2WPHE

Factor ixa superactive triple mutant
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
TCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of the Cofactor- and Substrate-Assisted Activation of Human Coagulation Factor Ixa
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords COAGULATION FACTOR IXA LIGHT CHAIN
total genus 13
structure length 59
sequence length 59
ec nomenclature ec 3.4.21.22: Coagulation factor IXa.
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2wphE00
1JL9A 1NPEB 2M74A 2WG4B 4O02B 2VVVL 1CVUA 5K0HB 1EGFA 4Y79B 5IKQA 5IKRA 3FFGL 2VVCK 1HCGB 3CFWA 2W86A 2Y81B 2XBXL 2J38B 1DDXA 1PFXL 4PH9A 5F19A 1NFWB 2UWPB 2XBWL 3N8ZA 1CQEA 1APOA 3FCSB 2BQ6A 2VWNL 1DX5I 1FAKL 1EPJA 1DQBA 1FFMA 1M1XB 2XC4L 1FSBA 3SOQA 4XL1A 5L2ZL 3N8YA 2VWLL 5CKNA 2Y82B 1EPGA 4E1GA 4NG9L 1WHFA 2H9EL 3Q3KB 2BQ7A 3CA7A 3MQEA 1B9WA 2XC5L 3OLUA 1HZ8A 2CJIB 3TH3L 5JBAE 3IJEB 1IJQA 1UZKA 2K2TA 3TZIA 1IQHL 2KV4A 4RUTA 1ADXA 2OYUP 2BOUA 2PHBB 1G1QA 2BOKL 3GISX 3KL6B 3ZYIB 1EMOA 3LAQA 3Q7DA 4YT7L 1IQML 3KRKA 3RR3A 1K37A 2P16L 4Y7AB 1HRFA 2P26A 1EZQB 1HAFA 1UZPA 3V65B 4RRZA 1ZAQA 3SW2A 1F0RB 1G2MB 1IQKL 1QFKL 4XLWA 1LQDA 1PRHA 5L2YL 1L3YA 3DEMA 4CUFA 1CEJA 3BT1A 2BMGA 4Y71B 3TGFA 2KL7A 1IQEL 2P93L 3M37L 1G1RA 4BDWA 5CISA 2BO2A 1NFXB 2W2NE 1O5DL 3ELAL 1HAEA 1JV2B 2W3IB 2J4IB 3QCWA 1W8BL 3H5CB 1AUTL 3HPTA 2VWMK 2VH0B 5L30L 1CVWL 2OYEP 4Y76B 1PXXA 3N8WA 2YGPA 4RS0A 1KSNB 1MOXC 2P3UA 1COUA 4OTJA 3KK6A 5JBBE 2PUQL 5FDQA 2MGPA 1TOZA 2NPRA 1IVOC 2W2ME 3P5BL 4AQTA 4NA9L 1HJ7A 4ZHAB 4CUEA 4D0EA 1PTHA 3TK5B 1NFUB 1LPZA 1EQHA 1G2LB 4BTTA 1V3XB 4C16A 5JW1A 1W7XL 2WPHE 4CUDA 1BF9A 3HS5A 2Y7ZB 1EMNA 1YUFA 2RA0L 2YGOA 1N7DA 2XBVL 1OB1C 4X8TL 1IGXA 3R05A 1F7MA 4RRXA 1HX2A 4G1MB 2FZZL 2MHPA 2Y5GL 1I0UA 3NT1A 4OTYA 1EPIA 1ATBA 3KQEL 3ENSA 1YO8A 1L5GB 2ADXA 3HO4A 4A7IA 1Z6EL 3KQCL 5E8DA 2J95B 1IQIL 2GD4A 2W2QE 2XBYL 1ATAA 2Y5FL 3N8YB 2MGRA 2PR3B 5JB8E 1KLOA 2WPKE 4LORA 4CSYA 1P0SL 2Y7XB 3F6UL 2VJ3A 1HT5A 2TGFA 2P3FN 5F1AA 3M36L 1LPKA 4BTIA 1P9JA 3CS7L 1WU1B 2DDUA 3NJPC 1IQLL 3U73A 3LTGD 3MDLA 4LMFA 4YZUB 1EAIC 1APQA 3LIWB 1EPHA 1F0SB 1TLEA 2D1JB 3V64C 2J2UB 1RFNB 2JKHL 4MMZB 4Z0KB 2FLRL 4Z0LA 1CCVA 2W2PE 1X7AL 2EI7B 4Z6AL 3EGFA 2I9BA 2EI8B 3LC3B 4X8UL 2BOXA 3HO3A 1U8CB 3N8WB 1U67A 4JYUL 3TK6B 2J34B 1F7EA 1SZBA 1EQGA 1DIYA 5COXA 4MMYB 4Y6DB 5IKTA 1MQ6L 1Z6CA 1IGZA 4ISHL 2AYLA 2VWOL 2P28B 2KB9A 2W26B 3SOBB 1NT0A 2WG3C 2WPIE 1Q4GA 2Y5HL 1J9CL 2J94B 4X8VL 5CKMA 4BXSA 4JYVL 1IQJL 3K9XA 2Q1JB 1FJSL 1NZIA 4JZFL 3IITB 2RNLA 4RRWA 4XBMA 2VVUL 1KLIL 5JVYA 1LPGA 1HREA 1XFEA 2W3KB 3ASIA 3CENL 3ZYJB 1YGCL 3GCWE 1A3PA 2UWOB 2BOHA 3HS6A 5JB9E 3QMOA 1TPGA 2UWLB 4D0FA 4RRYA 1IP0A 3QH0A 3LTFB 4BTUA 3KQDL 3LN0A 2FLBL 4ZH8B 4JZEL 3C9AC 3U7UG 1WHEA 1IQNL 3FBYA 1IOXA 1YUKB 4COXA 1UZJA 1ATEA 3GCXE 4TGFA 4MMXB 2RHPA 3TBDA 1KIGL 1FE2A 1CCFA 5IKVA 3KQBL 4BDXA 3BT2A 1XKAL 2B7DL 4NGAL 3POYA 1JBUL 4JZDL 4M11A 