2WPVA

Crystal structure of s. cerevisiae get4-get5 complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
281
structure length
281
Chain Sequence
b'KLAKTLQRFENKIKAGDYYEAHQTLRTIANRYVRSKSYEHAIELISQGALSFLKAKQGGSGTDLIFYLLEVYDLAEVKVDDISVARLVRLIAELDPSEPNLKDVITGMNNWSIKFSEYKFGDPYLHNTIGSKLLEGDFVYEAERYFMLGTHDSMIKYVDLLWDWLCQVDDIEDSTVAEFFSRLVFNYLFISNISFAHESKDIFLERFIEKFHPKYEKIDKNGYEIVFFEDYSDLNFLQLLLITCQTKDKSYFLNLKNHYLDFSQAYKSELEFLGQEYFNIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0363 PROTEIN YOR164C
publication title Crystal Structure of Get4-Get5 Complex and its Interactions with Sgt2, Get3, and Ydj1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 121
structure length 281
sequence length 281
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04190 DUF410 Protein of unknown function (DUF410)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wpvA00
2Q7FA 1KLXA 3PE3A 4GYWA 3RO3A 2V5FA 4UI9J 2PQRA 3ULQA 4JL0A 5AYWD 4U0ZA 3ASHA 3CV0A 4XIFA 2LSUA 3S7BA 2UWJG 2JLBA 4YVQC 3KAEA 4F3VA 4KBQA 3KD7A 1Y8MA 2UY1A 2VSNA 2XGMA 2J9QA 4KYOB 3Q47B 4J0UA 1HH8A 4RG6A 2Y4TA 3Q5MA 4HORA 4N3CA 4UI9K 3R9AB 5M72A 3U3WA 3QWWA 3RKVA 4GYYA 4G26A 2KC7A 3Q49B 3SZ7A 4CGWA 5FTPA 1ZU2A 4APOA 4JHRA 2KATA 5FZSA 3TAXA 5LCWC 5DIZA 3ZFWA 4CGVA 2KCKA 4N3AA 1QZ2A 1E96B 5G05C 4AIFA 3RIBA 2XCCA 4G23A 4I2ZA 3S7JA 1IYGA 2R5SA 4G24A 2OOEA 4N5CA 4BWRA 3LPZA 4UQXA 2QFCA 3HYMB 4N3BA 4ABNA 4UQYA 4HOSA 3CVLA 5FZRA 1HXIA 2C0MA 4GCOA 2XEVA 4O6FA 5G04C 3EDTB 4H7YA 3CVPA 3UQ3A 5ARFA 3MV2B 3ZGQA 4A1SA 4J8DA 1ELWA 3U4TA 2PQNA 2VGXA 4RG9A 4I9EA 3AS4A 3OXLA 4GZ6A 3KS2A 2VQ2A 2YHCA 2XCBA 3CEQA 2FBNA 3WXXA 4GPKA 4NRHB 4B94A 3LKUA 4GZ5A 5BNWA 2P58C 3FFLA 4H7XA 2IF4A 3TG4A 2HYZA 4YVOA 3CKCA 3VTXA 5HI7A 2FI7A 5EX3A 4WUYA 5HQ8A 4W9RA 3AS5A 3QOUA 4U04A 3ASFA 