2WPAB

Optimisation of 6,6-dimethyl pyrrolo 3,4-c pyrazoles: identification of pha-793887, a potent cdk inhibitor suitable for intravenous dosing
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Optimization of 6,6-Dimethyl Pyrrolo[3,4-C]Pyrazoles: Identification of Pha-793887, a Potent Cdk Inhibitor Suitable for Intravenous Dosing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 89
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wpaB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wpaB02
4F7NB 3DOGB 1AISB 4F6WB 1OIUB 4BCMB 4BCMD 3TNIB 4Y72B 2WMAB 2WIHB 3MI9B 1H27B 2WPAB 5EFQB 4BCJB 5HBHB 4EOMB 2WHBB 5HQ0B 2IW8B 4CRLB 4CFNB 4EOIB 5CEIB 3K7AM 4ROCA 2C6TB 2PK9B 2W96A 3TNHB 5IDNB 2IW6B 1OKVB 1VINA 2IVXA 4NSTB 5ICPB 4YC3B 4ROEA 1G3NC 2C5XB 4BCOB 1JKWA 4BCKB 1OIYB 3DDQB 2C5NB 3RGFB 4EOLB 4CFXB 2I40B 2JGZB 2PHGA 4BCND 4EONB 1E9HB 3POMA 2W99A 2PK2A 2B9RA 3MIAB 1GY3B 4EOSB 4BCIB 1H1QB 1H25B 1VOLA 2UUEB 3F5XB 2UZEB 4G6LB 5HBJB 5HBEB 2C5VB 4F6SB 1AD6A 1H28B 1JSUB 4RODA 3M03A 1OGUB 1P5EB 1ZP2A 5LMKB 4CFWB 1H24B 4KRCB 3LQ5B 1UNLD 2BKZB 5IF1B 1O9KB 4EC8B 3BHTB 4CFVB 3MY1B 4BCFB 2G9XB 1H1RB 1H1SB 2F2CA 4EOKB 2WEVB 3EJ1B 3TN8B 3BLHB 4II5B 2W9ZA 4YOZA 4BCNB 1QMZB 1XO2A 1F5QB 1JSTB 1JOWA 4BCQB 4BCHB 2PMIB 4BCQD 4EOQB 1GUXB 2CJMB 4FX3B 2UZLB 4UN0A 2WXVB 4EORB 3O0GD 4TTHA 3QHRB 4OGRB 1OI9B 1TFBA 2EUFA 2C4GB 4I3ZB 1H4LD 1FINB 2WMBB 1FVVB 3TNWB 4EC9B 5HNBB 5HVYB 1W98B 2UZBB 2X1NB 1H1PB 5I5ZB 3EOCB 1UNGD 2CCIB 5LQFB 1VYWB 1BU2A 1URCB 1OL1B 4F7JB 4YOOA 2CCHB 4ELJA 4ELLA 4IMYB 4BCPB 1C9BA 4F6UB 5BNJB 4YOSA 1N4MA 2C5OB 4EOJB 2WFYB 2I53A 1GUXA 4CFMB 4EOOB 1H26B 2QDJA 5CYIB 3QHWB 5ACBA 1OL2B 2UZDB 2R7GA 3G33B 3MY5B 5IDPB 3H4CA 1GH6B 2WIPB 2BPMB 4CFUB 1PKDB 4CFUD 2W2HA 2W9FA 4F70B 1OKWB 2V22B 4BCGB 3BHVB 1O9KA 3BHUB 4KRDB 4CXAB 5FGKB 1UNHD 3EIDB 4EOPB 4F7SB 3BLQB 4OR5B 1D3UB 1KXUA 2IW9B 3DDPB 4F7LB 5L2WB 3BLRB
chains in the Genus database with same CATH superfamily
