA 3QIDA 3H40A 2E66A 4B3MJ 1N32K 1RTJA 2XB2D 1GLDG 2CPIA 1VBKA 1XHZA 4B1VA 5D8HB 2OZMA 3HVTA 2AJ1A 1AUSL 1FJGK 1JLEB 4JLHA 2P9KB 3K9KA 1TR0A 3DNCA 3VGMA 5E3CA 4R0JA 2BANA 4CF0A 4DL2A 3M8YA 3M32A 2MLXA 1S1XB 5BPNA 2MZRA 4LF4J 3KDNA 2OTLN 2MSSA 5E41A 2D0AA 3I8BA 3KD1E 4J9SA 4M63C 2NLWA 3DMJA 3D5MA 1OVYA 4ED3A 2ILZA 3VOVA 2EK6A 2AWZA 4ILJA 3CCSS 2CQHA 2V4JB 1D8ZA 1GOCA 1HMVA 3B4DA 4OX7A 4CERA 1GLJO 3CUNA 2E2NA 2FC9A 1ESVA 3K5NA 4Y2KA 3L2VA 3EGNA 2X6SA 5AQIA 4FW2A 2HEKA 1NDPA 2O66A 2G0IA 4HEA9 3MCSA 2YH1A 1PGZA 3WXIA 3G6VA 5J2QB 3MM8A 1FDAA 5EWEA 4ZVTB 1Y3JA 2VONA 4KHNA 1S9GB 1YJNN 3W61A 1WAFA 4JRPA 2DGSA 2IMWP 3UCUP 2B56A 4WU3A 4B3TJ 4Q2LA 4ID5B 3BP8A 1JB0C 4OZ2A 4DPUA 2IC3A 5KFEA 2V7YA 2HNDA 4F3TA 3LOUA 4P74A 2H65B 2IRUA 2BE2B 3CFOA 4Y65A 4OPKA 3RWUA 3E2EA 3GJRB 1C4AA 4J9RA 4FZZA 2DNPA 4P10A 1YF5L 3UKRB 2R9LA 3GV7B 3LPEA 5DG7A 1CZ9A 1X8DA 3GQCA 1O13A 2ZHOA 2W9BA 4LSNA 2FXUA 3WHIA 3AA9A 4OYAA 1NSPA 4NRTA 5CAAA 1H1VA 1SBRA 1Q5VA 1CC7A 1OY9A 4C7QA 3BSNA 3ZSZA 1U1RA 5AQQA 3DLBA 4FJHA 2QKBA 4Y2CA 2BQUA 1U45A 2WAQD 3R5BA 1ZBIA 2R7XA 2QWPA 2D9OA 2G1HA 2J7KA 2X3DA 1HI1A 3ZZPA 3R8EA 2H48B 2GA7A 2CJXB 1VSFA 2K3KA 4CRJA 3OBIA 3TZYA 1APSA 1F5CA 1NAQA 2E6MA 3MZIA 4FLUA 2ZJPL 2W01A 2P9LB 1S22A 1RA6A 5EN1A 1SB6A 3FEZA 3QJLA 1JQGA 5DQHA 4DHVA 1FWLA 1URRA 2HFVA 1FWKA 1QQMA 2WONB 4RKUC 3E9LA 2MKYA 3M4XA 3UIQA 2HVIA 4GKJJ 3D67A 2IIRA 1IUJA 5E26A 3A5LC 3CC4S 2QGFB 1N0VC 1NGJA 2YPYA 2NXEA 4C8MA 1SJRA 4U6PA 4Q0BA 2V5HG 2HF4A 2DNLA 1O1WA 1R0AB 1N48A 2VQFF 2HSEB 2CADA 3SJHA 2CQ0A 4X65J 1VK3A 3G82B 5A0YB 1C0GA 3NVMA 4DU4A 3U3YA 3LF0A 4JNEA 3U27A 4NCGA 5JVHQ 1A9NB 1TKXB 3FZHA 4CJWA 2ZBCA 3W2WB 3AY9A 2OA8A 2H5JB 1N8RO 5ELZA 4OX8A 3F73A 1T9TA 2BE7D 2MTLA 1IBKJ 4CM0A 2GIFA 3OYHA 4NLVA 4DDFA 3PRBA 4OGCA 3I5AA 1U4BA 3HD1A 5EDWA 1HKCA 4F0KA 5E3PA 2AGOA 2H5IB 5GAHU 3KVGA 4DL6A 3OYFA 4FPBA 3QATA 3AGKA 4B3RK 4H0XB 3HHNB 3JAMU 3SAFA 2MKHA 4WTYA 1CSJA 3IRXA 4ERDA 4YOXA 3IKMA 4LFCJ 2ZD1A 1UEUA 3KHRA 3M2RA 3OYLA 4LF5J 3I82A 1P9YA 2Y0BB 2UU9F 2YWGA 1VQ9S 2VQFK 1A7GE 1REVA 1IWAA 2RDIA 3PW5A 5IC4B 2AJFE 3NCRA 5F8HA 4KE5A 1WOOA 3T6BA 1X4CA 4PL8A 4L6V3 2IFXA 4C8LA 1EWRA 2QLXA 4B8CA 3LQVA 3TR8A 4B1ZA 5KG6A 3GV8B 5K8MA 4A8SA 1EKSA 2XNQA 2ZH2A 2QN6B 2MY8A 4DTJA 3I5BA 4QWEA 1M0SA 3SPYA 3AVLA 1VQ8S 3A5OC 1EX8A 3M9NB 1U8SA 4O3PA 2GBZA 4ISFA 3ITHA 3PNIA 2IIHA 2CPHA 3RBDA 5I4MA 3DFEA 1V3RA 4F4XA 2D7SA 2LMIA 3AVFA 4QIVA 5THWA 3RAXA 1XNRF 2B4JA 4NLSA 1VK0A 4PYDA 1JNZB 3MECA 2C2ZB 2D0OA 3LWLA 2UU9K 3DOMA 4IKFA 4DI6A 3N28A 4ZOSA 2JH3A 2PEBA 1WHXA 3MCNA 5D78A 4B3RJ 1ZYQA 5L1KA 4FWNA 4FWSA 5CQGA 5EY4A 3X1LB 2OANA 3H59A 1RT4A 3JS6A 2IVNA 1U1OA 3QMLA 3RZAA 2BW7A 4OHXA 3CCUN 4F2RA 4JD2B 2ZH3A 1VRUB 2HHSA 5FRMA 3CC2S 3K5PA 3OPKA 1RKIA 1RWKB 4DFKA 2KVIA 3DXSX 1S72N 1DRZA 1QUVA 4WYWA 3PRDA 2MDAA 4HLBA 3KNGA 1S48A 4DR7F 2DPNA 4LF1A 4RWWA 5C42B 3V4IB 3GPAA 3R3LA 4DTOA 2RH3A 3NNCA 