2WONA

Crystal structure of uk-453061 bound to hiv-1 reverse transcriptase (wild-type).
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lersivirine: A Non-Nucleoside Reverse Transcriptase Inhibitor with Activity Against Drug- Resistant Human Immunodeficiency Virus-1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2wonA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wonA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wonA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wonA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2wonA05
4N47A 3EPGA 1NK7A 4WFXA 3NDKA 4R8UA 4WE1A 3SFGA 4QWAA 3GV5B 3OJSA 1QAJA 2QXFA 4ICLA 2R8GA 4NLGA 3DRSA 2E9ZA 1HRHA 4KHUA 2X6SA 3G6VA 2RDIA 2V0NA 3MXIA 2BDPA 4FLZA 1ZBUA 1HMVA 3OYDA 2YNGB 1WNSA 4M45A 2GC8A 1WNEA 4DS5A 1RT4A 1DTQB 4RW4A 4CJQA 3O4QA 3QESA 4G1QA 4FLYA 1Z4UA 2ZKUA 3L2QA 3NAHA 1C0TB 3HPOA 1FKOB 4NLPA 2HNZB 5FDLB 3IG1B 3OYMA 5J2MB 4RW7B 3CDWA 4ECRA 1XR7A 4IKAA 4CJRA 1RILA 3CIZA 4BACA 1S4FA 4OLBA 2IS3A 3DOLB 4TSXA 4DTJA 1R0AB 1RDRA 1HQUA 4FVMA 3WNGA 1VSHA 3CJ0A 1EKEA 4KPYA 4F4KA 1SUQB 3G10A 4E3SA 3PO5A 4H4MB 3PJWA 2KTQA 3MEDB 3M8QB 3SQ1A 5EWEA 4CHOA 3TAQA 4DF4A 1QHTA 2IBKA 2PZSA 4B9NA 1JLAA 5JUMA 4IFYA 2VG5A 4DFPA 4ZPDA 3KLIA 4ED3A 2OPRB 5FROA 4CF8A 5J1EB 3DOKB 1L3UA 2G8FA 3V9XA 4O5BA 1Z26A 2E6MA 3FFIB 1RA6A 2Z1HA 3NFAA 4DQRA 3LPUA 3TWHA 4WYWA 5CY4A 3DRPB 5FRNA 4DU4A 2BANB 3BSCA 3WNHA 3S3OA 4NLRA 4QAGA 3V81A 1TK5A 1VSLA 4KE5A 4DU3A 1NK8A 1RT2B 1S1UB 4MIBA 2WB4A 3AVHA 3KMSA 4IRKA 5CYMA 5HROB 2OPQB 1NJZA 1SUQA 4RW9B 3LAKA 3N6MA 3RMDA 2W7PA 3JSMB 1ASWA 4AHRA 4WZQA 4HUFA 1W0HA 4FYDA 3QYYA 4AILC 4GVMA 4B9TA 5J2NB 3OYFA 5F8MA 3CYMA 4FK0A 1JX4A 3NF7A 4CHQA 1HNVB 3RB3A 4GMJB 4NCGB 4EP5A 2D3UA 1K6YA 4F2SA 3TAGA 3MXMA 5CYMB 1GOCA 4DFMA 4DEZA 3SUNA 2ALZA 2AQ4A 2X74A 2C2EA 4U6PA 3HPGA 1VSDA 5KTQA 2ZD1B 2ZE2A 1C1CA 3SI6A 4FJIA 2HAIA 1RNHA 3AVLA 4WFZA 2WCXA 3ULDA 3KMQA 4BDYA 5KFXA 4FLVA 3U3YA 4FZYA 2HNDB 2B43A 4CIGA 4TXSA 4ED8A 2IM0A 3GQCA 4I9QA 4FBUA 2ASJA 2XY5A 3MEGB 1UOCA 4ICLB 4ECVA 1C1AA 3S9HA 1DTTB 2PYLA 5KFDA 4IG0A 4KHRA 5DG7A 4DQSA 1RT1B 1U45A 3K2PA 4EYHB 4FZXC 1FK9A 1ZBFA 1G15A 3V6KA 1A5WA 1KTQA 5KFPA 1RT4B 4RNOA 3NGDA 4ECXA 4QOZB 3VQBA 4KBIA 4ID1A 3DLGA 3MR6A 2XWYA 1CLQA 2IDOA 1SKWA 2YNFB 4Q0BB 4ED7A 3MEGA 4AHTA 3QZ8A 1VSJA 4Y34A 1U4BA 4QWEA 4KSEB 4M3RA 3A2FA 3H59A 4TLRA 2XRIA 4Q5VA 5KGWA 2P51A 3AVFA 5KRTA 3NF9A 4ZHRB 4QCLA 1K1QA 1ZTTA 2ILZA 2V4RA 1RA7A 1TVRB 4KKOA 2XI3A 5KFAA 1ASUA 4OPJA 1RT7B 3ASMA 1JKHA 2ITGA 3HVWA 2ASDA 3KKRA 3AA5X 2GUIA 1QAIA 4M3YA 5KFHA 3KHGA 3M9MB 1N5YB 3B6PA 3G6XA 2YKNA 3OS1A 1RTHB 3OL8A 4Y2CA 1LAWA 4BDPA 4KREA 2WHOA 2I1RA 5DK5A 4B9UA 4N76A 1LW2A 2AX1A 4I2QA 5KFBA 4E89A 4DWIA 3ZSXA 3NH0A 4NYFA 1YVFA 3I0RB 2R8IA 4JV2A 5KT4A 3QEPA 1L5UA 5KFWA 1S9EB 2KZZA 1NK4A 4EYIB 4L8RB 3SCXA 4E0DA 2IAJB 1CXQA 2IM3A 1BISA 4WXOA 3HP9A 4H8KA 2V4QA 5DQGA 4EBEA 1RAJA 4MH8A 3VQ8A 5CZ1A 1S97A 3QETA 1I3AA 2JEFA 4KB1A 1LWEA 1JLCB 4RNMA 1D1UA 3VQ6A 1L3SA 3LANA 4NLQA 5L1LA 2E9RX 4EZ9A 4QW8A 1RTIB 1U48A 4ZVGA 3P83D 2HHTA 3I0RA 1TV6A 2GIRA 3DLKA 3DLHA 3CG7A 4DS4A 1S9EA 4KRFA 2P1JA 1TKXB 5C25B 4OGEA 1ZETA 4M3UA 2FLPA 4ZP6A 1IO2A 3OS0A 2BRLA 4Y1CA 1LWCA 3LP2A 3H08A 1S1TA 1HNIB 2HHSA 3ZT1A 3H5XA 4NCBA 3H5UA 4WE1B 2JGUA 4M3TA 2WONA 4PQUB 2C28A 4TN2A 1RT3B 5F8NA 3T3FA 2D0AA 4W5OA 4YR0A 3C6TA 3KLFB 4MK9A 5T14A 2WOMA 4ID5B 4FJJA 4Z4FA 3B6OA 1NK5A 2HHUA 2YV0X 4KFBA 4BWMA 3EZ5A 4JV1A 1DTQA 3I5BA 5KG1A 5KG3A 1S1XA 5HLFB 1IKWA 1NJWA 1NK6A 2KZMA 1JLFB 2RKIB 3BR9A 1D0EA 1C2PA 1C0TA 4IFVB 4FJHA 1JKHB 1RTIA 5J2QB 4ECYA 4H4OA 5KFJA 3DI6A 3C6TB 3KLFA 5C24B 3TVKA 1KLNA 3LPTA 1X9SA 4QWDA 4XPEA 4WXWA 2VA2A 3L2WA 4Z0UA 4YNQA 3AVMA 2HNYB 4FM1A 5J2PB 1LV5A 4KHQA 4QPXA 3U6FA 4PA1A 5HP1A 4QWBA 4OJRA 3HVTB 1FXXA 1XC9A 4DFJA 4F8RA 3OYJA 1BHLA 5KFMA 3QO9B 3ZT3A 3O3FA 1RDCA 1JXBA 3ITHA 4DSFA 4IG0B 4RUCA 4ZP8A 4RW7A 1J53A 3ZT2A 3OL6A 1TL1B 5F8JA 3KOAA 2C2RA 5KT6A 3PW2A 2UVWA 3M8RA 2HVHA 4AHUA 4Y2AA 4NLUA 5HRNA 3ZT0A 4K4TA 4DSJA 2V9WA 3CFRA 3BDPA 2Z1JA 3BSAA 2OPPB 5F9LA 2Y1JA 5DLFA 4CHYA 4RNFA 3TAFA 1BQMA 1RBTA 1L3TA 4XPCA 2GIQA 3TAMA 1N48A 4KO0A 1S6QB 3LP2B 3C94A 2BQUA 4DG1A 3DYAA 1IG9A 4KHYA 4FM0A 1TP7A 3RAQA 3MEEB 3KLHB 3HKWA 3RB0A 4CEAA 1KVBA 3OYKA 3K5OA 3KTQA 2KFZA 3CFOA 3IS9A 3ZCMA 5D3GA 3OYGA 4ECWA 3FRZA 1LAVA 3NGIA 1SH0A 1B9FA 2HHXA 4OKKA 3PW0A 3OYAA 5KFYA 3RR7A 4O3OA 3OYEA 4NLDA 3V9UA 3NCIA 1IKXA 4R0EA 5DLGA 4ELTA 1NKEA 3Q8QB 4Q45A 4IOBA 3KIOA 3FSIA 4KB7A 1IKYA 2OA8A 3SZ2A 2HHWA 3HP6A 1ASVA 3JSMA 4KHMA 2FVPA 4YFUA 3MR3A 4KAZA 4FJGA 1BIUA 1TKXA 3RBDA 4OLAA 3MFHA 5F8LA 4CGDA 4FJ5A 1KFSA 2HWHA 3M8PA 4J9QA 5C42B 2W8KA 4AH9A 5HRSA 4IRCA 1W25A 4K8ZA 1VRTA 4MKAA 1RT6B 1VSFA 4ELVA 4RW8A 3MECA 5I42B 2XGQA 3D0PA 3AO5A 3EPIA 3DM2A 1UWBA 4CEFA 3EY1A 3CM6A 4AHVA 1L3VA 4C8LA 4DU1A 4CJWA 1EP4A 3DLRA 4DL5A 1HYVA 4PUOB 5KFEA 4FLUA 3QZ7A 3OL9A 3IGVA 3SV4A 2AGOA 4HYKA 3OSNA 3V1RA 4BE2A 4AHSA 3SQ2A 4TY9A 1TKDA 3BSNA 2OPSA 2IOCA 4EZ6A 1RTHA 4B8CA 3NAIA 3DLBA 3TARA 1T7PA 2OPQA 1IKVA 3IG1A 3DM2B 5J2MA 4CGGA 