2WIHB 1UGSB 1TD6A 4EOMB 2C6TB 3VYGB 2IVXA 4ROEA 4AKIA 2C5XB 3VKGA 4EOLB 4EONB 3X25B 2PK2A 4AI6A 1H25B 2D0QB 1VOLA 2UUEB 5HBJB 5HBEB 1H28B 2ZPEB 2CZ7B 4CFWB 4KRCB 3HHTB 3BHTB 4Z6YA 4OB1B 4BCFB 3TW7A 2F2CA 4EOKB 3EJ1B 3BLHB 3DL1A 4BCQB 2CJMB 4EORB 3O0GD 3QWLA 1ENWA 1TFBA 3B57A 4AKGA 4BBRM 1FVVB 3VYHB 3A8GB 3TNWB 5HVYB 1W98B 2UZBB 1H1PB 1UNGD 4M6VA 5LQFB 1URCB 3BG9A 2BS2A 2CCHB 4IMYB 4BCPB 3HZJA 4YOSA 1N4MA 1UGPB 1OL2B 5IDPB 2WIPB 2BPMB 2W2HA 2QF7A 4CFUD 2W9FA 4BBSM 4BY7X 2PJQA 3HBLA 2QDYB 4BXXX 3GTMS 3QXEB 2WJ9A 4KRDB 4CXAB 1AHJB 2ZZDB 1KXUA 3DDPB 4HNTA 3X26B 3DOGB 4BCMB 2KR6A 4JX6A 2CYZB 3MI9B 1H27B 5HQ0B 2IW8B 4EOIB 4ROCA 2PK9B 2W96A 3TNHB 4MIMA 5IDNB 2IW6B 4NC6A 1E7PA 3QYHB 1OIYB 1UGRB 3A8LB 2C5NB 3A8HB 2JGZB 2DD5B 1E9HB 4ZGJB 2CZ1B 4BCIB 3HO8A 3TW6A 4AKHA 4G6LB 4F6SB 1P5EB 1ZP2A 3A8MB 5LMKB 2CZ0B 1UNLD 2BKZB 5IF1B 1O9KB 4EC8B 3VKHA 3MY1B 2QFZA 2ZPIB 4YOZA 1QMZB 1F5QB 1JOWA 2PMIB 2UZLB 2WXVB 4TTHA 3QHRB 1OI9B 2C4GB 4I3ZB 5HNBB 2CCIB 2DD4B 1FKMA 1C9BA 4JX5A 4F6UB 5BNJB 3QHWB 2R7GA 4LOCA 1UNHD 3EIDB 4F7SB 4F7LB 3KHIA 3QYGB 2QQ8A 1AISB 4F6WB 1OIUB 3TNIB 2WMAB 2BS4A 4BCJB 4CFNB 5CEIB 1OKVB 4HNUA 1VINA 4OB0B 4YC3B 2LW4A 4BCOB 1JKWA 4BCKB 3WVDB 3DDQB 3RGFB 4CFXB 2KMGA 2ZPBB 3POMA 2W99A 2B9RA 1GY3B 3X24B 2DMEA 1H1QB 3QYBA 3F5XB 1AD6A 1QLBA 3DTOA 4CFVB 2G9XB 1H1RB 3TN8B 3HB9A 3WVEB 2W9ZA 4BCNB 3BG5A 1IREB 2DPPB 4BCQD 4EOQB 4FX3B 2ZPGB 3BG3A 2EUFA 1H4LD 2WMBB 2X1NB 5I5ZB 2BS3A 1VYWB 1OL1B 4F7JB 4ELLA 3QZ9B 4EOJB 4CFMB 2AHJB 5ACBA 2UZDB 3G33B 3MY5B 3H4CA 2ZPFB 4CFUB 2QGSA 3BHVB 1O9KA 3BHUB 5FGKB 4EOPB 1D3UB 3X28B 5DQVA 3BLRB 4F7NB 4FM4B 4BCMD 4Y72B 2WPAB 5EFQB 5HBHB 2WHBB 4CRLB 3K7AM 4NSTB 5ICPB 1G3NC 2CZ6B 2ZPHB 5IHYA 3DJBA 2I40B 4ZGDB 2PHGA 3A8OB 3QYEA 4BCND 4ZGEB 2G77A 3MIAB 4EOSB 1V29B 3X20B 2UZEB 4JX4A 2C5VB 1JSUB 4RODA 3M03A 4MFDA 5EJCA 1OGUB 1H24B 3LQ5B 2ZCFB 1H1SB 2WEVB 4OB2B 4II5B 3QZ5B 4MFEA 1XO2A 1JSTB 2IN3A 4BCHB 4HLQA 1GUXB 4UN0A 4OB3B 4OGRB 4BY1X 5DQWA 1UGQB 3NDQA 1FINB 4HL4A 4EC9B 4HNVA 3PO3S 3EOCB 1BU2A 4YOOA 4ELJA 2C5OB 2WFYB 2I53A 1GUXA 4EOOB 1H26B 2QDJA 5CYIB 4QSHA 1GH6B 2DXBB 1PKDB 4F70B 1OKWB 2V22B 4BCGB 2DXCB 3BLQB 4OR5B 2IW9B 5L2WB
chains in the Genus database with same CATH topology