4CDRA 5G04J 3AS8A 3PDNA 1IHGA 5CCLA 4IN3B 4WNDA 2E2EA 4GYOA 3QKYA 3IEGA 4GA1A 1NZNA 2I6HA 4J8EA 4N2SA 1TJCA 3LY8A 3ASGA 3QWVA 1YA0A 3CK9A 5JJ6A 4HOUA 2NC9A 5KJNA 1B89A 3TG5A 4GA2A 5KJLA 3S7DA 3CVQA 1NA3A 2UY1B 5ARGA 4EQFA 1PC2A 2Y4UA 3ZHEA 4AY6A 4G2VA 5BT1A 4GZ3A 4LEUA 2FEZA 1W3BA 3CVNA 4JA7A 3LYAA 4BT8A 3MV3B 5JJTA 2XGSA 3TGOA 4Y6CA 4XI9A 3Q15A 3CK7A 4KXKB 5C1DA 3RJVA 5D0QD 1P5QA 4AY5A 4HOQA 2IFUA 5A6CA 5LCWJ 4GCNA 5BW8C 5G05J 2PL2A 4I2WA 3LY9A 2XGOA 5FJYA 1HZ4A 2MHKA 4U0SA 2KCLA 3ZHEB 2HR2A 3CKBA 1KT1A 5CCMA 3JYSA 4I17A 4AM9A 2VSYA 5A7DB 4YNDA 3K9IA 2ONDA 3ESKA 3NF1A 4BTAA 1WM5A 2LSVA 3OXFA 2LNIA 4BT9A 2GW1A 3GW4A 3VTYA 5D0OD 3QDNA 2VGXB 2XPIA 3QWPA 3SF4A 4ME2A 2VGYA 4J8FA 4WNGA 2FO7A 4N39A 2YQ8A 2KCVA 3E4BA 4JA9A 2C0LA 4I1AA 3OXGA 3RO2A 1KT0A 3ZN3A 2HO1A 2FF4A 5FT9A 3Q4AB 3GZ2A 2WPVA 3UPVA 2AVPA 1A17A 3FWVA 2WQHA 4U07A 1ZBPA 5KJKA 1FCHA 5DBKA 3LY7A 1NA0A 4N2QA 4U0UA 4G1TA 3O48A 2DBAA 3N71A 4UI9C 5JJ7A 3CK8A 5EX0A 3MKRA 1ELRA 2PZIA 2L6JA 1OUVA 5EKQD 3S7FA 3URZA 3RU0A 4GA0A 4UQZA 4HOTA 5CHEE 2BUGA 3FP3A 3LCAA 4NQ0A 4XI0A 4G25A 3UUXA 3GYZA 1XNFA 3ZPJA 1QQEA 3MA5A 4Y6WA 1WAO1 4WNFA 2C2LA 3ASDA 2VYIA 4WNEA 4I9CA 5KJMA 4BTBA 5FZQA 3MEKA 3GZ1A 3PE4A 3BEEA
chains in the Genus database with same CATH superfamily
1S63A 1KLXA 2F8YA 2MRIA 3FU0A 3RO3A 4I6EA 3L6AA 1HFAA 2EILE 2WXQA 2RKKA 5BV0A 2WXLA 5ENQD 3BG1B 4GMRA 1BPOA 1X81A 4BSXA 1INZA 2JLBA 4TUUA 4L1BA 5ENOD 4L23A 4GAAA 3KD7A 2QYJA 4GTQA 1MHQA 3FH5A 1Y8MA 3OAWA 1E7UA 5B1BE 2J9QA 3APDA 3Q47B 3Q7AA 4AV7A 1SA5A 4GB9A 4WWPA 4DRXE 4DUIA 1D8EA 4O1OA 3ASOE 5M72A 3LEWA 3T8KA 1JCRA 5AJDA 4E6HA 3DSXA 2P2CP 5AQBA 5EYPF 1EF1C 3IBEA 1VDYA 3CSFA 5CBNA 3FDHA 3UXGA 3EHNA 4JD2G 4CGWA 1OWNA 1ZU2A 1N0QA 4JHRA 4L7TA 5FZSA 4YDOA 4B89A 2KCKA 5BUZA 1MX4A 2VSOE 1ZB1A 4KVMA 4G23A 