2WPUA

Chaperoned ruthenium metallodrugs that recognize telomeric dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
122
structure length
122
Chain Sequence
b'DEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Chemo-Genetic Optimization of DNA Recognition by Metallodrugs Using a Presenter-Protein Strategy.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin binding protein
total genus 29
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2wpuA00
2OF8A 2IZHB 2IZJA 1SWDA 3RY1A 4Y59A 2RTPB 3RDSA 3WZNA 1KL3A 1VWHB 3RDMA 4JNJA 3WZQA 3PK2A 2RTHB 3MM0A 1SLDB 1VWPB 1VYOA 3RY2A 1SWJA 1LDQA 3RDUA 1MEPA 1SLEB 3FDCA 1PTSA 4BBOA 4Z2PA 4GGRA 1LCZA 1IJ8A 1LDOA 1RXHA 1LCVA 3T2XA 4Z28A 1SLFB 1SRGA 1SWLA 1VWFB 4GGZA 5B5GA 2FHLA 4BCSA 3T2WA 2RTIB 4GDAA 2A5BA 4Z2VA 2F01A 2IZCB 5K68A 1SWCA 1SWOA 1MM9A 1SWAA 1RSUB 1NQNA 1VWEB 1DF8A 2OFAA 4Z27A 2IZGB 2RTKA 2IZLB 3RE5A 1VWKB 3SZHA 4CPHB 1MOYA 1RAVA 4U46A 4YVBA 1SRIA 1VWJB 1SRJA 2RTMA 1HXZA 4Y5DA 2RTAA 4DNEA 2Y3EA 5CHKA 3RE6A 5IRWA 2RTQB 1SWBA 2RTBB 4IRWA 2IZKA 1SWGA 2JGSA 4BJ8A 1VWBB 4CPFA 1VWGB 1VWQB 1LELA 1LUQA 2IZFB 1HQQA 4JHQA 1WBIA 4BX5B 3X00A 1NDJA 5JD2A 1SRFA 1LCWA 3WYQA 1NQMA 3VHMA 4BX6A 1SREA 2RTCB 4GJSA 3WZOA 4OKAA 4CPHA 3VHHA 1STSB 1KL4A 2C1SA 3VGWA 1SWSA 2GH7A 4GD9A 1STRB 4EKVA 3EW2A 1N9YA 1SWEA 2MF6A 1NBXA 1HXLA 2BC3A 5IRUA 4JO6A 3WYPA 2RTLA 1VWIB 1SWUA 2UYWA 4BX7B 2UZ2A 1NC9A 1SRHA 1Y55X 1SWPA 1SWQA 4CPIA 2CAMA 2RTGB 1SLGB 5IRAA 2RTDB 5L3YA 2WPUA 3SZJA 2Y32A 2C4IA 1VWCB 3MG5A 1STPA 5K67A 4GJVA 1KL5A 3WZPA 2IZEB 5B5FA 2ZSCA 5F2BA 1VWRB 3RDXA 2G5LA 2Y3FA 1N43A 1SWRA 1RSTB 4I60A 3RDQA 4BX7A 1RXJA 1AVEA 2RTOB 2IZAA 1SWKA 1MK5A 1N4JA 2RTRB 1KFFA 1RXKA 1VWMB 3VHIA 1N7YA 3T6FA 1HY2A 1N9MA 1SWTA 1Y52X 2IZBA 2QCBA 4GGTA 1VWDB 3RDOA 5CSEA 1Y53X 1VWNB 2FHNX 1SWNA 2IZIA 3EW1A 3SZIA 2A5CA 1SWFA 4BX5A 1VWOB 1VWLB 1AVDA 2AVIA 1VWAB 2C1QA 4CPEA 4Z2OA 2RTNB 2RTJA 1SWHA 4Z6JA 2RTFB 2A8GA 2IZDB 3T6LA 2RTEB 2OFBA 2OF9A 4BX6B 1I9HA
chains in the Genus database with same CATH superfamily
3DSZA 5IXGA 2IZJA 2M4LA 3OJYC 1ZNGA 3FA6A 2RTPB 2OL7A 4YGZA 3LTWA 3VG7A 3WZQA 2OL8O 1GX8A 2AT8X 2L67A 3PEDA 1SLDB 1DC9A 2E4JA 1LDQA 2O62A 4BBOA 1TW4A 2MO5A 2VFBA 1MX7A 1QFVA 1LCVA 1RXHA 2AKQA 1N0SA 1X71A 3FIDA 2OYBO 1JYJA 3RSWA 4AZQA 4HPAA 4D6AA 2FHLA 5B11O 4BCSA 3T2WA 1HMRA 1KGLA 3D4RA 4Z2VA 3Q34A 2F01A 5LJBA 1KT7A 3AKMA 1P6PA 1LIEA 1SWOA 4K19A 1UYOX 2L68A 1KT3A 4DQ3A 3Q6LA 2WQAE 1GXAA 3P6FA 3B2LA 2OFAA 1PEEA 5BVTA 2HKDA 2K62A 1U0XA 4YKMA 3WVMA 1EUOA 5HCCC 1GM6A 4DQ4A 2WWPA 4MVLA 3ZUIA 4U46A 1IKEA 1E2TA 2HZQA 1SXUA 2RTMA 3HWFA 1SRJA 4D6BA 3CKGA 3EM0A 3KFHA 3ZW0A 2Q2MA 3ZQ3A 4BGFA 5CHKA 2WEXA 2XSTA 3RE6A 2QOMA 4O3ZA 1S2PA 1RLBE 1A18A 2PI3O 1OEKA 2RTBB 1B8EA 3BS2A 3HWGA 3I0AA 1VPRA 4ORRA 1WUBA 1HMTA 4NLJA 2GTFX 4QAEA 1LUQA 2MJIA 2RN4A 4MVKA 4KIIA 3U9PC 1WBIA 2X55A 1NDJA 2W2BA 5JD2A 5B29A 1X8PA 4GETA 2BHVA 2WUTA 1BSYA 4GJSA 4O4XA 1HBQA 4CSBA 3KQ0A 2AMMX 3EBWA 2MWHA 3MX7A 5HZ6A 3VGWA 4AZMA 5BVQA 3OE3A 4GD9A 5IO5A 1T8VA 2LFOA 1IIUA 1KXOA 1X89A 2MF6A 4HPCA 4QZUA 2BS5A 1W6FA 3FMZA 2EU7X 4ALBA 1GT4A 2ACPX 1DV9A 4BX7B 2UZ2A 1NC9A 1SWQA 3LHNA 3FA7A 1FEMA 5KICA 1OBPA 1KOIA 1JBHA 3TZSA 2RTGB 2CM9A 4YCHA 2HLVA 1QY0A 3VE1A 1BSOA 1ICNA 1LFOA 1L6MA 1LPJA 1S7DA 3FYFA 3NQKA 4TNNA 4ML7B 3SZJA 2FR3A 1B56A 2FKJA 1EPAA 1GKAA 3NADA 