2YNHB 2R8HA 3T19A 4FLWA 4RW9A 4M94A 3IN5A 2HMIA 1REVA 1IM4A 3KJVB 3KK2B 4RZRA 4RNHA 3NBPB 2YKMB 4B8AB 1WAFA 4ED1A 1A5VA 1IKWB 3IGNA 5HBMB 4DTUA 2YNFA 2Q3SA 3PW5A 2O5DA 3BGRB 4IH7A 1DLOA 4B3OB 4CERA 1JLGA 1MU2B 1RT7A 1RDDA 3RMAA 1NK9A 3KLEA 3HXMA 1T05A 1EP4B 3UDLA 1BIZA 5EWGA 3OYIA 2G8UA 3OVNA 2YKNB 2ZE2B 5KFNA 2XCAA 4PUOA 2FVQA 2YHBA 3HSTB 3SUOA 3I0SB 4Y1DA 2W9BB 2YKMA 5KRSA 4K50A 1BL3A 3SYZA 3RB4A 3ICLA 2R2SA 2B6AB 1N6QB 4FZZA 1C6VA 3BQ2A 4DFKA 3BGRA 4CJLA 4K4UA 5T7BA 3IRXA 4YMEA 4K4SA 3V6DA 1BGXT 2FVSA 5E41A 3ISNC 5DGBA 4TQSA 3TAMB 3OY9A 4IH6A 1HYZA 4E7LA 4URGA 1T05B 5KFQA 5KFVA 5KFCA 1VRTB 4W5TA 2FJVA 3NAEA 1JLCA 5DGAA 2IA6A 3AA3A 2JEGA 4IRDA 4CGIA 5I42A 4LSLA 4URQU 3OS2A 1HPZB 1GOBA 4CCHA 2X6NA 4JS5A 1HYSA 4CJFA 2B6AA 2AJQA 2W42A 4NZ0A 3OHBA 3KKSA 4NLOA 2D5RA 1JLQA 3N6LA 4HUGA 2YNIB 3GV8B 5KFOA 2P5OA 1QS4A 1J5OB 1D8YA 4H4OB 1JLBA 2XI2A 3M9OB 3AVIA 1SH2A 3CJ5A 2W9CB 3O3GA 3NGYA 2ASLA 3DOLA 3SUQA 1BQNB 1QQCA 2Z1IA 3PUFA 3PJXA 1LW0B 1TGOA 4GC6A 2E9TA 4JLHA 2W9BA 3IS9B 2ZQBA 2B5JB 3LP1A 4CFBA 3RRHA 4CFAA 4I2PB 3OSPA 3V6HA 3VQ4A 1VSIA 1TK0A 1SL0A 4ECQA 5KG2A 3H98A 5KG6A 4H54A 3I5AA 3VQQA 4JRPA 1O1WA 4BWJA 4NLVA 1NNDA 3OYNA 2WTFA 2D0CA 1FKPB 3SNNA 3K5MA 3HPHA 4CJ5A 3LP0B 4O4GA 2IJFA 3TQ1A 4R5PB 3P5JA 4YR3A 5KFLA 3OHAA 4CJEA 1GOAA 3PX6A 4Z4CA 3LWMA 4IG3B 4ZHRA 3NH2A 1IKYB 1ITGA 1KLMB 1RT1A 5I3UB 2VG6B 3V4IB 3C95A 2WOMB 4ID5A 4RU9A 2BE2B 4RG8A 4NLYA 1HJRA 3WNFA 1RT5A 3QGIA 3H4BA 3Q8SB 5J2NA 4CECA 5L1KA 3KHRA 2FBVA 4MFBA 1Q9YA 4CHPA 3ZSQA 2IM2A 4NYNA 3C6UA 4LSNA 4TYBA 4RW8B 4CHNA 4DL4A 4U7CA 2QK9A 3MR5A 2FC0A 1N4LA 1RTDB 3CDUA 4IR9A 1JLEB 4WFYA 1IH7A 2DY4A 4FK2A 2AWZA 4CGJA 4HCBA 4B08A 2HNYA 3T5HA 1T3NA 4CJKA 3VA3A 5JXSA 4O0IA 2KQ2A 2IC3A 4CIEA 5KT5A 2RPIA 5JS1A 3T5KA 1WSIA 5F8HA 3K57A 3NMAA 4IG3A 1QE1A 4J9SA 5DG9A 2FLLA 3BJYA 4DTSA 3OJUA 2R2RA 1KFDA 4EP4A 3DOKA 1TL1A 2HHQA 5KG5A 3V4IA 1TL3A 4Z4GA 1WN7A 1S9GB 2J6UA 4DL7A 1C0UA 2G8VA 1QUVA 3OYBA 4FS1A 1LW2B 1CXUA 1HARA 3D45A 5F8GA 2GV9A 4Q8EA 3L3UA 3RAXA 5D3GB 1RYSA 2KW4A 4I2PA 2P5GA 3NF8A 4KTWA 2LSNA 2HWIA 1QSSA 4DLGA 1T03A 1S10A 4B9LA 4J9OA 3CO9A 4FJ8A 1U04A 4MQ3A 3MECB 3G6YA 3ZT4A 1FKPA 2JLEA 5SZTA 4JS4A 5KGXA 4O4GB 3V9SA 3DDKA 4EBDA 1CZ9A 3U3GA 3L2VA 4F50A 5J1EA 1D9FA 4KHWA 2G8IA 5HLFA 3SUPA 2R8KA 5EU7A 3OYCA 1JLFA 1EXQA 4KI4A 4CEEA 2X78A 4RW6A 2BANA 3WNEA 1S1VB 4J9KA 1JLBB 4IR1A 2VWJA 5F9NA 3THVA 4IQXA 1TAUA 3QIOA 1WSGA 1S9GA 3RR8A 2YNGA 3KLIB 3NL0A 4CFCA 1NHUA 1JIHA 1HQEA 4NYZA 4IH5A 2EC0A 1VRUB 3NGZA 4Z4HA 4C8KA 1JXLA 1SL2A 3SPYA 3VQCA 1RBVA 3RWUA 1SKSA 4WZMA 3HL8A 3OYLA 5FDLA 4Z4IA 3HJFA 4PWDA 1D9DA 1X9MA 2E4LA 2RKIA 4MKBA 3AVKA 3KK1B 1ZYQA 4M3WA 1RBRA 1UWBB 4E7JA 2J6TA 3PV8A 3S3MA 1NKBA 4I7FB 2ZD1A 3HO1A 1CZBA 3HVRA 1NJYA 4E7HA 4RW6B 3DMJB 4M3XA 2HNZA 2IMWP 3AVGA 2FJXA 1YTAA 5KFSA 4ED6A 2BQ3A 3AVBA 4JUZA 2HNDA 5HRRA 1UAXA 4RUAA 3SI8A 3ZSOA 5HBMA 4B9VA 1KSPA 4DSKA 4KTZA 1S6PA 2BGGA 2JEJA 4PY5A 3ITHB 4AHCA 5KT7A 1D5AA 2VG6A 2C22A 3DLEA 4CESA 2RF2B 5L1IA 5FRMA 3H5SA 5C25A 4RW4B 1OS5A 1S0MA 1HNIA 3ZSVA 4HUEA 3VQSA 3UIQA 1EETB 1S1XB 2VG7B 4CK3A 1I6JA 4C8MA 1TKZB 1RYRA 3V6DB 3P1GA 3SQ4A 2QKBA 4M95A 1TQLA 4KO0B 4F4WA 2AU0A 1ZBHA 1CSJA 1RDAA 3KLHA 2F8EX 5DG8A 2QV6A 3CDEA 1YTUA 3V81B 3QNNA 1RT2A 1S1UA 5C42A 2RDJA 2VG7A 5KFTA 4Q0BA 1WSHA 1C1BA 2JC0A 1U09A 5L1JA 2YNIA 4OL8A 3BREA 1TKTA 3EZUA 4KB0A 4CK2A 2W7OA 1JL2A 4IBNA 3LZJA 4IFYB 4C8OA 2UUWA 3E01B 4HCCA 1RBSA 1ZBIA 3MXJA 3LALA 1VSEA 1ZBLA 3LWLA 1EETA 4G3IA 2BRKA 3CWJA 4J2AA 1TKZA 1K1SA 3S3NA 2DFFA 1NHVA 3AA2A 1C1BB 1SL1A 1FKOA 3VA0A 2I5JB 1S6QA 1XR5A 3NKYA 4K8XA 1NK0A 5HRPA 1HMVB 4E1NA 2FJWA 1C1CB 3FQKA 3K58A 1KCFA 5HROA 5CZ2A 4FW1A 4M42A 3CJ3A 3BSOA 4FJLA 4YP3A 2HHVA 4Y3CA 1U47A 4OKJA 3O4NA 4W5RA 2O4IA 4F4XA 3MR2A 4FJKA 3DLGB 3IAYA 1J9AA 1N6QA 4ED2A 4O44B 3F9KA 4M3ZA 2G8KA 1TK8A 1JLGB 4CF9A 4QW9A 3KLVA 4NRTA 4DTRA 4K4XA 4DSEA 4NLWA 3RB6A 1Z25A 4W5NA 4HVJA 5KFFA 4F2RA 4NLTA 1FK9B 2VG5B 3AA4A 2WONB 4PQUA 1HQUB 4LSLB 3I8DA 3H5YA 4CF1A 1RTDA 3MTKA 3AV9A 4O3SA 4K4VA 4OPKA 1XWLA 4M41A 1RCHA 4DTMA 3M8QA 3HM9A 1KVAA 3NE6A 4DTOA 4LY7A 1LWCB 3O3HA 4TY8B 4GC7A 3AO3A 3MAQA 2DFHA 4BE0A 1RDBA 3C6UB 4LSNB 1RTJB 2PYJA 4IKFA 4B3OA 2ATQA 3EYZA 3QEIA 2PY5A 2FVCA 3CQ8A 3RRGA 4DL3A 2B5JA 3LP1B 4G1QB 4E1MA 3GV7B 1JLQB 4OGCA 4KFBB 3D28A 2UVRA 1KHWA 3M8SA 4KHNA 5KT3A 2OZMA 5KFZA 4CJTA 4MK8A 3GIKA 4F4YA 5DQHA 1Q9XA 1S6PB 4LQ9A 1QE1B 4KI6A 4DSIA 4EBCA 3DRSB 3TAPA 5KG4A 2ILYA 4I2QB 3QIPA 1S48A 3DLEB 3UQSA 4KV8B 4B9MA 3DLKB 1C0UB 2HMIB 3VN5A 2FBYA 4CK1A 3L2UA 3NBPA 3HK2A 4N56A 4ZPAA 1VSKA 4CEQA 3AVNA 3V1QA 3M9NB 1RTJA 3V9WA 1BQMB 4TYAA 1GX6A 2OPRA 4CE9A 3TAEA 4CGHA 1IKVB 2XHBA 4ZMMA 4Z4EA 4ELUA 2IJNA 3L3VA 3LZIA 4CJUA 3MEEA 4I7FA 4I9LA 1LWFA 3PY8A 4ZVFA 1S49A 3VQEA 3HYFA 1VRUA 3QIDA 1BCMA 4BE1A 3PW4A 2QE5A 4MIAA 3CM5A 3QEXA 3H40A 4O3PA 4E7IA 1F21A 4J2DA 2OYQA 2FVRA 1DTTA 3L2RA 4URSA 4ED0A 4CJSA 3KLGA 4Q44A 3HVAA 2UVUA 1QSYA 3OLBA 4HKQA 4ECTA 4FS2A 2E6LA 2RF2A 4F4ZA 4IDKA 2BR0A 3OLAA 1R0AA 3I0SA 3RMBA 2IC3B 3NH1A 3K5NA 1VK0A 5HP1B 4DL2A 4J9PA 4O3RA 