2WPLE 2P3TA 2I9AA 3SOVA 2BQWA 1NQLB 2EI6B 2Y38A 2WPME 2W2OE 2FLGA 1C5MF 1IQFL 3HO5A 2FD6A 1KLJL 1N1IA 2BZ6L 2K2SB 1URKA 1CX2A 3NTBA 2G00L 2VH6B 3ZYGA 4X8SL 1LMJA 2P3FL 3OLTA 2WPJE 2P94L 1G1SA 3N8XA 1YUGA 4BXWA 2F9BL 1GK5A 3LC5B 1HT8A 2Y80B 2WFXB 1FF7A 3KCGL 1EBVA 2WYGB 3HS7A 4Y7BB 4YT6L 2P95L 5JBCE 1K36A 1ATDA 1DVAL 3NTGA 4ZAEB 4ZXYL 5JVZA 5KN5C 4FM5A 4ISIL 3PGHA 1IQGL 4M10A 1G1TA 1XKBA 2XC0L 3F1SB 1PGEA 4O1ZA 1MQ5L 1XDTR 1UZQA 4ZXXL 6COXA 3LN1A 5CKQA 3BPSE 1IOEL 5EGMB 1NFYB 5I46L 1FAXL 5KIRA 3N8VA 2WYJB 2WFTA 4D90A
chains in the Genus database with same CATH superfamily
1JL9A 1NPEB 2M74A 2WG4B 4O02B 2VVVL 1CVUA 5K0HB 1EGFA 4Y79B 5IKQA 5IKRA 3FFGL 1V1IA 2VVCK 1HCGB 3CFWA 2W86A 2Y81B 2XBXL 2J38B 1DDXA 1PFXL 4PH9A 5F19A 1NFWB 2UWPB 2XBWL 3N8ZA 1CQEA 1APOA 3FCSB 2BQ6A 2VWNL 1DX5I 1FAKL 1EPJA 1DQBA 1FFMA 1M1XB 2XC4L 1FSBA 3SOQA 4XL1A 5L2ZL 3N8YA 2VWLL 5CKNA 2Y82B 1EPGA 4E1GA 4NG9L 1V1HA 1WHFA 2H9EL 3Q3KB 2BQ7A 3CA7A 3MQEA 1B9WA 2XC5L 3OLUA 1HZ8A 2CJIB 3TH3L 5JBAE 3IJEB 1IJQA 1UZKA 4GU4A 2K2TA 3TZIA 1IQHL 2KV4A 4RUTA 1ADXA 2OYUP 2BOUA 2PHBB 1G1QA 2BOKL 2HOXA 3GISX 3KL6B 3ZYIB 1EMOA 3LAQA 3Q7DA 4YT7L 1IQML 3KRKA 1LMMA 3RR3A 1K37A 2P16L 4Y7AB 1HRFA 2P26A 2BT8A 1EZQB 1HAFA 1UZPA 3V65B 4RRZA 1ZAQA 3SW2A 1F0RB 1G2MB 1IQKL 1QFKL 4XLWA 1LQDA 1PRHA 5L2YL 1L3YA 3DEMA 4CUFA 1CEJA 4A94C 3BT1A 2BMGA 4Y71B 3TGFA 2KL7A 1IQEL 2P93L 3M37L 1G1RA 4BDWA 5CISA 2BO2A 1NFXB 2W2NE 1O5DL 3ELAL 1HAEA 1JV2B 2W3IB 2J4IB 3QCWA 1W8BL 3H5CB 1AUTL 3HPTA 2VWMK 2VH0B 5L30L 2HORA 1CVWL 2OYEP 4Y76B 1PXXA 3N8WA 2YGPA 4RS0A 1KSNB 1MOXC 2P3UA 1COUA 4OTJA 3KK6A 5JBBE 2PUQL 5FDQA 2MGPA 1TOZA 2NPRA 1IVOC 2W2ME 3P5BL 4AQTA 4NA9L 1HJ7A 4ZHAB 4CUEA 4D0EA 1PTHA 3TK5B 1NFUB 1LPZA 1QIUA 1EQHA 1G2LB 4BTTA 1V3XB 4C16A 5JW1A 1W7XL 2WPHE 4CUDA 1BF9A 3HS5A 2Y7ZB 1EMNA 1YUFA 2RA0L 2YGOA 1N7DA 2XBVL 1OB1C 4X8TL 1IGXA 3R05A 1F7MA 4RRXA 1HX2A 1LK9A 4G1MB 2FZZL 2MHPA 2Y5GL 1I0UA 3NT1A 4OTYA 1EPIA 2JJLA 1ATBA 3KQEL 3ENSA 1YO8A 1L5GB 2ADXA 3HO4A 4A7IA 1Z6EL 3KQCL 5E8DA 2J95B 1IQIL 2GD4A 2W2QE 2XBYL 1ATAA 2Y5FL 3N8YB 2MGRA 2PR3B 5JB8E 1KLOA 2WPKE 4LORA 4CSYA 1P0SL 2Y7XB 3F6UL 2VJ3A 1HT5A 2TGFA 2P3FN 5F1AA 3M36L 1LPKA 4BTIA 1P9JA 2WZPP 3CS7L 1WU1B 2DDUA 3NJPC 1IQLL 3U73A 3LTGD 3MDLA 4LMFA 4YZUB 1EAIC 1APQA 3LIWB 1EPHA 1F0SB 1TLEA 2D1JB 3V64C 2J2UB 1RFNB 2JKHL 4MMZB 4Z0KB 2FLRL 4Z0LA 1CCVA 2W2PE 1X7AL 2EI7B 4Z6AL 3EGFA 2I9BA 2EI8B 3LC3B 4X8UL 2BOXA 3HO3A 1U8CB 3N8WB 1U67A 4JYUL 3TK6B 2J34B 1F7EA 1SZBA 1EQGA 1DIYA 5COXA 4MMYB 4Y6DB 5IKTA 1MQ6L 1Z6CA 1IGZA 4ISHL 2AYLA 2VWOL 2P28B 2KB9A 2W26B 3SOBB 1NT0A 2WG3C 2WPIE 1Q4GA 2Y5HL 1J9CL 2J94B 4X8VL 5CKMA 4BXSA 4JYVL 1IQJL 3K9XA 2Q1JB 1FJSL 1NZIA 4JZFL 3IITB 2BSFA 2RNLA 4RRWA 4XBMA 2KNIA 2VVUL 1KLIL 5JVYA 1LPGA 1HREA 1XFEA 2W3KB 3ASIA 3CENL 3ZYJB 1YGCL 2BT7A 3GCWE 1A3PA 2UWOB 2BOHA 3HS6A 5JB9E 3QMOA 1TPGA 2VRSA 2UWLB 4D0FA 4RRYA 1IP0A 3QH0A 3LTFB 4BTUA 3KQDL 3LN0A 2FLBL 4ZH8B 4JZEL 