3GR0A 5IXUA 5B09A 2M70A 2VDIA 2C2EA 1H2UX 2QA2A 3DDKA 1ROFA 1XNRK 1CQNA 5L8RC 1JXEA 4MAKA 2WVEA 1RT3A 2HBJA 1NOYA 3PACA 4LF7J 3A5NC 4CLZA 2V2KA 4IH7A 4TKTA 1BE4A 3P83D 2N3OA 3AB4B 1HHSA 3BJYA 4AXJA 1IJEB 2F65A 4BRIA 3Q8UA 1D4XA 4FYXB 5CZ1A 5IQQA 4WQ5A 3THYB 3K8WA 3FZMA 3M9OB 2ZH1A 2UVWA 4M3UA 1VQYA 2UV8G 2AGPA 4RW7B 4G3IA 4YY3F 4BRHA 2G8HA 3TUJC 2JFDA 1OY8A 1YZ7A 4TN2A 3LPYA 3W9JA 1RT6A 2W25A 1TFWA 3AVBA 3O9UA 1C0UA 5IWAK 1VJQA 1NZAA 3BZKA 3KD5E 1SC1B 3G0ZA 3H25A 2IM0A 4LJMA 2PD1A 4BRAA 2AYBA 2QLWA 2MGZB 3CJTA 1TP7A 2P9CA 2HHUA 1MLAA 4ATNA 3CJ5A 4DSIA 1EQMA 1BI4A 3P1GA 3TJ9A 3S7RA 4KHMA 1KVIA 4IWVA 4JKAA 1NB7A 4DSJA 4FYDA 2HS0A 4R8UB 5KRSA 2LDIA 5C2GA 1U2VB 2R42A 4DR1J 2A6OA 1AZSA 4WF9Q 3TANA 4FJLA 4FOEA 1NK4A 3BDPA 4NXNF 3C0BA 2R8KA 1HUXA 3IC1A 2GVDB 3ELHA 4ZVEA 2WRMA 4YY3K 3L2WA 3N79A 4HACB 3GJQB 2RHKA 4NMXA 3FDSA 2XY6A 2E1AA 2CNNB 1HRHA 1HBNB 1ZXOA 3RVCA 3H90A 3ETOA 2ZNZA 4IH6A 1DQ8A 1IM4A 5FIIA 1X9JA 1HJOA 2OLWA 3Q8PB 2LECA 4KHYA 4DR2F 4NLRA 4DV7K 1YJ9S 2VA2A 3GSDA 1SC3B 3CCEN 2FPHX 3X3UA 2CDRB 3MFHA 1YKWA 4PWDA 1WHVA 5IWAJ 4MFBA 4OPHA 2GNKA 1N5QA 1H7XA 1VQLN 1PYTA 1WKKA 1F3FA 2Y1JA 1KDNA 3PV8A 2VC0A 1M90T 5K8PA 5KFFA 1CXUA 4IG3A 2K7JA 2LQ5A 2PYJA 3HULA 4TNOA 2ADCA 4NXNK 3SV4A 1U1KA 4PG8A 2IRXA 2VPYB 4UT4A 1AFJA 4I9QA 1H3DA 2CJQA 3PR4A 4GVBB 3EKUA 2E2OA 1YIJN 4USKA 3AVHA 3BEGB 2CH6A 2LU1A 1H38A 1P6TA 4FF2A 4QR0A 4V19X 2VFVA 4GMJB 1SIZA 2CUYA 3T1YJ 2DRAA 2UXCF 1KQGB 1QHAA 3M8PA 3FC9A 2ZUGA 5KT3A 2PDAA 4OYZA 1SC4B 2OI2A 3S8SA 3J81Y 3WNEA 1LQ9A 2ACMA 3I6PA 3HPHA 4DR2K 4KHUA 1ZBLA 1JLFB 4J9LA 3MAQA 2Z0GA 3NWRA 2YNHB 2BQRA 4G1IA 2FC0A 3U6FA 3ZZUA 1NDLA 2BJDA 4DL7A 1KAXA 2DTJA 2KYZA 3CCJS 4JK7A 1RWOB 1Q16B 4UF4A 4CJTA 4CEFA 2GUIA 3K17A 1IBLF 1UOCA 2HFNA 3GZ7A 4RW4A 4B3SJ 4G65A 4DV7J 5HMWA 3MPYA 5KFPA 1WEZA 2E9RX 5ADXA 3MDFA 1JX4A 4CJ5A 1R0CB 2EFNA 1HQ2A 4UZBA 4L75A 1BWEA 2E1ZA 2LEAA 3I33A 3OL8A 4CJ7A 3CD5A 1FVSA 4OJHA 3HTVA 5BPMA 3OYIA 3DXKA 1NMDA 2YVSA 2UUBJ 4BGBA 3IR6B 2UXCK 5BYRA 2JLGA 3C46A 3GLJA 5EUHA 1D9DA 4R0EA 4P2FA 5DM7L 2Q36A 1KC8O 5ITHA 2VWBA 4DQPA 4KPYA 1HI8A 1RE1B 1SV5A 5H1SV 1G7CB 3RB4A 3C6TB 5JVGQ 3E1YA 2FVRA 5EWFA 4AYBD 1HBMA 3WQPA 4YFUA 4GKKF 2KHOA 2DTUA 1ILYA 3ENOA 2DVIA 2PA3A 3HT3A 1X4EA 2Y0SD 4A46A 4FSVA 2XULA 2V8VA 1FHTA 4WE1B 4KHPF 4G9ZA 1YVNA 3KLGB 1WG4A 4ECXA 2Y1RI 3OYKA 1HWUA 3QB0A 2A1BA 4ZCLA 1JL2A 1RKJA 5BJRA 3NGIA 4H5NA 4JAXA 3BN7A 4FN5A 3EDRB 3UVJB 4DQSA 2XSFA 1KVCA 2HIQA 1UFKA 1C0MA 3MPUB 4LR7A 3W5ZA 1K1SA 3R7SB 3HHLC 4ED7A 1LOUA 3QQCD 4OJ1A 1SH2A 1GLEG 2V4JA 2CGLA 3UD4P 1HR0K 3NAEA 1RGIA 2CWKA 1KVBA 5TKYA 3GIRA 1YTYA 1QTMA 1BOTO 1FRKA 3DU6A 5FDLB 4DF4A 3U1MA 3CCTA 3D66A 2ASMA 2HVEA 1KVJA 4U67L 2BBEA 4Y00A 5AFUA 4GKKK 1TKZB 4HL9A 3CCQS 2HWHA 4ZIVA 4WFNL 5B0BA 1VQNN 4Y34A 4MO5A 3PXGa 3ZSOA 5AQTA 2CPEA 1C0TB 3PW2A 3SYZA 1U04A 1HNVA 4ID5A 3QEVA 1WF2A 1BXNA 3SFUA 2O8BA 2RU9A 2V94A 2H4WB 1U1NA 