2WPIE

Factor ixa superactive double mutant
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
59
structure length
59
Chain Sequence
TCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of the Cofactor- and Substrate-Assisted Activation of Human Coagulation Factor Ixa
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords COAGULATION FACTOR IXA LIGHT CHAIN
total genus 9
structure length 59
sequence length 59
ec nomenclature ec 3.4.21.22: Coagulation factor IXa.
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2wpiE00
1XFEA 1HAEA 2VH0B 4ZXXL 5CKNA 1KLOA 3EGFA 4Y6DB 2FLRL 2J95B 3N8WB 1NZIA 3LAQA 1APQA 2F9BL 1N7DA 1IJQA 3LN1A 1EPHA 1TPGA 4YT6L 4JYUL 4Z0LA 4OTJA 2P3FL 1G1SA 2Y5GL 1K36A 4BDXA 2WFXB 3HS5A 3BT2A 1CX2A 3HO5A 5JBAE 3H5CB 4RS0A 3F6UL 5F1AA 1LMJA 2WYJB 5I46L 1G1TA 1NFWB 1F0RB 3BT1A 4M10A 1NT0A 2W3KB 1UZJA 5CISA 2Y5FL 1HZ8A 4ISIL 1UZPA 3SOBB 3KQDL 3HO3A 2WPKE 4MMXB 1XKBA 1F7EA 3ZYIB 1FAXL 2XBYL 1CEJA 3TBDA 2FLGA 3TK5B 4X8UL 1N1IA 4ZHAB 1ATEA 3LIWB 3HO4A 1CVUA 4BTUA 1AUTL 1HCGB 3TGFA 2BOXA 1KSNB 2P28B 3C9AC 1JL9A 2VWNL 3TZIA 2BZ6L 1LPZA 1G2LB 1C5MF 5JW1A 2W3IB 2EI8B 1QFKL 3ELAL 4COXA 4JYVL 1XKAL 2Y7XB 5COXA 2J4IB 2RNLA 1W8BL 4M11A 4TGFA 3V65B 1HREA 1LPKA 2B7DL 2FLBL 2KL7A 2Y5HL 1HX2A 2EI7B 3N8XA 1A3PA 3LC3B 2VWMK 1JBUL 3NTGA 2ADXA 2J34B 3LC5B 2MHPA 3M36L 1CVWL 1IQKL 1EMNA 3CA7A 1IQFL 1URKA 2VH6B 4JZEL 5JVYA 1G2MB 1EAIC 2RHPA 3N8VA 5JBBE 5IKVA 1XDTR 1CCFA 1CQEA 4Y76B 3LTFB 3NT1A 4ZH8B 5IKRA 5L30L 4X8SL 2FZZL 4ZAEB 1EQGA 3OLUA 3F1SB 2WPHE 2BO2A 5FDQA 1EMOA 4BTTA 3FCSB 1P9JA 2P3FN 1NFXB 2TGFA 5JB8E 2WYGB 5JBCE 4YZUB 4CUFA 1DIYA 2WPIE 2XBWL 1G1RA 2W2NE 3Q3KB 2OYEP 2P26A 2XC4L 4RUTA 1UZKA 4BXWA 1EQHA 1IQIL 2WG4B 4CUEA 4ISHL 1TOZA 3FFGL 2PR3B 1F7MA 1FFMA 4FM5A 1OB1C 1IGXA 2VWOL 3PGHA 2P93L 2XC5L 1NFYB 1NFUB 4LORA 3TK6B 2BQ7A 2XBXL 4RRYA 1WHFA 3QMOA 2Y80B 2J38B 3KQEL 1ATAA 1YUKB 3FBYA 1FE2A 3N8ZA 4RRWA 1EPIA 4MMYB 1LQDA 1Q4GA 6COXA 2VVCK 4NA9L 4C16A 2NPRA 3U7UG 2OYUP 4BTIA 1KLIL 2YGPA 1DVAL 1FF7A 1X7AL 4MMZB 2XC0L 1W7XL 2Q1JB 2W2ME 2BOKL 2H9EL 1HT5A 4JZFL 5EGMB 4Y71B 2BQ6A 4X8VL 3ENSA 4XLWA 5L2YL 3HS7A 3QCWA 1ATBA 3U73A 1FJSL 1I0UA 1RFNB 1COUA 1M1XB 1NPEB 5KIRA 3BPSE 5K0HB 3HPTA 4RRZA 1DX5I 5KN5C 4CSYA 2P3UA 4O02B 2WFTA 2I9BA 2AYLA 3M37L 1PFXL 3CFWA 2K2TA 4BDWA 3ASIA 1WU1B 4BXSA 4NG9L 2Y81B 4OTYA 1V3XB 2RA0L 2I9AA 3CENL 3SW2A 3IJEB 1B9WA 4CUDA 3V64C 3NJPC 2D1JB 4LMFA 2XBVL 1HT8A 2M74A 3LN0A 4XL1A 1J9CL 5L2ZL 2Y82B 1MQ5L 1EPJA 4Y7BB 1IQLL 1U67A 1WHEA 1HJ7A 1G1QA 3N8WA 3CS7L 2BOUA 3ZYGA 4YT7L 3R05A 1IQEL 1IP0A 1LPGA 2WPLE 4A7IA 1IQML 1HAFA 3MQEA 2P94L 1BF9A 3LTGD 3MDLA 2J94B 2KV4A 1APOA 4Z0KB 1TLEA 1IOXA 2UWOB 3KRKA 4AQTA 5JVZA 3K9XA 2MGRA 4D0EA 3N8YB 4Y79B 3GISX 2Y7ZB 1Z6CA 2BOHA 4RRXA 2WPME 3GCXE 2YGOA 5E8DA 1PRHA 4G1MB 3HS6A 3ZYJB 2P3TA 3KL6B 1IQHL 3OLTA 1Z6EL 3GCWE 3KK6A 4PH9A 3RR3A 1PTHA 1EPGA 4D0FA 1IVOC 4ZXYL 4X8TL 2W2OE 5F19A 3KCGL 1GK5A 3NTBA 2W86A 