2RCQA 4GJVA 4RUNA 2OVDA 1TOWA 5LJHA 1T0VA 1SXXA 1N43A 3VU1A 4NYRA 2DM5A 1PBYA 1MK5A 1N4JA 3O2YA 3QKGA 1N7YA 1HY2A 4Y0SA 4GDZA 1RBPA 3BU1A 2G78A 3MBTA 2AH7X 1GX9A 5HCEC 2FHNX 2XKLA 1U17A 2IZIA 2RQ0A 2A5CA 1SWFA 1DZMA 2G79A 4IB6A 4A60A 1VWOB 1B4MA 1BM5A 1AVDA 4QGVA 2OVSA 3F6ZB 3VE2A 2X56A 3P24A 4BQUA 2FTBA 3RWXA 1NP4A 2RTFB 3OBLA 3STKA 2AT3X 4DCBA 1OPBA 4EXZA 5BYPA 3T6LA 5EZ2A 4IB7A 1X8QA 1QY1A 2OFBA 3S5VA 4IAWA 5FAZA 3S26A 1A2DA 1SWDA 4QGWA 3ZW2A 4EQAC 1I4UA 3RDSA 1LF7A 1KL3A 5EEEA 3P6HA 4O4OA 3SOTA 4Y0PA 4ORWA 5L8IA 2VFCA 2RTHB 3MM0A 1VWPB 1W5RA 1VYOA 1ALBA 1SWJA 3RY2A 2FS6A 4GRJA 4NP1A 1SLEB 2LA7A 4UU3A 1HMSA 4GGRA 1IJ8A 1ML7A 4O3XB 5DPQA 5HTEA 2WR6A 1YWBA 1CBRA 4IABA 3WJBA 1SLFB 1SRGA 1SWLA 4IB8A 2R74A 4GGZA 2OFMX 2X4MA 4AZOA 3P6DA 1YP6A 4KC7A 5BVSA 4GDAA 1FTPA 3LV4A 2LBVA 1SY1A 3BLGA 2A2GA 2ACOA 3NP1A 4ORUA 3I17A 1VWEB 1DF8A 3C78X 4YDBA 4IB9A 4GH7A 4Z27A 2X46A 5C0NA 5CE4A 2OY1O 4A1HA 2CM4A 2L5PA 4IAXA 3RE5A 3D9WA 1VWKB 4CPHB 5EDBA 5AQ6A 4A1YA 1RAVA 4YVBA 1SY3A 1GKAB 4YFRA 1SRIA 2JU8A 5LJKA 1HXZA 1JYDA 3CBCA 3D96A 4MVEA 4Y5DA 1IFBA 1SMPI 2Y3EA 3E3CA 1SY2A 2KW1A 3AKNA 3NX2A 4MEEA 5HZQA 1SWBA 4ZGUA 3TGBA 1HBPA 2IZKA 4IRWA 1SWGA 1ZNDA 4BJ8A 2AL0X 2X8TA 5D8JA 3FEPA 1W4TA 3NBXX 4GE1A 5F6ZA 3PH6A 3HOLA 2FLJA 3JS1A 1CBIA 4NW4A 2KTSA 1X8UA 4ZHFA 2FS7A 1E02A 2VDFA 5KIDA 1FENA 1R0UA 1TOUA 4TKBA 3BU9A 3VHMA 1Y9TA 2RTCB 3WZOA 5D45A 4AW8A 4I3CA 4PJ2A 1K3BA 1ICMA 4YFPA 3ZWEA 1BRQA 5FQ7E 5H9LA 1Z24A 1AVGI 1QQSA 5AJCA 3FR4A 2Q2PA 4EKVA 5FFHA 1EI5A 1HN2A 2RD7C 3FW4A 4O49A 2FGSA 1NP1A 3UAQA 1JMXA 4AZRA 5IRUA 5IO6A 1EIIA 3VG3A 2RTLA 1EW3A 1AQBA 3CWKA 3APVA 4XMHA 2RCTA 1Y9LA 4YCEA 1X8NA 3BY0A 4ODDA 3ZUOA 3HPEA 1D2UA 2Q4NA 3HTYA 4O3YA 2Q9SA 1BLRA 4GNWA 1JJJA 5IRAA 3VG2A 2LKKA 5L8OA 5HZ9A 1S44A 5HWZA 4WFUA 2GTLN 2WPUA 1O1UA 4ORXA 2QO6A 4WBKA 2C4IA 3WOVA 1QWDA 4LZVA 4TJZA 2LB6A 3PQUA 4GNYA 1LIFA 5K06A 5K67A 3WZPA 1KL5A 2IZEB 3U03A 4R0BA 3WJEA 4KH8A 3N91A 1EQDA 2G5LA 5H9KA 2Y3FA 2DJFA 4I60A 1SWRA 1RXJA 1IFCA 1VYGA 2DJGA 1CBSA 1I04A 3CKFA 4IMOA 2IZAA 4TQ2A 3VHIA 1RXKA 2QO4A 1VWMB 2F73A 4OMXA 3FW5A 3BRNA 3SAOA 2QCBA 2OL6O 1LICA 4OMWA 5CSEA 4YGHA 1PMPA 1Y53X 4EDEA 4WHIA 4ZCBA 4L1NA 2I5ZO 1YP7A 1YWAA 1T68X 4FGIB 5HTDA 4XMFA 2AVIA 1VWAB 1PM1X 2BT9A 2RTNB 3S60A 4NV8A 4Z2OA 5B10O 1JJXA 4OEMA 3ELZA 3TGAA 3HWEA 4OS8A 5HCDC 4I3BA 2IZDB 2CZUA 3STMX 3WJCA 2RTEB 3CR6A 2OF9A 4GGTA 3SLTA 3ZZVA 4ZHDA 1I9HA 1FELA 2OF8A 2G7BA 4JGLA 3RY1A 2KTDA 4Y59A 3WXQA 2MHDA 3KFGA 3WZNA 1VWHB 4IMNA 3P6GA 1ACDA 3RDMA 2OFRX 2WSJA 1KQXA 4JNJA 3PK2A 3B2HA 2CZTA 2NNQA 1ERBA 1MEPA 4ARHA 2GTLO 4OELA 4Z2PA 3APXA 4QNIA 5B2AO 3ZW0B 3T2XA 1FJ1E 3VG5A 2A13A 3WJDA 5IO7A 5LKEA 1VWFB 4I3DA 4I6SA 1D3SA 4FQBB 2I5VO 2RTIB 1I06A 1UYNX 2QM9A 4O4UA 1MM9A 3RZYA 4Y0QA 1JV4A 4BVMA 1HQPA 1NQNA 2BS6A 4ZHHA 4MVIA 1K24A 2AT5X 3O19A 3OD9A 4ON1A 1AELA 4ZHCA 1ZNLA 2IZLB 2JOZA 3AUMO 3SZHA 1TVQA 3FENA 1VWJB 4KT5A 1EALA 1EXSA 2JMBA 2RTAA 3NQ9A 4U3QA 1MDCA 1GX3A 5IRWA 4NNTA 3UEVA 1SA8A 3C76X 4NV7A 4ORYA 4ALOA 3P6EA 5CYBA 4CPFA 1VWGB 1KT5A 1VWQB 3VPJE 2ASNX 4XMDA 2FWVA 2GTLM 2HZRA 3D97A 1IW2A 4JHQA 1AB0A 4LKTA 1B0OA 4CK4A 3X00A 4MIRA 3WYQA 1NQMA 1MVGA 1SREA 2ANSA 4UU2A 3S5XA 3TGCA 1STSB 1KL4A 2C1SA 2A2UA 5L8NA 2GH7A 2W2AA 1STRB 4OS0A 4KC8A 1N9YA 1QY2A 2PY1A 4U9CA 1H91A 3QQ2A 3FR2A 2BC3A 1G5WA 1LNMA 3WYPA 5F6BA 1VWIB 