4QWCA 5KFIA 3PX4A 3VQDA 1XHXA 4ZVHA 1MMLA 5C24A 3TI0A 2NUBA 4MFBB 2YHAA 4F3OA 4CJPA 1N5YA 4DSLA 1EX4A 4HHTA 5J2PA 3ZSYA 1LW0A 3QIPB 1VSMA 2JC1A 2F96A 4FW2A 2WK4A 1N56A 3RTVA 4CF0A 2GBZA 3FFIA 3AVJA 3T5LA 2OPPA 4DL6A 2Y1IA 5EUHA 3PHEA 1J54A 4O3NA 4NLXA 2XCPA 3KD5E 2HB5A 4ZTFA 3PR4A 3M8PB 1WLJA 3AVCA 2FLNA 3JYTA 4CEZA 1S9FA 5EWFA 1UA0A 4YR2A 4K4YA 5K14B 1YT3A 4O4RA 3NF6A 3VQ9A 1HQEB 3TR8A 1SKRA 5F8IA 1QTMA 4J2EA 2D7SA 3VQAA 4B9SA 5C5JA 4DF8A 4DTPA 4ZVEA 3G0ZA 4DTNA 3N6NA 4K4WA 4FJXA 4O3QA 4FLTA 2VWKA 4FJMA 3HHKA 3PR5B 4E7KA 3KHLA 3QO9A 3CJ4A 1DLOB 2DTUA 2D3ZA 1WAJA 2F8TA 3GIMA 1NOZA 2J6SA 4NCAA 3MFIA 1C0MA 1TV6B 1WSJA 2A1SA 4N41A 2C2DA 2O4GA 5KG7A 2AGPA 3DRRB 4GW6A 2XY6A 5DMRA 1S0NA 3K5LA 2DPIA 4PWDB 3ISND 1QSLA 2OZSA 4LH4A 3V1OA 1YVUA 5DQIA 4CGFA 4FCYA 4ZP9A 1RT3A 4Q43A 1NJXA 3D5MA 2IM1A 2B4JA 5J2QA 4FM2A 1S5JA 3F73A 4CEOA 4FJ9A 3T5JA 3HT3A 2KFNA 3DI6B 1TAQA 4FXDA 1JL1A 2R7YA 1W9HA 3DRPA 3E01A 1B92A 4O55A 2G8WA 2XC9A 1LWFB 3DRRA 4HTUA 4TY8A 1KRPA 3OL7A 3GIIA 5KFRA 4KAIA 4R8UB 3NHGA 1SV5B 3QGGA 4KKOB 1XHZA 3LP0A 2OPSB 3ZSRA 1RT6A 2CKWA 2CJQA 1U49A 1ZTWA 2DPJA 2I5JA 4CFDA 3GIJA 2W8LA 1KLMA 3ZSWA 3KLGB 1JLAB 5KT2A 2R8JA 4NLSA 3GYNA 4K4ZA 4UQGA 2W9CA 3SPZA 3AO2A 4J9NA 2EHGA 5KFKA 4N5SA 3PZPA 2AX0A 5CYQB 1I39A 4EO6A 5KFGA 3BQ0A 3SJJA 1X9WA 4O44A 3SFUA 4RNNA 1S1WB 4YQWA 1BI4B 2AGQA 4DMNA 4X2BA 5KG0A 3GILA 2FBTA 1NOYA 2UUTA 1TKTB 2Z1GA 1JLEA 5KFUA 1A5XA 4DLEA 3T1AA 4IDKB 1BQNA 3KK2A 4J9MA 4CJ3A 3AVAA 2JEIA 3I5CA 3K59A 1NKCA 3LDSA 3KK3A 4DQQA 1SV5A 4FJNA 3E51A 4JRQA 4ZTJA 4OKEA 1S1WA 2IAJA 2ETJA 3MEDA 3RMCA 1BCOA 4C8NA 2XY7A 3QEVA 1RT5B 3KNAA 4ZP7A 3RBEA 2FBXA 4DG1B 4WYLA 1JXEA 4FJ7A 1HNVA 3PX0A 1GX5A 4Q8FA 2XY8A 4LH5A 3KD1E 5CYQA 4J2BA 4BDZA 1B9DA 3LAMA 2F8SA 2YNHA 1X1PA 1SH3A 2QKKA 3FQLA 1XR6A 3FDSA 4W5QA 4LD0A 4J9LA 3HVTA 3KK3B 4F3TA 3G86A 2BQRA 4KV8A 3QNOA 4CEBA 3KJVA 4MK7A 2RN2A 1BI4A 3DMJA 4CIFA 2D41A 2ATLA 3OYHA 2UVVA 1S1TB 4ECZA 3SV3A 3VQ5A 4E19A 1UA1A 1KVCA 4FLXA 3VQPA 3JYTB 2DFEA 5SWMA 3KHHA 2HW3A 4OVLA 5KI6A 5K14A 3KK1A 4NRUA 3CFPA 1MU2A 3ZSZA 3V9ZA 1HYSB 4XO0A 3BQ1A 1TVRA 2EX3A 3SQ0A 3ALYA 3Q8RB 2VA3A 3UPFA 2A1RA 3CJ2A 5EDWA 3QGHA 1J5OA 3V6JA 1S1VA 3CVKA 3PW7A 3AO1A 3H4DA 5JS2A 2XGPA 3VQ7A 3MF5A 3DYAB 4JV0A 4KHSA 2HVIA 3UR0A 3QEWA 3IRXB 4EEYA 4IFVA 1T94A 4ECUA 4DQPA 4KTQA 3QLHA 4O0JA 4ECSA 1WSEA 2G8HA 3AO4A 4ZPBA 1TL3B 3PVXA 2OH2A 4LQ3A 3L8BA 4H4MA 4EO8A 4XIUA 3QINA 4DTXA 4J9RA 4CJ4A 1HPZA 1S0OA 2XO7A 3PO4A 2R2UA 2W9AA 1T8EA 1XI1A 1LWEB 4TQRA 1T03B 4R5PA 1WSFA 4NCGA 1IKXB 4CF2A 3Q8PB 3QERA 4CHZA 3QLHB 3LP3A 4FK4A 1Q8IA 3TANA 5I3UA 3KLEB 4ZPCA 2BE2A 2R2TA 4DQIA 4CEDA 3H2LA 1REVB 1KHVA 3TABA 2D0BA 2IGIA 2WRMA 4CJVA 4FBTA 1Y97A 5L9XA 1RBUA
chains in the Genus database with same CATH superfamily
4WFXA 1S77D 4R8UA 2GELA 3LDOA 3FEXB 4DX7A 4QWAA 3GV5B 3OJSA 2QXFA 2R8GA 1KP6A 3DRSA 1FRIA 3P49B 1WEZA 4KIAA 3VAHA 3MXIA 2P9UA 1FRHA 4UY85 2YNGB 2UUCK 3M6VA 2FGOA 1YBTA 4DS5A 2NZCA 5H9EJ 1EO1A 3NRBA 4DI6A 2VWBA 1BE4A 2ZBIA 3HOSA 4YOTA 1PC5A 4JV5J 4QIGA 3HPOA 3VAFA 4EU0A 4ETZA 5FDLB 3IG1B 3HKZD 3ET6A 2PFUA 4B1ZA 3M4XA 2ZJQQ 2YX7A 4BACA 2IS3A 4YHHK 3P31A 4UQTA 4CZKA 1R0AB 1RDRA 3F5TA 1UPMB 4LF4F 4OYZA 1FNOA 4KPYA 1EKEA 3S8SA 1R8BA 4E3SA 3MEDB 2WSFC 1H2UX 3M8QB 1BA0A 5E3QA 3CXCR 4DF4A 1QHTA 2PZSA 4B9NA 5JUMA 2J7WA 6FDRA 3SMSA 4DFPA 4CJ7A 1P6TA 3LDPA 4ED3A 2OPRB 4CF8A 1R3NA 5J1EB 1L3UA 3HI9A 2N7CA 3EGVA 3NFAA 3LPUA 5CD4A 2BJ3A 3EICA 2YWFA 3C6HA 3BSCA 4E8UA 5LOQA 4NLRA 2J76E 3MM5A 4QAGA 1RT2B 1S1UB 3SBGA 2H1YA 3U02A 3KMSA 3BN4A 2YHWA 2QA4N 2YHYA 5LXYA 1SUQA 4RW9B 3LAKA 3VVUA 1L3KA 2W7PA 4FZVA 4AHRA 5J1PA 4DPTA 3TUJC 3MURP 4WZQA 3DWLA 1HI1A 3QYYA 2JHEA 5J2NB 2LYVA 1ESVA 1PKUA 3HHEA 1JX4A 3NF7A 4CHQA 1ZM3A 4EWTA 2JFKA 3ZTPA 2Q0UA 5CYMB 1GOCA 3RAMA 3MM8A 3P6YC 3S6EA 3O3LA 4DEZA 2AQ4A 3DNCA 2QX0A 4U6PA 3ZETB 4BHQA 2DNMA 4O8UA 1XEZA 4FJIA 4WFZA 3TVZA 1R6YA 3Q0AA 5D0HA 3B78A 5KFXA 1F60B 1R0CB 2AYGA 3O8MA 5D0RA 2V4JB 2HGMA 3JS9A 4CIGA 3VGMA 4FBUA 5LMNJ 1UOCA 5MLCQ 4ECVA 4NA3A 4ZA1A 2GCFA 3S9HA 1DTTB 1J5EK 4ZK7M 2ZJPQ 1YJ7A 5DG7A 3GFYA 3HHLC 2D4WA 3QFHA 4FZXC 3M2VA 1T9UA 1K47A 5GAEU 1ZBFA 3V6KA 2Z2MA 1RE1B 3MPWA 4QZVB 2V67A 1RT4B 3LDLA 3ZLJA 1UJ4A 1JNRB 4ID1A 4BG9A 1ROFA 2AHOB 1RWMB 3MR6A 2XWYA 4F04B 4DUYK 2IDOA 4Q0BB 1N5SA 1WC3A 3R8YA 1EQ0A 4ED7A 3MEGA 4OHWA 1WC6A 1WHWA 2EFPA 3FMBA 4DPOA 1VSJA 2FJAB 4WIQA 1IBMF 4Y34A 1VIOA 2K3KA 4QWEA 4KSEB 4M3RA 5DS7A 3OR2A 5A8WA 4EUVA 3DLLQ 4Q5VA 1K1QA 2GMLA 1KDNA 2CG8A 1PYTA 3K9JA 1EWQA 1YIJN 4OPJA 2HS0A 2ASDA 3KKRA 1AUSL 3KHGA 2HIYA 1N5YB 4GRSA 2YKNA 3OS1A 3P4IA 4Y2CA 2W7AA 4KREA 2DISA 2I1RA 5DK5A 4N76A 2BW2A 4BS2A 5MAOA 1RBLA 5BPLA 4I2QA 4E89A 3ZSXA 3LW5C 4NYFA 4DV1K 3I0RB 4JV2A 3CGIA 4BR7A 3MN9A 3MCOA 1S9EB 1X4DA 2HRTA 2CPHA 2QLWA 2O01C 2NRTA 4CNYA 1HWIA 5DQGA 1VHIA 4QJVA 3SEOA 3BO2A 1IVZA 1I3AA 3BGUA 4KB1A 4RNMA 3VQ6A 3D7EO 3LANA 2CJAA 2BUPA 4WFAL 5J1NA 4QW8A 1VQKN 4BLGA 1RFQA 2QRRA 1U48A 4ZVGA 1YZ7A 4KH1B 2QI2A 2B3TB 3DLHA 3OFHA 5CCLA 3CW2C 1TKXB 1ZETA 4HACB 4M3UA 1R31A 2FLPA 2BRLA 5CH7B 4Y0WA 