1PGEA 1DQBA 1MOXC 3SOQA 1P0SL 4O1ZA 1YO8A 1HRFA 2P95L 4NGAL 2G00L 5CKMA 2VWLL 2WG3C 2VJ3A 1ZAQA 1YUGA 2BQWA 2CJIB 3DEMA 3KQCL 2JKHL 1FSBA 2W26B 2DDUA 3KQBL 5IKQA 4D90A 4XBMA 1NQLB 3P5BL 2VVVL 2GD4A 1L5GB 5CKQA 1SZBA 2KB9A 2BMGA 3QH0A 2W2PE 1IGZA 2UWLB 3SOVA 1ADXA 1L3YA 2PUQL 1MQ6L 1EGFA 1PXXA 1CCVA 1IOEL 1UZQA 2MGPA 3POYA 2PHBB 4Z6AL 1IQNL 4Y7AB 1K37A 4JZDL 1YGCL 2FD6A 2J2UB 2EI6B 1O5DL 2K2SB 1IQGL 1F0SB 2W2QE 4E1GA 5IKTA 2WPJE 3IITB 1EZQB 5JB9E 1FAKL 2UWPB 1KIGL 2P16L 2VVUL 1DDXA 1IQJL 1ATDA 2Y38A 3TH3L 1U8CB 3Q7DA 1EBVA 1JV2B 3N8YA 1KLJL 1YUFA
chains in the Genus database with same CATH superfamily
1XFEA 1HAEA 2H9EC 2VH0B 4ZXXL 5CKNA 1KLOA 3EGFA 4Y6DB 2FLRL 2J95B 3N8WB 1NZIA 3LAQA 1APQA 2F9BL 1N7DA 1IJQA 3LN1A 1EPHA 1TPGA 4YT6L 4JYUL 4Z0LA 4OTJA 2P3FL 1G1SA 2Y5GL 1K36A 4BDXA 2WFXB 3HS5A 3BT2A 1CX2A 3HO5A 5JBAE 3H5CB 4RS0A 3F6UL 5F1AA 1LMJA 2WYJB 5I46L 1G1TA 1NFWB 2VRSA 1F0RB 3BT1A 4M10A 1NT0A 2W3KB 1UZJA 5CISA 2Y5FL 1HZ8A 4ISIL 1UZPA 3SOBB 3KQDL 2BT7A 3HO3A 2WPKE 4MMXB 1XKBA 1F7EA 3ZYIB 1FAXL 2XBYL 1CEJA 3TBDA 2FLGA 3TK5B 4X8UL 1N1IA 4ZHAB 1ATEA 3LIWB 3HO4A 1CVUA 4BTUA 1AUTL 1HCGB 3TGFA 2BOXA 1KSNB 2P28B 3S6XA 3C9AC 1JL9A 2VWNL 3TZIA 2BZ6L 1LPZA 1G2LB 1C5MF 5JW1A 1V1HA 2W3IB 2EI8B 1QFKL 3ELAL 4COXA 4JYVL 1XKAL 2Y7XB 5COXA 2J4IB 2RNLA 1W8BL 4M11A 2JJLA 4TGFA 2BT8A 3V65B 1HREA 1LPKA 2B7DL 2FLBL 2KL7A 2Y5HL 1HX2A 2EI7B 3N8XA 1A3PA 3LC3B 2VWMK 1JBUL 3NTGA 2ADXA 2J34B 3LC5B 2MHPA 3M36L 1CVWL 1IQKL 1EMNA 3CA7A 1IQFL 1URKA 2VH6B 4JZEL 5JVYA 1G2MB 1EAIC 2RHPA 2WZPP 3N8VA 5JBBE 5IKVA 1XDTR 1CCFA 1CQEA 4Y76B 3LTFB 3NT1A 4ZH8B 5IKRA 5L30L 4X8SL 2FZZL 4ZAEB 1EQGA 1LK9A 3OLUA 3F1SB 2HOXA 2WPHE 2BO2A 5FDQA 1EMOA 4BTTA 3FCSB 1P9JA 2P3FN 1NFXB 2TGFA 5JB8E 2WYGB 5JBCE 4YZUB 4CUFA 1DIYA 2WPIE 2XBWL 1G1RA 2W2NE 3Q3KB 2OYEP 2P26A 2XC4L 4RUTA 1UZKA 4BXWA 1EQHA 1IQIL 2WG4B 4CUEA 4ISHL 1TOZA 3FFGL 2PR3B 1F7MA 1FFMA 4FM5A 1OB1C 1IGXA 2VWOL 3PGHA 2P93L 2XC5L 1NFYB 1NFUB 4LORA 3TK6B 1KKEA 2BQ7A 2XBXL 4RRYA 1WHFA 3QMOA 2Y80B 2J38B 3KQEL 1ATAA 1YUKB 3FBYA 1FE2A 3N8ZA 4RRWA 1EPIA 1LQDA 4MMYB 1Q4GA 6COXA 2VVCK 4NA9L 4C16A 2NPRA 3U7UG 2OYUP 4BTIA 1KLIL 2YGPA 1DVAL 1FF7A 1X7AL 4MMZB 2XC0L 1W7XL 2Q1JB 2W2ME 2BOKL 2H9EL 1HT5A 4JZFL 5EGMB 4Y71B 2BQ6A 4X8VL 3ENSA 4XLWA 5L2YL 2YGQA 3HS7A 3QCWA 1ATBA 3U73A 1FJSL 1I0UA 1RFNB 1COUA 1M1XB 2BSFA 1NPEB 5KIRA 3BPSE 5K0HB 3HPTA 4RRZA 1DX5I 5KN5C 4CSYA 2P3UA 4O02B 2WFTA 2I9BA 2AYLA 3M37L 1PFXL 3CFWA 2K2TA 4BDWA 3ASIA 2HORA 1WU1B 4BXSA 4NG9L 2Y81B 4OTYA 1V3XB 2RA0L 2I9AA 3CENL 3SW2A 3IJEB 1B9WA 4CUDA 3V64C 3NJPC 2D1JB 4LMFA 1QIUA 4GU3A 2XBVL 1HT8A 2M74A 3LN0A 4XL1A 1J9CL 5L2ZL 2Y82B 1MQ5L 1EPJA 4Y7BB 1IQLL 1U67A 1WHEA 1HJ7A 1G1QA 3N8WA 3CS7L 2BOUA 3ZYGA 4YT7L 3R05A 1IQEL 1IP0A 1LPGA 2WPLE 4A7IA 1IQML 1HAFA 3MQEA 2P94L 1BF9A 3LTGD 3MDLA 2J94B 2KV4A 1APOA 4Z0KB 1TLEA 1IOXA 2UWOB 3KRKA 4AQTA 5JVZA 3K9XA 2MGRA 4D0EA 3N8YB 4Y79B 3GISX 2Y7ZB 1Z6CA 2BOHA 4RRXA 