3DTQA 1ZRYA 5HAEA 2UYWA 4GK9A 1GGLA 3CMPA 4L3RA 2X34A 2X32A 1SRHA 1Y55X 2QOSC 1SWPA 4CPIA 1A57A 5LJCA 3RBYA 1QG5A 4ZGFA 4XMCA 2CAMA 1BBPA 1SXWA 4LQZA 4GUZA 4O3WA 1SLGB 1DF3A 2RTDB 4NYQA 5LKFA 4YH0A 4BOEA 1BEBA 2CBRA 3UEWA 1JQPA 3G7XA 2Y32A 5AJBA 3FLLA 2NNDA 3VG6A 4YDAA 4ES7A 1VWCB 5B27A 2OY7A 1G85A 5B5FA 5F2BA 3K3LA 3RDXA 3FR5A 4IBAA 1ZNEA 3IFBA 1RSTB 4BX7A 5B3MO 3PP6A 3WBGA 1AVEA 1ERXA 4INNA 1YWCA 2RTRB 2ZAGA 3CBSA 4MISA 4XMEA 5HA1A 3MVFA 5F1EA 3CQRA 5LJDA 1E5PA 1N9MA 2POAA 1SWTA 2IZBA 2LBAA 3BDRA 4M6SA 3P6CA 4N7DA 5EDCA 3KFIA 3H3IA 3EW1A 1JIWI 1SWNA 4N7CA 3JSQA 4BX5A 1MUPA 2OVAA 3WJFA 2HNXA 1VWLB 1XKIA 1JMZA 2C1QA 3IA8A 5H8TA 2HMBA 2RTJA 4RUUA 4QYPA 2WEWA 2A8GA 1YWDA 2BSZA 4ZH9A 5F58A 1YUPA 4AYHA 2IZHB 3ZI8A 3EMMA 4ZHGA 2OY8A 2WQ9A 3EBKA 3FIQA 2X8FA 1KZXA 3NPOA 4CV7A 3APUA 3B2KA 3PECA 2MM3A 5H9AA 2OY5O 1BSQA 4I9SA 3RDUA 4COTA 3FDCA 1PTSA 1CBQA 3FA8A 4XMGA 1LIBA 1LCZA 3O22A 4HWMA 1GT3A 4ORSA 5HBSA 3PQSA 1LDOA 5FQ8E 3B2JA 4YFQA 1O1VA 2Z4IA 4Z28A 5HZ8A 2JW1A 3ZW1A 2YG2A 3HK1A 5B5GA 5D48A 3HOEA 4ZFXA 3GE2A 4FBVA 4I95A 1G7NA 1JZUA 2A5BA 2CBSA 3HWDA 2IZCB 3NX1A 2AT0X 1SWCA 1U18A 2FR2A 1SWAA 2HYSA 2JU7A 5K68A 3RKGA 1KT6A 4EFGA 1RSUB 3B2IA 1EIOA 2JN3A 5LJEA 1ADLA 1MX8A 1SY0A 5LJGA 3BSZE 3L4RA 1LKEA 2IZGB 2RTKA 4HPDA 4QQ1A 3EC5A 3PDFA 4QZTA 4U8UN 3SLOA 1GT1A 1IKJA 4Y0RA 1MOYA 4QGXA 3BX7A 4C5PA 2NP1A 2JU3A 4TLJA 3VG4A 4YBPA 1CJ5A 4KCAA 3WJGA 4DNEA 2X45A 1G74A 1DFVA 1VYFA 4TKHA 2RTQB 3JQOA 4ZH6A 1Y0GA 5AEOA 4QRLA 2AT6X 2JGSA 2NNEA 2K23A 4YMYA 1VWBB 1OEEA 1ZNKA 1LELA 2IZFB 1HQQA 1CRBA 2AF5A 3BX8A 1OEJA 1BJ7A 5HA0A 2Q39A 3U0DA 4BX5B 1ZNHA 1FE3A 3ELXA 3EYCA 1SRFA 1LCWA 2OZQA 4BX6A 3C77X 4CPHA 4NLIA 2KD2A 4OKAA 1BWYA 4LZUA 3P02A 3FEKA 4PSQA 5D47A 3VHHA 1A3YA 1UZ2X 4OS3A 1PBOA 4YKOA 3CQNA 1DZKA 1SWSA 4ZJ0A 1SXYA 3EW2A 1SWEA 2GJ5A 4YGGA 5KHPA 1LIDA 1HXLA 1NBXA 3KVNA 4JO6A 1FDQA 4A8ZA 1E00A 2R73A 3PPTA 4HFOA 4AZPA 1SWUA 2W2FA 3GAQA 4ID2A 1O8VA 2G8CO 2A0AA 1I05A 4CDDA 2R56A 1E06A 3KFFA 5D4AA 4WFVA 1KT4A 1EPBA 3KZAA 3T1DA 4CDFA 3D95A 4M7MA 4HPBA 2OVEA 2P8GA 4U8UO 2N93A 1DZJA 3V8UA 4EEJA 2L9CA 1JJUA 3AEHA 4GZVA 2Z4HA 5DG4A 2GC9A 3SLJA 2RA6A 4B55A 4CDEA 5L3YA 2A3FX 3ZW1B 1QFTA 4GKCA 1UREA 3FA9A 3FELA 5EEDA 3NR3A 2F09A 4FBOA 3PH5A 2ZAIA 1BRPA 3F8AA 1STPA 1OBQA 2YMSA 3MG5A 1NGLA 5H9NA 2X8SA 4NNSA 2FT9A 2ZSCA 4O9SA 1TXLA 1VWRB 4TKJA 3STNA 3TF6A 2BLGA 4FBRA 4O4SA 3UEUA 3RDQA 4AZNA 4ZR2A 2IFBA 4CDCA 1GT5A 2RTOB 1KZWA 1SWKA 3T6FA 1KFFA 1X8OA 3F9DA 4I9RA 2QO5A 1XCAA 4YBUA 5JR8A 1OBUA 5HZ5A 1Y52X 4LKPA 3RDOA 1VWDB 5F7GA 2QMIA 1OSPO 1VWNB 2ALLX 5FQ6E 3SZIA 1KQWA 1YIVA 1QABE 2FRSA 3NQ3A 3UEXA 4CPEA 5FENA 4QYNA 1I78A 1SWHA 1DZPA 2KT4B 4Z6JA 4U8UM 5EPQA 4GU8A 2FKGA 4BX6B 3APWA 1OPAA
chains in the Genus database with same CATH topology
2OF8A 2IZHB 2IZJA 1SWDA 3RY1A 4Y59A 2RTPB 3RDSA 3WZNA 1KL3A 1VWHB 3RDMA 4JNJA 3WZQA 3PK2A 2RTHB 3MM0A 1SLDB 1VWPB 1VYOA 3RY2A 1SWJA 1LDQA 3RDUA 1MEPA 1SLEB 3FDCA 1PTSA 4BBOA 4Z2PA 4GGRA 1LCZA 1IJ8A 1LDOA 1RXHA 1LCVA 3T2XA 4Z28A 1SLFB 1SRGA 1SWLA 1VWFB 4GGZA 5B5GA 2FHLA 4BCSA 3T2WA 2RTIB 4GDAA 2A5BA 4Z2VA 2F01A 2IZCB 5K68A 1SWCA 1SWOA 1MM9A 1SWAA 1RSUB 1NQNA 1VWEB 1DF8A 2OFAA 4Z27A 2IZGB 2RTKA 2IZLB 3RE5A 1VWKB 3SZHA 4CPHB 1MOYA 1RAVA 4U46A 4YVBA 1SRIA 1VWJB 1SRJA 2RTMA 1HXZA 4Y5DA 2RTAA 4DNEA 2Y3EA 5CHKA 3RE6A 5IRWA 2RTQB 1SWBA 2RTBB 