3LP2A 1Q5VA 1HD1A 2G2OA 3THYA 2XZWA 3HCXA 3ENHA 3VF4A 3I4PA 4TN2A 1RT3B 3DDNA 2D0AA 2Q79A 3SIPB 2EBGA 3VAIA 2UXCK 5T14A 2WOMA 4FJJA 1NK5A 3VF0B 3VAJA 2ZOGA 3HZEA 5IQ6A 3T9ZA 3PIOQ 1WBBA 2LXIA 5KG1A 1NGHA 3HHLA 3MX2A 3FZ2A 2QIFA 1IKWA 3D6FB 4IQMA 1NJWA 1NK6A 3D68A 3F0NA 1Q82T 2NZ4A 3MPUB 1D0EA 3OPKA 3NGKA 2BXJA 4FKXA 3DI6A 3S41A 4USKA 3TVKA 1RHJB 3TX0A 4NOHA 5HMXA 2GGPB 1KLNA 1X9SA 3C46A 4QWDA 5FPMA 4K25A 1FESA 2VA2A 2ASYA 4DX8H 4YNQA 4CZLA 1LV5A 1XNRJ 4KHQA 4U95A 5HP1A 4OJRA 1FCAA 4CM0A 4OZ2A 5H9EK 1BHLA 5KFMA 5AR0A 1F6TA 5E0OA 2O8DA 2HFVA 4DSFA 1NLKL 1R6VA 3ET6B 2PN6A 3KOAA 2QWRA 1KOHA 4L74A 2C2RA 3CJBA 4C8YA 3M8RA 2HVHA 3OT9A 2F8HA 4DSJA 2LMIA 3H3OB 3CCUN 1FD2A 4OV1A 4O8KA 1P1LA 2A6AA 2HQIA 4I68A 2WFBA 1ZXOA 5DLFA 5M1QA 3TAFA 1BQMA 4FPRA 2NXNA 5KOWA 4XPCA 3P96A 2XS5A 2ZBPA 4KO0A 3LP2B 2BQUA 2VZ9A 4OX8A 3G4SS 3T1YJ 4A48A 2MKCA 5DJBA 3RAQA 4ZOSA 3G8SA 3OYKA 2GWJA 1QDUB 4OI1A 2V8PA 4ISEA 1WHVA 4E98A 3EL2A 3MPDA 2B7BB 2CFXA 2P9GA 3JTPA 2HHXA 1U8WA 5AXNA 3OYAA 3MM5B 3A5LC 3C15B 5KFYA 3PIOL 3AY0A 5AZIB 3BYPA 4NLDA 4JHDA 2M0GB 4CI6A 4WFNQ 5CCMA 3V9UA 4R0EA 5DLGA 1UL3A 4ZITA 5AJ3J 4ER8A 1IBLF 2UXDF 1N52B 4Y2MA 3DKDA 2E1AA 3WQUA 1VQMS 1KN6A 4OLAA 3CO0P 3D0GE 1PSDA 4JI7F 3M8PA 4ZPWR 5C42B 2VPYB 4RO0A 3IXQA 4P73A 4IRCA 1RHRB 3MMJA 1VMBA 2IY5B 1P9YA 2BJ1A 2EPIA 3P45B 4DU1A 1TYQB 5A0YA 2B0GA 3DLRA 3IMXA 4DUZK 4PUOB 4FLUA 2WVBA 3R5GA 3U1NA 3CD7A 2P9LB 3V1RA 1ZAVA 2IOCA 2OPSA 2VFUA 3M8ZA 3IR6B 1RABB 3TARA 3DLBA 4DR3J 4K8RA 5IT4A 4RX6A 2HIQA 2DO0A 4B3MJ 4DR1K 2HMIA 1REVA 2YQ1A 5BYQA 3PNIA 2RDDA 5B0EA 4ED1A 3J81O 2Q3SA 1JWWA 4IH7A 4B3OB 4J90A 1ZA2B 1JLGA 1RDDA 3SQGA 4V19S 3GR0A 1T05A 1Q8BA 3UDLA 2G8UA 3FC9A 4I6WA 2YJFA 4O5FA 2ZE2B 4ATNA 1HHSA 1VC0A 2FVQA 1U1QA 2YHBA 1BL3A 3G82A 1DQAA 1VS3A 2HG4A 1C6VA 3HSZA 5A8KB 4DFKA 1K44A 1XNRF 2DR9A 4YMEA 3UD5A 4K4SA 3V6DA 3ZEUB 1AZSB 4KGMA 1RDUA 5IC4B 2MLXA 4J9VA 3M1VB 4TQSA 3TAMB 8RUCA 2HHHK 2GVDB 4URGA 4BR2A 2UXBK 3NAEA 5DGAA 4BC3A 5JVGQ 4IRDA 4CGIA 1HQ2A 5IS2A 1FXRA 2HBLA 3HBTA 5GVQA 4X4RA 2OIHA 1EWRA 2B6AA 4PXBA 4NZ0A 4C4WA 2FC8A 3DLJA 3N6LA 2J0XA 4AM6A 2YX4A 3MCAB 2YNIB 5AQXA 4I6AA 4K42A 2BV3A 2P5OA 1J5OB 1D8YA 2GX9A 4OZJA 4H4OB 2E5GA 2XI2A 3MM9B 1FVQA 3AVIA 1Z05A 3EXYA 4DPXA 3R5CA 1PBAA 3CJQA 4U96A 2W9BA 1FFGB 3VHQA 4RBTA 2XLIA 1ZA1B 1LKZA 2DHSA 3HTVA 3RRHA 3NCQA 1X0FA 1XERA 4GV3A 3PLAA 4H54A 3I5AA 2KM8C 3H8YA 4NLVA 1NNDA 1QVFM 3VEVA 4XK8C 1FWPA 2D0CA 1FKPB 4EMDA 5I3QA 1U25A 1Q95G 4QIWD 1XBWA 4O4GA 3OBIA 4CJEA 2IBOA 4Z4CA 4IG3B 4ZHRA 3NH2A 3SQGB 2HQ3A 1ITGA 3L9ZA 4OX6A 1HIYA 4DN9A 3V4IB 2QGFB 2WOMB 1H2VZ 1WSRA 1QQOA 5AE2A 3JAMO 1X4CA 5C7PA 1HJRA 5IM0A 1RT5A 1RWKB 2FHKA 3Q8SB 5J2NA 2ZNZA 4TKTA 4CHPA 2IM2A 4NYNA 2LEPA 4TYBA 4RW8B 1B4SA 1UVNA 3QSIA 2H48B 4V1Ak 1RTDB 1IBMK 1IR0A 2OTJN 4WFYA 2DY4A 3D0IE 2AWZA 1T95A 5LXRA 2J8SA 2LKZA 3IKMA 4CGJA 1UVLA 1VK8A 2AZ1A 4CIEA 5JS1A 2PDAA 3NMAA 5DDQC 3H90A 2ADBA 4ZVOB 3BJYA 4DTSA 2KM8B 2R2RA 1KFDA 4EP4A 3WXKA 8ATCB 1CLFA 5KG5A 2DR6A 3ZETA 4U8YA 5DZ6A 2H3GX 2GMJA 4Z4GA 1WN7A 1HR0J 3U1MA 4U67Q 3IR5B 2DNQA 3DGPA 4DL7A 2G8VA 2QWQA 4BGBA 2CJXB 4GVBB 2DVIA 5HVFA 2U1AA 2P5GA 2RJZA 2HWIA 2V52B 2IRXA 4FF3A 4MQ3A 3MECB 5HMZA 1FKPA 3PIPL 4DCHA 1QAXA 2KN4A 5SZTA 1FXLA 4O4GB 2C3YA 3JXOA 4PG5A 4EBDA 4B1UB 4P7TA 5A8WB 3U3GA 4E1JA 2VBXA 2O3DA 1B7FA 3HZGA 3G8TA 2BUNA 3GOIA 3G6ES 4DX5A 2DR5A 3W3DA 1NGAA 3VAMA 4BY9C 3G96A 2G1HA 3CC2N 4BRPA 1YTYA 2BANA 3PXGa 3GWCA 5AFUH 1M5VC 3SAHA 1JLBB 3O80A 3K0SA 3N5FA 4IQXA 1WSGA 1KD1T 3OR2B 4ZCKA 3TSPA 2HBRB 2YNGA 3NL0A 1N54B 1IJEB 3W1YC 2P8IA 3QPIA 4RPFA 2CVIA 3CUNA 4Z4HA 5AJ3K 4P2MA 1NMDA 4Y0FA 2CGJA 4WZMA 4MMOA 5LY3A 3OYLA 5FDLA 4X4NA 5E3PA 4GVEA 2HFOA 1X4BA 1F9HA 1WC4A 2CH6A 3AVKA 1B70B 3KK1B 3PACA 4ED4A 3IBFB 2R7SA 4PKDB 4RUBA 1NKBA 3AXMA 3HO1A 1Q7YT 3VWSA 4RW6B 3DMJB 4YOEA 4M3XA 3M8YA 2IMWP 1YTAA 4ED6A 2HNDA 3CSKA 4RUAA 4C0BA 4KTZA 2GVZA 2VH7A 1S6PA 2CPIA 2BGGA 3SMPA 4AHCA 5KT7A 1W97L 1O13A 1K9MO 2HPUA 3ULEA 1VGYA 3DLEA 4ANDA 3PIPQ 2APOA 3GSIA 3H5SA 5GADP 2QMWA 1W2IA 4WBFA 2J0WA 4HUEA 4DL0C 1MG7A 1FW6A 2VBWA 4CK3A 2XMAA 2ZJRL 4OI3A 3EVOA 3P8BB 2JH3A 3PKMA 1WF1A 3KZBA 1M5SA 4H0VB 2GW8A 5DG8A 5BRDA 3W5XA 2DXDA 3CDEA 1UZDA 1YTUA 3FLCO 1QM9A 3G6EN 1RT2A 1S1UA 2RDJA 4WP3A 5ETPA 2VG7A 5AQGA 1CS4B 2ZBCA 4AXJA 2MQPA 4USVA 5A2QO 5BPMA 1U09A 1RU2A 5L1JA 2RE1A 2O8DB 2NUUG 1TKTA 4KB0A 1U24A 5K20B 1OPZA 4C8OA 2UUWA 3SSSA 4LF9J 2BBEA 4WQ4A 2W1BA 4F3MA 2EFGA 4OYWA 1ZBLA 3BZKA 2RB7A 3N5BA 4ZDNA 4CBWA 4IO9L 2VICA 3ZYYX 1TKZA 1K1SA 4C0HA 1H98A 1E4FT 2OCEA 1PCAA 1V4SA 2DTJA 3VA0A 2MZRA 2ZM6J 4YY3J 4E1NA 5C2DA 4EFHA 5E3CA 1WC5A 4FF2A 2DNHA 1M90T 2F40A 2LEBA 1M5PC 3HSJA 1XIQA 3K58A 5HROA 1UKUA 4FW1A 2AW0A 4YP3A 4M5DA 4F67A 3BV8A 4DR6J 1NU4A 1PJ6A 3C16B 5K5MA 3F9KA 1OO0B 4ZN3A 4DSEA 5E2QA 2CRLA 3IBWA 3J7AP 5FPDA 1DRZA 3CJKB 5DZ7A 1X3NA 1XQIA 4NXNJ 2VG5B 3AA4A 4PQUA 3R6LB 1HQUB 3I8DA 1MMDA 2P9NA 4CF1A 2MQLA 3PCOB 3MMAB 5CA5A 3MTKA 3CB4A 2MLYA 4O3SA 4K4VA 3MWPA 2ZHAA 1AXQA 2G0CA 1RCHA 3N4QA 5T7LA 4PHTX 4DTMA 4MTPA 4NA1A 2XNQA 3CC4S 2DFHA 1RLDA 