3PVLA 3S7JA 2R5SA 2X6FA 4FADA 4LERA 4J7WA 4XKCA 4FC8A 3PH0C 2QFCA 3UKRG 2XEEA 3AG2E 3DXMG 1L5JA 4LNGA 3TWTA 2WXRA 5FZRA 2X3MA 5CBOA 1Y6IA 3CHSA 4H7YA 3AG4E 1RW2A 2R59A 3B7BA 4J8DA 4FA6A 5ENTD 4RG9A 3TWXA 3GZSA 1OWMA 3U66A 2VQ2A 3KEAA 4KT6B 2B0OE 3HXFA 4NRHB 1KPSB 2ZGDA 3OTNA 3SHFA 4OAVB 2X6HA 4K5CA 4CYMD 3X2QE 1NL4A 3HXDA 3LKUA 5AQ7A 5BNWA 3PUJA 3HVEB 3FFLA 2IF4A 4LNUD 3TG4A 1HS6A 4YVOA 3CKCA 5LFAA 4CZ2D 2VSXE 1N94A 4U63A 3C98A 4CDRA 3T5VA 3JUEA 2JABA 1IHGA 5CCLA 2IOSA 3QJZA 1E90A 5BXUA 5C2YA 1OWLA 2A4ZA 3PEUB 2IQCA 4J8EA 2EIJE 1N52A 1LTXA 2L9BA 4MRUA 2GRQB 2IJGX 4V3IA 2A5UA 2VJ8A 1K1AA 1B89A 1JWGA 4WAFA 4GA2A 4XKBA 3Q73A 4OAUC 5D2MC 1NA3A 2UY1B 2WXKA 5A23A 2Y4UA 1EYHA 3QB2A 5BT1A 2XRZA 3I4RB 1H0AA 2I9CA 2X6IA 2FEZA 1W3BA 3CVNA 4TUMA 3FEYA 2EINE 3LYAA 3W9GA 4GZCA 3DEPA 2AXVA 3J5PA 2X38A 3FTZA 5AARA 3T9KA 2WQ6A 3ZRHA 3ZUVB 4HB5A 3Q79A 5C1DA 3E34A 2LXLA 3ZYKA 1P5QA 3AAAC 4FULA 3FUNA 4HOQA 2IU1A 5LCWJ 3I5PA 4BSZB 5BW8C 3D9MA 3EHQA 5G05J 3D3MA 3ZYLA 4KZ0A 2ETAA 1V54E 2AJAA 1E8XA 1HZ4A 2XENA 4ILGA 3SY2A 2KCLA 4AVXA 2HR2A 2WVIA 2DZOA 3MKQA 3CKBA 1KT1A 4BEPA 2P9LG 2OVFA 1MYOA 3ESKA 5ITZF 4UWFA 5LP0A 2XEHA 3ZYMA 3G2SA 4A63B 3HDXA 4JB8P 3FTXA 3CVXA 5D0OD 2H6IA 3ASNE 4C0MA 3LVQE 4WNGA 4N39A 4M7CA 1SQMA 3FH7A 3T5XA 4F1PA 3RO2A 4A1GA 2FF4A 5FT9A 3NZUA 2ETBA 3GZ2A 2Y1LE 2BKGA 4ACKA 2AVPA 4EZKA 1OT8A 4LUNU 1IKND 3FWVA 5CEAA 5CECB 3ENEA 4HXIA 2V4LA 4RSYA 4U95D 4HVBA 3V2OA 2J49A 3QAQA 4HI8A 3FY4A 4UI9C 3CK8A 2F37A 4LNBA 3DSUA 3PS6A 5CERB 3P1UA 3ZIMA 2L6JA 2WXFA 5CHEE 1QQEA 4HLLA 2ILRA 4WNFA 1OY3D 1PAQA 4BTBA 1Z5SC 5BV1A 4GTVA 2Q7FA 4JC8A 1MJ0A 3L22A 1UG3A 1N9AA 3APFA 1H2TC 4IRUA 2KXPC 2V5FA 3QK0A 4JL0A 1O1RA 2H6HA 3FULA 3MCXA 3SQVA 4LRZA 3CV0A 1WY6A 2UWJG 4DLOA 4YVQC 3L08A 3RRMB 3CVWA 3AJIA 3KSQA 3LJ3A 5EDSA 2M63A 2DYRE 