2WPME 3GCXE 2YGOA 5E8DA 1PRHA 4G1MB 3HS6A 3ZYJB 1LMMA 2P3TA 3KL6B 1IQHL 3OLTA 1Z6EL 3GCWE 3KK6A 4PH9A 3RR3A 1PTHA 1EPGA 4D0FA 1IVOC 4ZXYL 4X8TL 2W2OE 5F19A 3KCGL 1GK5A 3NTBA 2W86A 1PGEA 1DQBA 2KNIA 1MOXC 3SOQA 1P0SL 4O1ZA 1YO8A 1HRFA 2P95L 4NGAL 2G00L 5CKMA 2VWLL 2WG3C 2VJ3A 1ZAQA 1YUGA 1V1IA 2BQWA 2CJIB 3DEMA 3KQCL 2JKHL 1FSBA 2W26B 2DDUA 3KQBL 5IKQA 4D90A 4XBMA 1NQLB 4A94C 3P5BL 2VVVL 2GD4A 1L5GB 5CKQA 1SZBA 2KB9A 2BMGA 3QH0A 2W2PE 1IGZA 2UWLB 3SOVA 1ADXA 1L3YA 2PUQL 1MQ6L 1EGFA 1PXXA 1CCVA 1IOEL 1UZQA 2MGPA 3POYA 2PHBB 4Z6AL 1IQNL 4Y7AB 1K37A 4JZDL 1YGCL 2FD6A 2J2UB 2EI6B 1O5DL 2K2SB 1IQGL 1F0SB 2W2QE 4E1GA 5IKTA 2WPJE 3IITB 1EZQB 4GU4A 5JB9E 1FAKL 2UWPB 1KIGL 2P16L 2VVUL 1DDXA 1IQJL 1ATDA 2Y38A 3TH3L 1U8CB 3Q7DA 1EBVA 1JV2B 3N8YA 1KLJL 1YUFA
chains in the Genus database with same CATH topology
1XFEA 1HAEA 2H9EC 2VH0B 4ZXXL 5CKNA 1KLOA 3EGFA 4Y6DB 2FLRL 2J95B 3N8WB 1NZIA 3LAQA 1APQA 2F9BL 1N7DA 1IJQA 3LN1A 1EPHA 1TPGA 4YT6L 4JYUL 4Z0LA 4OTJA 2P3FL 1G1SA 2Y5GL 1K36A 4BDXA 2WFXB 3HS5A 3BT2A 1CX2A 3HO5A 5JBAE 3H5CB 4RS0A 3F6UL 5F1AA 1LMJA 2WYJB 5I46L 1G1TA 1NFWB 1F0RB 3BT1A 4M10A 1NT0A 2W3KB 1UZJA 5CISA 2Y5FL 1HZ8A 4ISIL 1UZPA 3SOBB 3KQDL 3HO3A 2WPKE 4MMXB 1XKBA 1F7EA 3ZYIB 1FAXL 2XBYL 1CEJA 3TBDA 2FLGA 3TK5B 4X8UL 1N1IA 4ZHAB 1ATEA 3LIWB 3HO4A 1CVUA 4BTUA 1AUTL 1HCGB 3TGFA 2BOXA 1KSNB 2P28B 3S6XA 3C9AC 1JL9A 2VWNL 3TZIA 2BZ6L 1LPZA 1G2LB 1C5MF 5JW1A 2W3IB 2EI8B 1QFKL 3ELAL 4COXA 4JYVL 1XKAL 2Y7XB 5COXA 2J4IB 2RNLA 1W8BL 4M11A 4TGFA 3V65B 1HREA 1LPKA 2B7DL 2FLBL 2KL7A 2Y5HL 1HX2A 2EI7B 3N8XA 1A3PA 3LC3B 2VWMK 1JBUL 3NTGA 2ADXA 2J34B 3LC5B 2MHPA 3M36L 1CVWL 1IQKL 1EMNA 3CA7A 1IQFL 1URKA 2VH6B 4JZEL 5JVYA 1G2MB 1EAIC 2RHPA 2WZPP 3N8VA 5JBBE 5IKVA 1XDTR 1CCFA 1CQEA 4Y76B 3LTFB 3NT1A 4ZH8B 5IKRA 5L30L 4X8SL 2FZZL 4ZAEB 1EQGA 3OLUA 3F1SB 2WPHE 2BO2A 5FDQA 1EMOA 4BTTA 3FCSB 1P9JA 2P3FN 1NFXB 2TGFA 5JB8E 2WYGB 5JBCE 4YZUB 4CUFA 1DIYA 2WPIE 2XBWL 1G1RA 2W2NE 3Q3KB 2OYEP 2P26A 2XC4L 4RUTA 1UZKA 4BXWA 1EQHA 1IQIL 2WG4B 4CUEA 4ISHL 1TOZA 3FFGL 2PR3B 1F7MA 1FFMA 4FM5A 1OB1C 1IGXA 2VWOL 3PGHA 2P93L 2XC5L 1NFYB 1NFUB 4LORA 3TK6B 2BQ7A 2XBXL 4RRYA 1WHFA 3QMOA 2Y80B 2J38B 3KQEL 1ATAA 1YUKB 3FBYA 1FE2A 3N8ZA 4RRWA 1EPIA 4MMYB 1LQDA 1Q4GA 6COXA 2VVCK 4NA9L 4C16A 2NPRA 3U7UG 2OYUP 4BTIA 1KLIL 2YGPA 1DVAL 1FF7A 1X7AL 4MMZB 2XC0L 1W7XL 2Q1JB 2W2ME 2BOKL 2H9EL 1HT5A 4JZFL 5EGMB 4Y71B 2BQ6A 4X8VL 3ENSA 4XLWA 5L2YL 2YGQA 3HS7A 3QCWA 1ATBA 3U73A 1FJSL 1I0UA 1RFNB 1COUA 1M1XB 1NPEB 5KIRA 3BPSE 5K0HB 3HPTA 4RRZA 1DX5I 5KN5C 4CSYA 2P3UA 4O02B 2WFTA 2I9BA 2AYLA 3M37L 1PFXL 3CFWA 2K2TA 4BDWA 3ASIA 1WU1B 4BXSA 4NG9L 2Y81B 4OTYA 1V3XB 2RA0L 2I9AA 3CENL 3SW2A 3IJEB 1B9WA 4CUDA 3V64C 3NJPC 2D1JB 4LMFA 2XBVL 1HT8A 2M74A 3LN0A 4XL1A 1J9CL 5L2ZL 2Y82B 1MQ5L 1EPJA 4Y7BB 1IQLL 1U67A 1WHEA 1HJ7A 1G1QA 3N8WA 3CS7L 2BOUA 3ZYGA 4YT7L 3R05A 1IQEL 1IP0A 1LPGA 2WPLE 4A7IA 1IQML 1HAFA 3MQEA 2P94L 1BF9A 3LTGD 3MDLA 