3U1LA 3QFUA 3QAUA 3ZZYA 3BO3A 1RTJB 4IKFA 3HJVA 2ATQA 4CO4A 1J6ZA 2PY5A 2KDOA 3VMFB 2GJFA 4B3TJ 3QATA 2YBVA 3MCMA 4OGCA 4KHNA 5DETA 5L39A 2OZMA 2F4VK 4CP5A 1IV0A 3OHRA 2HLUA 2Y0BB 3VPZA 4DBQA 3EGWB 2FSNA 4OHZA 4KI6A 4DSIA 4EBCA 3TAPA 5KG4A 5D77A 4I2QB 2W2QP 3N9UC 1RBOB 4CD3A 3U27A 3GG4A 3LQVA 4OI4A 3J81Y 4A47A 2CGLA 3ELHA 3EVMA 2HMIB 1A9NB 3FZHA 3MN6A 1FD8A 2AYBA 4CK1A 3HK2A 1UVJA 4ZPAA 5IC6B 3KNGA 1JJ2M 2PMWA 2O8EA 4X62J 1RQ0A 1VK3A 4AFFA 4OI6A 3J8AA 2OPRA 4CE9A 2OO4A 4LFAK 4ANCA 2KH9A 2XHBA 1GT8A 4ZMMA 1QQMA 4Z4EA 4B1YB 3M6GA 4FPIA 1TR0A 3TA1A 3LZIA 3QBWA 4I7FA 3NS6A 2FQQB 4ZVFA 3UD4P 2RE2A 4HVZA 2IPOB 1HBNB 3HYFA 1VRUA 4UUWA 3PW4A 2PMZD 3J7A1 2QC3A 1F9FA 1KWMA 1F21A 3WXLA 3HDSA 2OYQA 4XH4A 3FBEA 2V2KA 3L2RA 4DV1F 1YVNA 2HK2A 2OKQA 2RQKA 4WKRA 1PILA 4ECTA 4BRHA 2RF2A 1KNZA 3KKFA 2NRXA 1NZAA 4DV2J 2PO4A 2C42A 1RWPB 2GEMA 2PT0A 1R27B 1KOOA 1ZZNA 5HP1B 3TZWA 4DL2A 4QWCA 3BS9A 5AQIA 1K0TA 3O5BA 3B54A 4JKGB 3VQDA 4GKKF 1U1PA 4CBXA 3R1LA 2LA6A 1XHXA 4BVPA 1LFPA 4B1VA 4IOCQ 1O0PA 5LMUJ 2YHAA 4F3OA 2YWHA 2FHMA 4DSLA 4FO0A 1XJWB 1V3SA 3VF2A 1S79A 3V2UC 1CJTB 1VSMA 2WK4A 3M2UA 1NAQA 1V4TA 4I67A 4CF0A 2ASPA 4Z7CA 1QZ6A 3T5LA 2GO9A 4TU9A 3IC1A 2I38A 4GO5X 3KD5E 3IWLA 1W2BR 3MM9A 3NS7B 2R7WA 4NB4A 3DRXA 2FUG9 5M2PA 4A8XA 5IZHA 3A3PB 2B4VA 2Z2ZA 5EWFA 1UA0A 4K4YA 1YT3A 2A5XA 1SKRA 3NF6A 3QRQA 3VQAA 4DF8A 4CH1A 4DTPA 4DOZA 3C66A 3ENBA 3N6NA 3ENOA 4K4WA 4FJXA 3A3OB 1F3VA 2ZF5O 1TTHB 4IO8A 3TVYA 3QO9A 4IEEA 1DLOB 3Q8UA 4TVAB 3EEQA 2F8TA 3JXUA 1NOZA 4NCAA 3MFIA 2R7OA 1TV6B 2CJYB 1MROB 4JV5K 2M3DA 4PABA 1QVGR 3K5LA 1NG9A 5AZIA 4PWDB 3D6MB 5JMVA 2OZSA 2QWOA 8AT1B 4FCYA 4F02A 3W0LA 1GAOA 2IM1A 2B9XA 2CQ4A 1S5JA 5JJBA 3F73A 4FJ9A 3MDFA 3PJ9A 2KFNA 1HHQA 4FXDA 2K1RA 2IIHA 1RCOB 2E1MC 2YY3A 1B92A 2MZJA 4C6AA 2G8WA 1LWFB 3DRRA 2RILA 2NRWA 2H51B 4B3RJ 2R7XA 3NHGA 1XNQK 4KKOB 4PAAA 4FN5A 2OPSB 3VEOA 2RT3A 3GJRB 2P9KB 3TWZA 3THXA 2W8LA 1KLMA 1SJ4P 4JK8A 1CEZA 4UQGA 2W9CA 3SPZA 2RQ4A 4J9NA 2EHGA 3RYLA 4N5SA 5CYQB 3J80U 2NPIA 5KFGA 2RNEA 3FGVA 4RNNA 2CQHA 4X4TA 2ZH3A 5F2RA 1GLAG 3PEHA 4X2BA 2FBTA 1M90O 1QD1A 2QSWA 4IZ9A 3B4MA 3PFOA 2HLTA 2KT2A 4WFBQ 2GAHC 2H5JB 1RWUA 3R1XA 5E3RA 2D9OA 2XWXA 2BEFA 3AVAA 2GMHA 2DXFA 3R5JB 4DQQA 1SV5A 2M8DB 2QW9A 4OKEA 4BR5A 2IAJA 4FOIA 1UJ5A 4C8NA 2XY7A 3ZEUA 1K0VA 5AQMA 3KNAA 3CJ1A 2FBXA 3DXBA 2HFUA 5E7OB 4EGLA 2FIUA 2HAFA 4OYBA 4CDIA 4KH5A 1GX5A 3W63A 4JEPA 4BG8A 1ATNA 3LAMA 2QKKA 3C65A 3T6JA 4J9LA 3KK3B 2E7WA 1H38A 3G86A 2BQRA 4KV8A 4M5NA 3QNOA 1VQ6S 2ZH4A 1RADB 1QUPA 4K43A 3DMJA 4AE5A 4CIFA 1GK8A 2D41A 2AP1A 3OYHA 1KQSM 2KFYA 3VGVA 3VQ5A 2NSCA 3BEXA 2W6LA 3VQPA 3NWRA 2DFEA 2EK1A 1YRXA 5K14A 3KK1A 4OVLA 4NRUA 5EOYA 1SQKA 3UB5A 2XMUA 1Z6RA 3V9ZA 3Q22A 3ILIA 4X64J 4HH1A 3K17A 4QPTA 5HJYA 1YJNS 4NEZA 4BC5A 4A5AA 3FZLA 3PKYA 3CCJS 2A1RA 3BB5A 1J5OA 2MHEA 1S1VA 3MWBA 2FZGB 3EZWA 3MUMP 1SQEA 1ATRA 2PFDA 4ECUA 1X31C 4KTQA 2UUAK 4O0JA 1OSDA 2G8HA 3O8WA 1Y7PA 2OH2A 3OVSA 3LGMA 2VQEK 3QINA 4KGKA 3LA0A 3ZZRA 2CWXA 4CJ4A 1S0OA 2XO7A 4GNIA 4LRFA 1CULB 3UN3A 4TQRA 1WSFA 3B8HA 2V51B 1OQ3A 3OW2M 2ZHOA 1QZ5A 2JNJA 2HK3A 3TANA 4WK3A 2OGUA 4DQIA 4LMZA 3TABA 2IGIA 1UEVA 2DNPA 4CJVA 2KLAA 3Q7CA 1FEEA 1VHFA 4C11B 1NK7A 3NDKA 4Q7AA 5DM6L 4WE1A 4UW2A 3A5NC 1UWAA 2BE7D 3TZZA 5D4NA 4ICLA 2C3MA 1MLAA 4A46A 4DV3K 3G6VA 5IV3A 4M5JA 5CYJA 4LF4J 4V19X 2MJUA 1D4XA 3X3UA 2FPHX 2PSZA 3OYDA 2LLZA 2FTRA 3WIUA 3FCVA 2GC8A 4MDAA 3FJ2A 4CO1A 3GSDA 5CE3A 4DR4F 2NSBA 4M63A 3ZTQA 2XZTB 3BZCA 3L2QA 1E6VA 1C0TB 5B0GA 4DR1F 1DY3A 3I55S 3OYMA 3IFRA 3CCSS 4IKAA 4QS8A 3SXLA 2CJBA 3CIZA 4TSXA 1HQUA 1HWJA 4H0TB 1QQNA 4FF1A 2W2PP 3CJ0A 3T1YF 4F4KA 3G10A 4YB7A 4JD2A 1OSCA 4DR1J 3PJWA 3KJFB 2N3OA 5EX5A 3K0JA 3BEGB 4DV5K 5EWEA 4EI2A 2BZ2A 2OHDA 2GQQA 3CJKA 2UV8A 1JLAA 2L3MA 1ZBSA 4CM2A 1EQMA 4IFYA 2VG5A 4JP8A 4DCOB 3OBWA 2HSEB 1IN0A 5FROA 1XNRK 2RQMA 3DOKB 1D09B 3W2VB 3K8VA 4O5BA 1Z26A 3FFIB 3BP8A 2Z1HA 3PTWA 4DQRA 4PG7A 1FJGJ 3DRPB 3CDBA 5E84A 4M5KA 4LF5K 1Q53A 3GYGA 2YKOA 2BANB 1HBUA 1NWKA 1JJ4A 4BQZA 3E8OA 1TK5A 1VSLA 2CXEA 4CLLA 4DR7J 4NPOA 2ZOMA 2C2OB 1VJWA 4IRKA 2CDQA 5CYMA 4QS9A 4F0HA 3AB2B 2OPQB 3L7OA 4C1NI 2HHHJ 1WSVA 3N6MA 3JSMB 2RAQA 3O9SA 4OZ3A 4FYDA 4HUFA 5JVGL 1RI7A 2CPFA 4B3MK 2RHKA 4FWPA 2LQ9A 3ZX0A 1FA0A 4ILJA 5HQ8A 2ASOA 1VQ7S 1K6YA 2P9KA 4H5TA 2QLFB 4DFMA 1YJWN 1R8CA 1GTEA 2X74A 2C2EA 2F5GA 2XMWA 2RHSB 3ZXWA 3SI6A 1K8KA 1M5HA 2I6WA 1GXLA 3CT9A 1CPZA 5KPTA 2HNDB 3MX5A 2HS3A 3BPSP 1K8AT 1UVKA 3CMES 4I9QA 2XY5A 3MEGB 5D15A 1D9AA 5KFDA 4IG0A 2J7KA 2KKZA 4DQSA 1QJHA 1CC7A 3MXHP 5CAAA 3K2PA 3FR0A 4P71A 3J7YU 1NSKL 2JDJA 1Q81T 1VYAA 3RUBL 3D4JA 3CCQN 1RWXB 1KAYA 2V7ZA 2DIUA 2DJWA 1CLQA 4IO9Q 3N4WA 1SKWA 4DV7J 3WX4A 4P2XA 1DARA 4NLCA 1Y00A 4A8KA 2X1AA 3O9RA 2XTJP 4ZCIA 1U0HB 2PD1A 1U4BA 3H59A 2UZAA 3DXMB 4R0JA 2WZ1A 4TNOA 1M1KT 4L3QA 3R7SB 4ZJLA 1SZ2A 3NF9A 5KRTA 4QCLA 3D2FA 1ZTTA 3P4UB 2VC1A 3D1HA 1RA7A 4HTJA 3WC2A 2XI3A 2PAVA 3DU5A 3A4TA 5KFAA 2WTUA 3JTNA 3HVWA 2ERRA 3AA5X 2LCWA 5KFHA 5E5NA 3ZNJ1 1RTHB 2HRYA 4B9UA 4DR5J 2NUHA 5KFBA 3CCRS 1NU0A 3QEPA 