4CFCA 3W62A 3SXLA 4CLTA 2XY5A 5D0HA 2QA4N 3IBWA 2XLIA 3CJ2A 1WHYA 4HCBA 2O1PA 4PKHA 2YNGA 1RXOB 3NWGA 2YKOA 1UEKA 1RTIA 3GCWP 1JJ4A 5JMNA 2ZH9A 2JC0A 1RBVA 3GYGA 5EU7A 4LVOP 1W26A 3HHDA 2BJ9A 4BS2A 3NRBA 4X64J 5M1PA 3KKRA 3S1TA 1VSMA 1UVLA 2V9WA 2NCKL 4I69A 3HZ6A 2AX0A 5HJYA 4FXDA 4CF8A 1FRHA 2XMWA 1UA0A 4Q2MA 2B8PA 4N8NA 3MM6A 2MQLA 2V2VA 2YWFA 4EFAC 2QRRA 3VZHA 4NMLA 3MEEB 3H4DA 1HHTP 4NEYA 4CLYA 2XMUA 1B92A 3NG8A 5KFRA 2J8SA 2I5JA 4YHHJ 4DTPA 2DNOA 2MQPA 1ZA2B 5L1JA 4CZKA 4NLPA 4KIAA 2KH9A 2OMLA 4H0OA 4X62J 1QS4A 1K9MO 4E89A 3N4WA 2WONA 2FQQB 3VF4A 1LNQA 1CULB 2YNIB 3OVNA 4FWLA 4ECVA 1EAYC 3CCRS 3QNWB 3TTCA 5HLFA 3KLEB 5AQNA 2FY1A 1RZMA 4K41A 1N5TA 1L3UA 4FJGA 2RPIA 1TUWA 5GAEU 3G71N 2HWTA 2GX8A 1WSHA 3J81O 4I4BA 3RMBA 3G82A 2EEYA 5A0YA 5DDQC 3VTHA 1IVZA 3K0JA 4RL1A 4AHUA 1O5JA 9RUBA 2C3UA 1X4GA 2YQ1A 2NREA 1XK8A 1TKXA 5HSPA 3W2WA 3HO1A 4FM2A 1BWVA 3VQ6A 3OLBA 4CTAB 3L09A 2XC9A 1KLNA 3H4BA 2HQFA 3O3GA 1IKXA 1FT8A 2HHXA 3I4PA 3QGGA 4OHVA 4OJGA 5C24B 4FF4A 1F5BA 5DLGA 4F7VA 5KFCA 2ATCB 4XDDA 1PC4A 1VC0A 3I0RB 2RHSB 4A8YA 1MU2B 1UVIA 5KQ8A 1DTTA 4GV3A 1C4CA 1HBUB 4KRFA 4IJNA 4BRNA 4UOGA 3MEDB 1A5WA 4K2JA 3LL3A 4OZ3A 4EU0A 1ZZNA 2WSEC 2AEMA 2VPXB 3MR3A 5F8NA 1MROB 1U2FA 5AJ3F 4JI8F 5LMUJ 4KFBB 5L9XA 2CNKB 4GMKA 5M2UA 3FNNA 1TL3B 2V67A 2O3DA 1FE0A 1DEJA 1ZA1B 4A8OA 1XMOK 4KGVB 4NASA 5LSOA 1VQOS 1X0PA 3NS7B 4Q8FA 4BDPA 5A8WB 4RG8A 3TNVA 4DXLA 1GMVA 2KZMA 3MN5A 2WTUA 4YOVA 2NRVA 3C66A 2E29A 1VQ4N 2R3VA 1S5JA 3I55S 1LWEA 3JS9A 1YRTA 3R6LB 3UN5A 4ILLA 3BSOA 2C2NA 3ULEB 1NK0A 3CJQA 3SUPA 4MK7A 3PEJA 2LQBA 3R5AA 1Q9YA 2VFSA 4ZVRB 2KQ2A 1HX1A 3Q8QB 2Z8QA 5IZHA 2ALYB 3L9ZA 3BO2A 1VFJA 2RILA 5A8RB 2R2TA 4PUOA 3KHHA 3BDEA 5TKWA 2ZWOA 2BQ3A 3L4IA 2HNYB 2JDJA 5HAOA 1Q0NA 2L48A 2BKPA 4B1XB 3AO5A 3THWB 2ZKTA 1VIOA 1SJ4P 2X51A 3SUQA 4UUXA 3QPIA 8RUCA 2WW8A 3SQ1A 1MN9A 4DPWA 3P6YC 4O5FA 1WACA 5LJWA 2Q6BA 1D8YA 2E2PA 1HYSA 2RVJA 4FLXA 4OL8A 3TRGA 3V4IA 2JJ4D 4MK8A 4LF6K 5EOYA 4PWWA 4QAGA 3RRHA 4ECUA 4FM0A 4C11B 1RHKB 4E7IA 2G4BA 5FROA 1BQNA 1N6QA 2ZZMA 3G10A 3MUMP 4BRLA 4NE9C 2JLFA 3Q8SB 5AXMA 1M1GA 1PJ5A 3R6GB 1BLUA 3OFFA 1JLQB 4OX6A 4LFAJ 3O1WA 3LANA 3F5TA 5MLCQ 5GIOA 2B9YA 1FJ7A 3ZETA 3SUNA 2FBVA 3UQSA 1UJ6A 2WCXA 4B9SA 5DDOC 2W8LA 2NNWA 4Q43A 3OBYA 2C1EB 3EVWA 2XCAA 1MNEA 1RHJB 4FJ9A 1RSCA 1NDCA 2P9UB 1K8KB 4F4ZA 4CEBA 3AGRA 4ZA1A 2IJFA 3AA3A 3JTNA 2MY7A 2DIVA 4IEEA 3OY9A 1IO2A 1F0XA 2C3YA 4NRUA 3EN9A 5GINA 1KRPA 1IKVB 2W2QP 2M2BA 2W6LA 3E9PA 1M5HA 2MQ8A 3SV3A 2BUPA 2NUHA 4M8LA 3K89A 2HFUA 4DTXA 1KSPA 1IG8A 2QEXN 4LF6J 4R8UA 2ASDA 2ETJA 1LFPA 1U2VA 4F2SA 4QU6A 4DR6F 2IVPA 4J2AA 1WOSA 3EPIA 2L9NA 4IDKA 2ZWPA 3CMAS 3IAS9 1R0BG 2JEJA 3LZIA 3VR1A 4P73A 4C0BA 1PAUB 4J9MA 4NZ7A 1YJWS 3O6QA 3LALA 2OPPB 1NGBA 3V9WA 2VG5A 3V81A 5KG7A 4JI2F 4AUKA 2XQCA 1ASUA 4DEZA 4M5DB 1NMNA 2R7YA 1JLGA 5EX3A 4V19J 2E5JA 5D6GA 3MCPA 4K25A 4M5MA 5BN8A 4LH4A 