2J94B 2KV4A 1APOA 4Z0KB 1TLEA 1IOXA 2UWOB 3KRKA 4AQTA 5JVZA 3K9XA 2MGRA 4D0EA 3N8YB 4Y79B 3GISX 2Y7ZB 1Z6CA 2BOHA 4RRXA 2WPME 3GCXE 2YGOA 5E8DA 1PRHA 4G1MB 3HS6A 3ZYJB 1LMMA 2P3TA 3KL6B 1IQHL 3OLTA 1Z6EL 3GCWE 3KK6A 4PH9A 3RR3A 1PTHA 1EPGA 4D0FA 1IVOC 4ZXYL 4X8TL 2W2OE 5F19A 3KCGL 1GK5A 3NTBA 2W86A 1PGEA 1DQBA 2KNIA 1MOXC 3SOQA 1P0SL 4O1ZA 1YO8A 1HRFA 2P95L 4NGAL 2G00L 5CKMA 2VWLL 2WG3C 2VJ3A 1ZAQA 1YUGA 2BQWA 2CJIB 3DEMA 3KQCL 2JKHL 1FSBA 2W26B 2DDUA 3KQBL 5IKQA 4D90A 4XBMA 1NQLB 4A94C 3P5BL 2VVVL 2GD4A 1L5GB 5CKQA 1SZBA 2KB9A 2BMGA 3QH0A 2W2PE 1IGZA 2UWLB 3SOVA 1ADXA 1L3YA 2PUQL 1MQ6L 1EGFA 1PXXA 1CCVA 1IOEL 1UZQA 2MGPA 3POYA 2PHBB 4Z6AL 1IQNL 4Y7AB 1K37A 4JZDL 1YGCL 2FD6A 2J2UB 2EI6B 1O5DL 2K2SB 1IQGL 1F0SB 2W2QE 4E1GA 5IKTA 2WPJE 3IITB 1EZQB 5JB9E 1FAKL 2UWPB 1KIGL 2P16L 2VVUL 1DDXA 1IQJL 1ATDA 2Y38A 3TH3L 1U8CB 3Q7DA 1EBVA 1JV2B 3N8YA 1KLJL 1YUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFE A;  1HAE A;  2VH0 B;  4ZXX L;  5CKN A;  1KLO A;  3EGF A;  4Y6D B;  2FLR L;  2J95 B;  3N8W B;  1NZI A;  3LAQ A;  1APQ A;  2F9B L;  1N7D A;  1IJQ A;  3LN1 A;  1EPH A;  1TPG A;  4YT6 L;  4JYU L;  4Z0L A;  4OTJ A;  2P3F L;  1G1S A;  2Y5G L;  1K36 A;  4BDX A;  2WFX B;  3HS5 A;  3BT2 A;  1CX2 A;  3HO5 A;  5JBA E;  3H5C B;  4RS0 A;  3F6U L;  5F1A A;  1LMJ A;  2WYJ B;  5I46 L;  1G1T A;  1NFW B;  1F0R B;  3BT1 A;  4M10 A;  1NT0 A;  2W3K B;  1UZJ A;  5CIS A;  2Y5F L;  1HZ8 A;  4ISI L;  1UZP A;  3SOB B;  3KQD L;  3HO3 A;  2WPK E;  4MMX B;  1XKB A;  1F7E A;  3ZYI B;  1FAX L;  2XBY L;  1CEJ A;  3TBD A;  2FLG A;  3TK5 B;  4X8U L;  1N1I A;  4ZHA B;  1ATE A;  3LIW B;  3HO4 A;  1CVU A;  4BTU A;  1AUT L;  1HCG B;  3TGF A;  2BOX A;  1KSN B;  2P28 B;  3C9A C;  1JL9 A;  2VWN L;  3TZI A;  2BZ6 L;  1LPZ A;  1G2L B;  1C5M F;  5JW1 A;  2W3I B;  2EI8 B;  1QFK L;  3ELA L;  4COX A;  4JYV L;  1XKA L;  2Y7X B;  5COX A;  2J4I B;  2RNL A;  1W8B L;  4M11 A;  4TGF A;  3V65 B;  1HRE A;  1LPK A;  2B7D L;  2FLB L;  2KL7 A;  2Y5H L;  1HX2 A;  2EI7 B;  3N8X A;  1A3P A;  3LC3 B;  2VWM K;  1JBU L;  3NTG A;  2ADX A;  2J34 B;  3LC5 B;  2MHP A;  3M36 L;  1CVW L;  1IQK L;  1EMN A;  3CA7 A;  1IQF L;  1URK A;  2VH6 B;  4JZE L;  5JVY A;  1G2M B;  1EAI C;  2RHP A;  3N8V A;  5JBB E;  5IKV A;  1XDT R;  1CCF A;  1CQE A;  4Y76 B;  3LTF B;  3NT1 A;  4ZH8 B;  5IKR A;  5L30 L;  4X8S L;  2FZZ L;  4ZAE B;  1EQG A;  3OLU A;  3F1S B;  2WPH E;  2BO2 A;  5FDQ A;  1EMO A;  4BTT A;  3FCS B;  1P9J A;  2P3F N;  1NFX B;  2TGF A;  5JB8 E;  2WYG B;  5JBC E;  4YZU B;  4CUF A;  1DIY A;  2WPI E;  2XBW L;  1G1R A;  2W2N E;  3Q3K B;  2OYE P;  2P26 A;  2XC4 L;  4RUT A;  1UZK A;  4BXW A;  1EQH A;  1IQI L;  2WG4 B;  4CUE A;  4ISH L;  1TOZ A;  3FFG L;  2PR3 B;  1F7M A;  1FFM A;  4FM5 A;  1OB1 C;  1IGX A;  2VWO L;  3PGH A;  2P93 L;  2XC5 L;  1NFY B;  1NFU B;  4LOR A;  3TK6 B;  2BQ7 A;  2XBX L;  4RRY A;  1WHF A;  3QMO A;  2Y80 B;  2J38 B;  