3C9AC 3U7UG 1WHEA 1IQNL 3FBYA 1IOXA 1YUKB 4COXA 1UZJA 1ATEA 3GCXE 4TGFA 4MMXB 2RHPA 3TBDA 1KIGL 1FE2A 1CCFA 5IKVA 3KQBL 4BDXA 3BT2A 1XKAL 2B7DL 4NGAL 3POYA 1JBUL 4JZDL 4M11A 2WPLE 2P3TA 2I9AA 3SOVA 2BQWA 1NQLB 2EI6B 2Y38A 2WPME 2W2OE 2FLGA 3S6XA 4GU3A 1C5MF 1IQFL 3HO5A 2FD6A 1KLJL 1N1IA 2BZ6L 2K2SB 1URKA 1CX2A 3NTBA 2G00L 2VH6B 3ZYGA 4X8SL 1LMJA 2P3FL 3OLTA 2WPJE 2P94L 1G1SA 3N8XA 1YUGA 4BXWA 2F9BL 1GK5A 3LC5B 1HT8A 2Y80B 2WFXB 1FF7A 3KCGL 1EBVA 2WYGB 3HS7A 4Y7BB 4YT6L 2P95L 5JBCE 1K36A 1ATDA 1DVAL 2H9EC 3NTGA 4ZAEB 4ZXYL 5JVZA 5KN5C 4FM5A 2YGQA 4ISIL 3PGHA 1IQGL 4M10A 1G1TA 1XKBA 2XC0L 3F1SB 1PGEA 4O1ZA 1MQ5L 1XDTR 1UZQA 4ZXXL 1KKEA 6COXA 3LN1A 5CKQA 3BPSE 1IOEL 5EGMB 1NFYB 5I46L 1FAXL 5KIRA 3N8VA 2WYJB 2WFTA 4D90A
chains in the Genus database with same CATH topology
1JL9A 1NPEB 2M74A 2WG4B 4O02B 2VVVL 1CVUA 5K0HB 1EGFA 4Y79B 5IKQA 5IKRA 3FFGL 2VVCK 1HCGB 3CFWA 2W86A 2Y81B 2XBXL 2J38B 1DDXA 1PFXL 4PH9A 5F19A 1NFWB 2UWPB 2XBWL 3N8ZA 1CQEA 1APOA 3FCSB 2BQ6A 2VWNL 1DX5I 1FAKL 1EPJA 1DQBA 1FFMA 1M1XB 2XC4L 1FSBA 3SOQA 4XL1A 5L2ZL 3N8YA 2VWLL 5CKNA 2Y82B 1EPGA 4E1GA 4NG9L 1WHFA 2H9EL 3Q3KB 2BQ7A 3CA7A 3MQEA 1B9WA 2XC5L 3OLUA 1HZ8A 2CJIB 3TH3L 5JBAE 3IJEB 1IJQA 1UZKA 2K2TA 3TZIA 1IQHL 2KV4A 4RUTA 1ADXA 2OYUP 2BOUA 2PHBB 1G1QA 2BOKL 3GISX 3KL6B 3ZYIB 1EMOA 3LAQA 3Q7DA 4YT7L 1IQML 3KRKA 1LMMA 3RR3A 1K37A 2P16L 4Y7AB 1HRFA 2P26A 1EZQB 1HAFA 1UZPA 3V65B 4RRZA 1ZAQA 3SW2A 1F0RB 1G2MB 1IQKL 1QFKL 4XLWA 1LQDA 1PRHA 5L2YL 1L3YA 3DEMA 4CUFA 1CEJA 4A94C 3BT1A 2BMGA 4Y71B 3TGFA 2KL7A 1IQEL 2P93L 3M37L 1G1RA 4BDWA 5CISA 2BO2A 1NFXB 2W2NE 1O5DL 3ELAL 1HAEA 1JV2B 2W3IB 2J4IB 3QCWA 1W8BL 3H5CB 1AUTL 3HPTA 2VWMK 2VH0B 5L30L 1CVWL 2OYEP 4Y76B 1PXXA 3N8WA 2YGPA 4RS0A 1KSNB 1MOXC 2P3UA 1COUA 4OTJA 3KK6A 5JBBE 2PUQL 5FDQA 2MGPA 1TOZA 2NPRA 1IVOC 2W2ME 3P5BL 4AQTA 4NA9L 1HJ7A 4ZHAB 4CUEA 4D0EA 1PTHA 3TK5B 1NFUB 1LPZA 1EQHA 1G2LB 4BTTA 1V3XB 4C16A 5JW1A 1W7XL 2WPHE 4CUDA 1BF9A 3HS5A 2Y7ZB 1EMNA 1YUFA 2RA0L 2YGOA 1N7DA 2XBVL 1OB1C 4X8TL 1IGXA 3R05A 1F7MA 4RRXA 1HX2A 4G1MB 2FZZL 2MHPA 2Y5GL 1I0UA 3NT1A 4OTYA 1EPIA 1ATBA 3KQEL 3ENSA 1YO8A 1L5GB 2ADXA 3HO4A 4A7IA 1Z6EL 3KQCL 5E8DA 2J95B 1IQIL 2GD4A 2W2QE 2XBYL 1ATAA 2Y5FL 3N8YB 2MGRA 2PR3B 5JB8E 1KLOA 2WPKE 4LORA 4CSYA 1P0SL 2Y7XB 3F6UL 2VJ3A 1HT5A 2TGFA 2P3FN 5F1AA 3M36L 1LPKA 4BTIA 1P9JA 2WZPP 3CS7L 1WU1B 2DDUA 3NJPC 1IQLL 3U73A 3LTGD 3MDLA 4LMFA 4YZUB 1EAIC 1APQA 3LIWB 1EPHA 1F0SB 1TLEA 2D1JB 3V64C 2J2UB 1RFNB 2JKHL 4MMZB 4Z0KB 2FLRL 4Z0LA 1CCVA 2W2PE 1X7AL 2EI7B 4Z6AL 3EGFA 2I9BA 2EI8B 3LC3B 4X8UL 2BOXA 3HO3A 1U8CB 3N8WB 1U67A 4JYUL 3TK6B 2J34B 1F7EA 1SZBA 1EQGA 1DIYA 5COXA 4MMYB 4Y6DB 5IKTA 1MQ6L 1Z6CA 1IGZA 4ISHL 2AYLA 2VWOL 2P28B 2KB9A 2W26B 3SOBB 1NT0A 2WG3C 2WPIE 1Q4GA 2Y5HL 1J9CL 2J94B 4X8VL 5CKMA 4BXSA 4JYVL 1IQJL 3K9XA 2Q1JB 1FJSL 1NZIA 4JZFL 3IITB 2RNLA 4RRWA 4XBMA 2KNIA 2VVUL 1KLIL 5JVYA 1LPGA 1HREA 1XFEA 2W3KB 3ASIA 3CENL 3ZYJB 