4IRWA 2IZKA 1SWGA 2JGSA 4BJ8A 1VWBB 4CPFA 1VWGB 1VWQB 1LELA 1LUQA 2IZFB 1HQQA 4JHQA 1WBIA 4BX5B 3X00A 1NDJA 5JD2A 1SRFA 1LCWA 3WYQA 1NQMA 3VHMA 4BX6A 1SREA 2RTCB 4GJSA 3WZOA 4OKAA 4CPHA 3VHHA 1STSB 1KL4A 2C1SA 3VGWA 1SWSA 2GH7A 4GD9A 1STRB 4EKVA 3EW2A 1N9YA 1SWEA 2MF6A 1NBXA 1HXLA 2BC3A 5IRUA 4JO6A 3WYPA 2RTLA 1VWIB 1SWUA 2UYWA 4BX7B 2UZ2A 1NC9A 1SRHA 1Y55X 1SWPA 1SWQA 4CPIA 2CAMA 2RTGB 1SLGB 5IRAA 2RTDB 5L3YA 2WPUA 3SZJA 2Y32A 2C4IA 1VWCB 3MG5A 1STPA 5K67A 4GJVA 1KL5A 3WZPA 2IZEB 5B5FA 2ZSCA 5F2BA 1VWRB 3RDXA 2G5LA 2Y3FA 1N43A 1SWRA 1RSTB 4I60A 3RDQA 4BX7A 1RXJA 1AVEA 2RTOB 2IZAA 1SWKA 1MK5A 1N4JA 2RTRB 1KFFA 1RXKA 1VWMB 3VHIA 1N7YA 3T6FA 1HY2A 1N9MA 1SWTA 1Y52X 2IZBA 2QCBA 4GGTA 1VWDB 3RDOA 5CSEA 1Y53X 1VWNB 2FHNX 1SWNA 2IZIA 3EW1A 3SZIA 2A5CA 1SWFA 4BX5A 1VWOB 1VWLB 1AVDA 2AVIA 1VWAB 2C1QA 4CPEA 4Z2OA 2RTNB 2RTJA 1SWHA 4Z6JA 2RTFB 2A8GA 2IZDB 3T6LA 2RTEB 2OFBA 2OF9A 4BX6B 1I9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OF8 A;  2IZH B;  2IZJ A;  1SWD A;  3RY1 A;  4Y59 A;  2RTP B;  3RDS A;  3WZN A;  1KL3 A;  1VWH B;  3RDM A;  4JNJ A;  3WZQ A;  3PK2 A;  2RTH B;  3MM0 A;  1SLD B;  1VWP B;  1VYO A;  3RY2 A;  1SWJ A;  1LDQ A;  3RDU A;  1MEP A;  1SLE B;  3FDC A;  1PTS A;  4BBO A;  4Z2P A;  4GGR A;  1LCZ A;  1IJ8 A;  1LDO A;  1RXH A;  1LCV A;  3T2X A;  4Z28 A;  1SLF B;  1SRG A;  1SWL A;  1VWF B;  4GGZ A;  5B5G A;  2FHL A;  4BCS A;  3T2W A;  2RTI B;  4GDA A;  2A5B A;  4Z2V A;  2F01 A;  2IZC B;  5K68 A;  1SWC A;  1SWO A;  1MM9 A;  1SWA A;  1RSU B;  1NQN A;  1VWE B;  1DF8 A;  2OFA A;  4Z27 A;  2IZG B;  2RTK A;  2IZL B;  3RE5 A;  1VWK B;  3SZH A;  4CPH B;  1MOY A;  1RAV A;  4U46 A;  4YVB A;  1SRI A;  1VWJ B;  1SRJ A;  2RTM A;  1HXZ A;  4Y5D A;  2RTA A;  4DNE A;  2Y3E A;  5CHK A;  3RE6 A;  5IRW A;  2RTQ B;  1SWB A;  2RTB B;  4IRW A;  2IZK A;  1SWG A;  2JGS A;  4BJ8 A;  1VWB B;  4CPF A;  1VWG B;  1VWQ B;  1LEL A;  1LUQ A;  2IZF B;  1HQQ A;  4JHQ A;  1WBI A;  4BX5 B;  3X00 A;  1NDJ A;  5JD2 A;  1SRF A;  1LCW A;  3WYQ A;  1NQM A;  3VHM A;  4BX6 A;  1SRE A;  2RTC B;  4GJS A;  3WZO A;  4OKA A;  4CPH A;  3VHH A;  1STS B;  1KL4 A;  2C1S A;  3VGW A;  1SWS A;  2GH7 A;  4GD9 A;  1STR B;  4EKV A;  3EW2 A;  1N9Y A;  1SWE A;  2MF6 A;  1NBX A;  1HXL A;  2BC3 A;  5IRU A;  4JO6 A;  3WYP A;  2RTL A;  1VWI B;  1SWU A;  2UYW A;  4BX7 B;  2UZ2 A;  1NC9 A;  1SRH A;  1Y55 X;  1SWP A;  1SWQ A;  4CPI A;  2CAM A;  2RTG B;  1SLG B;  5IRA A;  2RTD B;  5L3Y A;  2WPU A;  3SZJ A;  2Y32 A;  2C4I A;  1VWC B;  3MG5 A;  1STP A;  5K67 A;  4GJV A;  1KL5 A;  3WZP A;  2IZE B;  5B5F A;  2ZSC A;  5F2B A;  1VWR B;  3RDX A;  2G5L A;  2Y3F A;  1N43 A;  1SWR A;  1RST B;  4I60 A;  3RDQ A;  4BX7 A;  1RXJ A;  1AVE A;  2RTO B;  2IZA A;  1SWK A;  1MK5 A;  1N4J A;  2RTR B;  1KFF A;  1RXK A;  1VWM B;  3VHI A;  1N7Y A;  3T6F A;  1HY2 A;  1N9M A;  1SWT A;  1Y52 X;  2IZB A;  2QCB A;  4GGT A;  1VWD B;  3RDO A;  5CSE A;  1Y53 X;  1VWN B;  2FHN X;  1SWN A;  2IZI A;  3EW1 A;  3SZI A;  2A5C A;  1SWF A;  4BX5 A;  1VWO B;  1VWL B;  1AVD A;  2AVI A;  1VWA B;  2C1Q A;  4CPE A;  4Z2O A;  2RTN B;  2RTJ A;  1SWH A;  4Z6J A;  2RTF B;  2A8G A;  2IZD B;  3T6L A;  2RTE B;  2OFB A;  2OF9 A;  4BX6 B;  1I9H A; 
#chains in the Genus database with same CATH topology