3KQE L;  1ATA A;  1YUK B;  3FBY A;  1FE2 A;  3N8Z A;  4RRW A;  1EPI A;  4MMY B;  1LQD A;  1Q4G A;  6COX A;  2VVC K;  4NA9 L;  4C16 A;  2NPR A;  3U7U G;  2OYU P;  4BTI A;  1KLI L;  2YGP A;  1DVA L;  1FF7 A;  1X7A L;  4MMZ B;  2XC0 L;  1W7X L;  2Q1J B;  2W2M E;  2BOK L;  2H9E L;  1HT5 A;  4JZF L;  5EGM B;  4Y71 B;  2BQ6 A;  4X8V L;  3ENS A;  4XLW A;  5L2Y L;  3HS7 A;  3QCW A;  1ATB A;  3U73 A;  1FJS L;  1I0U A;  1RFN B;  1COU A;  1M1X B;  1NPE B;  5KIR A;  3BPS E;  5K0H B;  3HPT A;  4RRZ A;  1DX5 I;  5KN5 C;  4CSY A;  2P3U A;  4O02 B;  2WFT A;  2I9B A;  2AYL A;  3M37 L;  1PFX L;  3CFW A;  2K2T A;  4BDW A;  3ASI A;  1WU1 B;  4BXS A;  4NG9 L;  2Y81 B;  4OTY A;  1V3X B;  2RA0 L;  2I9A A;  3CEN L;  3SW2 A;  3IJE B;  1B9W A;  4CUD A;  3V64 C;  3NJP C;  2D1J B;  4LMF A;  2XBV L;  1HT8 A;  2M74 A;  3LN0 A;  4XL1 A;  1J9C L;  5L2Z L;  2Y82 B;  1MQ5 L;  1EPJ A;  4Y7B B;  1IQL L;  1U67 A;  1WHE A;  1HJ7 A;  1G1Q A;  3N8W A;  3CS7 L;  2BOU A;  3ZYG A;  4YT7 L;  3R05 A;  1IQE L;  1IP0 A;  1LPG A;  2WPL E;  4A7I A;  1IQM L;  1HAF A;  3MQE A;  2P94 L;  1BF9 A;  3LTG D;  3MDL A;  2J94 B;  2KV4 A;  1APO A;  4Z0K B;  1TLE A;  1IOX A;  2UWO B;  3KRK A;  4AQT A;  5JVZ A;  3K9X A;  2MGR A;  4D0E A;  3N8Y B;  4Y79 B;  3GIS X;  2Y7Z B;  1Z6C A;  2BOH A;  4RRX A;  2WPM E;  3GCX E;  2YGO A;  5E8D A;  1PRH A;  4G1M B;  3HS6 A;  3ZYJ B;  2P3T A;  3KL6 B;  1IQH L;  3OLT A;  1Z6E L;  3GCW E;  3KK6 A;  4PH9 A;  3RR3 A;  1PTH A;  1EPG A;  4D0F A;  1IVO C;  4ZXY L;  4X8T L;  2W2O E;  5F19 A;  3KCG L;  1GK5 A;  3NTB A;  2W86 A;  1PGE A;  1DQB A;  1MOX C;  3SOQ A;  1P0S L;  4O1Z A;  1YO8 A;  1HRF A;  2P95 L;  4NGA L;  2G00 L;  5CKM A;  2VWL L;  2WG3 C;  2VJ3 A;  1ZAQ A;  1YUG A;  2BQW A;  2CJI B;  3DEM A;  3KQC L;  2JKH L;  1FSB A;  2W26 B;  2DDU A;  3KQB L;  5IKQ A;  4D90 A;  4XBM A;  1NQL B;  3P5B L;  2VVV L;  2GD4 A;  1L5G B;  5CKQ A;  1SZB A;  2KB9 A;  2BMG A;  3QH0 A;  2W2P E;  1IGZ A;  2UWL B;  3SOV A;  1ADX A;  1L3Y A;  2PUQ L;  1MQ6 L;  1EGF A;  1PXX A;  1CCV A;  1IOE L;  1UZQ A;  2MGP A;  3POY A;  2PHB B;  4Z6A L;  1IQN L;  4Y7A B;  1K37 A;  4JZD L;  1YGC L;  2FD6 A;  2J2U B;  2EI6 B;  1O5D L;  2K2S B;  1IQG L;  1F0S B;  2W2Q E;  4E1G A;  5IKT A;  2WPJ E;  3IIT B;  1EZQ B;  5JB9 E;  1FAK L;  2UWP B;  1KIG L;  2P16 L;  2VVU L;  1DDX A;  1IQJ L;  1ATD A;  2Y38 A;  3TH3 L;  1U8C B;  3Q7D A;  1EBV A;  1JV2 B;  3N8Y A;  1KLJ L;  1YUF A; 
#chains in the Genus database with same CATH topology