1MMDA 1MWKA 4QIGA 3HFKA 3M6UA 1B3TA 2G2ZA 3DKDA 1FNMA 2BRLA 5RUBA 3EE9A 5F0WA 1T3VA 4C1NI 4D3GA 3NHGA 1T03A 1RAGB 3K58A 1KD1O 4QYRA 1P9QC 3DHXA 3TI0A 3ILIA 4BRPA 2D3O1 4B3OB 1TZ0A 4YN3B 5GAHI 1WUUA 2OTLS 1JWWA 3UO0A 4DFPA 1BCOA 5DJBA 3ENBA 3LP2B 3E01A 1WKJA 5HK4A 3BY5A 3KLIA 3BSAA 4DN0A 4B02A 2NSBA 4X4TA 7AT1B 5AQUA 3CM5A 3Q83A 2CJ9A 2ZH6A 4C8OA 1RHMB 3MPWA 4J2DA 1K47A 4OYBA 3DN9A 4F4YA 4K8XA 1GOAA 3U1NA 4GVBA 1D09B 4ICLA 2A6MA 1YUWA 4C8NA 2P1JA 1Y5IB 3ZLJA 1Q86T 4OI3A 4JI2K 4WXWA 2IGIA 2IVFB 4F04B 5HP1A 2IM3A 4QJVA 5KFHA 4NLTA 3HHLA 2J6TA 3MX5A 2HBYB 4EHTA 3HF5A 4WCEL 3D6HB 2HYIB 1BL3A 4HUGA 2VBXA 1HQUB 1YJNS 1FFSB 3MM7B 3VQQA 3ZC4A 4E19A 1WN7A 1UCNA 3ZCMA 4QWAA 3BGRB 3V2UC 4A8KA 1JMTA 3VAFA 1UAXA 3QLHB 3SCLE 3CPWR 3OW2R 4YB5A 4H8KA 3M9MB 2W6KA 3IGVA 2I8EA 4JHDA 1NU0A 2C2RA 1IR0A 3BPDA 3WC0A 5LL6Z 4LBHA 1RBAA 3TAFA 3UNYA 4DX6A 1CJVA 4E3SA 1Q5YA 4DV1J 1RA7A 1AW0A 4U7BA 3VQCA 1BCMA 3L2QA 1PAEX 1R43A 1SVDA 1JKHB 3VAJA 1WNSA 2V63A 1QVGM 2JFKA 2E5LJ 4O8UA 1JL1A 4QOTA 4NLXA 4F9OA 4KV8A 2W24A 4OKKA 1NHKL 1Y5LB 3AJ1A 2K1RA 4ZPCA 2DHXA 4LIWA 5KFSA 2KM8B 2PE8A 3IM9A 3H98A 1RT1B 3DRPB 2HIYA 2IBKA 3A1YG 1RDBA 1PYOB 4CCHA 3VN5A 1L3TA 2OGUA 1Q53A 3TSQA 4CHOA 4WE1A 4CJFA 2YKPA 4ZPBA 2AA4A 4WTOB 3OTOF 2VJUA 2HAIA 3ET6B 3AY0A 1R59O 3QSIA 3PM9A 2NXCA 3IR5B 1Q82O 1L5UA 1UL3A 1RHRB 1A5XA 2R8GA 3VA3A 1ZM4A 4CJRA 1HWLA 2N7YA 2VKZG 4PXBA 5J1NA 5KFAA 1HBOA 4E1NA 2UUCF 3CMEN 1GLCG 3DOKA 5LMNF 3QESA 1H72C 1NGDA 2KDOA 4OO1J 1NHUA 3LPTA 2VDHA 1K8AT 2FBXA 4PPZA 4LBIA 4WFYA 2R8HA 5FDLA 2DFEA 1HW8A 1E6YA 4DTSA 2ZBIA 3M2UB 2FJBB 3M05A 1YVUA 1ITPA 3VMFB 3B6OA 5AQOA 3C7NB 4M94A 4M42A 3GYNA 4RW8B 1FE4A 4IQXA 2AKWB 3EXCX 1KAYA 3OTOK 4FNHA 2GVZA 2WB4A 3OFGA 3D68A 5D4PA 2XMTA 2LDYA 5CD4A 1S9EA 4A8MP 1EQ0A 4X4SA 5GIPA 3VVTA 3PYEA 4JI0F 2A1SA 4CZGA 1RGVA 1WSFA 3I0SB 2DR9A 2JEFA 2ALZA 2X1FA 3AOAA 1T8EA 1K73O 1KLMA 3VQAA 4CIFA 2DK2A 4B9QA 3M8WA 4DTNA 2ZOMA 4CGGA 1W7AA 4BCAA 1YTUA 1W7WA 4GVMA 4ID8A 2J6SA 3HM9A 3QO9B 3SDEB 2M3DA 2C3MA 4LVNP 5CYQB 3CJKB 2VA3A 4CYUA 3O4NA 1KWMA 3BH7B 3ZZZA 2QWRA 4DUZJ 3CERA 1FDNA 1RISA 2WW4A 3FZBA 1S1WB 2V51B 1UVNA 3HPOA 2UUAK 3DGPB 4OLBA 3VEXA 2O8EA 2D4WA 2GFFA 3SMSA 4L3QA 2MYFA 5KFLA 3W66A 4ED0A 5F1XA 1GT8A 5A76A 4O4GB 3E66A 2MMYA 1WLJA 4I68A 1S1VB 4CH7A 1Y5NB 2DNNA 1XQSC 1XR6A 1MMLA 4CECA 4JI0K 2KKHA 2WHOA 3WEEA 1YAGA 2M7SA 1XERA 4H4KC 1D5AA 2KFYA 2G2YA 1HNZF 2Z56B 3FKBA 2CQ3A 2R8JA 3TQ1A 1I3AA 1H2VZ 1TV6A 3FEYB 3KLEA 3SBMA 5JXSA 2QTWA 2RF2B 2FYXA 3ENHA 5AQYA 2CZVC 2OSRA 3R7NB 4IQMA 1NM1A 5IC6B 3KMSA 2YWHA 3FQKA 4DR3K 1S72S 2YKMB 2F8TA 3K2PA 2VG6B 4FWRA 3K0SA 2D3UA 3C15A 4IXCA 3EE8A 2AW0A 1ATNA 4I67A 2R2RA 2CPDA 3RUBL 2E44A 5KPZA 2GC8A 4CI6A 1X5PA 2V0NA 4CTAA 5C2CA 2B9WA 3CDUA 3OYMA 4HVJA 3KWMA 2DHAA 2M9KA 3HRGA 3MPDA 4WU2A 3AO1A 4EBCA 5MLCV 1RUSA 2AEJA 2DXEA 3OTCA 4M5LA 2G13A 3CC2N 4DR4J 1T6DA 2HWIA 1JLBB 3VALA 3I0RA 