 3DSZ A;  5IXG A;  2IZJ A;  2M4L A;  3OJY C;  1ZNG A;  3FA6 A;  2RTP B;  2OL7 A;  4YGZ A;  3LTW A;  3VG7 A;  3WZQ A;  2OL8 O;  1GX8 A;  2AT8 X;  2L67 A;  3PED A;  1SLD B;  1DC9 A;  2E4J A;  1LDQ A;  2O62 A;  4BBO A;  1TW4 A;  2MO5 A;  2VFB A;  1MX7 A;  1QFV A;  1LCV A;  1RXH A;  2AKQ A;  1N0S A;  1X71 A;  3FID A;  2OYB O;  1JYJ A;  3RSW A;  4AZQ A;  4HPA A;  4D6A A;  2FHL A;  5B11 O;  4BCS A;  3T2W A;  1HMR A;  1KGL A;  3D4R A;  4Z2V A;  3Q34 A;  2F01 A;  5LJB A;  1KT7 A;  3AKM A;  1P6P A;  1LIE A;  1SWO A;  4K19 A;  1UYO X;  2L68 A;  1KT3 A;  4DQ3 A;  3Q6L A;  2WQA E;  1GXA A;  3P6F A;  3B2L A;  2OFA A;  1PEE A;  5BVT A;  2HKD A;  2K62 A;  1U0X A;  4YKM A;  3WVM A;  1EUO A;  5HCC C;  1GM6 A;  4DQ4 A;  2WWP A;  4MVL A;  3ZUI A;  4U46 A;  1IKE A;  1E2T A;  2HZQ A;  1SXU A;  2RTM A;  3HWF A;  1SRJ A;  4D6B A;  3CKG A;  3EM0 A;  3KFH A;  3ZW0 A;  2Q2M A;  3ZQ3 A;  4BGF A;  5CHK A;  2WEX A;  2XST A;  3RE6 A;  2QOM A;  4O3Z A;  1S2P A;  1RLB E;  1A18 A;  2PI3 O;  1OEK A;  2RTB B;  1B8E A;  3BS2 A;  3HWG A;  3I0A A;  1VPR A;  4ORR A;  1WUB A;  1HMT A;  4NLJ A;  2GTF X;  4QAE A;  1LUQ A;  2MJI A;  2RN4 A;  4MVK A;  4KII A;  3U9P C;  1WBI A;  2X55 A;  1NDJ A;  2W2B A;  5JD2 A;  5B29 A;  1X8P A;  4GET A;  2BHV A;  2WUT A;  1BSY A;  4GJS A;  4O4X A;  1HBQ A;  4CSB A;  3KQ0 A;  2AMM X;  3EBW A;  2MWH A;  3MX7 A;  5HZ6 A;  3VGW A;  4AZM A;  5BVQ A;  3OE3 A;  4GD9 A;  5IO5 A;  1T8V A;  2LFO A;  1IIU A;  1KXO A;  1X89 A;  2MF6 A;  4HPC A;  4QZU A;  2BS5 A;  1W6F A;  3FMZ A;  2EU7 X;  4ALB A;  1GT4 A;  2ACP X;  1DV9 A;  4BX7 B;  2UZ2 A;  1NC9 A;  1SWQ A;  3LHN A;  3FA7 A;  1FEM A;  5KIC A;  1OBP A;  1KOI A;  1JBH A;  3TZS A;  2RTG B;  2CM9 A;  4YCH A;  2HLV A;  1QY0 A;  3VE1 A;  1BSO A;  1ICN A;  1LFO A;  1L6M A;  1LPJ A;  1S7D A;  3FYF A;  3NQK A;  4TNN A;  4ML7 B;  3SZJ A;  2FR3 A;  1B56 A;  2FKJ A;  1EPA A;  1GKA A;  3NAD A;  2RCQ A;  4GJV A;  4RUN A;  2OVD A;  1TOW A;  5LJH A;  1T0V A;  1SXX A;  1N43 A;  3VU1 A;  4NYR A;  2DM5 A;  1PBY A;  1MK5 A;  1N4J A;  3O2Y A;  3QKG A;  1N7Y A;  1HY2 A;  4Y0S A;  4GDZ A;  1RBP A;  3BU1 A;  2G78 A;  3MBT A;  2AH7 X;  1GX9 A;  5HCE C;  2FHN X;  2XKL A;  1U17 A;  2IZI A;  2RQ0 A;  2A5C A;  1SWF A;  1DZM A;  2G79 A;  4IB6 A;  4A60 A;  1VWO B;  1B4M A;  1BM5 A;  1AVD A;  4QGV A;  2OVS A;  3F6Z B;  3VE2 A;  2X56 A;  3P24 A;  4BQU A;  2FTB A;  3RWX A;  1NP4 A;  2RTF B;  3OBL A;  3STK A;  2AT3 X;  4DCB A;  1OPB A;  4EXZ A;  5BYP A;  3T6L A;  5EZ2 A;  4IB7 A;  1X8Q A;  1QY1 A;  2OFB A;  3S5V A;  4IAW A;  5FAZ A;  3S26 A;  1A2D A;  1SWD A;  4QGW A;  3ZW2 A;  4EQA C;  1I4U A;  3RDS A;  1LF7 A;  1KL3 A;  5EEE A;  3P6H A;  4O4O A;  3SOT A;  4Y0P A;  4ORW A;  5L8I A;  2VFC A;  2RTH B;  3MM0 A;  1VWP B;  1W5R A;  1VYO A;  1ALB A;  1SWJ A;  3RY2 A;  2FS6 A;  4GRJ A;  4NP1 A;  1SLE B;  2LA7 A;  4UU3 A;  1HMS A;  4GGR A;  1IJ8 A;  1ML7 A;  4O3X B;  5DPQ A;  5HTE A;  2WR6 A;  1YWB A;  1CBR A;  4IAB A;  3WJB A;  1SLF B;  1SRG A;  1SWL A;  4IB8 A;  2R74 A;  4GGZ A;  2OFM X;  2X4M A;  4AZO A;  3P6D A;  1YP6 A;  4KC7 A;  5BVS A;  4GDA A;  1FTP A;  3LV4 A;  2LBV A;  1SY1 A;  3BLG A;  2A2G A;  2ACO A;  3NP1 A;  4ORU A;  3I17 A;  1VWE B;  1DF8 A;  3C78 X;  4YDB A;  4IB9 A;  4GH7 A;  4Z27 A;  2X46 A;  5C0N A;  5CE4 A;  2OY1 O;  4A1H A;  2CM4 A;  2L5P A;  4IAX