 1XFE A;  1HAE A;  2H9E C;  2VH0 B;  4ZXX L;  5CKN A;  1KLO A;  3EGF A;  4Y6D B;  2FLR L;  2J95 B;  3N8W B;  1NZI A;  3LAQ A;  1APQ A;  2F9B L;  1N7D A;  1IJQ A;  3LN1 A;  1EPH A;  1TPG A;  4YT6 L;  4JYU L;  4Z0L A;  4OTJ A;  2P3F L;  1G1S A;  2Y5G L;  1K36 A;  4BDX A;  2WFX B;  3HS5 A;  3BT2 A;  1CX2 A;  3HO5 A;  5JBA E;  3H5C B;  4RS0 A;  3F6U L;  5F1A A;  1LMJ A;  2WYJ B;  5I46 L;  1G1T A;  1NFW B;  2VRS A;  1F0R B;  3BT1 A;  4M10 A;  1NT0 A;  2W3K B;  1UZJ A;  5CIS A;  2Y5F L;  1HZ8 A;  4ISI L;  1UZP A;  3SOB B;  3KQD L;  2BT7 A;  3HO3 A;  2WPK E;  4MMX B;  1XKB A;  1F7E A;  3ZYI B;  1FAX L;  2XBY L;  1CEJ A;  3TBD A;  2FLG A;  3TK5 B;  4X8U L;  1N1I A;  4ZHA B;  1ATE A;  3LIW B;  3HO4 A;  1CVU A;  4BTU A;  1AUT L;  1HCG B;  3TGF A;  2BOX A;  1KSN B;  2P28 B;  3S6X A;  3C9A C;  1JL9 A;  2VWN L;  3TZI A;  2BZ6 L;  1LPZ A;  1G2L B;  1C5M F;  5JW1 A;  1V1H A;  2W3I B;  2EI8 B;  1QFK L;  3ELA L;  4COX A;  4JYV L;  1XKA L;  2Y7X B;  5COX A;  2J4I B;  2RNL A;  1W8B L;  4M11 A;  2JJL A;  4TGF A;  2BT8 A;  3V65 B;  1HRE A;  1LPK A;  2B7D L;  2FLB L;  2KL7 A;  2Y5H L;  1HX2 A;  2EI7 B;  3N8X A;  1A3P A;  3LC3 B;  2VWM K;  1JBU L;  3NTG A;  2ADX A;  2J34 B;  3LC5 B;  2MHP A;  3M36 L;  1CVW L;  1IQK L;  1EMN A;  3CA7 A;  1IQF L;  1URK A;  2VH6 B;  4JZE L;  5JVY A;  1G2M B;  1EAI C;  2RHP A;  2WZP P;  3N8V A;  5JBB E;  5IKV A;  1XDT R;  1CCF A;  1CQE A;  4Y76 B;  3LTF B;  3NT1 A;  4ZH8 B;  5IKR A;  5L30 L;  4X8S L;  2FZZ L;  4ZAE B;  1EQG A;  1LK9 A;  3OLU A;  3F1S B;  2HOX A;  2WPH E;  2BO2 A;  5FDQ A;  1EMO A;  4BTT A;  3FCS B;  1P9J A;  2P3F N;  1NFX B;  2TGF A;  5JB8 E;  2WYG B;  5JBC E;  4YZU B;  4CUF A;  1DIY A;  2WPI E;  2XBW L;  1G1R A;  2W2N E;  3Q3K B;  2OYE P;  2P26 A;  2XC4 L;  4RUT A;  1UZK A;  4BXW A;  1EQH A;  1IQI L;  2WG4 B;  4CUE A;  4ISH L;  1TOZ A;  3FFG L;  2PR3 B;  1F7M A;  1FFM A;  4FM5 A;  1OB1 C;  1IGX A;  2VWO L;  3PGH A;  2P93 L;  2XC5 L;  1NFY B;  1NFU B;  4LOR A;  3TK6 B;  1KKE A;  2BQ7 A;  2XBX L;  4RRY A;  1WHF A;  3QMO A;  2Y80 B;  2J38 B;  3KQE L;  1ATA A;  1YUK B;  3FBY A;  1FE2 A;  3N8Z A;  4RRW A;  1EPI A;  1LQD A;  4MMY B;  1Q4G A;  6COX A;  2VVC K;  4NA9 L;  4C16 A;  2NPR A;  3U7U G;  2OYU P;  4BTI A;  1KLI L;  2YGP A;  1DVA L;  1FF7 A;  1X7A L;  4MMZ B;  2XC0 L;  1W7X L;  2Q1J B;  2W2M E;  2BOK L;  2H9E L;  1HT5 A;  4JZF L;  5EGM B;  4Y71 B;  2BQ6 A;  4X8V L;  3ENS A;  4XLW A;  5L2Y L;  2YGQ A;  3HS7 A;  3QCW A;  1ATB A;  3U73 A;  1FJS L;  1I0U A;  1RFN B;  1COU A;  1M1X B;  2BSF A;  1NPE B;  5KIR A;  3BPS E;  5K0H B;  3HPT A;  4RRZ A;  1DX5 I;  5KN5 C;  4CSY A;  2P3U A;  4O02 B;  2WFT A;  2I9B A;  2AYL A;  3M37 L;  1PFX L;  3CFW A;  2K2T A;  4BDW A;  3ASI A;  2HOR A;  1WU1 B;  4BXS A;  4NG9 L;  2Y81 B;  4OTY A;  1V3X B;  2RA0 L;  2I9A A;  3CEN L;  3SW2 A;  3IJE B;  1B9W A;  4CUD A;  3V64 C;  3NJP C;  2D1J B;  4LMF A;  1QIU A;  4GU3 A;  2XBV L;  1HT8 A;  2M74 A;  3LN0 A;  4XL1 A;  1J9C L;  5L2Z L;  2Y82 B;  1MQ5 L;  1EPJ A;  4Y7B B;  1IQL L;  1U67 A;  1WHE A;  1HJ7 A;  1G1Q A;  3N8W A;  3CS7 L;  2BOU A;  3ZYG A;  4YT7 L;  3R05 A;  1IQE L;  1IP0 A;  1LPG A;  2WPL E;  4A7I A;  1IQM L;  1HAF A;  3MQE A;  2P94 L;  1BF9 A;  3LTG D;  3MDL A;  2J94 B;  2KV4 A;  1APO A;  4Z0K B;  1TLE A;  1IOX A;  2UWO B;  3KRK A;  4AQT A;  5JVZ A;  3K9X A;  2MGR