1YGCL 3GCWE 1A3PA 2UWOB 2BOHA 3HS6A 5JB9E 3QMOA 1TPGA 2UWLB 4D0FA 4RRYA 1IP0A 3QH0A 3LTFB 4BTUA 3KQDL 3LN0A 2FLBL 4ZH8B 4JZEL 3C9AC 3U7UG 1WHEA 1IQNL 3FBYA 1IOXA 1YUKB 4COXA 1UZJA 1ATEA 3GCXE 4TGFA 4MMXB 2RHPA 3TBDA 1KIGL 1FE2A 1CCFA 5IKVA 3KQBL 4BDXA 3BT2A 1XKAL 2B7DL 4NGAL 3POYA 1JBUL 4JZDL 4M11A 2WPLE 2P3TA 2I9AA 3SOVA 2BQWA 1NQLB 2EI6B 2Y38A 2WPME 2W2OE 2FLGA 3S6XA 1C5MF 1IQFL 3HO5A 2FD6A 1KLJL 1N1IA 2BZ6L 2K2SB 1URKA 1CX2A 3NTBA 2G00L 2VH6B 3ZYGA 4X8SL 1LMJA 2P3FL 3OLTA 2WPJE 2P94L 1G1SA 3N8XA 1YUGA 4BXWA 2F9BL 1GK5A 3LC5B 1HT8A 2Y80B 2WFXB 1FF7A 3KCGL 1EBVA 2WYGB 3HS7A 4Y7BB 4YT6L 2P95L 5JBCE 1K36A 1ATDA 1DVAL 2H9EC 3NTGA 4ZAEB 4ZXYL 5JVZA 5KN5C 4FM5A 2YGQA 4ISIL 3PGHA 1IQGL 4M10A 1G1TA 1XKBA 2XC0L 3F1SB 1PGEA 4O1ZA 1MQ5L 1XDTR 1UZQA 4ZXXL 6COXA 3LN1A 5CKQA 3BPSE 1IOEL 5EGMB 1NFYB 5I46L 1FAXL 5KIRA 3N8VA 2WYJB 2WFTA 4D90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JL9 A;  1NPE B;  2M74 A;  2WG4 B;  4O02 B;  2VVV L;  1CVU A;  5K0H B;  1EGF A;  4Y79 B;  5IKQ A;  5IKR A;  3FFG L;  2VVC K;  1HCG B;  3CFW A;  2W86 A;  2Y81 B;  2XBX L;  2J38 B;  1DDX A;  1PFX L;  4PH9 A;  5F19 A;  1NFW B;  2UWP B;  2XBW L;  3N8Z A;  1CQE A;  1APO A;  3FCS B;  2BQ6 A;  2VWN L;  1DX5 I;  1FAK L;  1EPJ A;  1DQB A;  1FFM A;  1M1X B;  2XC4 L;  1FSB A;  3SOQ A;  4XL1 A;  5L2Z L;  3N8Y A;  2VWL L;  5CKN A;  2Y82 B;  1EPG A;  4E1G A;  4NG9 L;  1WHF A;  2H9E L;  3Q3K B;  2BQ7 A;  3CA7 A;  3MQE A;  1B9W A;  2XC5 L;  3OLU A;  1HZ8 A;  2CJI B;  3TH3 L;  5JBA E;  3IJE B;  1IJQ A;  1UZK A;  2K2T A;  3TZI A;  1IQH L;  2KV4 A;  4RUT A;  1ADX A;  2OYU P;  2BOU A;  2PHB B;  1G1Q A;  2BOK L;  3GIS X;  3KL6 B;  3ZYI B;  1EMO A;  3LAQ A;  3Q7D A;  4YT7 L;  1IQM L;  3KRK A;  3RR3 A;  1K37 A;  2P16 L;  4Y7A B;  1HRF A;  2P26 A;  1EZQ B;  1HAF A;  1UZP A;  3V65 B;  4RRZ A;  1ZAQ A;  3SW2 A;  1F0R B;  1G2M B;  1IQK L;  1QFK L;  4XLW A;  1LQD A;  1PRH A;  5L2Y L;  1L3Y A;  3DEM A;  4CUF A;  1CEJ A;  3BT1 A;  2BMG A;  4Y71 B;  3TGF A;  2KL7 A;  1IQE L;  2P93 L;  3M37 L;  1G1R A;  4BDW A;  5CIS A;  2BO2 A;  1NFX B;  2W2N E;  1O5D L;  3ELA L;  1HAE A;  1JV2 B;  2W3I B;  2J4I B;  3QCW A;  1W8B L;  3H5C B;  1AUT L;  3HPT A;  2VWM K;  2VH0 B;  5L30 L;  1CVW L;  2OYE P;  4Y76 B;  1PXX A;  3N8W A;  2YGP A;  4RS0 A;  1KSN B;  1MOX C;  2P3U A;  1COU A;  4OTJ A;  3KK6 A;  5JBB E;  2PUQ L;  5FDQ A;  2MGP A;  1TOZ A;  2NPR A;  1IVO C;  2W2M E;  3P5B L;  4AQT A;  4NA9 L;  1HJ7 A;  4ZHA B;  4CUE A;  4D0E A;  1PTH A;  3TK5 B;  1NFU B;  1LPZ A;  1EQH A;  1G2L B;  4BTT A;  1V3X B;  4C16 A;  5JW1 A;  1W7X L;  2WPH E;  4CUD A;  1BF9 A;  3HS5 A;  2Y7Z B;  1EMN A;  1YUF A;  2RA0 L;  2YGO A;  1N7D A;  2XBV L;  1OB1 C;  4X8T L;  1IGX A;  3R05 A;  1F7M A;  4RRX A;  1HX2 A;  4G1M B;  2FZZ L;  2MHP A;  2Y5G L;  1I0U A;  3NT1 A;  4OTY A;  1EPI A;  1ATB A;  3KQE L;  3ENS A;  1YO8 A;  1L5G B;  2ADX A;  3HO4 A;  4A7I A;  