2WPAB

Optimisation of 6,6-dimethyl pyrrolo 3,4-c pyrazoles: identification of pha-793887, a potent cdk inhibitor suitable for intravenous dosing
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Optimization of 6,6-Dimethyl Pyrrolo[3,4-C]Pyrazoles: Identification of Pha-793887, a Potent Cdk Inhibitor Suitable for Intravenous Dosing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 89
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wpaB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wpaB02
2I53A 3BLHB 4EOPB 4F7NB 4BCKB 1H1PB 2UZBB 2QDJA 4EOKB 3EIDB 2C5VB 1N4MA 1VYWB 2WIPB 4EONB 5LMKB 1AISB 4F6SB 4YOOA 3BLQB 1JOWA 4KRCB 1GY3B 2UZDB 3MY1B 4EORB 4YC3B 2C5NB 1OL1B 2WHBB 3G33B 4BCOB 1BU2A 1UNLD 2IW9B 4IMYB 3F5XB 1H26B 4BCNB 2WFYB 4CXAB 4EC8B 2WXVB 4F6UB 1OIUB 1H4LD 3O0GD 4CFMB 4RODA 1G3NC 4EOQB 5IF1B 2W99A 4F70B 5IDPB 3MI9B 4BCJB 1GH6B 1VOLA 2WMBB 1JKWA 4F7LB 5L2WB 2W9ZA 5LQFB 5CYIB 3BHTB 3QHWB 2V22B 1H25B 1GUXA 3BHUB 1H1QB 4BCND 4CFXB 2X1NB 1JSTB 1H24B 3MY5B 1XO2A 4CFWB 1O9KA 3TN8B 5I5ZB 1H27B 4BCHB 2W96A 3BLRB 2WIHB 1ZP2A 2PK9B 1QMZB 3RGFB 2PK2A 2CCHB 1FINB 1VINA 2WPAB 2WEVB 1FVVB 1F5QB 2CCIB 2B9RA 2F2CA 2PMIB 2UUEB 4II5B 1W98B 3QHRB 4TTHA 4ROEA 4ELLA 1KXUA 4EOMB 4ROCA 4BCGB 5ACBA 3M03A 1OKWB 1P5EB 4UN0A 3EOCB 5HNBB 1OGUB 2C5OB 3MIAB 1UNHD 3EJ1B 1H1RB 1OKVB 4I3ZB 2W9FA 1H28B 1E9HB 4G6LB 3H4CA 2WMAB 4BCFB 2UZLB 5HBEB 5BNJB 4F7JB 1UNGD 2C4GB 5HBJB 4NSTB 3LQ5B 1JSUB 3DDQB 5FGKB 2W2HA 4EOLB 2CJMB 2IW6B 2PHGA 3DDPB 3DOGB 4Y72B 2IW8B 2G9XB 2BPMB 3BHVB 2I40B 4BCIB 5HVYB 2EUFA 3TNIB 1GUXB 1PKDB 4YOZA 4BCQD 3TNHB 4EOOB 1OIYB 4ELJA 4CFVB 5CEIB 4BCMB 4FX3B 1O9KB 5HBHB 4EOJB 4BCPB 4F6WB 2JGZB 4EOSB 4EC9B 4BCQB 4YOSA 1D3UB 2UZEB 4CFUD 5EFQB 4OGRB 1AD6A 2IVXA 2R7GA 2BKZB 4KRDB 5ICPB 4EOIB 5IDNB 2C6TB 1TFBA 3POMA 4OR5B 1C9BA 3TNWB 4CFNB 4F7SB 1H1SB 4CFUB 1OI9B 5HQ0B 4BCMD 1URCB 1OL2B 2C5XB 4CRLB 3K7AM
chains in the Genus database with same CATH superfamily