A;  4D0E A;  3N8Y B;  4Y79 B;  3GIS X;  2Y7Z B;  1Z6C A;  2BOH A;  4RRX A;  2WPM E;  3GCX E;  2YGO A;  5E8D A;  1PRH A;  4G1M B;  3HS6 A;  3ZYJ B;  1LMM A;  2P3T A;  3KL6 B;  1IQH L;  3OLT A;  1Z6E L;  3GCW E;  3KK6 A;  4PH9 A;  3RR3 A;  1PTH A;  1EPG A;  4D0F A;  1IVO C;  4ZXY L;  4X8T L;  2W2O E;  5F19 A;  3KCG L;  1GK5 A;  3NTB A;  2W86 A;  1PGE A;  1DQB A;  2KNI A;  1MOX C;  3SOQ A;  1P0S L;  4O1Z A;  1YO8 A;  1HRF A;  2P95 L;  4NGA L;  2G00 L;  5CKM A;  2VWL L;  2WG3 C;  2VJ3 A;  1ZAQ A;  1YUG A;  1V1I A;  2BQW A;  2CJI B;  3DEM A;  3KQC L;  2JKH L;  1FSB A;  2W26 B;  2DDU A;  3KQB L;  5IKQ A;  4D90 A;  4XBM A;  1NQL B;  4A94 C;  3P5B L;  2VVV L;  2GD4 A;  1L5G B;  5CKQ A;  1SZB A;  2KB9 A;  2BMG A;  3QH0 A;  2W2P E;  1IGZ A;  2UWL B;  3SOV A;  1ADX A;  1L3Y A;  2PUQ L;  1MQ6 L;  1EGF A;  1PXX A;  1CCV A;  1IOE L;  1UZQ A;  2MGP A;  3POY A;  2PHB B;  4Z6A L;  1IQN L;  4Y7A B;  1K37 A;  4JZD L;  1YGC L;  2FD6 A;  2J2U B;  2EI6 B;  1O5D L;  2K2S B;  1IQG L;  1F0S B;  2W2Q E;  4E1G A;  5IKT A;  2WPJ E;  3IIT B;  1EZQ B;  4GU4 A;  5JB9 E;  1FAK L;  2UWP B;  1KIG L;  2P16 L;  2VVU L;  1DDX A;  1IQJ L;  1ATD A;  2Y38 A;  3TH3 L;  1U8C B;  3Q7D A;  1EBV A;  1JV2 B;  3N8Y A;  1KLJ L;  1YUF A; 
#chains in the Genus database with same CATH homology
 1XFE A;  1HAE A;  2H9E C;  2VH0 B;  4ZXX L;  5CKN A;  1KLO A;  3EGF A;  4Y6D B;  2FLR L;  2J95 B;  3N8W B;  1NZI A;  3LAQ A;  1APQ A;  2F9B L;  1N7D A;  1IJQ A;  3LN1 A;  1EPH A;  1TPG A;  4YT6 L;  4JYU L;  4Z0L A;  4OTJ A;  2P3F L;  1G1S A;  2Y5G L;  1K36 A;  4BDX A;  2WFX B;  3HS5 A;  3BT2 A;  1CX2 A;  3HO5 A;  5JBA E;  3H5C B;  4RS0 A;  3F6U L;  5F1A A;  1LMJ A;  2WYJ B;  5I46 L;  1G1T A;  1NFW B;  1F0R B;  3BT1 A;  4M10 A;  1NT0 A;  2W3K B;  1UZJ A;  5CIS A;  2Y5F L;  1HZ8 A;  4ISI L;  1UZP A;  3SOB B;  3KQD L;  3HO3 A;  2WPK E;  4MMX B;  1XKB A;  1F7E A;  3ZYI B;  1FAX L;  2XBY L;  1CEJ A;  3TBD A;  2FLG A;  3TK5 B;  4X8U L;  1N1I A;  4ZHA B;  1ATE A;  3LIW B;  3HO4 A;  1CVU A;  4BTU A;  1AUT L;  1HCG B;  3TGF A;  2BOX A;  1KSN B;  2P28 B;  3S6X A;  3C9A C;  1JL9 A;  2VWN L;  3TZI A;  2BZ6 L;  1LPZ A;  1G2L B;  1C5M F;  5JW1 A;  2W3I B;  2EI8 B;  1QFK L;  3ELA L;  4COX A;  4JYV L;  1XKA L;  2Y7X B;  5COX A;  2J4I B;  2RNL A;  1W8B L;  4M11 A;  4TGF A;  3V65 B;  1HRE A;  1LPK A;  2B7D L;  2FLB L;  2KL7 A;  2Y5H L;  1HX2 A;  2EI7 B;  3N8X A;  1A3P A;  3LC3 B;  2VWM K;  1JBU L;  3NTG A;  2ADX A;  2J34 B;  3LC5 B;  2MHP A;  3M36 L;  1CVW L;  1IQK L;  1EMN A;  3CA7 A;  1IQF L;  1URK A;  2VH6 B;  4JZE L;  5JVY A;  1G2M B;  1EAI C;  2RHP A;  2WZP P;  3N8V A;  5JBB E;  5IKV A;  1XDT R;  1CCF A;  1CQE A;  4Y76 B;  3LTF B;  3NT1 A;  4ZH8 B;  5IKR A;  5L30 L;  4X8S L;  2FZZ L;  4ZAE B;  1EQG A;  3OLU A;  3F1S B;  2WPH E;  2BO2 A;  5FDQ A;  1EMO A;  4BTT A;  3FCS B;  1P9J A;  2P3F N;  1NFX B;  2TGF A;  5JB8 E;  2WYG B;  5JBC E;  