2QZAA 4BETA 3VLDA 1DVPA 3V79K 4ANVA 3DRAA 2J09A 1KZPA 2XS1A 3IV0A 4HORA 4BERA 4N3CA 1H2UA 2BTDA 3CHRA 5H7PA 4ILHB 4R7LA 3ABKE 3CIAA 4JXTA 5CMWA 4K5AB 3VLFA 4BY6A 2CG2A 2Y0BG 2HM8A 5FTPA 1OWPA 1E8ZA 3HXEA 2Y69E 2BEDA 2LAIA 3ZXSA 4N3AA 4BESA 1QZ2A 3IKOB 4LCTA 3RIBA 3DSSA 3PNTB 4I2ZA 3HRAA 4EHMA 4GTRA 4G24A 1Q2ZA 3ML8A 3JXJA 3DWLG 1GW6A 5T3RA 3JQ1A 2XS8A 2XPZA 3UINC 2L6BA 3S2AA 1HU3A 3DBSA 2CFZA 4HOSA 3G2TA 3NOGD 2MOWA 4GPMA 1MX2A 5AJLA 3D9IA 1HXIA 4EZLA 4PS3A 4BX9A 4DJAA 3UQ3A 4ILIA 3ZGQA 4A1SA 3DSTA 4ATGA 3G2UA 3U4TA 5ANLA 4CEMA 2R2LA 4DI4A 5CRUA 5G2NA 3UIPC 3FTWA 2XCBA 3CEQA 2FBNA 3WXXA 4YDWA 3FU6A 1OCRE 2OVBA 2XQ0A 2V8SE 3SO8A 2ZXWE 5EYLA 2HYZA 2FI7A 2RFAA 5AAOA 3D9NA 4BX8A 4O60A 1BI7B 4DX5D 4W9RA 3AS5A 2RD0A 3ASFA 3UTMA 1AP7A 3PDNA 4TV3A 3C72A 3FUEA 5KBAA 5ENPD 4WNDA 3CHPA 1NP7A 3QKYA 2IEJA 4EECA 2WMOA 2FO1E 4GA1A 2Y3AA 2WXOA 3B7TA 3PRZA 2H6GA 4K0RA 4ANUA 4Q94A 1QBQA 3UM3A 1RZ4A 2B6CA 1OCOE 5G55A 3NQPA 2OV8A 4U8YD 2WXNA 4GMLA 3HIZA 5AQ9A 4HOUA 5KJNA 1TEZA 5J90A 3E37A 3CVQA 5ARGA 4EQFA 3ZHEA 5EIDA 3PUKA 3FUKA 3UMVA 4I6GA 1K1BA 4F53A 3NOCD 1MQSA 4JA7A 4URKA 3AG3E 3E30A 3W9FA 4TXPA 3MV3B 1UJKA 4XE0A 3VLEA 3FUJA 2VTBA 1U3DA 2XHEA 1MX6A 4Y6CA 1DNPA 3Q15A 4XI9A 3SD5A 4CCAA 3CK7A 4L2YA 2WMNA 3P2BA 4KXKB 5B1AE 1N0RA 4HRLA 4GMJA 4CT4A 5D0QD 3NAWA 1JPLA 2IFUA 3E33A 3TXNA 1FT2A 2XRYA 4YDYA 2PL2A 3LY9A 2XGOA 3Q7FA 2CHXA 2MHKA 1EDUA 4U7EB 5D66A 5ENNA 2XPYA 3DSWA 5LX8A 4GTMA 1S64A 5A7DB 1TR4A 3ULYA 1A5EA 3K9IA 5CRVA 4FU3A 2ONDA 3UT7A 2GRMA 1WM5A 3OXFA 2LO6A 2LNIA 1TN8A 3E32A 3GW4A 4AP2A 2J8SD 3SBTB 2VGXB 2KZTA 2DIWA 3U9WA 3SF4A 2FO7A 2KM4A 2EIKE 1H6KA 2KCVA 3B95A 3O4ZA 3OXGA 4CT0A 3ABLE 2BKKB 4I1MA 4C48B 5EIBE 3Q4AB 1E8WA 3RRUA 1TN7A 1A17A 5EN5D 2WXIA 5KJKA 5DBKA 3LY7A 1NA0A 4N2QA 4TXRA 4WWOA 2F8XK 4CDNA 5JJ7A 1H19A 