1Z6E L;  3KQC L;  5E8D A;  2J95 B;  1IQI L;  2GD4 A;  2W2Q E;  2XBY L;  1ATA A;  2Y5F L;  3N8Y B;  2MGR A;  2PR3 B;  5JB8 E;  1KLO A;  2WPK E;  4LOR A;  4CSY A;  1P0S L;  2Y7X B;  3F6U L;  2VJ3 A;  1HT5 A;  2TGF A;  2P3F N;  5F1A A;  3M36 L;  1LPK A;  4BTI A;  1P9J A;  3CS7 L;  1WU1 B;  2DDU A;  3NJP C;  1IQL L;  3U73 A;  3LTG D;  3MDL A;  4LMF A;  4YZU B;  1EAI C;  1APQ A;  3LIW B;  1EPH A;  1F0S B;  1TLE A;  2D1J B;  3V64 C;  2J2U B;  1RFN B;  2JKH L;  4MMZ B;  4Z0K B;  2FLR L;  4Z0L A;  1CCV A;  2W2P E;  1X7A L;  2EI7 B;  4Z6A L;  3EGF A;  2I9B A;  2EI8 B;  3LC3 B;  4X8U L;  2BOX A;  3HO3 A;  1U8C B;  3N8W B;  1U67 A;  4JYU L;  3TK6 B;  2J34 B;  1F7E A;  1SZB A;  1EQG A;  1DIY A;  5COX A;  4MMY B;  4Y6D B;  5IKT A;  1MQ6 L;  1Z6C A;  1IGZ A;  4ISH L;  2AYL A;  2VWO L;  2P28 B;  2KB9 A;  2W26 B;  3SOB B;  1NT0 A;  2WG3 C;  2WPI E;  1Q4G A;  2Y5H L;  1J9C L;  2J94 B;  4X8V L;  5CKM A;  4BXS A;  4JYV L;  1IQJ L;  3K9X A;  2Q1J B;  1FJS L;  1NZI A;  4JZF L;  3IIT B;  2RNL A;  4RRW A;  4XBM A;  2VVU L;  1KLI L;  5JVY A;  1LPG A;  1HRE A;  1XFE A;  2W3K B;  3ASI A;  3CEN L;  3ZYJ B;  1YGC L;  3GCW E;  1A3P A;  2UWO B;  2BOH A;  3HS6 A;  5JB9 E;  3QMO A;  1TPG A;  2UWL B;  4D0F A;  4RRY A;  1IP0 A;  3QH0 A;  3LTF B;  4BTU A;  3KQD L;  3LN0 A;  2FLB L;  4ZH8 B;  4JZE L;  3C9A C;  3U7U G;  1WHE A;  1IQN L;  3FBY A;  1IOX A;  1YUK B;  4COX A;  1UZJ A;  1ATE A;  3GCX E;  4TGF A;  4MMX B;  2RHP A;  3TBD A;  1KIG L;  1FE2 A;  1CCF A;  5IKV A;  3KQB L;  4BDX A;  3BT2 A;  1XKA L;  2B7D L;  4NGA L;  3POY A;  1JBU L;  4JZD L;  4M11 A;  2WPL E;  2P3T A;  2I9A A;  3SOV A;  2BQW A;  1NQL B;  2EI6 B;  2Y38 A;  2WPM E;  2W2O E;  2FLG A;  1C5M F;  1IQF L;  3HO5 A;  2FD6 A;  1KLJ L;  1N1I A;  2BZ6 L;  2K2S B;  1URK A;  1CX2 A;  3NTB A;  2G00 L;  2VH6 B;  3ZYG A;  4X8S L;  1LMJ A;  2P3F L;  3OLT A;  2WPJ E;  2P94 L;  1G1S A;  3N8X A;  1YUG A;  4BXW A;  2F9B L;  1GK5 A;  3LC5 B;  1HT8 A;  2Y80 B;  2WFX B;  1FF7 A;  3KCG L;  1EBV A;  2WYG B;  3HS7 A;  4Y7B B;  4YT6 L;  2P95 L;  5JBC E;  1K36 A;  1ATD A;  1DVA L;  3NTG A;  4ZAE B;  4ZXY L;  5JVZ A;  5KN5 C;  4FM5 A;  4ISI L;  3PGH A;  1IQG L;  4M10 A;  1G1T A;  1XKB A;  2XC0 L;  3F1S B;  1PGE A;  4O1Z A;  1MQ5 L;  1XDT R;  1UZQ A;  4ZXX L;  6COX A;  3LN1 A;  5CKQ A;  3BPS E;  1IOE L;  5EGM B;  1NFY B;  5I46 L;  1FAX L;  5KIR A;  3N8V A;  2WYJ B;  2WFT A;  4D90 A; 
#chains in the Genus database with same CATH topology
 1JL9 A;  1NPE B;  2M74 A;  2WG4 B;  4O02 B;  2VVV L;  1CVU A;  5K0H B;  1EGF A;  4Y79 B;  5IKQ A;  5IKR A;  3FFG L;  1V1I A;  2VVC K;  1HCG B;  3CFW A;  2W86 A;  2Y81 B;  2XBX L;  2J38 B;  1DDX A;  1PFX L;  4PH9 A;  5F19 A;  1NFW B;  2UWP B;  2XBW L;  3N8Z A;  1CQE A;  1APO A;  3FCS B;  2BQ6 A;  2VWN L;  1DX5 I;  1FAK L;  1EPJ A;  1DQB A;  1FFM A;  1M1X B;  2XC4 L;  1FSB A;  3SOQ A;  4XL1 A;  5L2Z L;  3N8Y A;  2VWL L;  