4F7NB 3DOGB 1AISB 4F6WB 1OIUB 4BCMB 4BCMD 3TNIB 4Y72B 2WMAB 2WIHB 3MI9B 1H27B 2WPAB 5EFQB 4BCJB 5HBHB 4EOMB 2WHBB 5HQ0B 2IW8B 4CRLB 4CFNB 4EOIB 5CEIB 3K7AM 4ROCA 2C6TB 2PK9B 2W96A 3TNHB 5IDNB 2IW6B 1OKVB 1VINA 2IVXA 4NSTB 5ICPB 4YC3B 4ROEA 1G3NC 2C5XB 4BCOB 1JKWA 4BCKB 1OIYB 3DDQB 2C5NB 3RGFB 4EOLB 4CFXB 2I40B 2JGZB 2PHGA 4BCND 4EONB 1E9HB 3POMA 2W99A 2PK2A 2B9RA 3MIAB 1GY3B 4EOSB 4BCIB 1H1QB 1H25B 1VOLA 2UUEB 3F5XB 2UZEB 4G6LB 5HBJB 5HBEB 2C5VB 4F6SB 1AD6A 1H28B 1JSUB 4RODA 3M03A 1OGUB 1P5EB 1ZP2A 5LMKB 4CFWB 1H24B 4KRCB 3LQ5B 1UNLD 2BKZB 5IF1B 1O9KB 4EC8B 3BHTB 4CFVB 3MY1B 4BCFB 2G9XB 1H1RB 1H1SB 2F2CA 4EOKB 2WEVB 3EJ1B 3TN8B 3BLHB 4II5B 2W9ZA 4YOZA 4BCNB 1QMZB 1XO2A 1F5QB 1JSTB 1JOWA 4BCQB 4BCHB 2PMIB 4BCQD 4EOQB 1GUXB 2CJMB 4FX3B 2UZLB 4UN0A 2WXVB 4EORB 3O0GD 4TTHA 3QHRB 4OGRB 1OI9B 1TFBA 2EUFA 2C4GB 4I3ZB 1H4LD 1FINB 2WMBB 1FVVB 3TNWB 4EC9B 5HNBB 5HVYB 1W98B 2UZBB 2X1NB 1H1PB 5I5ZB 3EOCB 1UNGD 2CCIB 5LQFB 1VYWB 1BU2A 1URCB 1OL1B 4F7JB 4YOOA 2CCHB 4ELJA 4ELLA 4IMYB 4BCPB 1C9BA 4F6UB 5BNJB 4YOSA 1N4MA 2C5OB 4EOJB 2WFYB 2I53A 1GUXA 4CFMB 4EOOB 1H26B 2QDJA 5CYIB 3QHWB 5ACBA 1OL2B 2UZDB 2R7GA 3G33B 3MY5B 5IDPB 3H4CA 1GH6B 2WIPB 2BPMB 4CFUB 1PKDB 4CFUD 2W2HA 2W9FA 4F70B 1OKWB 2V22B 4BCGB 3BHVB 1O9KA 3BHUB 4KRDB 4CXAB 5FGKB 1UNHD 3EIDB 4EOPB 4F7SB 3BLQB 4OR5B 1D3UB 1KXUA 2IW9B 3DDPB 4F7LB 5L2WB 3BLRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7N B;  3DOG B;  1AIS B;  4F6W B;  1OIU B;  4BCM B;  4BCM D;  3TNI B;  4Y72 B;  2WMA B;  2WIH B;  3MI9 B;  1H27 B;  2WPA B;  5EFQ B;  4BCJ B;  5HBH B;  4EOM B;  2WHB B;  5HQ0 B;  2IW8 B;  4CRL B;  4CFN B;  4EOI B;  5CEI B;  3K7A M;  4ROC A;  2C6T B;  2PK9 B;  2W96 A;  3TNH B;  5IDN B;  2IW6 B;  1OKV B;  1VIN A;  2IVX A;  4NST B;  5ICP B;  4YC3 B;  4ROE A;  1G3N C;  2C5X B;  4BCO B;  1JKW A;  4BCK B;  1OIY B;  3DDQ B;  2C5N B;  3RGF B;  4EOL B;  4CFX B;  2I40 B;  2JGZ B;  2PHG A;  4BCN D;  4EON B;  1E9H B;  3POM A;  2W99 A;  2PK2 A;  2B9R A;  3MIA B;  1GY3 B;  4EOS B;  4BCI B;  1H1Q B;  1H25 B;  1VOL A;  2UUE B;  3F5X B;  2UZE B;  4G6L B;  5HBJ B;  5HBE B;  2C5V B;  4F6S B;  1AD6 A;  1H28 B;  1JSU B;  4ROD A;  3M03 A;  1OGU B;  1P5E B;  1ZP2 A;  5LMK B;  4CFW B;  1H24 B;  4KRC B;  3LQ5 B;  1UNL D;  2BKZ B;  5IF1 B;  1O9K B;  4EC8 B;  3BHT B;  4CFV B;  3MY1 B;  4BCF B;  2G9X B;  1H1R B;  1H1S B;  2F2C A;  4EOK B;  