1IQTA 4MYTA 4NO7A 4R79A 1IJFB 2IM3A 2NPFA 1MWQA 3MR7A 2BKPA 1HHTP 2R7VA 5KPRA 4FNIA 2HRUA 3TPQA 2BTFA 4BRNA 1DBDA 2JEFA 1LWEA 3TSQA 1JLCB 1L3SA 1D1UA 3Q8YA 4F7VA 4ZPVR 4NLQA 5L1LA 3CMAS 4EZ9A 2Z57B 2JOQA 1CJUA 1RTIB 2DGVA 1H7WA 4LF6K 4WFBL 3N28A 3P83D 3T69A 2AYEA 3WHIA 2CYYA 1TV6A 1GMWA 2GIRA 3DLKA 3C16A 3CG7A 1SAZA 3ETOA 2CQ3A 4ERDA 3OS0A 3H08A 1P8ZA 3H5XA 1WOPA 2FF6A 4NYPA 3H5UA 2JGUA 3FKBA 2Q97A 4AQYF 4BREA 4PQUB 5F8NA 3J7YI 2Z30B 1NGCA 5ADXH 4JI5K 3E1YA 3HM8A 1ILYA 4MK9A 5HOOA 4Z4FA 2DRBA 1ICEB 4BWMA 3EZ5A 1HLUA 2IVOA 3RSEB 1UVMA 1N0VC 2XYGB 2M88A 1YSJA 1Q82O 4ECYA 3SMZA 4B3TF 4JB8B 2P9PA 4ZJQA 3L2WA 1FDDA 3WQTA 3AVMA 1BXNA 4FM1A 3NNHA 5B7WA 1X0PA 3RGIA 1PIEA 4CZGA 3HVTB 1XC9A 1FXXA 1F0XA 4DFJA 3D0HE 4F8RA 2CQPA 3NMRA 3SK3A 3NCRA 3ZT3A 4AF1A 3O5TB 1VQKS 1X5OA 3UKUA 4RUCA 2IIRA 4ZP8A 2E44A 2YWKA 2FZKB 3IRWP 2G0IA 2U2FA 4ZVPB 4AHUA 4A2AA 3ZT0A 2CQIA 4BROA 1KVKA 2V9WA 2BX6A 3BDPA 3T7ZA 2ABYA 2WVCA 3BSAA 2OPPB 4WIIA 2Z1JA 2YVSA 2DR7A 2BJ8A 3QDKA 4CLSA 2HFSA 2BKNA 1L3TA 3LDNA 1N33J 1N48A 1S6QB 3C94A 1GLFO 1VQON 1IG9A 1F5AA 1Q8KA 3HKWA 1KVBA 3MCPA 2GJIA 1YJ9N 2MQMA 3IS9A 3ZCMA 2HZVA 5D3GA 2OMOA 1TZ0A 2DY1A 3QB0A 1BHNA 4UZBA 1NRKA 5M1NA 3RG6A 3PW0A 4YN3B 3M30A 5BR8F 4CO5A 1TFWA 1P1TA 1T9VA 4AYBD 2H65B 4LF1A 1KQGB 3FSIA 2MHNA 5AXKA 1R43A 2OA8A 1B64A 2HHWA 3E66A 2K06A 2Q1LA 1MW7A 3JSMA 2EKYA 2FSKA 2YPZA 5A6PA 5B0CA 5I3PA 4FJGA 1S4EA 3M05A 2CG4A 1RAFB 1BC6A 3HZ6A 5H9FK 4LF8F 3AJ1A 1VRTA 3DOMA 1VSFA 3EPIA 1AROP 2E7XA 4CEFA 4AHVA 4Z37A 1L3VA 4CJWA 1EP4A 4X4SA 4G6VB 4DL5A 2QLBB 5KFEA 1VQ9N 4ZLNA 4QQBA 5BYSA 3SV4A 3DCAA 1RK8A 3FEYB 4HYKA 3OSNA 4BE2A 3SQ2A 1WOOA 4B8CA 1N0UA 3NAIA 4HEA9 1NZ8A 2OTLS 2N3LA 3DM2B 5J2MA 3O9UA 4RW9A 4M94A 2CZ4A 1ATSA 3MD1A 1DZ5A 3RVCA 3NBPB 3AQOA 1WAFA 3VGKA 3MD3A 1A5VA 1IKWB 3IGNA 5HBMB 4DTUA 3PW5A 4DR2K 3PFEA 3OFGA 2ASMA 4FWKA 1DLOA 4CERA 1MU2B 2VJVA 3M32B 2LQ5A 2NXCA 2DGUA 1MROA 5HQMA 3OYIA 4GO7X 3OVNA 2YKNB 3FCHA 5GAHI 2JWKA 3HSTB 1SPBP 2YH1A 3M3ZA 2YKMA 4B3RF 4K50A 3SYZA 2XNRA 2R2SA 2B6AB 4C98A 1N6QB 2WSEC 3BQ2A 3BGRA 4CJLA 4Y2KA 3IRXA 1TL7B 4BRMA 2FVSA 3ISNC 5DGBA 2I2YA 1CG2A 1WUUA 4M7YA 4E7LA 4DB3A 5KFVA 5KFCA 1VRTB 1IM6A 4EAHD 1NGBA 2IA6A 3AA3A 3UFCX 4JKFA 1UAWA 1W2BM 4LSLA 1HPZB 1GOBA 3BN7A 4CCHA 4JS5A 1HYSA 2GHPA 3KXDA 2AJQA 5ADXA 4DUTA 2OSQA 3AB4B 2D5RA 3C0BA 2HQFA 1JLQA 1NDPA 3OTOJ 1AFIA 4UUXA 5IV4A 1QS4A 4LVOP 3FSXA 4R25A 3RBZA 2W9CB 4K0KF 3O3GA 1RAAB 2Z1IA 2Q0RA 2EI5A 3IFEA 4U7BA 4JI8F 4CT9A 1B7YB 3GCWP 3LP1A 4CFBA 1U6FA 3CCZA 1TK0A 1BDGA 5KG2A 3KJNB 4LF6J 5CHIA 1HBOB 2VODA 3VQQA 4B3TK 1YJNN 4DMZA 5EX3A 3D2WA 3UN5A 4DZDA 3HPHA 4LBHA 3UR3C 3LP0B 2PEHA 2QEXN 3F41A 4YUDA 4LRCA 4YR3A 3P5JA 1M1KO 1ZPWX 1GOAA 3O6QA 2DO4A 4ZLLA 1H74A 2EFVA 1GLDG 4L75A 4YDUC 2HQCA 2BE2B 2GTDA 1VQPN 4NLYA 1HBUB 3T41A 3DGVA 5BPNA 3WNFA 3QGIA 3BKTA 2FBVA 2POKA 4J91A 3AAQA 1VBXA 3DU6A 3IR7B 4DL4A 1UCNA 4OLPA 3CDUA 2W25A 4IR9A 4D3GA 4P2FA 1Y10A 3RJMB 2E66A 1IH7A 5AXMA 4DR6K 2OI2A 1C4AA 5IOLA 5L46A 4B08A 3IUCA 2GO8A 2IA0A 1T3NA 3T5HA 3D2EB 3VA3A 4O0IA 2IC3A 4C8ZA 3KG0A 1GMWD 3VEXA 1BUPA 3CCLN 2VQFJ 3UDVA 5AQVA 4J9SA 3MPVA 1EB0A 2FLLA 4JYAJ 4RTFD 2VKZG 1R0BG 4DHYA 5IT9Y 2GNKA 1VQ5S 2ZVIA 4XDDA 2JJ4D 4LFBF 3NGSA 3EO3A 2MY7A 2J6UA 1C0UA 1QUVA 3OYBA 3QBXA 1HARA 3D45A 5F8GA 4Q8EA 3L3UA 3RAXA 4WQ4C 1RYSA 2VC0A 4IEIA 3CC4N 4WQ5C 4B9LA 4J9OA 3CO9A 1E6YA 2YPYA 4U8VA 3R8EA 3CPWM 1T02A 4JS4A 1SJFA 4B1XB 4WF9L 3DDKA 2V63A 3BF4A 2E2NA 1NSPA 4KGXB 5BXIA 3L2VA 2F4VJ 4CYUA 3ETMA 1D9FA 2KRBA 2ZDPA 5F1XA 1CULA 1SQFA 3SUPA 1X4AA 2QMUB 5B0FA 5EU7A 3J81U 3OYCA 1EXQA 1GMUA 2O67A 1S72S 1S7IA 1HLWA 4I69A 3BF3A 3WNEA 2NRRA 1HW8A 1VDHA 1T6DA 2RU9A 4CTAA 2VWJA 5LJVA 4X66F 2H4WB 3QIOA 1G2EA 1S9GA 3RR8A 4IJNA 3KLIB 4CFCA 1HQEA 2FHJD 2MKHA 5BR9A 1UP1A 3ILJA 4C8KA 2V4JA 1HX1A 3DHWC 4LFBK 1JXLA 1SL2A 1FXDA 1VQPS 3PYGA 1OWXA 1DFDA 3SPYA 4TU8A 1YXQA 1RBVA 5CHCB 3G71N 3RWUA 1VBYA 3BKFA 1F9EB 2UUBJ 2CA9A 4Z4IA 3HJFA 3NVMA 3THXB 1DGKN 2O8BB 3GR1A 1WF2A 4LSZB 3Q2SC 1ZYQA 2CPDA 1EZZB 4IXCA 5H9FJ 4E7JA 2D9PA 4DPYA 3IBCB 1NDKA 1NGEA 2AD9A 1OYDA 3VZIA 3K7RA 2ZD1A 1WF0A 2GWKA 1I3OB 5HANA 2HEKA 3HSDA 4JK7A 2NREA 5KFSA 1B0PA 2BQ3A 3AVBA 3SI8A 1WG1A 4DSKA 2V5HG 3UNGC 3IAM9 1IQZA 4PY5A 3QBCA 4OZ1A 3CXCM 2C22A 2B4PA 1VQ7N 3CQYA 2ZOFA 2HHPA 5FRMA 4PL7A 4RW4B 3C15A 2GQCA 3PEJA 4ANEA 1EETB 1UW4A 2VG7B 4LF2A 2VJUA 1NPPA 1Z2ZA 1RYRA 3GG0A 3V6DB 2QKBA 1NEEA 1TQLA 4RWWA 1RACB 2KHOA 2AU0A 1KVJA 3I56S 1RDAA 1TYQA 4K2XA 3KLHA 4A5BA 3MAAB 4CZMA 2CQ1A 2ROGA 3QNNA 5C42A 1XUPO 3AGKA 3JSBA 3NLCA 3CPWR 2UXCF 4FWSA 1U1NA 2YNIA 3BREA 2FD2A 5D0GA 3UKUB 2O8BA 4CK2A 2W4PA 4NMXA 2W7OA 1JL2A 4IBNA 2UXDJ 3LZJA 2DGWA 3R3LA 2C2KB 2F8MA 3O1LA 4PRFA 3FK4A 3NGTA 1UZHA 2DNKA 3AAWB 3PM9A 2FF3B 1NHVA 3HFZB 3G87A 1ZAXA 3CE8A 1S6QA 3IMQJ 2WVEA 3UNYA 3OVAA 1HMVB 4GV6A 5GAEP 2J0QD 3DLLL 3L4IA 4JYAF 1KCFA 2WBNA 1QTNB 2J4RA 2BM0A 4M42A 2ZZTA 4DQ8A 4Y3CA 1U47A 4K0KK 4OKJA 2ZM6F 1YBAA 3O2IA 4DZ6A 6FD1A 2CUYA 2JL9A 2QWNA 3IAYA 3TU5A 4O44B 1LK7A 2G8KA 1JLGB 3KLVA 4DR3K 4NLWA 4CVNE 4HVJA 2OEJA 2JRSA 2GGPA 