5CKN A;  2Y82 B;  1EPG A;  4E1G A;  4NG9 L;  1V1H A;  1WHF A;  2H9E L;  3Q3K B;  2BQ7 A;  3CA7 A;  3MQE A;  1B9W A;  2XC5 L;  3OLU A;  1HZ8 A;  2CJI B;  3TH3 L;  5JBA E;  3IJE B;  1IJQ A;  1UZK A;  4GU4 A;  2K2T A;  3TZI A;  1IQH L;  2KV4 A;  4RUT A;  1ADX A;  2OYU P;  2BOU A;  2PHB B;  1G1Q A;  2BOK L;  2HOX A;  3GIS X;  3KL6 B;  3ZYI B;  1EMO A;  3LAQ A;  3Q7D A;  4YT7 L;  1IQM L;  3KRK A;  1LMM A;  3RR3 A;  1K37 A;  2P16 L;  4Y7A B;  1HRF A;  2P26 A;  2BT8 A;  1EZQ B;  1HAF A;  1UZP A;  3V65 B;  4RRZ A;  1ZAQ A;  3SW2 A;  1F0R B;  1G2M B;  1IQK L;  1QFK L;  4XLW A;  1LQD A;  1PRH A;  5L2Y L;  1L3Y A;  3DEM A;  4CUF A;  1CEJ A;  4A94 C;  3BT1 A;  2BMG A;  4Y71 B;  3TGF A;  2KL7 A;  1IQE L;  2P93 L;  3M37 L;  1G1R A;  4BDW A;  5CIS A;  2BO2 A;  1NFX B;  2W2N E;  1O5D L;  3ELA L;  1HAE A;  1JV2 B;  2W3I B;  2J4I B;  3QCW A;  1W8B L;  3H5C B;  1AUT L;  3HPT A;  2VWM K;  2VH0 B;  5L30 L;  2HOR A;  1CVW L;  2OYE P;  4Y76 B;  1PXX A;  3N8W A;  2YGP A;  4RS0 A;  1KSN B;  1MOX C;  2P3U A;  1COU A;  4OTJ A;  3KK6 A;  5JBB E;  2PUQ L;  5FDQ A;  2MGP A;  1TOZ A;  2NPR A;  1IVO C;  2W2M E;  3P5B L;  4AQT A;  4NA9 L;  1HJ7 A;  4ZHA B;  4CUE A;  4D0E A;  1PTH A;  3TK5 B;  1NFU B;  1LPZ A;  1QIU A;  1EQH A;  1G2L B;  4BTT A;  1V3X B;  4C16 A;  5JW1 A;  1W7X L;  2WPH E;  4CUD A;  1BF9 A;  3HS5 A;  2Y7Z B;  1EMN A;  1YUF A;  2RA0 L;  2YGO A;  1N7D A;  2XBV L;  1OB1 C;  4X8T L;  1IGX A;  3R05 A;  1F7M A;  4RRX A;  1HX2 A;  1LK9 A;  4G1M B;  2FZZ L;  2MHP A;  2Y5G L;  1I0U A;  3NT1 A;  4OTY A;  1EPI A;  2JJL A;  1ATB A;  3KQE L;  3ENS A;  1YO8 A;  1L5G B;  2ADX A;  3HO4 A;  4A7I A;  1Z6E L;  3KQC L;  5E8D A;  2J95 B;  1IQI L;  2GD4 A;  2W2Q E;  2XBY L;  1ATA A;  2Y5F L;  3N8Y B;  2MGR A;  2PR3 B;  5JB8 E;  1KLO A;  2WPK E;  4LOR A;  4CSY A;  1P0S L;  2Y7X B;  3F6U L;  2VJ3 A;  1HT5 A;  2TGF A;  2P3F N;  5F1A A;  3M36 L;  1LPK A;  4BTI A;  1P9J A;  2WZP P;  3CS7 L;  1WU1 B;  2DDU A;  3NJP C;  1IQL L;  3U73 A;  3LTG D;  3MDL A;  4LMF A;  4YZU B;  1EAI C;  1APQ A;  3LIW B;  1EPH A;  1F0S B;  1TLE A;  2D1J B;  3V64 C;  2J2U B;  1RFN B;  2JKH L;  4MMZ B;  4Z0K B;  2FLR L;  4Z0L A;  1CCV A;  2W2P E;  1X7A L;  2EI7 B;  4Z6A L;  3EGF A;  2I9B A;  2EI8 B;  3LC3 B;  4X8U L;  2BOX A;  3HO3 A;  1U8C B;  3N8W B;  1U67 A;  4JYU L;  3TK6 B;  2J34 B;  1F7E A;  1SZB A;  1EQG A;  1DIY A;  5COX A;  4MMY B;  4Y6D B;  5IKT A;  1MQ6 L;  1Z6C A;  1IGZ A;  4ISH L;  2AYL A;  2VWO L;  2P28 B;  2KB9 A;  2W26 B;  3SOB B;  1NT0 A;  2WG3 C;  2WPI E;  1Q4G A;  2Y5H L;  1J9C L;  2J94 B;  4X8V L;  5CKM A;  4BXS A;  4JYV L;  1IQJ L;  3K9X A;  2Q1J B;  1FJS L;  1NZI A;  4JZF L;  3IIT B;  2BSF A;  2RNL A;  4RRW A;  4XBM A;  2KNI A;  2VVU L;  1KLI L;  5JVY A;  1LPG A;  1HRE A;  1XFE A;  2W3K B;  3ASI A;  3CEN L;  3ZYJ B;  1YGC L;  2BT7 A;  3GCW E;  1A3P A;  2UWO B;  2BOH A;  3HS6 A;  5JB9 E;  3QMO A;  1TPG A;  2VRS