2WEV B;  3EJ1 B;  3TN8 B;  3BLH B;  4II5 B;  2W9Z A;  4YOZ A;  4BCN B;  1QMZ B;  1XO2 A;  1F5Q B;  1JST B;  1JOW A;  4BCQ B;  4BCH B;  2PMI B;  4BCQ D;  4EOQ B;  1GUX B;  2CJM B;  4FX3 B;  2UZL B;  4UN0 A;  2WXV B;  4EOR B;  3O0G D;  4TTH A;  3QHR B;  4OGR B;  1OI9 B;  1TFB A;  2EUF A;  2C4G B;  4I3Z B;  1H4L D;  1FIN B;  2WMB B;  1FVV B;  3TNW B;  4EC9 B;  5HNB B;  5HVY B;  1W98 B;  2UZB B;  2X1N B;  1H1P B;  5I5Z B;  3EOC B;  1UNG D;  2CCI B;  5LQF B;  1VYW B;  1BU2 A;  1URC B;  1OL1 B;  4F7J B;  4YOO A;  2CCH B;  4ELJ A;  4ELL A;  4IMY B;  4BCP B;  1C9B A;  4F6U B;  5BNJ B;  4YOS A;  1N4M A;  2C5O B;  4EOJ B;  2WFY B;  2I53 A;  1GUX A;  4CFM B;  4EOO B;  1H26 B;  2QDJ A;  5CYI B;  3QHW B;  5ACB A;  1OL2 B;  2UZD B;  2R7G A;  3G33 B;  3MY5 B;  5IDP B;  3H4C A;  1GH6 B;  2WIP B;  2BPM B;  4CFU B;  1PKD B;  4CFU D;  2W2H A;  2W9F A;  4F70 B;  1OKW B;  2V22 B;  4BCG B;  3BHV B;  1O9K A;  3BHU B;  4KRD B;  4CXA B;  5FGK B;  1UNH D;  3EID B;  4EOP B;  4F7S B;  3BLQ B;  4OR5 B;  1D3U B;  1KXU A;  2IW9 B;  3DDP B;  4F7L B;  5L2W B;  3BLR B; 
#chains in the Genus database with same CATH topology
 2WIH B;  1UGS B;  1TD6 A;  4EOM B;  2C6T B;  3VYG B;  2IVX A;  4ROE A;  4AKI A;  2C5X B;  3VKG A;  4EOL B;  4EON B;  3X25 B;  2PK2 A;  4AI6 A;  1H25 B;  2D0Q B;  1VOL A;  2UUE B;  5HBJ B;  5HBE B;  1H28 B;  2ZPE B;  2CZ7 B;  4CFW B;  4KRC B;  3HHT B;  3BHT B;  4Z6Y A;  4OB1 B;  4BCF B;  3TW7 A;  2F2C A;  4EOK B;  3EJ1 B;  3BLH B;  3DL1 A;  4BCQ B;  2CJM B;  4EOR B;  3O0G D;  3QWL A;  1ENW A;  1TFB A;  3B57 A;  4AKG A;  4BBR M;  1FVV B;  3VYH B;  3A8G B;  3TNW B;  5HVY B;  1W98 B;  2UZB B;  1H1P B;  1UNG D;  4M6V A;  5LQF B;  1URC B;  3BG9 A;  2BS2 A;  2CCH B;  4IMY B;  4BCP B;  3HZJ A;  4YOS A;  1N4M A;  1UGP B;  1OL2 B;  5IDP B;  2WIP B;  2BPM B;  2W2H A;  2QF7 A;  4CFU D;  2W9F A;  4BBS M;  4BY7 X;  2PJQ A;  3HBL A;  2QDY B;  4BXX X;  3GTM S;  3QXE B;  2WJ9 A;  4KRD B;  4CXA B;  1AHJ B;  2ZZD B;  1KXU A;  3DDP B;  4HNT A;  3X26 B;  3DOG B;  4BCM B;  2KR6 A;  4JX6 A;  2CYZ B;  3MI9 B;  1H27 B;  5HQ0 B;  2IW8 B;  4EOI B;  4ROC A;  2PK9 B;  2W96 A;  3TNH B;  4MIM A;  5IDN B;  2IW6 B;  