4YZU B;  4CUF A;  1DIY A;  2WPI E;  2XBW L;  1G1R A;  2W2N E;  3Q3K B;  2OYE P;  2P26 A;  2XC4 L;  4RUT A;  1UZK A;  4BXW A;  1EQH A;  1IQI L;  2WG4 B;  4CUE A;  4ISH L;  1TOZ A;  3FFG L;  2PR3 B;  1F7M A;  1FFM A;  4FM5 A;  1OB1 C;  1IGX A;  2VWO L;  3PGH A;  2P93 L;  2XC5 L;  1NFY B;  1NFU B;  4LOR A;  3TK6 B;  2BQ7 A;  2XBX L;  4RRY A;  1WHF A;  3QMO A;  2Y80 B;  2J38 B;  3KQE L;  1ATA A;  1YUK B;  3FBY A;  1FE2 A;  3N8Z A;  4RRW A;  1EPI A;  4MMY B;  1LQD A;  1Q4G A;  6COX A;  2VVC K;  4NA9 L;  4C16 A;  2NPR A;  3U7U G;  2OYU P;  4BTI A;  1KLI L;  2YGP A;  1DVA L;  1FF7 A;  1X7A L;  4MMZ B;  2XC0 L;  1W7X L;  2Q1J B;  2W2M E;  2BOK L;  2H9E L;  1HT5 A;  4JZF L;  5EGM B;  4Y71 B;  2BQ6 A;  4X8V L;  3ENS A;  4XLW A;  5L2Y L;  2YGQ A;  3HS7 A;  3QCW A;  1ATB A;  3U73 A;  1FJS L;  1I0U A;  1RFN B;  1COU A;  1M1X B;  1NPE B;  5KIR A;  3BPS E;  5K0H B;  3HPT A;  4RRZ A;  1DX5 I;  5KN5 C;  4CSY A;  2P3U A;  4O02 B;  2WFT A;  2I9B A;  2AYL A;  3M37 L;  1PFX L;  3CFW A;  2K2T A;  4BDW A;  3ASI A;  1WU1 B;  4BXS A;  4NG9 L;  2Y81 B;  4OTY A;  1V3X B;  2RA0 L;  2I9A A;  3CEN L;  3SW2 A;  3IJE B;  1B9W A;  4CUD A;  3V64 C;  3NJP C;  2D1J B;  4LMF A;  2XBV L;  1HT8 A;  2M74 A;  3LN0 A;  4XL1 A;  1J9C L;  5L2Z L;  2Y82 B;  1MQ5 L;  1EPJ A;  4Y7B B;  1IQL L;  1U67 A;  1WHE A;  1HJ7 A;  1G1Q A;  3N8W A;  3CS7 L;  2BOU A;  3ZYG A;  4YT7 L;  3R05 A;  1IQE L;  1IP0 A;  1LPG A;  2WPL E;  4A7I A;  1IQM L;  1HAF A;  3MQE A;  2P94 L;  1BF9 A;  3LTG D;  3MDL A;  2J94 B;  2KV4 A;  1APO A;  4Z0K B;  1TLE A;  1IOX A;  2UWO B;  3KRK A;  4AQT A;  5JVZ A;  3K9X A;  2MGR A;  4D0E A;  3N8Y B;  4Y79 B;  3GIS X;  2Y7Z B;  1Z6C A;  2BOH A;  4RRX A;  2WPM E;  3GCX E;  2YGO A;  5E8D A;  1PRH A;  4G1M B;  3HS6 A;  3ZYJ B;  1LMM A;  2P3T A;  3KL6 B;  1IQH L;  3OLT A;  1Z6E L;  3GCW E;  3KK6 A;  4PH9 A;  3RR3 A;  1PTH A;  1EPG A;  4D0F A;  1IVO C;  4ZXY L;  4X8T L;  2W2O E;  5F19 A;  3KCG L;  1GK5 A;  3NTB A;  2W86 A;  1PGE A;  1DQB A;  2KNI A;  1MOX C;  3SOQ A;  1P0S L;  4O1Z A;  1YO8 A;  1HRF A;  2P95 L;  4NGA L;  2G00 L;  5CKM A;  2VWL L;  2WG3 C;  2VJ3 A;  1ZAQ A;  1YUG A;  2BQW A;  2CJI B;  3DEM A;  3KQC L;  2JKH L;  1FSB A;  2W26 B;  2DDU A;  3KQB L;  5IKQ A;  4D90 A;  4XBM A;  1NQL B;  4A94 C;  3P5B L;  2VVV L;  2GD4 A;  1L5G B;  5CKQ A;  1SZB A;  2KB9 A;  2BMG A;  3QH0 A;  2W2P E;  1IGZ A;  2UWL B;  3SOV A;  1ADX A;  1L3Y A;  2PUQ L;  1MQ6 L;  1EGF A;  1PXX A;  1CCV A;  1IOE L;  1UZQ A;  2MGP A;  3POY A;  2PHB B;  4Z6A L;  1IQN L;  4Y7A B;  1K37 A;  4JZD L;  1YGC L;  2FD6 A;  2J2U B;  2EI6 B;  1O5D L;  2K2S B;  1IQG L;  1F0S B;  2W2Q E;  4E1G A;  5IKT A;  2WPJ E;  3IIT B;  1EZQ B;  5JB9 E;  1FAK L;  2UWP B;  1KIG L;  2P16 L;  2VVU L;  1DDX A;  1IQJ L;  1ATD A;  2Y38 A;  3TH3 L;  1U8C B;  3Q7D A;  1EBV A;  1JV2 B;  3N8Y A;  1KLJ L;  1YUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...