A;  2UWL B;  4D0F A;  4RRY A;  1IP0 A;  3QH0 A;  3LTF B;  4BTU A;  3KQD L;  3LN0 A;  2FLB L;  4ZH8 B;  4JZE L;  3C9A C;  3U7U G;  1WHE A;  1IQN L;  3FBY A;  1IOX A;  1YUK B;  4COX A;  1UZJ A;  1ATE A;  3GCX E;  4TGF A;  4MMX B;  2RHP A;  3TBD A;  1KIG L;  1FE2 A;  1CCF A;  5IKV A;  3KQB L;  4BDX A;  3BT2 A;  1XKA L;  2B7D L;  4NGA L;  3POY A;  1JBU L;  4JZD L;  4M11 A;  2WPL E;  2P3T A;  2I9A A;  3SOV A;  2BQW A;  1NQL B;  2EI6 B;  2Y38 A;  2WPM E;  2W2O E;  2FLG A;  3S6X A;  4GU3 A;  1C5M F;  1IQF L;  3HO5 A;  2FD6 A;  1KLJ L;  1N1I A;  2BZ6 L;  2K2S B;  1URK A;  1CX2 A;  3NTB A;  2G00 L;  2VH6 B;  3ZYG A;  4X8S L;  1LMJ A;  2P3F L;  3OLT A;  2WPJ E;  2P94 L;  1G1S A;  3N8X A;  1YUG A;  4BXW A;  2F9B L;  1GK5 A;  3LC5 B;  1HT8 A;  2Y80 B;  2WFX B;  1FF7 A;  3KCG L;  1EBV A;  2WYG B;  3HS7 A;  4Y7B B;  4YT6 L;  2P95 L;  5JBC E;  1K36 A;  1ATD A;  1DVA L;  2H9E C;  3NTG A;  4ZAE B;  4ZXY L;  5JVZ A;  5KN5 C;  4FM5 A;  2YGQ A;  4ISI L;  3PGH A;  1IQG L;  4M10 A;  1G1T A;  1XKB A;  2XC0 L;  3F1S B;  1PGE A;  4O1Z A;  1MQ5 L;  1XDT R;  1UZQ A;  4ZXX L;  1KKE A;  6COX A;  3LN1 A;  5CKQ A;  3BPS E;  1IOE L;  5EGM B;  1NFY B;  5I46 L;  1FAX L;  5KIR A;  3N8V A;  2WYJ B;  2WFT A;  4D90 A; 
#chains in the Genus database with same CATH homology
 1JL9 A;  1NPE B;  2M74 A;  2WG4 B;  4O02 B;  2VVV L;  1CVU A;  5K0H B;  1EGF A;  4Y79 B;  5IKQ A;  5IKR A;  3FFG L;  2VVC K;  1HCG B;  3CFW A;  2W86 A;  2Y81 B;  2XBX L;  2J38 B;  1DDX A;  1PFX L;  4PH9 A;  5F19 A;  1NFW B;  2UWP B;  2XBW L;  3N8Z A;  1CQE A;  1APO A;  3FCS B;  2BQ6 A;  2VWN L;  1DX5 I;  1FAK L;  1EPJ A;  1DQB A;  1FFM A;  1M1X B;  2XC4 L;  1FSB A;  3SOQ A;  4XL1 A;  5L2Z L;  3N8Y A;  2VWL L;  5CKN A;  2Y82 B;  1EPG A;  4E1G A;  4NG9 L;  1WHF A;  2H9E L;  3Q3K B;  2BQ7 A;  3CA7 A;  3MQE A;  1B9W A;  2XC5 L;  3OLU A;  1HZ8 A;  2CJI B;  3TH3 L;  5JBA E;  3IJE B;  1IJQ A;  1UZK A;  2K2T A;  3TZI A;  1IQH L;  2KV4 A;  4RUT A;  1ADX A;  2OYU P;  2BOU A;  2PHB B;  1G1Q A;  2BOK L;  3GIS X;  3KL6 B;  3ZYI B;  1EMO A;  3LAQ A;  3Q7D A;  4YT7 L;  1IQM L;  3KRK A;  1LMM A;  3RR3 A;  1K37 A;  2P16 L;  4Y7A B;  1HRF A;  2P26 A;  1EZQ B;  1HAF A;  1UZP A;  3V65 B;  4RRZ A;  1ZAQ A;  3SW2 A;  1F0R B;  1G2M B;  1IQK L;  1QFK L;  4XLW A;  1LQD A;  1PRH A;  5L2Y L;  1L3Y A;  3DEM A;  4CUF A;  1CEJ A;  4A94 C;  3BT1 A;  2BMG A;  4Y71 B;  3TGF A;  2KL7 A;  1IQE L;  2P93 L;  3M37 L;  1G1R A;  4BDW A;  5CIS A;  2BO2 A;  1NFX B;  2W2N E;  1O5D L;  3ELA L;  1HAE A;  1JV2 B;  2W3I B;  2J4I B;  3QCW A;  1W8B L;  3H5C B;  1AUT L;  3HPT A;  2VWM K;  2VH0 B;  5L30 L;  1CVW L;  2OYE P;  4Y76 B;  1PXX A;  3N8W A;  2YGP A;  4RS0 A;  1KSN B;  1MOX C;  2P3U A;  1COU A;  4OTJ A;  3KK6 A;  5JBB E;  2PUQ L;  5FDQ A;  2MGP A;  1TOZ A;  2NPR A;  1IVO C;  2W2M E;  3P5B L;  4AQT A;  4NA9 L;  1HJ7 A;  4ZHA B;  4CUE A;  4D0E A;  1PTH A;  3TK5 B;  1NFU