1MU2A 4UY8O 4NWBA 4A8WA 3MEDA 2QO3A 3NS6A 4DQ8A 1D1UA 3SJJA 4YNQA 4DUYJ 5IV4A 2V8HA 1KEKA 3MR7A 3RW6A 4E7HA 1YI2N 4OI1A 4ETXA 3OS2A 1MROA 3WX8A 1S4FA 4M5IA 2JSXA 4G1QB 4KFBA 2XMVA 1LCUA 1U48A 1DZ5A 4YOWA 4TVAB 1KVKA 3QINA 3B6PA 4C3KA 4IKAA 4BQLA 3S3NA 2IA0A 1HWIA 4P71A 3R8YA 2MEWA 1Q18A 3IGNA 2F4VK 3J8AA 1RT2B 4KB7A 1PJ7A 4DTRA 2ZH8A 3NFAA 4JI3F 4DV4F 3IBFB 2NXUA 3M7VA 3PSFA 3OV7A 5J2NB 3FGUA 1VI7A 4C8YA 2ZITA 4U9RA 3AQPA 2M4MA 4HUFA 5A2QY 5KRTA 2QC3A 3RTVA 2VWKA 5C25A 3NXZA 1NSAA 3R9LA 3P4UB 2GW8A 4OX9J 1P8GA 3SI6A 4JI7F 1GMWD 4OI2A 3Q22A 4M3XA 4ES2A 1UA1A 3BBCA 3O8WA 2H1YA 2DRDA 5CCMA 3D0GE 4OZ5A 1XWLA 4DV0J 3AAWB 5T7LA 2KXHA 2VOPA 1V3ZA 3DOLB 3D0HE 2MHNA 1VSIA 3JYTB 2FVPA 3AHPA 2IYGA 4BRKA 2HHHK 4K8RA 1RI7A 3SK3A 4B08A 4A48A 5B8HA 2ZOFA 3O08A 4JKGA 2ZJQL 1FDBA 2EX3A 1KHWA 2OHDA 1OMSA 4J8FA 5DZ6A 2U1AA 4CJLA 5DETA 5HN0A 3TVKA 2A41A 4DV4K 3LM9A 1Q4RA 2Y1IA 4C0HA 2ZOGA 3CCES 4BWMA 3G96A 4B9UA 2ROGA 3FBCA 5IS2A 5C12A 4H54A 1Y64A 1HIYA 1B64A 4OMFG 3LGHA 1IBLJ 3RGIA 3Q7CA 1EO1A 1BHLA 3TVZA 1VQLS 3NMRA 3PJ9A 1UVJA 1S3XA 1HA1A 4JI7K 4PXCA 5BR8F 2DH8A 1NSQA 5I3UB 1RBLA 2J0WA 3FZKA 2XMJA 4A8QA 3NGRA 2L9DA 4AHSA 4CK2A 3GV5B 2P9PB 4WZMA 2UUTA 4EUVA 3QMQA 3MXIA 2VQEF 4OV6A 4USWA 2C2KB 1NBWA 3R2CJ 2IM2A 3EL2A 3ILJA 1YJVA 5EVZA 2FC8A 3DLKB 1YIJS 3ZO7A 1X7VA 4OZNA 2JNJA 2W42A 2DHHA 3ATVA 1SXLA 2O4GA 2XZDB 5KFKA 4M5NA 1WJ9A 1HARA 2QWNA 3DGVA 1FRJA 2RKIA 3UDCA 2VU5A 4NB4A 4IFVA 3KLFB 3O4QA 5GAHP 2W9CB 2R7QA 1R8CA 4WF9L 3Q8RB 1S6QA 2HHHJ 3U02A 1YJUA 4EO6A 3THXB 2HVHA 1SPBP 2DISA 1HMVB 1QY7A 1K8KA 2B3TB 1N36K 2ASPA 2J5AA 3FFIA 2P9IB 4KHPJ 4YS2A 4A8XA 3AODA 3MAHA 2XO7A 3SI8A 3PHTA 5BR8K 3BS9A 1IKVA 3CMQA 1VK8A 1VSJA 1SH3A 2XLJA 3EVMA 4K42A 3CDWA 3MM8B 3ZZOA 4CHPA 2VQEK 1RWUA 1VRTA 3G8QA 2Z2MA 1KNZA 4QIWD 4ZVQB 3H3OB 5LT5A 2FHKA 3L7UA 2HNDB 1F1BB 2A42A 1FDDA 1JCFA 4KGXB 2DPIA 2OP5A 3AD8C 3VPZA 2N4CA 2H51B 4J5OA 2UYTA 5GAEI 3M8SA 3QGHA 4KH6A 4NLUA 2R8IA 1LW0A 3H45C 2FJAB 4LRDA 2W9BB 4LSNB 4M5DA 4CGHA 3PJWA 1FWPA 4ZPAA 4IOCQ 4E7JA 2BYCA 2HHQA 3F41A 5D4NA 4DG1B 5J1PA 4ECTA 2PGCA 4C8ZA 4HWIA 2YKAA 4DMZA 2VF3A 1G99A 3FZLA 2Q79A 2LLZA 4CO5A 2OEKA 1ZTWA 3VERA 1U26A 1IBMJ 4ZLPA 2RN2A 4ECWA 2HVZA 5T41A 3BYPA 2PIIA 4QYZK 5DDPC 3NDKA 4AQYF 3SCXA 4I2QB 4NXMF 3I8DA 3VGUA 2DFFA 2DR5A 4QQBA 5D4LA 5D0EA 3GFHA 4ZHRA 4CLPA 4BVPA 4O3RA 4B8AB 4ZP7A 2JRSA 3T6JA 1S5ZA 4FLTA 3CDEA 2Q1NA 2FF6A 2XZWA 4O3QA 2R7SA 3K8VA 1CC8A 3TTFA 4CO1A 1FW6A 3AA4A 4JK9A 1NGCA 3KK2B 4P2SA 1J27A 3T5KA 1KQSM 2W7OA 1FEHA 2UVUA 2MJUA 4ECSA 2ZH5A 5HQLA 1J54A 1X4HA 4FLWA 4JKCA 3K7RA 4F50A 4W5RA 1MDUB 4JKHA 2PBDA 1PKUA 3M6VA 3MXMA 3SNNA 3UPFA 5A2QO 1Z25A 2E4LA 1GQEA 3BGRA 5ADXH 3TO8A 5AZIA 1RT7A 3QLHA 1VRQC 2YKNB 4NCGB 1L3SA 4E0DA 2A3JA 3L95X 4AM7A 3BF3A 2B4UA 3T41A 3HJFA 5JVGL 5B0GA 1QSSA 5M1KA 4AQYK 4L73A 2ZJRQ 2QA4S 4NXMK 3EGVA 2RDDA 3J7Z5 3GFYA 1WELA 1SL2A 2CQ1A 3SBGA 2MB0B 3T5LA 