A;  3RE5 A;  3D9W A;  1VWK B;  4CPH B;  5EDB A;  5AQ6 A;  4A1Y A;  1RAV A;  4YVB A;  1SY3 A;  1GKA B;  4YFR A;  1SRI A;  2JU8 A;  5LJK A;  1HXZ A;  1JYD A;  3CBC A;  3D96 A;  4MVE A;  4Y5D A;  1IFB A;  1SMP I;  2Y3E A;  3E3C A;  1SY2 A;  2KW1 A;  3AKN A;  3NX2 A;  4MEE A;  5HZQ A;  1SWB A;  4ZGU A;  3TGB A;  1HBP A;  2IZK A;  4IRW A;  1SWG A;  1ZND A;  4BJ8 A;  2AL0 X;  2X8T A;  5D8J A;  3FEP A;  1W4T A;  3NBX X;  4GE1 A;  5F6Z A;  3PH6 A;  3HOL A;  2FLJ A;  3JS1 A;  1CBI A;  4NW4 A;  2KTS A;  1X8U A;  4ZHF A;  2FS7 A;  1E02 A;  2VDF A;  5KID A;  1FEN A;  1R0U A;  1TOU A;  4TKB A;  3BU9 A;  3VHM A;  1Y9T A;  2RTC B;  3WZO A;  5D45 A;  4AW8 A;  4I3C A;  4PJ2 A;  1K3B A;  1ICM A;  4YFP A;  3ZWE A;  1BRQ A;  5FQ7 E;  5H9L A;  1Z24 A;  1AVG I;  1QQS A;  5AJC A;  3FR4 A;  2Q2P A;  4EKV A;  5FFH A;  1EI5 A;  1HN2 A;  2RD7 C;  3FW4 A;  4O49 A;  2FGS A;  1NP1 A;  3UAQ A;  1JMX A;  4AZR A;  5IRU A;  5IO6 A;  1EII A;  3VG3 A;  2RTL A;  1EW3 A;  1AQB A;  3CWK A;  3APV A;  4XMH A;  2RCT A;  1Y9L A;  4YCE A;  1X8N A;  3BY0 A;  4ODD A;  3ZUO A;  3HPE A;  1D2U A;  2Q4N A;  3HTY A;  4O3Y A;  2Q9S A;  1BLR A;  4GNW A;  1JJJ A;  5IRA A;  3VG2 A;  2LKK A;  5L8O A;  5HZ9 A;  1S44 A;  5HWZ A;  4WFU A;  2GTL N;  2WPU A;  1O1U A;  4ORX A;  2QO6 A;  4WBK A;  2C4I A;  3WOV A;  1QWD A;  4LZV A;  4TJZ A;  2LB6 A;  3PQU A;  4GNY A;  1LIF A;  5K06 A;  5K67 A;  3WZP A;  1KL5 A;  2IZE B;  3U03 A;  4R0B A;  3WJE A;  4KH8 A;  3N91 A;  1EQD A;  2G5L A;  5H9K A;  2Y3F A;  2DJF A;  4I60 A;  1SWR A;  1RXJ A;  1IFC A;  1VYG A;  2DJG A;  1CBS A;  1I04 A;  3CKF A;  4IMO A;  2IZA A;  4TQ2 A;  3VHI A;  1RXK A;  2QO4 A;  1VWM B;  2F73 A;  4OMX A;  3FW5 A;  3BRN A;  3SAO A;  2QCB A;  2OL6 O;  1LIC A;  4OMW A;  5CSE A;  4YGH A;  1PMP A;  1Y53 X;  4EDE A;  4WHI A;  4ZCB A;  4L1N A;  2I5Z O;  1YP7 A;  1YWA A;  1T68 X;  4FGI B;  5HTD A;  4XMF A;  2AVI A;  1VWA B;  1PM1 X;  2BT9 A;  2RTN B;  3S60 A;  4NV8 A;  4Z2O A;  5B10 O;  1JJX A;  4OEM A;  3ELZ A;  3TGA A;  3HWE A;  4OS8 A;  5HCD C;  4I3B A;  2IZD B;  2CZU A;  3STM X;  3WJC A;  2RTE B;  3CR6 A;  2OF9 A;  4GGT A;  3SLT A;  3ZZV A;  4ZHD A;  1I9H A;  1FEL A;  2OF8 A;  2G7B A;  4JGL A;  3RY1 A;  2KTD A;  4Y59 A;  3WXQ A;  2MHD A;  3KFG A;  3WZN A;  1VWH B;  4IMN A;  3P6G A;  1ACD A;  3RDM A;  2OFR X;  2WSJ A;  1KQX A;  4JNJ A;  3PK2 A;  3B2H A;  2CZT A;  2NNQ A;  1ERB A;  1MEP A;  4ARH A;  2GTL O;  4OEL A;  4Z2P A;  3APX A;  4QNI A;  5B2A O;  3ZW0 B;  3T2X A;  1FJ1 E;  3VG5 A;  2A13 A;  3WJD A;  5IO7 A;  5LKE A;  1VWF B;  4I3D A;  4I6S A;  1D3S A;  4FQB B;  2I5V O;  2RTI B;  1I06 A;  1UYN X;  2QM9 A;  4O4U A;  1MM9 A;  3RZY A;  4Y0Q A;  1JV4 A;  4BVM A;  1HQP A;  1NQN A;  2BS6 A;  4ZHH A;  4MVI A;  1K24 A;  2AT5 X;  3O19 A;  3OD9 A;  4ON1 A;  1AEL A;  4ZHC A;  1ZNL A;  2IZL B;  2JOZ A;  3AUM O;  3SZH A;  1TVQ A;  3FEN A;  1VWJ B;  4KT5 A;  1EAL A;  1EXS A;  2JMB A;  2RTA A;  3NQ9 A;  4U3Q A;  1MDC A;  1GX3 A;  5IRW A;  4NNT A;  3UEV A;  1SA8 A;  3C76 X;  4NV7 A;  4ORY A;  4ALO A;  3P6E A;  5CYB A;  4CPF A;  1VWG B;  1KT5 A;  1VWQ B;  3VPJ E;  2ASN X;  4XMD A;  2FWV A;  2GTL M;  2HZR A;  3D97 A;  1IW2 A;  4JHQ A;  1AB0 A;  4LKT A;  1B0O A;  4CK4 A;  3X00 A;  4MIR A;  3WYQ A;  1NQM A;  1MVG A;  1SRE A;  2ANS A;  4UU2 A;  3S5X