2I53A 3BLHB 4HNUA 1AHJB 1H1PB 3WVEB 2C5VB 2WIPB 2ZPBB 4F6SB 1JOWA 3X20B 3MY1B 3HHTB 4BCNB 1BU2A 4EC8B 4BY7X 4RODA 2QFZA 5IDPB 1GH6B 1VOLA 4F7LB 2W9ZA 3BHUB 1XO2A 4HL4A 1H27B 2W96A 3A8GB 3QZ5B 1QMZB 2PK2A 4MIMA 4ZGEB 2B9RA 4II5B 1W98B 3PO3S 3B57A 2ZZDB 1OKVB 4I3ZB 4LOCA 1UGRB 4G6LB 3QXEB 5HBEB 4F7JB 5DQWA 4HNVA 4HLQA 4NSTB 1JSUB 2IW6B 3VYHB 4NC6A 1GUXB 4ELJA 3TNHB 1OIYB 4BCPB 3TW6A 4AKHA 4YOSA 1FKMA 4CFUD 1AD6A 2IVXA 2BKZB 3HB9A 5ICPB 2D0QB 3GTMS 4EOIB 4BY1X 4OR5B 2AHJB 1OI9B 2PJQA 5HQ0B 2BS2A 1OL2B 3K7AM 1QLBA 4EONB 2BS4A 2ZPGB 4YOOA 3VYGB 1E7PA 1GY3B 2C5NB 1OL1B 2WHBB 2WXVB 3MI9B 4BCJB 2WJ9A 1UGQB 4CFXB 1H24B 4CFWB 4OB1B 4Z6YA 3A8HB 1IREB 2G77A 5EJCA 4BBSM 1ZP2A 2PK9B 2CCHB 2QDYB 2CZ7B 1VINA 2WPAB 2PMIB 3BG3A 4ROEA 4ROCA 4BCGB 3EOCB 1OGUB 2C5OB 3MIAB 3BG9A 4BCFB 3QYHB 2LW4A 4MFEA 4Y72B 4BXXX 4BCIB 2EUFA 4YOZA 5CEIB 4FX3B 1O9KB 5HBHB 4EOJB 2ZPEB 4BCQB 5EFQB 4OGRB 4AKGA 4KRDB 2ZPFB 3X28B 3POMA 1C9BA 4CFNB 4BCMD 1URCB 1E9HB 4CRLB 4EOPB 1V29B 4F7NB 4BCKB 3DJBA 2UZBB 4EOKB 3EIDB 1N4MA 1VYWB 5LMKB 1AISB 2DXBB 2QGSA 4JX6A 2KR6A 3BLQB 4EORB 4YC3B 3G33B 2IW9B 4CXAB 2WFYB 4BBRM 1H4LD 2DPPB 4CFMB 3QWLA 4EOQB 5IF1B 4F70B 3HZJA 5L2WB 5LQFB 5CYIB 2V22B 1GUXA 4AI6A 1H1QB 4BCND 2X1NB 3MY5B 2CZ6B 4M6VA 3TN8B 5I5ZB 2ZPHB 2WIHB 3RGFB 1ENWA 2WEVB 1FVVB 1F5QB 4MFDA 1TD6A 2CCIB 3DTOA 2F2CA 2UUEB 4TTHA 4AKIA 3M03A 1P5EB 4UN0A 5HNBB 2QF7A 1UNHD 3EJ1B 1H1RB 3VKGA 2W9FA 1H28B 3H4CA 5DQVA 3BG5A 2C4GB 2DXCB 3LQ5B 3QYEA 5FGKB 4EOLB 2CJMB 2PHGA 3DOGB 2BPMB 2I40B 3X24B 4BCQD 4EOOB 4F6WB 2JGZB 4EOSB 2R7GA 2DD5B 2C6TB 3TNWB 1H1SB 5HVYB 3X26B 3HBLA 3DL1A 4JX4A 2QDJA 2ZPIB 4KRCB 2UZDB 4BCOB 1UNLD 4IMYB 4F6UB 3F5XB 1H26B 4ZGJB 3NDQA 1OIUB 5IHYA 3O0GD 3A8LB 1G3NC 2W99A 4FM4B 3WVDB 2WMBB 1JKWA 3BHTB 2BS3A 3QHWB 1H25B 2DD4B 3A8MB 1JSTB 4OB2B 1O9KA 3QYBA 3BLRB 1UGPB 4JX5A 4OB0B 3QZ9B 2QQ8A 2ZCFB 1FINB 2CZ1B 4ELLA 3X25B 3QHRB 1KXUA 4EOMB 3VKHA 5ACBA 1OKWB 4OB3B 3HO8A 2IN3A 2CYZB 2WMAB 2UZLB 5BNJB 1UNGD 5HBJB 3DDQB 2W2HA 3DDPB 2IW8B 2G9XB 3BHVB 4ZGDB 3TNIB 1PKDB 3A8OB 3TW7A 2DMEA 4CFVB 4BCMB 4HNTA 4QSHA 4EC9B 1D3UB 1UGSB 2UZEB 3QYGB 3KHIA 2CZ0B 2KMGA 5IDNB 1TFBA 4F7SB 4CFUB 4BCHB 2C5XB
chains in the Genus database with same CATH topology