3N9UC 3D7EO 1OS5A 1FCAA 3VQ8A 3TAPA 1R8AA 2B4PA 1Y3KA 3CJRA 2LXFA 1X3MA 3VGVA 1XMQF 2UP1A 4LF8F 2CAJA 3AJ2A 2RUSA 5FPMA 4OKEA 3CJSA 3IRXB 1NPKA 1RLDA 4OYIA 3VVUA 5HL7Q 2ZD1B 1JKHA 1OWXA 1YITS 3M2RB 2YHWA 4A2BA 3E51A 2YXLA 1RBUA 4DHYA 2D1KA 1REVB 3DRRB 2DGWA 2CG8A 2PFDA 4PG6A 2EG2A 5GAGU 1G1XA 4M3YA 2YWEA 4CZCA 4CDIA 1UZDA 4K4XA 2CQPA 4NYPA 3CG7A 3LTOA 4E7LA 5A8KB 1KOHA 5BN9A 4Z4GA 4ES3A 2CZ9A 5IM0B 3MOJB 4FL9A 2PI5A 1F9HA 3TSUA 2KXFA 1HPZA 1NK5A 5KOWA 4YR2A 2V69A 3I9ZA 3AFGA 4CM2A 1XMQK 4LF8K 4DV5K 3O9SA 3FEXB 5I3QA 2UUWA 5KFMA 4RBUA 4YOYA 5AFUH 3L7OA 1T6CA 3MECB 1OPZA 3VGTA 5DM6Q 2HMIA 4EAHD 5KQDA 3VCDA 2PAVA 1JXVA 4F02A 1TKDA 2GELA 3DOMB 4LFBJ 3MXJA 2QMXA 5BRHA 3SUOA 2RUGA 4CJSA 3HLUA 3ZYYX 1VR6A 1WSRA 3TP2A 2E5GA 2P9NB 2YJEA 1RQ0A 3CJ7A 3OFEA 3CCRN 1HLUA 3JSBA 5KFDA 2QA1A 2M0GB 3V4MA 1OH6A 3R2DJ 3TAQA 3O4WA 4PPDA 1U7LA 5GMDA 1Y0HA 1RFQA 3C7NA 3O5BA 5KGXA 3P3DA 3CPWM 4RW8A 3T7ZA 1FKOB 3QWPA 2EW9A 3HK2A 2ZVIA 1Q7YT 1P90A 4A61A 1ZS6A 4K4YA 5B0CA 1UPPA 1N5SA 1FXLA 3UN2A 1YBAA 2DNGA 2Q2RA 2A2DA 2CVEA 2HHWA 4NCAA 4JV1A 4JYAF 4FZYA 1KP6A 1OIAA 3W8PA 4E2FB 3GE9A 3IDHA 3A13A 3ZSVA 3HJVA 2VPZB 4JI1F 2HG4A 3BPSP 4CI0B 4K4VA 1S9FA 5D0RA 1RT3B 2XNRA 3A5MC 4J2EA 3SLCA 1RBSA 4MMOA 1GLLO 4A5BA 4ZS6A 3JXUA 3QO9A 2DO0A 2CZ4A 4HVZA 2DGXA 2Q66A 1S6UA 3CJ3A 3B78A 3PDNA 3T1HF 4CGDA 1N34K 2J9DE 2YV0X 1BU6O 4KH1B 3DC2A 2JZ5A 1VQ4S 1ZBSA 1NKBA 3DGPA 4PG7A 2FHJD 4HT5A 1DGKN 4MQ3A 4ZVFA 1AUDA 3H5XA 2VPWB 1XIQA 2KG1A 4DV2K 1VS3A 5D77A 3BKUA 3O1LA 1C0UB 4AL5A 4W4MA 5AQMA 3QZ8A 5BREA 3ZTSA 3DLGB 1R3NA 3OHRA 4ISEA 4JYAK 4DCOB 1HNXJ 3R1XA 3ID8A 3M3ZA 1WORA 1VC6A 4M3ZA 4QW8A 2HFZA 4JV5J 3ENAA 4QWDA 4KKOA 3PJXA 4USTA 4TU9A 3I55N 3OL7A 2AJQA 2XI2A 4TY9A 4I6MA 3OYBA 2GMHA 2HQCA 4X4PA 5IOLA 3GG4A 1ZPVA 1PBUA 3L2UA 4BRCA 3FRZA 2HRTA 1F9FA 1AXQA 3W7BA 3IRWP 3PHEA 2J6UA 1GOBA 3EICA 2YKMA 4HHJA 2XGQA 2O8CB 3CD7A 3HHLD 2IVOA 2YHXA 3D2EA 5SUHA 1SQFA 3WUHA 4WP9A 1RCOB 3CTRA 4ZVUB 2XBPA 3ISNC 3POTA 1WC5A 2BM1A 2L3MA 5GMEA 1JXBA 3FR0A 4DZDA 4EBDA 3Q89A 4B3MF 3CVKA 4RTFD 1REGX 3IWNC 1VAZA 4BC7A 1B0VA 4Z4HA 4HHHA 3MD3A 3EEQA 4DR6J 3R6MA 3M2VA 4PWDB 4MFBB 2H3GX 2W7PA 4LF4F 4OQJA 4BE0A 1I6JA 2LQ8A 2QX0A 5L1IA 2IHR1 3MCAB 3D1OA 2XI3A 2PSZA 3ZNJ1 4B1YB 4IG3B 3GR1A 4RJVA 1W2BR 2F7VA 1XHXA 2E9ZA 1UVKA 2J9CA 2XO6A 4HHUA 1BHNA 2QL7B 4RUAA 4W5QA 4IG0A 3OTBA 2K06A 4TLRA 4O3NA 1CLQA 4N76A 4KQZA 4FK4A 1B0PA 2OPRA 3C6UB 1KHVA 2FHMA 1H7WA 1Z1ZA 3R5CA 1XC3A 3CCVN 3G6EN 1I39A 1HHQA 4EMDA 3M8PB 4B3MK 1JCGA 1JNRB 1VHFA 2GJFA 2F40A 5D15A 2WOMA 4BHQA 1QVFM 3EE3A 2J8AA 5J2MB 2QEXS 1CEZA 3HOSA 1RJJA 2ACYA 4E98A 4X4QA 4B3TF 2Z1IA 2LQJA 4DLEA 4DQRA 4FJ7A 5HQMA 3KK1B 5DDRC 3MM9B 3KK7A 1HW9A 4LF4K 4BROA 1N33J 2BV3A 3MMCB 3THPA 3TA0A 4WJBA 1DLOA 3Q0AA 3V1OA 4RW4B 2P2CB 3DOLA 1HNWJ 1FJGF 4GV9A 3BKTA 2I2YA 1UTAA 1SQKA 3DCAA 3SAGA 4CIOA 3H8YA 2X1AA 1Y00A 4H4OA 4K0KJ 1TL7B 1FXRA 4DL4A 4K4TA 