A;  3TGC A;  1STS B;  1KL4 A;  2C1S A;  2A2U A;  5L8N A;  2GH7 A;  2W2A A;  1STR B;  4OS0 A;  4KC8 A;  1N9Y A;  1QY2 A;  2PY1 A;  4U9C A;  1H91 A;  3QQ2 A;  3FR2 A;  2BC3 A;  1G5W A;  1LNM A;  3WYP A;  5F6B A;  1VWI B;  3DTQ A;  1ZRY A;  5HAE A;  2UYW A;  4GK9 A;  1GGL A;  3CMP A;  4L3R A;  2X34 A;  2X32 A;  1SRH A;  1Y55 X;  2QOS C;  1SWP A;  4CPI A;  1A57 A;  5LJC A;  3RBY A;  1QG5 A;  4ZGF A;  4XMC A;  2CAM A;  1BBP A;  1SXW A;  4LQZ A;  4GUZ A;  4O3W A;  1SLG B;  1DF3 A;  2RTD B;  4NYQ A;  5LKF A;  4YH0 A;  4BOE A;  1BEB A;  2CBR A;  3UEW A;  1JQP A;  3G7X A;  2Y32 A;  5AJB A;  3FLL A;  2NND A;  3VG6 A;  4YDA A;  4ES7 A;  1VWC B;  5B27 A;  2OY7 A;  1G85 A;  5B5F A;  5F2B A;  3K3L A;  3RDX A;  3FR5 A;  4IBA A;  1ZNE A;  3IFB A;  1RST B;  4BX7 A;  5B3M O;  3PP6 A;  3WBG A;  1AVE A;  1ERX A;  4INN A;  1YWC A;  2RTR B;  2ZAG A;  3CBS A;  4MIS A;  4XME A;  5HA1 A;  3MVF A;  5F1E A;  3CQR A;  5LJD A;  1E5P A;  1N9M A;  2POA A;  1SWT A;  2IZB A;  2LBA A;  3BDR A;  4M6S A;  3P6C A;  4N7D A;  5EDC A;  3KFI A;  3H3I A;  3EW1 A;  1JIW I;  1SWN A;  4N7C A;  3JSQ A;  4BX5 A;  1MUP A;  2OVA A;  3WJF A;  2HNX A;  1VWL B;  1XKI A;  1JMZ A;  2C1Q A;  3IA8 A;  5H8T A;  2HMB A;  2RTJ A;  4RUU A;  4QYP A;  2WEW A;  2A8G A;  1YWD A;  2BSZ A;  4ZH9 A;  5F58 A;  1YUP A;  4AYH A;  2IZH B;  3ZI8 A;  3EMM A;  4ZHG A;  2OY8 A;  2WQ9 A;  3EBK A;  3FIQ A;  2X8F A;  1KZX A;  3NPO A;  4CV7 A;  3APU A;  3B2K A;  3PEC A;  2MM3 A;  5H9A A;  2OY5 O;  1BSQ A;  4I9S A;  3RDU A;  4COT A;  3FDC A;  1PTS A;  1CBQ A;  3FA8 A;  4XMG A;  1LIB A;  1LCZ A;  3O22 A;  4HWM A;  1GT3 A;  4ORS A;  5HBS A;  3PQS A;  1LDO A;  5FQ8 E;  3B2J A;  4YFQ A;  1O1V A;  2Z4I A;  4Z28 A;  5HZ8 A;  2JW1 A;  3ZW1 A;  2YG2 A;  3HK1 A;  5B5G A;  5D48 A;  3HOE A;  4ZFX A;  3GE2 A;  4FBV A;  4I95 A;  1G7N A;  1JZU A;  2A5B A;  2CBS A;  3HWD A;  2IZC B;  3NX1 A;  2AT0 X;  1SWC A;  1U18 A;  2FR2 A;  1SWA A;  2HYS A;  2JU7 A;  5K68 A;  3RKG A;  1KT6 A;  4EFG A;  1RSU B;  3B2I A;  1EIO A;  2JN3 A;  5LJE A;  1ADL A;  1MX8 A;  1SY0 A;  5LJG A;  3BSZ E;  3L4R A;  1LKE A;  2IZG B;  2RTK A;  4HPD A;  4QQ1 A;  3EC5 A;  3PDF A;  4QZT A;  4U8U N;  3SLO A;  1GT1 A;  1IKJ A;  4Y0R A;  1MOY A;  4QGX A;  3BX7 A;  4C5P A;  2NP1 A;  2JU3 A;  4TLJ A;  3VG4 A;  4YBP A;  1CJ5 A;  4KCA A;  3WJG A;  4DNE A;  2X45 A;  1G74 A;  1DFV A;  1VYF A;  4TKH A;  2RTQ B;  3JQO A;  4ZH6 A;  1Y0G A;  5AEO A;  4QRL A;  2AT6 X;  2JGS A;  2NNE A;  2K23 A;  4YMY A;  1VWB B;  1OEE A;  1ZNK A;  1LEL A;  2IZF B;  1HQQ A;  1CRB A;  2AF5 A;  3BX8 A;  1OEJ A;  1BJ7 A;  5HA0 A;  2Q39 A;  3U0D A;  4BX5 B;  1ZNH A;  1FE3 A;  3ELX A;  3EYC A;  1SRF A;  1LCW A;  2OZQ A;  4BX6 A;  3C77 X;  4CPH A;  4NLI A;  2KD2 A;  4OKA A;  1BWY A;  4LZU A;  3P02 A;  3FEK A;  4PSQ A;  5D47 A;  3VHH A;  1A3Y A;  1UZ2 X;  4OS3 A;  1PBO A;  4YKO A;  3CQN A;  1DZK A;  1SWS A;  4ZJ0 A;  1SXY A;  3EW2 A;  1SWE A;  2GJ5 A;  4YGG A;  5KHP A;  1LID A;  1HXL A;  1NBX A;  3KVN A;  4JO6 A;  1FDQ A;  4A8Z A;  1E00 A;  2R73 A;  3PPT A;  4HFO A;  4AZP A;  1SWU A;  2W2F A;  3GAQ A;  4ID2 A;  1O8V A;  2G8C O;  2A0A A;  1I05 A;  4CDD A;  2R56 A;  1E06 A;  3KFF A;  5D4A A;  4WFV A;  1KT4 A;  1EPB A;  3KZA A;  3T1D A;  4CDF A;  3D95 A;  4M7M A;  4HPB A;  2OVE A;  2P8G A;  4U8U