2I53A 3BLHB 4EOPB 4F7NB 4BCKB 1H1PB 2UZBB 2QDJA 4EOKB 3EIDB 2C5VB 1N4MA 1VYWB 2WIPB 4EONB 5LMKB 1AISB 4F6SB 4YOOA 3BLQB 1JOWA 4KRCB 1GY3B 2UZDB 3MY1B 4EORB 4YC3B 2C5NB 1OL1B 2WHBB 3G33B 4BCOB 1BU2A 1UNLD 2IW9B 4IMYB 3F5XB 1H26B 4BCNB 2WFYB 4CXAB 4EC8B 2WXVB 4F6UB 1OIUB 1H4LD 3O0GD 4CFMB 4RODA 1G3NC 4EOQB 5IF1B 2W99A 4F70B 5IDPB 3MI9B 4BCJB 1GH6B 1VOLA 2WMBB 1JKWA 4F7LB 5L2WB 2W9ZA 5LQFB 5CYIB 3BHTB 3QHWB 2V22B 1H25B 1GUXA 3BHUB 1H1QB 4BCND 4CFXB 2X1NB 1JSTB 1H24B 3MY5B 1XO2A 4CFWB 1O9KA 3TN8B 5I5ZB 1H27B 4BCHB 2W96A 3BLRB 2WIHB 1ZP2A 2PK9B 1QMZB 3RGFB 2PK2A 2CCHB 1FINB 1VINA 2WPAB 2WEVB 1FVVB 1F5QB 2CCIB 2B9RA 2F2CA 2PMIB 2UUEB 4II5B 1W98B 3QHRB 4TTHA 4ROEA 4ELLA 1KXUA 4EOMB 4ROCA 4BCGB 5ACBA 3M03A 1OKWB 1P5EB 4UN0A 3EOCB 5HNBB 1OGUB 2C5OB 3MIAB 1UNHD 3EJ1B 1H1RB 1OKVB 4I3ZB 2W9FA 1H28B 1E9HB 4G6LB 3H4CA 2WMAB 4BCFB 2UZLB 5HBEB 5BNJB 4F7JB 1UNGD 2C4GB 5HBJB 4NSTB 3LQ5B 1JSUB 3DDQB 5FGKB 2W2HA 4EOLB 2CJMB 2IW6B 2PHGA 3DDPB 3DOGB 4Y72B 2IW8B 2G9XB 2BPMB 3BHVB 2I40B 4BCIB 5HVYB 2EUFA 3TNIB 1GUXB 1PKDB 4YOZA 4BCQD 3TNHB 4EOOB 1OIYB 4ELJA 4CFVB 5CEIB 4BCMB 4FX3B 1O9KB 5HBHB 4EOJB 4BCPB 4F6WB 2JGZB 4EOSB 4EC9B 4BCQB 4YOSA 1D3UB 2UZEB 4CFUD 5EFQB 4OGRB 1AD6A 2IVXA 2R7GA 2BKZB 4KRDB 5ICPB 4EOIB 5IDNB 2C6TB 1TFBA 3POMA 4OR5B 1C9BA 3TNWB 4CFNB 4F7SB 1H1SB 4CFUB 1OI9B 5HQ0B 4BCMD 1URCB 1OL2B 2C5XB 4CRLB 3K7AM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I53 A;  3BLH B;  4EOP B;  4F7N B;  4BCK B;  1H1P B;  2UZB B;  2QDJ A;  4EOK B;  3EID B;  2C5V B;  1N4M A;  1VYW B;  2WIP B;  4EON B;  5LMK B;  1AIS B;  4F6S B;  4YOO A;  3BLQ B;  1JOW A;  4KRC B;  1GY3 B;  2UZD B;  3MY1 B;  4EOR B;  4YC3 B;  2C5N B;  1OL1 B;  2WHB B;  3G33 B;  4BCO B;  1BU2 A;  1UNL D;  2IW9 B;  4IMY B;  3F5X B;  1H26 B;  4BCN B;  2WFY B;  4CXA B;  4EC8 B;  2WXV B;  4F6U B;  1OIU B;  1H4L D;  3O0G D;  4CFM B;  4ROD A;  1G3N C;  4EOQ B;  5IF1 B;  2W99 A;  4F70 B;  5IDP B;  3MI9 B;  4BCJ B;  1GH6 B;  1VOL A;  2WMB B;  1JKW A;  4F7L B;  5L2W B;  2W9Z A;  5LQF B;  5CYI B;  3BHT B;  3QHW B;  2V22 B;  1H25 B;  1GUX A;  3BHU B;  1H1Q B;  4BCN D;  4CFX B;  2X1N B;  1JST B;  1H24 B;  3MY5 B;  1XO2 A;  4CFW B;  1O9K A;  3TN8 B;  5I5Z B;  1H27 B;  4BCH B;  2W96 A;  3BLR B;  2WIH B;  1ZP2 A;  2PK9 B;  1QMZ B;  3RGF B;  2PK2 A;  2CCH B;  1FIN B;  1VIN A;  2WPA B;  2WEV B;  1FVV B;  1F5Q B;  2CCI B;  2B9R A;  