3NNAA 1K1QA 3OYNA 2YQ0A 4O4RA 1NJIT 2D1CA 1X3NA 2DXFA 3UKUB 2WC9A 3CMAN 4EP5A 4ZDNA 4HTJA 2P6TA 5IT4A 1V5VA 4FWQA 2VZ9A 3VWSA 5E0OA 1DHMA 1SV5B 3GP9A 1OYEA 2V34A 4BRFA 5GAEP 3TEHB 2CPYA 4B3TK 1FD8A 2ASJA 4CW7B 4NYFA 2IRYA 4H4MA 1VQ7N 1VSKA 5I3UA 4NX9A 3ZTRA 2UVRA 3HKWA 3P49B 4CBWA 5AQGA 1LW2A 2I0XA 4DLGA 2P9PA 4KI4A 4LSLA 1N56A 5H9FJ 2KM8C 1XNQJ 3VGLA 1WSGA 2GHVC 4YOTA 2QWOA 2OFHX 1ZM9A 3DLKA 2QIFA 2J9DA 3QBCA 4GKJF 1JJ2R 1Q9XA 4PG4A 2Q0RA 2ZC3A 1NK7A 2DNRA 4Z7YA 2ZKUA 3EKSA 3DRSA 1GK8A 3FE1A 4JKDA 4ED5A 3F2KA 2D0CA 3KLFA 4C2MA 3FLCO 2W9CA 4YDUA 2KG0A 3ULHA 2IA6A 3IO1A 3HZEA 4CO2A 3THXA 3M1FA 3C6AA 4U7UK 4X65F 5JLHA 4BACA 1TVRA 2YTCA 4DR5J 3L2RA 4I9LA 3TAGA 2ZZNA 2AD9A 8AT1B 4WXOA 4C1NK 2YNFB 2P9IA 2MZQA 1D0EA 2V2ZA 1IV0A 1NRKA 3O3HA 4O0JA 4FM1A 4MJKA 2HHPA 2CVIA 3IS9B 5CZ2A 3D0IE 2ZZTA 3KJVA 1ZH5A 4LH5A 2Y1LB 4ED1A 4OHZA 1HNVB 3GFZA 2UUCJ 1VQPS 4KTZA 4M3TA 5LMNJ 3GFXA 1EP4A 2P8IA 4HDGA 4GKJK 2HW3A 3J7AN 4DOZA 4IRCA 3GJSB 1OPIA 2O8BB 3CDBA 4DSKA 1U49A 4LFCF 2DHSA 4QW9A 4KTQA 4LF5F 3M6WA 2B9EA 2G2OA 2KRRA 1M5PC 4CZJA 2GO9A 1D9AA 1FFGB 2YNGB 4QIFA 1WB9A 5KFNA 2IS3A 2BGGA 2BKOA 4X65K 4OLOA 3AA2A 1RTIB 2EWHA 2ITMA 1EXQA 4PL7A 3MM5B 3D7SB 5DMRA 4KHWA 3J80Y 3O3LA 2WSFC 2WUSA 3KK3B 2F9JA 5K9FA 4I2PA 2C2MB 1FKPA 1N5YB 4Z94A 2G8UA 3R5GA 1NCLA 4FXVA 1SQEA 1UFWA 4DG1A 3CFPA 3SCKE 1PO6A 4NYZA 3R5DA 3AVNA 2HPUA 1IBKK 3J81j 2BR0A 1FF2A 4CJKA 4MKVA 4ILHA 4CNZA 3MM6B 4FLVA 2LXIA 1OO0B 3SBTA 2VBYA 4OPAA 3LP1B 4KAZA 3ALYA 5KT7A 3SQGB 4X4NA 3CMES 4I2QA 1RDAA 4IO8A 2I5JB 4LFCK 4BE1A 1Z2LA 4LF5K 1UMJA 3DDIA 2MXYA 3S41A 3J81U 4ZVPB 3MAAA 4TY8B 2EFOA 3ATUA 4ITSA 4UOCA 1AFIA 2XHWA 4B3RF 3MN9A 2OPSA 2C3PA 5CYMA 5HLFB 4FDFA 4PHTX 3KK2A 3DLJA 5I9EB 2P6SA 4EK2A 3A8YA 1RWPB 2ZM6J 3GE1A 3HP9A 3VA0A 5HMYA 3L3UA 1H6KX 3LH2S 1OY6A 1AT1B 3OVAA 4RU2A 1I94J 4H5VA 2NRWA 5CE3A 2IMOA 3M1VB 2NQPA 2OIHA 2OTJN 1ASWA 3PW4A 2FZGB 1KQFB 3OYAA 2VV5A 2YKNA 2H3EB 2HQGA 3C14A 1KCFA 3KJFB 2EKNA 1IJFB 2MZTA 1TUVA 1U0HA 3HXMA 4KC5A 4PCQA 3TTDA 1IKXB 2IJNA 2VC1A 2VKRA 4LF7F 2BA9A 1WEYA 5KOXA 1ASVA 1A5VA 4BR4A 4KGZB 4WKRA 4GVLA 4YOUA 3SZ2A 5KG4A 4FJMA 2XY8A 5ETTA 3JB9k 6FD1A 1DTTB 3UDLA 3PG9A 2OYQA 3W2VA 3CXCM 3ZXWA 1NJXA 2DGTA 3V1RA 5HATA 1NWKA 2AYEA 2DY1A 3Q7BA 4G1PA 3MX2A 1FD2A 1HD0A 4YEAA 4FPRA 2CPZA 3CSKA 3DRRA 4CLLA 4OZLA 4DFMA 4FJNA 3KNAA 2W4CA 2WZ1A 3UI3A 1BA0A 4DQQA 1SI9A 4N8OA 4ZJOA 4ID1A 4ELVA 2FJXA 5A8KA 1TL1B 2J4RA 4BR0A 1WSVA 5CABA 3RBEA 3FRYA 5C7PA 5IM0A 5DGBA 1S7HA 4F4KA 3ZX3A 3GIKA 3JSMA 4CVNE 1XMBA 3IR7B 1LWEB 4LF7K 2QE5A 3H20A 1WC1A 4PZVA 3NBPA 1NJWA 3PX6A 2GQ2A 1BC6A 3HP6A 2E1CA 2OAUA 2NLXA 5I3PA 4DR1F 1OQ3A 2BH1A 3HSJA 1TAQA 4CFAA 4EGLA 3HM8A 2RRAA 1VBZA 5KFZA 2YHYA 1BUPA 1WOQA 5HRRA 5KFYA 2R7TA 3VHQA 5KG3A 1K6YA 1NGAA 2P9NA 3CJAA 3V6KA 5DK5A 3EJMA 4RW9B 4PUOB 3PCOB 3NGDA 1T05A 2LP4A 3FGVA 4TU7A 2BVZA 2LFVA 2QW9A 1X9WA 4EZ9A 1YTAA 2PFUA 4DQIA 