4NC6 A;  1E7P A;  3QYH B;  1OIY B;  1UGR B;  3A8L B;  2C5N B;  3A8H B;  2JGZ B;  2DD5 B;  1E9H B;  4ZGJ B;  2CZ1 B;  4BCI B;  3HO8 A;  3TW6 A;  4AKH A;  4G6L B;  4F6S B;  1P5E B;  1ZP2 A;  3A8M B;  5LMK B;  2CZ0 B;  1UNL D;  2BKZ B;  5IF1 B;  1O9K B;  4EC8 B;  3VKH A;  3MY1 B;  2QFZ A;  2ZPI B;  4YOZ A;  1QMZ B;  1F5Q B;  1JOW A;  2PMI B;  2UZL B;  2WXV B;  4TTH A;  3QHR B;  1OI9 B;  2C4G B;  4I3Z B;  5HNB B;  2CCI B;  2DD4 B;  1FKM A;  1C9B A;  4JX5 A;  4F6U B;  5BNJ B;  3QHW B;  2R7G A;  4LOC A;  1UNH D;  3EID B;  4F7S B;  4F7L B;  3KHI A;  3QYG B;  2QQ8 A;  1AIS B;  4F6W B;  1OIU B;  3TNI B;  2WMA B;  2BS4 A;  4BCJ B;  4CFN B;  5CEI B;  1OKV B;  4HNU A;  1VIN A;  4OB0 B;  4YC3 B;  2LW4 A;  4BCO B;  1JKW A;  4BCK B;  3WVD B;  3DDQ B;  3RGF B;  4CFX B;  2KMG A;  2ZPB B;  3POM A;  2W99 A;  2B9R A;  1GY3 B;  3X24 B;  2DME A;  1H1Q B;  3QYB A;  3F5X B;  1AD6 A;  1QLB A;  3DTO A;  4CFV B;  2G9X B;  1H1R B;  3TN8 B;  3HB9 A;  3WVE B;  2W9Z A;  4BCN B;  3BG5 A;  1IRE B;  2DPP B;  4BCQ D;  4EOQ B;  4FX3 B;  2ZPG B;  3BG3 A;  2EUF A;  1H4L D;  2WMB B;  2X1N B;  5I5Z B;  2BS3 A;  1VYW B;  1OL1 B;  4F7J B;  4ELL A;  3QZ9 B;  4EOJ B;  4CFM B;  2AHJ B;  5ACB A;  2UZD B;  3G33 B;  3MY5 B;  3H4C A;  2ZPF B;  4CFU B;  2QGS A;  3BHV B;  1O9K A;  3BHU B;  5FGK B;  4EOP B;  1D3U B;  3X28 B;  5DQV A;  3BLR B;  4F7N B;  4FM4 B;  4BCM D;  4Y72 B;  2WPA B;  5EFQ B;  5HBH B;  2WHB B;  4CRL B;  3K7A M;  4NST B;  5ICP B;  1G3N C;  2CZ6 B;  2ZPH B;  5IHY A;  3DJB A;  2I40 B;  4ZGD B;  2PHG A;  3A8O B;  3QYE A;  4BCN D;  4ZGE B;  2G77 A;  3MIA B;  4EOS B;  1V29 B;  3X20 B;  2UZE B;  4JX4 A;  2C5V B;  1JSU B;  4ROD A;  3M03 A;  4MFD A;  5EJC A;  1OGU B;  1H24 B;  3LQ5 B;  2ZCF B;  1H1S B;  2WEV B;  4OB2 B;  4II5 B;  3QZ5 B;  4MFE A;  1XO2 A;  1JST B;  2IN3 A;  4BCH B;  4HLQ A;  1GUX B;  4UN0 A;  4OB3 B;  4OGR B;  4BY1 X;  5DQW A;  1UGQ B;  3NDQ A;  1FIN B;  4HL4 A;  4EC9 B;  4HNV A;  3PO3 S;  3EOC B;  1BU2 A;  4YOO A;  4ELJ A;  2C5O B;  2WFY B;  2I53 A;  1GUX A;  4EOO B;  1H26 B;  2QDJ A;  5CYI B;  4QSH A;  1GH6 B;  2DXB B;  1PKD B;  4F70 B;  1OKW B;  2V22 B;  4BCG B;  2DXC B;  3BLQ B;  4OR5 B;  2IW9 B;  5L2W B; 