2F2C A;  2PMI B;  2UUE B;  4II5 B;  1W98 B;  3QHR B;  4TTH A;  4ROE A;  4ELL A;  1KXU A;  4EOM B;  4ROC A;  4BCG B;  5ACB A;  3M03 A;  1OKW B;  1P5E B;  4UN0 A;  3EOC B;  5HNB B;  1OGU B;  2C5O B;  3MIA B;  1UNH D;  3EJ1 B;  1H1R B;  1OKV B;  4I3Z B;  2W9F A;  1H28 B;  1E9H B;  4G6L B;  3H4C A;  2WMA B;  4BCF B;  2UZL B;  5HBE B;  5BNJ B;  4F7J B;  1UNG D;  2C4G B;  5HBJ B;  4NST B;  3LQ5 B;  1JSU B;  3DDQ B;  5FGK B;  2W2H A;  4EOL B;  2CJM B;  2IW6 B;  2PHG A;  3DDP B;  3DOG B;  4Y72 B;  2IW8 B;  2G9X B;  2BPM B;  3BHV B;  2I40 B;  4BCI B;  5HVY B;  2EUF A;  3TNI B;  1GUX B;  1PKD B;  4YOZ A;  4BCQ D;  3TNH B;  4EOO B;  1OIY B;  4ELJ A;  4CFV B;  5CEI B;  4BCM B;  4FX3 B;  1O9K B;  5HBH B;  4EOJ B;  4BCP B;  4F6W B;  2JGZ B;  4EOS B;  4EC9 B;  4BCQ B;  4YOS A;  1D3U B;  2UZE B;  4CFU D;  5EFQ B;  4OGR B;  1AD6 A;  2IVX A;  2R7G A;  2BKZ B;  4KRD B;  5ICP B;  4EOI B;  5IDN B;  2C6T B;  1TFB A;  3POM A;  4OR5 B;  1C9B A;  3TNW B;  4CFN B;  4F7S B;  1H1S B;  4CFU B;  1OI9 B;  5HQ0 B;  4BCM D;  1URC B;  1OL2 B;  2C5X B;  4CRL B;  3K7A M; 
#chains in the Genus database with same CATH topology
 2I53 A;  3BLH B;  4HNU A;  1AHJ B;  1H1P B;  3WVE B;  2C5V B;  2WIP B;  2ZPB B;  4F6S B;  1JOW A;  3X20 B;  3MY1 B;  3HHT B;  4BCN B;  1BU2 A;  4EC8 B;  4BY7 X;  4ROD A;  2QFZ A;  5IDP B;  1GH6 B;  1VOL A;  4F7L B;  2W9Z A;  3BHU B;  1XO2 A;  4HL4 A;  1H27 B;  2W96 A;  3A8G B;  3QZ5 B;  1QMZ B;  2PK2 A;  4MIM A;  4ZGE B;  2B9R A;  4II5 B;  1W98 B;  3PO3 S;  3B57 A;  2ZZD B;  1OKV B;  4I3Z B;  4LOC A;  1UGR B;  4G6L B;  3QXE B;  5HBE B;  4F7J B;  5DQW A;  4HNV A;  4HLQ A;  4NST B;  1JSU B;  2IW6 B;  3VYH B;  4NC6 A;  1GUX B;  4ELJ A;  3TNH B;  1OIY B;  4BCP B;  3TW6 A;  4AKH A;  4YOS A;  1FKM A;  4CFU D;  1AD6 A;  2IVX A;  2BKZ B;  3HB9 A;  5ICP B;  2D0Q B;  3GTM S;  4EOI B;  4BY1 X;  4OR5 B;  2AHJ B;  1OI9 B;  2PJQ A;  5HQ0 B;  2BS2 A;  1OL2 B;  3K7A M;  1QLB A;  4EON B;  2BS4 A;  2ZPG B;  4YOO A;  3VYG B;  1E7P A;  1GY3 B;  2C5N B;  1OL1 B;  2WHB B;  2WXV B;  3MI9 B;  4BCJ B;  2WJ9 A;  1UGQ B;  4CFX B;  1H24 B;  4CFW B;  4OB1 B;  4Z6Y A;  3A8H B;  1IRE B;  2G77 A;  5EJC A;  4BBS M;  