3EU9A 3JQ0A 3PEVB 4BFRA 4UWHA 5JHBA 3NBNB 2CHWA 1OUVA 3S7FA 3RU0A 1HG2A 2BUGA 4UWKA 3FP3A 4XI0A 1TYQG 4G25A 3UUXA 4KZCA 3ZW3A 3TL5A 3ZPJA 1HO8A 3HXCA 3DPDA 3MA5A 2OCCE 4GTPA 4ACLA 4B8CB 2C2LA 4UUCA 2VYIA 4WNEA 2I2OA 4I9CA 2J4BA 3GZ1A 3PE3A 1BD8A 4DPRA 3IXEA 3ZYQA 4GYWA 2ETCA 2HE0A 2QYUA 4UI9J 2PQRA 3ULQA 5FINA 3EIJA 2NXPA 3FHEA 3UM0A 3PZ4A 4KVOA 2E0IA 3HXBA 2LSUA 3S7BA 4DLQA 3TJPA 1LD8A 1N4PA 4KBQA 3TWVA 2UY1A 3R7QA 1N11A 4U8VD 4HLEA 1TN6A 4KYOB 1WG0A 4J0UA 1HH8A 2Y4TA 3Q5MA 3LVRE 4EBAG 3FUMA 4UI9K 2LXMA 5KNHD 3ESLA 3U3WA 4PDXA 3QWWA 1K3ZD 3RKVA 1H2VC 4GYYA 4G26A 3QARA 3Q49B 3LJNA 3FU5A 1S70B 5LCWC 2F0YA 5DIZA 3RSEG 1OCZE 1YMPA 3C3QA 5G05C 2P9KG 1DC2A 3EJNA 4HNAD 2WM9A 2RG8A 2OOEA 1IQUA 4JEHA 2VGEA 1OWOA 2NYJA 3ZXPA 3Q78A 4UQXA 2EIME 1BI8B 4ABNA 4UQYA 3ML9A 2WXHA 4ZHBA 1G3NB 3CHQA 2V5QC 4O6FA 3APCA 5G04C 3UKUG 4AXHA 3MV2B 5JHAA 3CQCB 2R02A 3Q75A 3CVUA 3ZU7B 1ELWA 4IYPA 4I9EA 3AS4A 3OXLA 3MGBA 1FVFA 2YINA 4HFGA 2J4DA 1EPUA 2YHCA 2IY0C 3UT4A 1YYHA 3QNKA 3WG7E 4B94A 2P9PG 2LAHA 2OEVA 3TWWA 2P58C 3UX4A 5AQAA 2AXUA 1UW4B 1SZAA 4TRQA 2V4HC 1KZOA 3RAUA 1N54A 1U3CA 4WUYA 3QOUA 4XEIG 4GU5A 3RK6A 3FUFA 5HRYA 1TNOA 1FVHA 2GRLA 3SFYA 3IHVA 4I1OB 2E2EA 1AWCB 3AU4A 2I1KA 2I6HA 3L13A 4EBAA 4J6IA 3NB2A 4N2SA 1TJCA 4WWNA 4HS2A 3ONKA 3QWVA 4B0ZA 1NI1A 4JW1A 1DCEA 3TG5A 5AENA 2EQXA 5KJLA 2XZTG 2J08A 4A55A 2ZGGA 2IO3C 2MYOA 4AY6A 5EILA 3ZKJA 4GZ3A 4TXQA 3EU5A 4X8QA 2XGSA 3TGOA 2GGFA 2P9NG 1IQRA 3RRNB 2WXGA 4NURA 4IULA 5LOZA 3RJVA 3CGHA 4OVUA 2R17C 4GCNA 4HRMB 2CHZA 2ZU6B 4ZFHA 4Q96A 3L54A 4I2WA 4K03A 4JHJA 4DX6D 4U8HA 4EZJA 5CMYA 4U0SA 5FWQA 3ZHEB 3HG0D 1D8DA 2FULA 2WXMA 5CCMA 3SFZA 4AM9A 3MYVA 3UIOC 3I3NA 3EHRA 1SVXA 3NF1A 1LD7A 2VTBB 4BTAA 3B13A 4ANWA 4ANXA 2GW1A 4UWGA 1SZ9A 3BG0B 3VTYA 1TNBA 3UM1A 5BPPA 4PS7A 3QDNA 4C0EA 