B;  1LPZ A;  1EQH A;  1G2L B;  4BTT A;  1V3X B;  4C16 A;  5JW1 A;  1W7X L;  2WPH E;  4CUD A;  1BF9 A;  3HS5 A;  2Y7Z B;  1EMN A;  1YUF A;  2RA0 L;  2YGO A;  1N7D A;  2XBV L;  1OB1 C;  4X8T L;  1IGX A;  3R05 A;  1F7M A;  4RRX A;  1HX2 A;  4G1M B;  2FZZ L;  2MHP A;  2Y5G L;  1I0U A;  3NT1 A;  4OTY A;  1EPI A;  1ATB A;  3KQE L;  3ENS A;  1YO8 A;  1L5G B;  2ADX A;  3HO4 A;  4A7I A;  1Z6E L;  3KQC L;  5E8D A;  2J95 B;  1IQI L;  2GD4 A;  2W2Q E;  2XBY L;  1ATA A;  2Y5F L;  3N8Y B;  2MGR A;  2PR3 B;  5JB8 E;  1KLO A;  2WPK E;  4LOR A;  4CSY A;  1P0S L;  2Y7X B;  3F6U L;  2VJ3 A;  1HT5 A;  2TGF A;  2P3F N;  5F1A A;  3M36 L;  1LPK A;  4BTI A;  1P9J A;  2WZP P;  3CS7 L;  1WU1 B;  2DDU A;  3NJP C;  1IQL L;  3U73 A;  3LTG D;  3MDL A;  4LMF A;  4YZU B;  1EAI C;  1APQ A;  3LIW B;  1EPH A;  1F0S B;  1TLE A;  2D1J B;  3V64 C;  2J2U B;  1RFN B;  2JKH L;  4MMZ B;  4Z0K B;  2FLR L;  4Z0L A;  1CCV A;  2W2P E;  1X7A L;  2EI7 B;  4Z6A L;  3EGF A;  2I9B A;  2EI8 B;  3LC3 B;  4X8U L;  2BOX A;  3HO3 A;  1U8C B;  3N8W B;  1U67 A;  4JYU L;  3TK6 B;  2J34 B;  1F7E A;  1SZB A;  1EQG A;  1DIY A;  5COX A;  4MMY B;  4Y6D B;  5IKT A;  1MQ6 L;  1Z6C A;  1IGZ A;  4ISH L;  2AYL A;  2VWO L;  2P28 B;  2KB9 A;  2W26 B;  3SOB B;  1NT0 A;  2WG3 C;  2WPI E;  1Q4G A;  2Y5H L;  1J9C L;  2J94 B;  4X8V L;  5CKM A;  4BXS A;  4JYV L;  1IQJ L;  3K9X A;  2Q1J B;  1FJS L;  1NZI A;  4JZF L;  3IIT B;  2RNL A;  4RRW A;  4XBM A;  2KNI A;  2VVU L;  1KLI L;  5JVY A;  1LPG A;  1HRE A;  1XFE A;  2W3K B;  3ASI A;  3CEN L;  3ZYJ B;  1YGC L;  3GCW E;  1A3P A;  2UWO B;  2BOH A;  3HS6 A;  5JB9 E;  3QMO A;  1TPG A;  2UWL B;  4D0F A;  4RRY A;  1IP0 A;  3QH0 A;  3LTF B;  4BTU A;  3KQD L;  3LN0 A;  2FLB L;  4ZH8 B;  4JZE L;  3C9A C;  3U7U G;  1WHE A;  1IQN L;  3FBY A;  1IOX A;  1YUK B;  4COX A;  1UZJ A;  1ATE A;  3GCX E;  4TGF A;  4MMX B;  2RHP A;  3TBD A;  1KIG L;  1FE2 A;  1CCF A;  5IKV A;  3KQB L;  4BDX A;  3BT2 A;  1XKA L;  2B7D L;  4NGA L;  3POY A;  1JBU L;  4JZD L;  4M11 A;  2WPL E;  2P3T A;  2I9A A;  3SOV A;  2BQW A;  1NQL B;  2EI6 B;  2Y38 A;  2WPM E;  2W2O E;  2FLG A;  3S6X A;  1C5M F;  1IQF L;  3HO5 A;  2FD6 A;  1KLJ L;  1N1I A;  2BZ6 L;  2K2S B;  1URK A;  1CX2 A;  3NTB A;  2G00 L;  2VH6 B;  3ZYG A;  4X8S L;  1LMJ A;  2P3F L;  3OLT A;  2WPJ E;  2P94 L;  1G1S A;  3N8X A;  1YUG A;  4BXW A;  2F9B L;  1GK5 A;  3LC5 B;  1HT8 A;  2Y80 B;  2WFX B;  1FF7 A;  3KCG L;  1EBV A;  2WYG B;  3HS7 A;  4Y7B B;  4YT6 L;  2P95 L;  5JBC E;  1K36 A;  1ATD A;  1DVA L;  2H9E C;  3NTG A;  4ZAE B;  4ZXY L;  5JVZ A;  5KN5 C;  4FM5 A;  2YGQ A;  4ISI L;  3PGH A;  1IQG L;  4M10 A;  1G1T A;  1XKB A;  2XC0 L;  3F1S B;  1PGE A;  4O1Z A;  1MQ5 L;  1XDT R;  1UZQ A;  4ZXX L;  6COX A;  3LN1 A;  5CKQ A;  3BPS E;  1IOE L;  5EGM B;  1NFY B;  5I46 L;  1FAX L;  5KIR A;  3N8V A;  2WYJ B;  2WFT A;  4D90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...