1ZP2 A;  2PK9 B;  2CCH B;  2QDY B;  2CZ7 B;  1VIN A;  2WPA B;  2PMI B;  3BG3 A;  4ROE A;  4ROC A;  4BCG B;  3EOC B;  1OGU B;  2C5O B;  3MIA B;  3BG9 A;  4BCF B;  3QYH B;  2LW4 A;  4MFE A;  4Y72 B;  4BXX X;  4BCI B;  2EUF A;  4YOZ A;  5CEI B;  4FX3 B;  1O9K B;  5HBH B;  4EOJ B;  2ZPE B;  4BCQ B;  5EFQ B;  4OGR B;  4AKG A;  4KRD B;  2ZPF B;  3X28 B;  3POM A;  1C9B A;  4CFN B;  4BCM D;  1URC B;  1E9H B;  4CRL B;  4EOP B;  1V29 B;  4F7N B;  4BCK B;  3DJB A;  2UZB B;  4EOK B;  3EID B;  1N4M A;  1VYW B;  5LMK B;  1AIS B;  2DXB B;  2QGS A;  4JX6 A;  2KR6 A;  3BLQ B;  4EOR B;  4YC3 B;  3G33 B;  2IW9 B;  4CXA B;  2WFY B;  4BBR M;  1H4L D;  2DPP B;  4CFM B;  3QWL A;  4EOQ B;  5IF1 B;  4F70 B;  3HZJ A;  5L2W B;  5LQF B;  5CYI B;  2V22 B;  1GUX A;  4AI6 A;  1H1Q B;  4BCN D;  2X1N B;  3MY5 B;  2CZ6 B;  4M6V A;  3TN8 B;  5I5Z B;  2ZPH B;  2WIH B;  3RGF B;  1ENW A;  2WEV B;  1FVV B;  1F5Q B;  4MFD A;  1TD6 A;  2CCI B;  3DTO A;  2F2C A;  2UUE B;  4TTH A;  4AKI A;  3M03 A;  1P5E B;  4UN0 A;  5HNB B;  2QF7 A;  1UNH D;  3EJ1 B;  1H1R B;  3VKG A;  2W9F A;  1H28 B;  3H4C A;  5DQV A;  3BG5 A;  2C4G B;  2DXC B;  3LQ5 B;  3QYE A;  5FGK B;  4EOL B;  2CJM B;  2PHG A;  3DOG B;  2BPM B;  2I40 B;  3X24 B;  4BCQ D;  4EOO B;  4F6W B;  2JGZ B;  4EOS B;  2R7G A;  2DD5 B;  2C6T B;  3TNW B;  1H1S B;  5HVY B;  3X26 B;  3HBL A;  3DL1 A;  4JX4 A;  2QDJ A;  2ZPI B;  4KRC B;  2UZD B;  4BCO B;  1UNL D;  4IMY B;  4F6U B;  3F5X B;  1H26 B;  4ZGJ B;  3NDQ A;  1OIU B;  5IHY A;  3O0G D;  3A8L B;  1G3N C;  2W99 A;  4FM4 B;  3WVD B;  2WMB B;  1JKW A;  3BHT B;  2BS3 A;  3QHW B;  1H25 B;  2DD4 B;  3A8M B;  1JST B;  4OB2 B;  1O9K A;  3QYB A;  3BLR B;  1UGP B;  4JX5 A;  4OB0 B;  3QZ9 B;  2QQ8 A;  2ZCF B;  1FIN B;  2CZ1 B;  4ELL A;  3X25 B;  3QHR B;  1KXU A;  4EOM B;  3VKH A;  5ACB A;  1OKW B;  4OB3 B;  3HO8 A;  2IN3 A;  2CYZ B;  2WMA B;  2UZL B;  5BNJ B;  1UNG D;  5HBJ B;  3DDQ B;  2W2H A;  3DDP B;  2IW8 B;  2G9X B;  3BHV B;  4ZGD B;  3TNI B;  1PKD B;  3A8O B;  3TW7 A;  2DME A;  4CFV B;  4BCM B;  4HNT A;  4QSH A;  4EC9 B;  1D3U B;  1UGS B;  2UZE B;  3QYG B;  3KHI A;  2CZ0 B;  2KMG A;  5IDN B;  1TFB A;  4F7S B;  4CFU B;  4BCH B;  2C5X B; 