2XPIA 4L9PA 4MLPA 3QWPA 4ME2A 3D9OA 4J8FA 4B93B 2ZISA 5KCMA 4JA9A 2C0LA 4HI9A 2HO1A 3UI2A 1FPPA 2KBXA 4KMOA 1SA4A 2L0TB 2R05A 3HHMA 3V30A 2GROB 4F7AA 3PZ3A 4MKTA 2WQHA 3FUIA 1ZBPA 4U07A 4GTTA 4U0UA 2J07A 5FQ6A 2DBAA 3N71A 5JMND 1IHBA 3C5RA 1O5MA 4ATZD 2QC9A 5EX0A 3TWUA 1S0PA 1UOHA 2JEKA 4FLHA 2KZTB 3DXKG 5KWDA 4GA0A 4UQZA 4HOTA 3FTSA 3L16A 4NIKA 3LCAA 4NQ0A 3IHYA 2X6KA 4PUCA 3GYZA 2DYSE 1HG5A 1WAO1 3ASDA 2AW6A 1UN9A 4FJZA 5FZQA 3PE4A 3JUIA 3FU3A 1NFIE 5T8IA 3BUAA 4PS8A 3CR3A 4M3OA 4FHJA 2H6FA 3U64A 4F1SA 5AYWD 4FHKA 4U0ZA 3ASHA 1Z6TA 5ANRA 4XIFA 3MX3A 5AN8A 4MS6A 3KAEA 4F3VA 1N4SA 3TWSA 5IY5E 5AIJA 3CHOA 2VSNA 3ONLA 4A3TA 2XGMA 3ZVVA 3T8MA 3FEXA 4XZ4A 1X5BA 4RG6A 5FQ7A 4Z68A 2AWIA 3JCKC 3J5QB 3R9AB 1N4RA 4XX5A 5JA4D 1QNFA 2PM7A 1JCSA 2KC7A 3MKQB 3SZ7A 3MJWA 4APOA 4HRNA 4Q69A 2KATA 3I4GA 5ENSD 3TAXA 2DZNA 3ZFWA 4CGVA 3DSVA 4DI3A 1E96B 4DK5A 4AIFA 1DCQA 4APFA 4GZDA 1HX8A 2XCCA 2DWZA 4FLBA 3FUDA 1YCSB 1O1SA 1IYGA 3HVEA 3ABME 3SI5A 4N5CA 4BWRA 4MBGA 1BU9A 1O1TA 2YHEA 3LPZA 4OYSA 3HYMB 4N3BA 3KSLA 1SW6A 3SBSA 3CVLA 3TXMA 3Q9UC 4G11A 2C0MA 1OXJA 4HQDA 4GCOA 2XEVA 4JPSA 2WB2A 3EDTB 4A3VA 3CVPA 1MZCA 5ARFA 1U2VG 2PNNA 4P29A 3BQOA 4I6JA 3FTVA 2PQNA 2VGXA 3TWRA 1TJFA 4GZ6A 3KS2A 2NSZA 3CHMA 3L9TA 1OCCE 2WXPA 4FP7A 2IO2C 4JEUA 1V55E 4GPKA 2IONA 4G8KA 4DX1A 5HS0A 2PM6A 4GZ5A 3EIQC 2XZDG 4YDEA 4H7XA 2CG3A 3C3RA 4E85A 5FQ4A 3PNLB 3VTXA 1XGWA 5HI7A 4G8LA 5ENRD 2DVWA 5CEDB 3LS8A 2AXZA 5EX3A 5HQ8A 1N95A 4U04A 5E76A 5G04J 4C9BB 3AS8A 1TNUA 3V2XA 4RVBA 4JHKA 3ZNGA 4IN3B 1LF8A 3PZ1A 4L2LA 4GYOA 1H6PA 4GTOA 3IEGA 3D9LA 3EUVA 5KNGA 1JCQA 5T4YA 1NZNA 3EHMA 3CLJA 2P9UG 4LSZE 5B3SE 3R7RA 4OVVA 1HE8A 3LY8A 3ASGA 2GRRB 1YA0A 3CK9A 3NZSA 5JJ6A 3FTYA 2NC9A 3FUHA 4QFVA 3S7DA 3B7UX 1PC2A 4O1PA 3FTUA 4GTSA 3PZ2A 4G2VA 4LG6A 2I1JA 4LEUA 