2GJ2A 3CJCA 1OH5A 4F2RA 3CJAA 1NMEB 5LL6d 4LRBA 4NEYA 4P74A 4JKAA 3NY0A 2EKNA 1RTDA 9ATCB 3AV9A 4B3RK 3CMAN 2YQ3A 3H2UB 4OPKA 1XWLA 4X64K 2CADA 4RU2A 4C97A 2V69A 3HM9A 3AY9A 3SQOP 2E88A 2OSRA 2D1CA 3O3HA 4TY8B 2OFGX 4GC7A 3MAQA 3AO3A 3A13A 2O1PA 1FVSA 4BE0A 4DR5F 2PYJA 4P2SA 1TUVA 2GZOA 1NJIT 5ETQA 4FYWB 2DRAA 1IWAA 3GV7B 5EGYA 1N8RT 1U1RA 3M8SA 2UVRA 5KT3A 4AD6A 2D3OR 4CJTA 1YWXA 2Z2LA 3GIKA 5DQHA 4YB5A 1WKLA 1S6PB 3CPEA 4LBPA 3DAWA 2MY8A 3OFEA 1FKAF 2ILYA 2DH7A 2DRDA 1NGGA 5EVZA 1X4EA 3ENVA 3DLEB 1FJ7A 2VGMA 3D67A 3DLKB 1C0UB 3LPEA 2ROEA 3VN5A 3WEEB 3NBPA 1SQGA 4N56A 4EHUA 1VSKA 4CEQA 2BJDA 2M7SA 2FC9A 3V1QA 3A3NB 5FIIA 3M9NB 1K9MT 2EG2A 4ZLPA 2XHWA 1VQ4N 1Y64A 4TYAA 1YKWA 1GX6A 4CGHA 3I32A 1SS6A 4OYAA 3W2VA 1YI2S 4ELUA 4X66J 3MEEA 1V5IB 4I9LA 4FKYA 3QSYB 3R6GB 1S49A 3VQEA 3W9JA 2SXLA 1JK9B 1GLBG 3QIDA 5GMDA 4MIAA 3QEXA 3H40A 3CJ7A 3TX8A 2CAJA 4XDCA 4CW7B 2MKJA 2E20A 5BN9A 4DV2F 3WX8A 1PAUB 3HT0A 4URSA 2QWLA 4PG8A 4X4UA 4Q44A 1XMOF 3CETA 2KKHA 1QSYA 1WEYA 4X65J 1UW9A 4Y65A 3I87A 1GMVA 2E6LA 4F4ZA 3E9OA 3JB9k 1UTAA 2BR0A 1G99A 1T9XA 3MMCB 4KBOA 2RRNA 3CCJN 3WZ0A 5LMUF 3NH1A 3K5NA 1VK0A 4LT6A 4O3RA 3LDQA 3HLUA 1RXOB 3R5BA 3MWTA 3ZO7A 3A12A 3A8KA 1M5KC 1YZ6A 2HGNA 2VKRA 4BBYA 4WP8A 1TMMA 3HF5A 4QS7A 4QIEA 3ZSYA 5F3TA 4ZVSB 2BACA 3AVJA 2GBZA 3SCJE 3TTDA 2OPPA 3ID8A 4CD1A 4DL6A 2A18A 2M70A 4JI3F 1WB9A 1LOTB 1J54A 4L3NA 1LEOA 4Y2IA 4O3NA 1YG0A 1IBKK 5SUHA 2BW7A 5K9FA 2GHVC 1WDDA 2VBZA 4LRDA 2ZGYA 2HB5A 2KG0A 2ZUGA 4PPDA 4F36A 3AVCA 3OTBA 1ELOA 1PYOB 1YF5L 3JYTA 5F0UA 2RU3A 2CPZA 4LFCF 3TR8A 3H20A 3NGRA 4J2EA 1I94J 5C5JA 4ZVEA 3IWXA 2Y8YA 2AF6A 3V4MA 3CCVN 4WWSA 1VI7A 4FSVA 4FLTA 2QZ8A 2QA2A 4B02A 2J9CA 3HHKA 4RBUA 1SIWB 4LR8A 3THWB 1CS4A 4E7KA 4DV7K 3WXMB 3DN9A 2DTUA 2D3ZA 2KB2A 2HBZB 2J6SA 1XMQK 2Q6CA 2YQ0A 2F63A 2C2DA 2R7RA 3CJ8A 2WVDA 4DKWA 2YWEA 3DRRB 2DPIA 4BQLA 3ISND 3V1OA 4OYIA 2R7TA 1RKJA 2KO1A 1NMNA 4FDFA 3MUVP 3SDEB 1W7WA 3WDOA 4Q43A 2L9WA 3NXZA 2CPXA 1HKGA 1H72C 4W98A 3QJLA 3A8YA 5J2QA 2JWNA 3T5JA 4AT1B 1JL1A 3R6MA 5AQQA 3SCIE 4O55A 2XC9A 1RHUB 4ZCLA 2EW9A 4A8YA 3OL7A 3GIIA 3PSIA 1FO1A 4KAIA 3QGGA 1N36K 3ZSRA 1RCXB 4HTIA 2CJQA 2EC2A 1U49A 4JI6K 1KONA 2RQCA 1KD1O 4BC2A 4CFDA 3KLGB 2R8JA 1NSQA 3OW2R 3GJSB 3B4DA 5KQ8A 2MZSA 4HR2A 4QR2A 1JJHA 2Z58B 2UUAF 3PZPA 2AX0A 2W4CA 4EO6A 4LF8J 3GZ7A 3M8WA 3W2WA 3LGHA 3SJJA 1J5EJ 1X9WA 1HKAA 2X1BA 3DC2A 4O44A 4RKUC 2FHOB 3JAMU 2E5LJ 1BI4B 4BRQA 4V19J 1NOYA 3TJ8A 1TKTB 1RAEB 5KFUA 1BQNA 2ZGZA 5LSRA 3Q24A 5D4LA 4CLYA 3EMTA 4W90B 3KK3A 3E51A 4ZTJA 2ZC4A 2BABA 3MEKA 1BCOA 5KPZA 2IRUA 3ZTSA 1R8HA 1H2TZ 3ZZUA 4JI3J 1YJWS 2QL9B 1YLXA 4UT4A 3G4SN 4FVCA 3Q23A 1DAXA 3W9IA 2V50A 3TTFA 4Q8FA 4H4KA 4LH5A 4BDZA 1B9DA 2ACYA 2JWLA 2YNHA 3FDSA 3JQJA 2R42A 3HVTA 4F3TA 3L7PA 3BGFA 3JSRA 4ISGA 4CEBA 3KJVA 2RN2A 3AH6A 3KWMA 1HI0P 2UVVA 2H3EB 1S1TB 4ECZA 1I94F 3U8XA 2NYHA 1KVCA 4FLXA 1KTVA 1BMQB 5AQHA 1EX8A 2VPZB 3KDOA 5AJ3F 1IBLJ 3CFPA 3SSRA 1HYSB 2B9WA 3CJRA 2Z8QA 3BQ1A 1REGX 1TVRA 3BYRA 1VOMA 2NR0A 2VA3A 4DR6F 1OIAA 5LMNF 3EWGA 4WCEQ 4KT0C 3PW7A 1N88A 5JS2A 5JICA 5IWAJ 2XGPA 1ZH5A 1JJCB 1QAYA 4JV0A 1SVDA 2HVIA 3UR0A 3SLCA 3ZX3A 2C2MB 4IFVA 1T94A 1NM2A 4DQPA 4OYXA 5D0EA 2EFQA 5GAEI 4S0MA 4ECSA 2XEXA 1WSEA 4ZPBA 3PVXA 4DCJB 4LQ3A 4L3KA 4F4AA 2VCPA 4DX6A 4H4MA 1N34J 4K59A 1FWLA 4XIUA 4KH4A 1R8PA 3OTDA 1IR2A 4KC5A 3P39A 3PO4A 1WC1A 3TYTA 1XI1A 3CC2S 4JKHA 4DR5K 3I33A 3CDAA 2F9WA 1TMJA 4CHZA 2FGCA 3MM8B 2V68A 3QLHB 3IM8A 4FK4A 4HWIA 1WORA 4U7UD 2X1GA 3FBCA 2X3GA 3MM7A 1APSA 4ZVTB 2BE2A 1UEUA 2CH5A 4RUHA 5MLCV 2D0BA 4FBTA 3Q86A 2VFTA 2NCKL 1OJ4A 4LJMA 4N47A 3OTEA 4CZFA 2CVEA 2ZH8A 3M2UB 4EHTA 4M5MA 4OHVA 2UU9J 1GFWB 4KHUA 3RW6A 1RWOB 2RDIA 2V0NA 3D6TB 2BDPA 2CZVC 1HMVA 3Q8VA 3TP2A 2RSQA 1PJ5A 4C2MA 3HHNB 1WNSA 5FLXY 4M45A 1WNEA 3W64A 1RT4A 2F65A 1DTQB 4CJQA 4JNEA 5A2QU 5IFMA 5CZVA 2ZKUA 4I0WA 3NAHA 2Y3YA 1HPMA 5ETOA 4NLPA 5J2MB 4RW7B 3CDWA 3CF5Q 4PXCA 1XR7A 2H9ZA 4OZ0A 3NGUA 3VALA 1RILA 4OLBA 3DOLB 5AZJB 2EK6A 1DJ0A 1KQFB 2D0PA 4DTJA 2QWMA 4OX9J 4FVMA 1VSHA 1OH8A 1KAZA 2XMTA 3IM9A 3C8YA 1SUQB 2R7QA 1FHTA 2MLZA 4H4MB 2KTQA 1RHQB 4QIFA 4LFAJ 5GMKa 2DNRA 4OYMA 1PG5B 4CHOA 3TAQA 2FJEB 1VC5A 1U1LA 2YJEA 1N5TA 3ADAC 1H3DA 4PXDA 3ID6A 4JKEA 4ZPDA 2QYGA 3KLIA 3S7RA 3LOUA 2RD5C 1KVIA 2G8FA 2DIVA 1PJ7A 3K5PA 5BN8A 3TWHA 4X4VA 5FRNA 2DHGA 4DU4A 3GYXB 1XMQF 3K89A 3WNHA 1XN9A 4BGAA 2GA7A 3S3OA 3V81A 3UCGA 1NK8A 2YHXA 3NG8A 5GAGU 3H45C 4MIBA 3PYEA 4HHJA 4DV2K 5HROB 1FF2A 1BUXA 3R97A 1U2VB 3RMDA 4QBUA 1IG8A 1ASWA 4WU3A 1RSCA 1VRQC 1HI8A 4AILC 4B9TA 1SCJB 5LMUK 3H2VE 3OYFA 2MDAA 5F8MA 2GV1A 2W2OP 3DJCA 1HNVB 4MT1A 3RB3A 4ILLA 5HVHA 4NCGB 4GMJB 1Q86O 2ZHBA 2PFFB 4F2SA 3MXMA 1NB7A 2MGZB 3SUNA 1JXVA 4UZCA 5M1OA 3HPGA 5KTQA 2ZD1B 3HULA 3KFWX 4GMKA 4MO5A 1FTRA 3D7SB 2WCXA 3ULDA 3MI7X 4BDYA 3U3YA 4FZYA 3QFWA 3QWUA 1EIYB 4TXSA 4ED8A 2F7VA 1FX4A 2IM0A 2BOAA 2ASJA 4CI0B 3I4HX 1CJVB 4KHRA 2A40A 1U45A 4QU7A 4B3SK 2B56A 3MMCA 1KTQA 2ATCB 2VBYA 4ECXA 4QOZB 3VQBA 4KBIA 2ZKTA 3M2RA 2YNFB 2JVRA 5HL7Q 4FF4A 2CPYA 1HNWK 4OO1J 