#chains in the Genus database with same CATH homology
 2I53 A;  3BLH B;  4EOP B;  4F7N B;  4BCK B;  1H1P B;  2UZB B;  2QDJ A;  4EOK B;  3EID B;  2C5V B;  1N4M A;  1VYW B;  2WIP B;  4EON B;  5LMK B;  1AIS B;  4F6S B;  4YOO A;  3BLQ B;  1JOW A;  4KRC B;  1GY3 B;  2UZD B;  3MY1 B;  4EOR B;  4YC3 B;  2C5N B;  1OL1 B;  2WHB B;  3G33 B;  4BCO B;  1BU2 A;  1UNL D;  2IW9 B;  4IMY B;  3F5X B;  1H26 B;  4BCN B;  2WFY B;  4CXA B;  4EC8 B;  2WXV B;  4F6U B;  1OIU B;  1H4L D;  3O0G D;  4CFM B;  4ROD A;  1G3N C;  4EOQ B;  5IF1 B;  2W99 A;  4F70 B;  5IDP B;  3MI9 B;  4BCJ B;  1GH6 B;  1VOL A;  2WMB B;  1JKW A;  4F7L B;  5L2W B;  2W9Z A;  5LQF B;  5CYI B;  3BHT B;  3QHW B;  2V22 B;  1H25 B;  1GUX A;  3BHU B;  1H1Q B;  4BCN D;  4CFX B;  2X1N B;  1JST B;  1H24 B;  3MY5 B;  1XO2 A;  4CFW B;  1O9K A;  3TN8 B;  5I5Z B;  1H27 B;  4BCH B;  2W96 A;  3BLR B;  2WIH B;  1ZP2 A;  2PK9 B;  1QMZ B;  3RGF B;  2PK2 A;  2CCH B;  1FIN B;  1VIN A;  2WPA B;  2WEV B;  1FVV B;  1F5Q B;  2CCI B;  2B9R A;  2F2C A;  2PMI B;  2UUE B;  4II5 B;  1W98 B;  3QHR B;  4TTH A;  4ROE A;  4ELL A;  1KXU A;  4EOM B;  4ROC A;  4BCG B;  5ACB A;  3M03 A;  1OKW B;  1P5E B;  4UN0 A;  3EOC B;  5HNB B;  1OGU B;  2C5O B;  3MIA B;  1UNH D;  3EJ1 B;  1H1R B;  1OKV B;  4I3Z B;  2W9F A;  1H28 B;  1E9H B;  4G6L B;  3H4C A;  2WMA B;  4BCF B;  2UZL B;  5HBE B;  5BNJ B;  4F7J B;  1UNG D;  2C4G B;  5HBJ B;  4NST B;  3LQ5 B;  1JSU B;  3DDQ B;  5FGK B;  2W2H A;  4EOL B;  2CJM B;  2IW6 B;  2PHG A;  3DDP B;  3DOG B;  4Y72 B;  2IW8 B;  2G9X B;  2BPM B;  3BHV B;  2I40 B;  4BCI B;  5HVY B;  2EUF A;  3TNI B;  1GUX B;  1PKD B;  4YOZ A;  4BCQ D;  3TNH B;  4EOO B;  1OIY B;  4ELJ A;  4CFV B;  5CEI B;  4BCM B;  4FX3 B;  1O9K B;  5HBH B;  4EOJ B;  4BCP B;  4F6W B;  2JGZ B;  4EOS B;  4EC9 B;  4BCQ B;  4YOS A;  1D3U B;  2UZE B;  4CFU D;  5EFQ B;  4OGR B;  1AD6 A;  2IVX A;  2R7G A;  2BKZ B;  4KRD B;  5ICP B;  4EOI B;  5IDN B;  2C6T B;  1TFB A;  3POM A;  4OR5 B;  1C9B A;  3TNW B;  4CFN B;  4F7S B;  1H1S B;  4CFU B;  1OI9 B;  5HQ0 B;  4BCM D;  1URC B;  1OL2 B;  2C5X B;  4CRL B;  3K7A M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...