3AG1E 4N5QA 3D9PA 4BT8A 5JJTA 3CVYA 1H6OA 3L82A 4AJWA 1ELKA 4FJYA 1TNZA 3PZDA 4UWLA 2OEWA 4U96D 4D10C 4JZYA 5J08A 4AY5A 3UM2A 2QY7A 5A6CA 1IXVA 3PREA 3D9KA 2V0PA 1Z3XA 2WXJA 5FJYA 4HBDA 2GRPB 3BU8A 3R9MA 3V31A 3CSTA 3SNXA 4K5BA 1UN8A 1Z3YA 5E75A 4CDMA 4I43A 5HKPA 1E7VA 2P9IG 3JYSA 4I17A 1BLXB 2VSYA 1JUQA 2A5EA 4YNDA 2X6JA 3G2WA 2L0IA 3UT8A 2LSVA 4BT9A 1PY1A 1HF8A 3G2VA 3F6QA 5FQ8A 3AU5A 3B7RL 3TWQA 4JVSA 4CRWA 4PH4B 4F6RD 3ULEG 3MZLB 2VGYA 2IOLA 1JWFA 4AOFA 1QYMA 1N4QA 2YQ8A 4J8YA 3E4BA 4RQIA 1TNYA 3DEOA 4I1AA 3ZN3A 1KT0A 4NACA 2R03A 1D9SA 1FT1A 2BF0X 2P9SG 3B7SA 3ISMC 2WPVA 3UPVA 3D9JA 3SGHA 2GRNB 3LXUX 4AEZC 3L17A 1FCHA 3ZEFA 4G1TA 3O48A 2CFUA 4DX7D 1WDYA 3DPYA 5FIOA 2RFMA 3LDZA 3CQGB 3MKRA 1K8KG 3FH8A 2LUHA 2YNQA 3KEZA 5BXOA 3SFXA 1ELRA 2PZIA 3D9HA 3QC1A 3JXIA 5EKQD 3URZA 4B8AA 2ZIRA 4QQIA 1XNFA 1E8YA 1UJJA 3Q9NC 2DCPA 4DX2A 4Y6WA 4RLYA 4J8SA 5KJMA 3C3OA 2WQ7A 3MEKA 3CVVA 3BEEA 4EPZA
chains in the Genus database with same CATH topology
3JUIA 2Q7FA 3FU3A 1KLXA 3PE3A 2MRIA 4JC8A 3L22A 5T8IA 1UG3A 3FU0A 3ZYQA 4DPRA 4PS8A 4GYWA 3CR3A 4M3OA 3RO3A 4I6EA 3L6AA 3APFA 4FHJA 1H2TC 1HFAA 4IRUA 2WXQA 2V5FA 4UI9J 5BV0A 2PQRA 3ULQA 3QK0A 3U64A 4JL0A 4F1SA 3EIJA 2WXLA 3FULA 3MCXA 5AYWD 4FHKA 4U0ZA 2NXPA 3ASHA 3FHEA 3BG1B 1BPOA 4LRZA 1Z6TA 4BSXA 4KVOA 5ANRA 1INZA 3CV0A 2E0IA 4XIFA 2LSUA 3S7BA 1WY6A 2UWJG 4DLOA 4DLQA 2JLBA 4YVQC 4TUUA 4L1BA 3MX3A 3L08A 3RRMB 4MS6A 3CVWA 3KAEA 4L23A 3TJPA 4F3VA 4KBQA 3LJ3A 4GAAA 5EDSA 2M63A 3KD7A 1MHQA 5AIJA 3FH5A 1Y8MA 2UY1A 3CHOA 2VSNA 3ONLA 4A3TA 3VLDA 1DVPA 3OAWA 3R7QA 1E7UA 2XGMA 3ZVVA 3T8MA 2J9QA 3FEXA 4HLEA 3APDA 4KYOB 4ANVA 3Q47B 4AV7A 4XZ4A 4GB9A 4J0UA 1HH8A 2J09A 1X5BA 4RG6A 4WWPA 5FQ7A 2Y4TA 3Q5MA 3IV0A 4HORA 3LVRE 2AWIA 4EBAG 3JCKC 4N3CA 3FUMA 4UI9K 3R9AB 5M72A 3LEWA 1H2UA 