#chains in the Genus database with same CATH homology
 4F7N B;  3DOG B;  1AIS B;  4F6W B;  1OIU B;  4BCM B;  4BCM D;  3TNI B;  4Y72 B;  2WMA B;  2WIH B;  3MI9 B;  1H27 B;  2WPA B;  5EFQ B;  4BCJ B;  5HBH B;  4EOM B;  2WHB B;  5HQ0 B;  2IW8 B;  4CRL B;  4CFN B;  4EOI B;  5CEI B;  3K7A M;  4ROC A;  2C6T B;  2PK9 B;  2W96 A;  3TNH B;  5IDN B;  2IW6 B;  1OKV B;  1VIN A;  2IVX A;  4NST B;  5ICP B;  4YC3 B;  4ROE A;  1G3N C;  2C5X B;  4BCO B;  1JKW A;  4BCK B;  1OIY B;  3DDQ B;  2C5N B;  3RGF B;  4EOL B;  4CFX B;  2I40 B;  2JGZ B;  2PHG A;  4BCN D;  4EON B;  1E9H B;  3POM A;  2W99 A;  2PK2 A;  2B9R A;  3MIA B;  1GY3 B;  4EOS B;  4BCI B;  1H1Q B;  1H25 B;  1VOL A;  2UUE B;  3F5X B;  2UZE B;  4G6L B;  5HBJ B;  5HBE B;  2C5V B;  4F6S B;  1AD6 A;  1H28 B;  1JSU B;  4ROD A;  3M03 A;  1OGU B;  1P5E B;  1ZP2 A;  5LMK B;  4CFW B;  1H24 B;  4KRC B;  3LQ5 B;  1UNL D;  2BKZ B;  5IF1 B;  1O9K B;  4EC8 B;  3BHT B;  4CFV B;  3MY1 B;  4BCF B;  2G9X B;  1H1R B;  1H1S B;  2F2C A;  4EOK B;  2WEV B;  3EJ1 B;  3TN8 B;  3BLH B;  4II5 B;  2W9Z A;  4YOZ A;  4BCN B;  1QMZ B;  1XO2 A;  1F5Q B;  1JST B;  1JOW A;  4BCQ B;  4BCH B;  2PMI B;  4BCQ D;  4EOQ B;  1GUX B;  2CJM B;  4FX3 B;  2UZL B;  4UN0 A;  2WXV B;  4EOR B;  3O0G D;  4TTH A;  3QHR B;  4OGR B;  1OI9 B;  1TFB A;  2EUF A;  2C4G B;  4I3Z B;  1H4L D;  1FIN B;  2WMB B;  1FVV B;  3TNW B;  4EC9 B;  5HNB B;  5HVY B;  1W98 B;  2UZB B;  2X1N B;  1H1P B;  5I5Z B;  3EOC B;  1UNG D;  2CCI B;  5LQF B;  1VYW B;  1BU2 A;  1URC B;  1OL1 B;  4F7J B;  4YOO A;  2CCH B;  4ELJ A;  4ELL A;  4IMY B;  4BCP B;  1C9B A;  4F6U B;  5BNJ B;  4YOS A;  1N4M A;  2C5O B;  4EOJ B;  2WFY B;  2I53 A;  1GUX A;  4CFM B;  4EOO B;  1H26 B;  2QDJ A;  5CYI B;  3QHW B;  5ACB A;  1OL2 B;  2UZD B;  2R7G A;  3G33 B;  3MY5 B;  5IDP B;  3H4C A;  1GH6 B;  2WIP B;  2BPM B;  4CFU B;  1PKD B;  4CFU D;  2W2H A;  2W9F A;  4F70 B;  1OKW B;  2V22 B;  4BCG B;  3BHV B;  1O9K A;  3BHU B;  4KRD B;  4CXA B;  5FGK B;  1UNH D;  3EID B;  4EOP B;  4F7S B;  3BLQ B;  4OR5 B;  1D3U B;  1KXU A;  2IW9 B;  3DDP B;  4F7L B;  5L2W B;  3BLR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...