5FPEA 3NGKA 3K9JA 1FKOA 4CK1A 2GCFA 2OO4A 5AXKA 3BGLA 2YH0A 1TUGB 2ASOA 1NPPA 1M1HA 3G25A 4CHZA 3PSIA 1Q7LB 1C1CA 5IWAF 1MW7A 1HYSB 3L8BA 1S1UB 2JVRA 2DITA 3V6JA 2E7WA 3OFHA 1YI2S 2GMJA 2BXJA 4DR1K 3VF6A 4FKYA 2XS5A 5JS1A 2E6LA 3I4HX 3U4LA 4QS7A 4CD3A 1H74A 4FJJA 3P96A 4JOUA 1BQNB 3B54A 3J80O 3CJCA 1N6QB 2X6NA 4U7UD 1HPMA 2V9KA 3VQ7A 3SSSA 4BG9A 4AHCA 4D3HA 2DO4A 2M5YA 1QSLA 3T9NA 2XY7A 1BQMB 3T1YF 5KT5A 3BR8A 4DV3J 2Q6CA 2Z30B 5L38A 3ZETB 3SQ0A 1RAOA 4UW2A 2XYPB 3RRGA 2UXBJ 2JL9A 2DNYA 5E84A 1SKSA 5KT2A 2O4IA 4E7KA 1Y9OA 4ZMMA 1M90O 1LKZA 1RABB 1O6XA 2V7ZA 3A8IA 1QE1A 5J2PA 3U1LA 1QQNA 3DLGA 4ZP8A 4KR0B 3VAKA 1D9FA 1RADB 2VCPA 2GQCA 1OYDA 3I56N 3LGNA 4B3SF 1KS2A 3MPVA 4DV7F 3L4QA 5JJBA 2ERRA 2JLEA 2E1PA 1XR7A 2CGKA 2GTDA 3OS0A 1DKGD 3NLCA 1IG9A 3AVGA 3M8QB 5AT1B 4FVUA 2KKZA 3TZZA 3AAQA 4YR3A 4KHRA 3H08A 3S3OA 2DPJA 4J9NA 3T1YK 5F8IA 2XTJP 4IDKB 2UUBF 1VSDA 3QNOA 2SXLA 4PAAA 2GJIA 3MMAA 2O8CA 3MMVA 2HNZA 3GB0A 2GIRA 4LD0A 1DBDA 1TAUA 3BKFA 2VG5B 3V81B 2QG9B 3CI5A 3EWGA 4F36A 1X4AA 1JLGB 3DXMA 4M41A 7FD1A 5HOOA 3P4IA 2IY5B 3QZ7A 1WSJA 2KN4A 4PKDB 1YXQA 3OQ2A 1R7IA 5LXRA 4B3SK 4BR7A 3AO3A 3UE5A 1VQ6N 2Z4PA 1T03B 4RCHA 1OJ4A 5CH7B 2FBYA 1NZ8A 4KB0A 2YHAA 2EKYA 5KGWA 2VUGA 2NSCA 3P5TL 3E01B 3FSXA 3KLIB 4W90B 1CZBA 5H9EJ 3THVA 2VBWA 3ILLA 3M6GA 4EYIB 3PW0A 2UUBK 5CHCB 1LXJA 1R8PA 1CXQA 1YHQN 4WPAA 1NK8A 1MWYA 2FJEB 3CJ0A 1QAYA 4ICLB 3AVJA 5DQIA 3SAHA 4B9TA 2EK1A 3EXYA 2GUPA 4HCCA 1C0FA 5BPLA 1Q8LA 1R6VA 5GAGI 1WTFA 3C6UA 5HP1B 1Q81T 1DTQA 2XLKA 2DFHA 4WK3A 2N7CA 4FYVB 2PN6A 4M63A 3HHLB 1VLOA 4OHYA 3ZSRA 4YDXA 1TK0A 1URNA 1UZHA 2CIMA 4NEZA 3LWMA 3WX4A 3NMUA 4ED4A 3PIPQ 3AOCA 2D0BA 5J2MA 2YCHA 1DFDA 2G9OA 4CEEA 4XAKA 5E3QA 4L8RB 4M5JA 1FXDA 4AD6A 3KK1A 4CGJA 3MM9A 3C95A 4KRWA 3OUYA 3MMCA 2F63A 1KVAA 2FF3B 4U95A 1YG0A 4NPOA 1EKEA 2KFZA 1BQXA 4F8RA 2DH7A 5T14A 1HKGA 1KFDA 3TUIC 3D45A 1V4SA 2CXEA 4JHDB 1RTZA 3QEIA 4DN9A 1VBYA 2GIQA 3DI6A 2LXUA 4E1JA 1VHXA 1TL7A 4I6WA 4Y6IA 3QAUA 1CJVB 5EX0A 4OPJA 3DYAB 4PA1A 4X64F 5DS7A 5CZVA 4O3OA 1XI1A 4AL7A 3UKUA 1WTBA 5IT9Y 3FBFA 4FJ5A 1HNIA 4KV8B 1AYEA 1UW9A 4LSZB 1HR0F 4M3RA 3RW7A 2DB1A 2KHDA 3GIMA 2GHWA 2XS7A 3QNNA 2K1RB 4JP8A 2QV6A 2CJKA 1LK5A 3AVMA 4R5PA 3V6DA 5IFMA 4FJKA 4JI4J 4FBUA 4RNHA 4TQSA 1E3MA 3OLAA 3PIOL 5LOQA 1QM9A 1JLCB 2EWSA 1RAFB 1U6BA 3NH0A 4YQWA 2YWKA 4RU9A 4DF8A 3QETA 4JI6J 2Q43A 3IWXA 1YZ6A 1B4SA 1X9MA 4X62F 1M5KC 2E5IA 3M6XA 1RWXB 1GMWA 1X60A 2IVYA 1QAIA 2RB7A 1FERA 3L3VA 3RB6A 5JLFA 1SL1A 4LY7A 1W2BM 3CJBA 4FS2A 3D2WA 3OVBA 2RHQB 1E4FT 2OFGX 3EZOA 2MQQA 2APOA 2D5RA 4N56A 2F7TA 1HBOB 5G0RA 4RWXA 3SQOP 4X64K 2J0QD 3DOKB 1SJ1A 3NS5A 5AQJA 3MMJA 4BC4A 4AHVA 1ZOTA 1GLAG 3C16A 5F9NA 1Q8KA 3RBZA 5LJ3Y 3ADAC 4LF9J 5DGAA 4Z2XA 3ZSQA 3I9V9 5B7WA 3FZ2A 2YNFA 4M95A 1E6YB 1S0VA 1CJUA 2B5JA 5F3ZA 3K57A 1J5EJ 3O8MA 4CGFA 3PR5B 3V9UA 4X66J 1FRLA 1DAXA 4IOCL 2FSKA 3CC7N 1GNKA 3IS9A