O;  2N93 A;  1DZJ A;  3V8U A;  4EEJ A;  2L9C A;  1JJU A;  3AEH A;  4GZV A;  2Z4H A;  5DG4 A;  2GC9 A;  3SLJ A;  2RA6 A;  4B55 A;  4CDE A;  5L3Y A;  2A3F X;  3ZW1 B;  1QFT A;  4GKC A;  1URE A;  3FA9 A;  3FEL A;  5EED A;  3NR3 A;  2F09 A;  4FBO A;  3PH5 A;  2ZAI A;  1BRP A;  3F8A A;  1STP A;  1OBQ A;  2YMS A;  3MG5 A;  1NGL A;  5H9N A;  2X8S A;  4NNS A;  2FT9 A;  2ZSC A;  4O9S A;  1TXL A;  1VWR B;  4TKJ A;  3STN A;  3TF6 A;  2BLG A;  4FBR A;  4O4S A;  3UEU A;  3RDQ A;  4AZN A;  4ZR2 A;  2IFB A;  4CDC A;  1GT5 A;  2RTO B;  1KZW A;  1SWK A;  3T6F A;  1KFF A;  1X8O A;  3F9D A;  4I9R A;  2QO5 A;  1XCA A;  4YBU A;  5JR8 A;  1OBU A;  5HZ5 A;  1Y52 X;  4LKP A;  3RDO A;  1VWD B;  5F7G A;  2QMI A;  1OSP O;  1VWN B;  2ALL X;  5FQ6 E;  3SZI A;  1KQW A;  1YIV A;  1QAB E;  2FRS A;  3NQ3 A;  3UEX A;  4CPE A;  5FEN A;  4QYN A;  1I78 A;  1SWH A;  1DZP A;  2KT4 B;  4Z6J A;  4U8U M;  5EPQ A;  4GU8 A;  2FKG A;  4BX6 B;  3APW A;  1OPA A; 
#chains in the Genus database with same CATH homology
 2OF8 A;  2IZH B;  2IZJ A;  1SWD A;  3RY1 A;  4Y59 A;  2RTP B;  3RDS A;  3WZN A;  1KL3 A;  1VWH B;  3RDM A;  4JNJ A;  3WZQ A;  3PK2 A;  2RTH B;  3MM0 A;  1SLD B;  1VWP B;  1VYO A;  3RY2 A;  1SWJ A;  1LDQ A;  3RDU A;  1MEP A;  1SLE B;  3FDC A;  1PTS A;  4BBO A;  4Z2P A;  4GGR A;  1LCZ A;  1IJ8 A;  1LDO A;  1RXH A;  1LCV A;  3T2X A;  4Z28 A;  1SLF B;  1SRG A;  1SWL A;  1VWF B;  4GGZ A;  5B5G A;  2FHL A;  4BCS A;  3T2W A;  2RTI B;  4GDA A;  2A5B A;  4Z2V A;  2F01 A;  2IZC B;  5K68 A;  1SWC A;  1SWO A;  1MM9 A;  1SWA A;  1RSU B;  1NQN A;  1VWE B;  1DF8 A;  2OFA A;  4Z27 A;  2IZG B;  2RTK A;  2IZL B;  3RE5 A;  1VWK B;  3SZH A;  4CPH B;  1MOY A;  1RAV A;  4U46 A;  4YVB A;  1SRI A;  1VWJ B;  1SRJ A;  2RTM A;  1HXZ A;  4Y5D A;  2RTA A;  4DNE A;  2Y3E A;  5CHK A;  3RE6 A;  5IRW A;  2RTQ B;  1SWB A;  2RTB B;  4IRW A;  2IZK A;  1SWG A;  2JGS A;  4BJ8 A;  1VWB B;  4CPF A;  1VWG B;  1VWQ B;  1LEL A;  1LUQ A;  2IZF B;  1HQQ A;  4JHQ A;  1WBI A;  4BX5 B;  3X00 A;  1NDJ A;  5JD2 A;  1SRF A;  1LCW A;  3WYQ A;  1NQM A;  3VHM A;  4BX6 A;  1SRE A;  2RTC B;  4GJS A;  3WZO A;  4OKA A;  4CPH A;  3VHH A;  1STS B;  1KL4 A;  2C1S A;  3VGW A;  1SWS A;  2GH7 A;  4GD9 A;  1STR B;  4EKV A;  3EW2 A;  1N9Y A;  1SWE A;  2MF6 A;  1NBX A;  1HXL A;  2BC3 A;  5IRU A;  4JO6 A;  3WYP A;  2RTL A;  1VWI B;  1SWU A;  2UYW A;  4BX7 B;  2UZ2 A;  1NC9 A;  1SRH A;  1Y55 X;  1SWP A;  1SWQ A;  4CPI A;  2CAM A;  2RTG B;  1SLG B;  5IRA A;  2RTD B;  5L3Y A;  2WPU A;  3SZJ A;  2Y32 A;  2C4I A;  1VWC B;  3MG5 A;  1STP A;  5K67 A;  4GJV A;  1KL5 A;  3WZP A;  2IZE B;  5B5F A;  2ZSC A;  5F2B A;  1VWR B;  3RDX A;  2G5L A;  2Y3F A;  1N43 A;  1SWR A;  1RST B;  4I60 A;  3RDQ A;  4BX7 A;  1RXJ A;  1AVE A;  2RTO B;  2IZA A;  1SWK A;  1MK5 A;  1N4J A;  2RTR B;  1KFF A;  1RXK A;  1VWM B;  3VHI A;  1N7Y A;  3T6F A;  1HY2 A;  1N9M A;  1SWT A;  1Y52 X;  2IZB A;  2QCB A;  4GGT A;  1VWD B;  3RDO A;  5CSE A;  1Y53 X;  1VWN B;  2FHN X;  1SWN A;  2IZI A;  3EW1 A;  3SZI A;  2A5C A;  1SWF A;  4BX5 A;  1VWO B;  1VWL B;  1AVD A;  2AVI A;  1VWA B;  2C1Q A;  4CPE A;  4Z2O A;  2RTN B;  2RTJ A;  1SWH A;  4Z6J A;  2RTF B;  2A8G A;  2IZD B;  3T6L A;  2RTE B;  2OFB A;  2OF9 A;  4BX6 B;  1I9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...