4Y6IA 3M6WA 3A2FA 4KH0B 1MWYA 2LFVA 5KGWA 3AVFA 3H1VX 1J2VA 2Q36A 2ILZA 1MSWD 3QRPA 4KKOA 1A6LA 1PYSB 2E5LF 2DB1A 1ASUA 4N8NA 4LBIA 1RT7B 3ASMA 1JKHA 2DGSA 2ZNYA 1QAIA 4M3YA 3NMUA 3M9MB 3UVJB 3G6XA 1YBUA 2VQFK 5H1SV 3OL8A 3TSUA 2WHOA 5CABA 3MOJB 2V8DA 4LF7F 2CNKB 2VOPA 1AW0A 3I82A 3A8IA 1YVFA 2V6AA 3U4LA 3CMEN 2BE9B 3AD7C 5KFWA 5BRFA 2E1ZA 1RU1A 4EYIB 2IAJB 1RWNB 1CJKB 4UY8T 1T3OA 5CXTA 1BISA 5FPNA 4WXOA 3QFPA 2V4QA 2AA4A 1RAJA 5CZ1A 1FJCA 3HFVA 2WAQD 1Y3JA 4LF9F 5JLFA 4AXIA 3ENAA 4CYUB 1UPPA 5K8MA 2E1CA 2PE8A 4IDHA 5ETRA 4WF9Q 4DS4A 2DGTA 1X7VA 4KRFA 5C25B 5GAGP 3CCES 1ZM2A 1NGIA 3JQMA 4Y1CA 1WKJA 3LM2A 3G82B 3EE8A 2X1FA 5A6WA 3ZT1A 2OP5A 4NCBA 1NLVA 3J7ZO 4WE1B 4M3TA 4RWXA 3F44A 2J9DA 3EKSA 4L6V3 3CD0A 3OXFA 4PL8A 2FSJA 4W5OA 4YR0A 4EIAA 5HAOA 1FNMA 4YS2A 2VU5A 2HHHF 2HMPA 2P9PB 3MM7B 5ADZA 3WT0A 2IVPA 3N4PA 5M1KA 1SC4B 4JV5F 2MKSA 2P9IB 3NNAA 5HLFB 1X5TA 4MLEA 2UUAJ 2HOEA 1JLFB 4YEAA 2COLA 4QIVA 3BR9A 1C2PA 1C0TA 5AQYA 3FCWA 2GAGC 1JKHB 5J2QB 4H4OA 5KFJA 4P7VA 3C6TB 3KLFA 2XSFA 4XPEA 1YDLA 1FDBA 3DXSX 1VQSA 1IXKA 3PYDA 3T1HJ 2ACMA 4QPXA 1VAZA 4PA1A 3C6AA 4QWBA 2UV8G 3QJPA 2HBJA 1WG5A 3OVBA 3QO9B 2QEXS 3O3FA 4LF5J 5CZXA 1RDCA 1S7HA 2N82B 4IG0B 4RW7A 1J53A 1I1GA 1TL1B 4P52A 3TUIC 5KT6A 3PW2A 2UVWA 4Y2AA 4NLUA 5HRNA 1X5SA 1JMTA 4K4TA 3WXIA 2PIIA 3R7BB 4WCEL 4F26A 2QA4G 1NBEB 1KQSR 2CQDA 3UN2A 4FPAA 3OUYB 2Y1JA 4OX9K 4LF4K 5IT0A 3I31A 4Q2MA 1RBTA 3ENWA 3M1VA 5F0WA 5K8OA 2R9LA 2J0SD 3TAMA 3J81j 1P27B 2VFVA 4FM0A 1TP7A 3DXMA 3MEEB 1VQMN 3KLHB 2UUBK 2OUGA 3VEZA 4AQYJ 4RJVA 3CFOA 3OYGA 1HJOA 4HLBA 4ECWA 3FRZA 4WTYA 4CBUA 3NGIA 3CCEN 1B9FA 4OKKA 1T3VA 1J5EF 3FZFA 5A8RB 4ZIWA 3RR7A 1Q8LA 2NQPA 3OYEA 3R7NB 1GNKA 3VV2B 2DGOA 1WDTA 1ACMB 1IKXA 5JVHQ 3MAHA 3DOMB 2GQ2A 1NKEA 3EXCX 4Q45A 4IOBA 1OVQA 3CTRA 4KB7A 1IKYA 2BM1A 4Y28C 1LK5A 2WW8A 1ASVA 4KHMA 2FVPA 1G4CA 5A2QY 4A2BA 4KAZA 1TKXA 4KR0B 3VR1A 4ES2A 2A41A 5IT9O 4GVBA 4OZLA 4AH9A 5HRSA 2DPNA 1VBKA 1W25A 3NEKA 4PQAA 4MKAA 5JMNA 1RT6B 3MECA 3O1BA 5BR8K 3D0PA 2MGZA 3AO5A 3DM2A 1UWBA 3EY1A 3CM6A 4C8LA 2DITA 2H5IB 4BRKA 2UUBF 2QSFA 1FRLA 4DR7K 4Z94A 2LQ8A 3QZ7A 1ULRA 2V9KA 3IGVA 5BREA 4B1WB 1FRKA 3HHLB 3TNVA 4AHSA 4CWBA 4OLOA 4FL9A 1TKDA 3PDNA 3THWA 3BSNA 3FBBA 2EG1A 4EZ6A 3G25A 2LA4A 2OPQA 1IKVA 3MN5A 4CGGA 3CNQP 3T19A 2MKYA 4FLWA 3IN5A 3W8PA 2RVJA 3GPAA 2XSJB 3KK2B 2JZ5A 4DV5J 5C2FA 3H25A 2YKMB 3WIVA 3AFGA 1RLCL 2YNFA 1YX2A 2HWTA 2O5DA 3BGRB 2QLXA 1HNXK 1KBRA 3RMAA 2UUCF 4DUYJ 3TO8A 4JKCA 1NK9A 1Y3KA 3HXMA 2V8GA 3L7UA 1BIZA 3DRYA 2H4YB 4X4PA 1S57A 4PUOA 3SUOA 1U1OA 3I0SB 4Y1DA 2W9BB 5KRSA 3ICLA 3MUTP 1C4CA 1VQ8S 1OVYA 4RL1A 1U26A 4Q2LA 3SDEA 4K4UA 2W01A 1N32F 3Q89A 2LECA 5E41A 4BC9A 3OY9A 4IH6A 4PWWA 1HYZA 3L0QA 5LL6Z 5KFQA 1I51B 2FJVA 1JLCA 1CQNA 3W3SA 4URQU 3CJ9A 1YITN 5FJ4A 4JI5J 4CJFA 1WEXA 1VQNS 2AP6A 4CH0S 1CZAN 3OHBA 3VAKA 2F3JA 1LQ9A 3GV8B 4XH5A 5KFOA 3ZTRA 4ZN1A 4M1KA 1JLBA 1URNA 3U9ZA 3VGSA 3M9OB 1U1MA 1F5CA 3J7ZT 2Q43A 3CJ5A 2RS2A 3BO4A 2AV5A 2DKOB 2ASLA 3DOLA 1W7AA 1WUAA 3SUQA 1BQNB 3R3TA 3PJXA 1LW0B 1TGOA 4GC6A 2E9TA 3IS9B 4LRAA 1GH8A 2B5JB 4CFAA 3V6HA 2V2VA 1VSIA 3AD9C 1SL0A 4OMFG 3OTCA 4ECQA 4F0KA 3H98A 2KJWA 1AZSA 3CIMA 4JRPA 1O1WA 1LXJA 1HNZJ 2NXEA 3OYNA 1UFKA 3SNNA 2VHGA 3K5MA 2Y1RI 2DBBA 5HK4A 1BWFO 3CI5A 4CJ5A 2HQGA 1O6XA 2LXUA 2IJFA 3TQ1A 2C3UA 3R2DJ 5KFLA 3PX6A 1NXIA 3LWMA 3BDEA 1V3ZA 4CLZA 2MZTA 3E2EA 1K73O 1RT1A 1X4FA 2JVOA 4ILHA 5I3UB 2VG6B 2NYIA 1X8DA 2VQEF 4RU9A 7FD1A 3DGPB 2P6TA 4DV3F 2IMOA 3FRYA 3H4BA 4CECA 1IR1A 2FDNA 1D8ZA 1Q9YA 2IFXA 2HURA 2A3JA 2DH9A 3C6UA 4LSNA 5AQJA 2JSXA 4U7CA 2NRVA 1N4LA 4K0KJ 4KJIA 4DR4K 1JLEB 1UFLA 2P9SB 3EJMA 4FK2A 1N33F 4BRFA 1SJRA 1Q18A 3LF0A 5JXSA 3TW0A 5B0BA 3EVWA 1WACA 2NXJA 5KT5A 2RPIA 3T5KA 3R5AA 5HJXA 4IG3A 4G9ZA 5DG9A 3OJUA 4A8MP 2RUGA 2QFIA 3DOKA 2F7TA 2OAUA 1TL1A 2XMKA 2HHQA 3V4IA 2RUSA 5D6GA 1HBMA 1T9YA 5DRKA 3GFZA 5LJ5Y 1LW2B 1CXUA 2LU1A 2P9NB 2GV9A 5D3GB 1HWLA 5I9EB 4USIA 4JI0J 3NF8A 4KTWA 2LSNA 1QSSA 1Q7YO 1U7LA 4UY8O 2J9EA 1U04A 3CHWA 2HS4A 3ENQA 5LJWA 3ZT4A 2JLEA 1ZZFA 4GKKK 3V9SA 1CZ9A 3PG9A 1ZM4A 3OR1A 2EEYA 4KHWA 2G8IA 3ZZOA 5HI7A 3AOBA 3OD2A 1PGZA 4CO0A 3CD5A 2ZJRQ 1OY8A 1CQMA 4RW6A 4BCAA 2MSSA 2Q31A 1ITPA 3THVA 1TAUA 3CF5L 5GADU 2Y0SD 1NHUA 3MCSA 3TZYA 4O0NA 2EC0A 2MQQA 1OY9A 3ULEB 2MTLA 4LF5F 3UD3P 1YAGA 1SJ3P 3HI0A 1PO6A 1WOQA 1Q79A 2E2QA 4OYOA 1RGVA 4OJHA 2G13A 2RKIA 2VV5A 4MKBA 5AFUA 2DT9A 3NCPA 1UWBB 5DO2A 3PV8A 2J6TA 4A62A 2G2YA 4I7FB 4FP9A 3SAFA 3OQ2A 1CJKA 1XMQJ 4FNHA 1S5ZA 4JKBA 4X4QA 4PYDA 3J80O 4DUZJ 5I4MA 4X65K 3ZSOA 5HBMA 4B9VA 1KSPA 2QN6B 2I8EA 3AOCA 3ITHB 1D5AA 2KXHA 3M32A 4JBCA 5RUBA 2WUSA 2HZAA 2IHR1 1RDWX 4CESA 2BH1A 2RF2B 5L1IA 2XSJA 3EUNA 5C25A 1MA9B 2OEKA 1IJJA 4BC7A 2XLJA 1CBKA 3VQSA 3UIQA 1NPKA 1HD0A 1SXLA 4C8MA 5AQWA 1X3MA 1TKZB 3VESA 4OX9F 4C3KA 4JI8J 3MPYA 3SQ4A 1FFWB 4M95A 2MEWA 4ZS6A 4KHPJ 3DFEA 4WFNL 1N36J 1RJJA 3BGOP 2HGLA 1JNZB 3BBCA 4USWA 2F8EX 1Q1KA 2P9IA 3V81B 2I7PA 4CZJA 2BA9A 4PPZA 2JLGA 3H42A 3HRGA 2O8EB 2MQOA 2M5YA 4FWOA 2DGXA 1M0SA 5HMYA 4AUKA 2ROPA 2JC0A 3OBYA