3ESLA 2BTDA 3CHRA 5AJDA 4E6HA 4ILHB 4R7LA 3U3WA 4PDXA 3CIAA 3QWWA 1EF1C 3IBEA 4JXTA 3RKVA 1H2VC 5CMWA 1VDYA 4XX5A 3CSFA 1QNFA 4GYYA 4G26A 2PM7A 3FDHA 3QARA 2KC7A 3Q49B 3VLFA 3MKQB 4BY6A 3EHNA 2CG2A 3SZ7A 4CGWA 2HM8A 5FTPA 3FU5A 1OWNA 1OWPA 1E8ZA 1ZU2A 3MJWA 4JHRA 4APOA 4Q69A 2KATA 3I4GA 4L7TA 5FZSA 3TAXA 2LAIA 5LCWC 5DIZA 3ZFWA 5G2NA 2KCKA 3ZXSA 4B89A 4CGVA 4DI3A 4N3AA 5BUZA 1QZ2A 1E96B 3IKOB 4LCTA 5G05C 4DK5A 4AIFA 4APFA 2VSOE 3RIBA 3PNTB 4GZDA 4KVMA 1HX8A 2XCCA 3EJNA 4G23A 3PVLA 4I2ZA 3S7JA 4FLBA 3FUDA 1IYGA 2R5SA 2WM9A 2RG8A 2X6FA 4FADA 4G24A 2OOEA 1IQUA 3HVEA 4LERA 3ML8A 4JEHA 3SI5A 1OWOA 4N5CA 4XKCA 4BWRA 1GW6A 4FC8A 3PH0C 5T3RA 2YHEA 3LPZA 4UQXA 3JQ1A 2XPZA 2QFCA 4OYSA 3S2AA 1HU3A 3HYMB 4N3BA 3DBSA 4ABNA 2CFZA 4UQYA 3G2TA 3SBSA 4HOSA 1L5JA 3CVLA 3ML9A 2MOWA 2WXHA 3TXMA 2WXRA 5FZRA 5AJLA 2X3MA 3D9IA 3CHQA 1HXIA 4EZLA 4PS3A 4G11A 2C0MA 4BX9A 1Y6IA 4GCOA 2XEVA 3APCA 4JPSA 4O6FA 5G04C 3CHSA 3EDTB 2WB2A 4H7YA 4A3VA 4DJAA 3CVPA 3UQ3A 4AXHA 5ARFA 2R59A 3MV2B 4ILIA 3ZGQA 4P29A 5JHAA 3CQCB 4A1SA 3CVUA 4J8DA 4ATGA 1ELWA 4I6JA 3FTVA 3G2UA 5ANLA 3U4TA 4CEMA 4FA6A 2PQNA 2VGXA 4IYPA 4I9EA 4RG9A 3AS4A 4DI4A 3GZSA 3OXLA 1TJFA 3MGBA 3KS2A 1OWMA 2NSZA 1FVFA 2YINA 3FTWA 4GZ6A 4HFGA 2J4DA 3CHMA 3U66A 1EPUA 2VQ2A 2YHCA 2WXPA 4KT6B 4FP7A 2XCBA 3CEQA 2FBNA 4JEUA 3WXXA 4GPKA 4NRHB 2IONA 3FU6A 2OVBA 3OTNA 3SHFA 3UT4A 3QNKA 2X6HA 2XQ0A 4B94A 2PM6A 2LAHA 3LKUA 4GZ5A 5BNWA 3EIQC 3PUJA 2P58C 3HVEB 3FFLA 2V8SE 4H7XA 3UX4A 2CG3A 2AXUA 2IF4A 1UW4B 1SZAA 3TG4A 1HS6A 4TRQA 4E85A 2HYZA 5FQ4A 4YVOA 3PNLB 3CKCA 3VTXA 5LFAA 1XGWA 5HI7A 2FI7A 1N54A 3D9NA 2VSXE 3LS8A 1U3CA 2AXZA 4BX8A 5EX3A 4U63A 4WUYA 5HQ8A 4W9RA 3AS5A 3C98A 3QOUA 4U04A 2RD0A 3ASFA 4GU5A 3RK6A 4CDRA 3T5VA 5E76A 5G04J 4C9BB 3AS8A 3PDNA 4TV3A 4RVBA 3FUFA 1IHGA 5CCLA 1FVHA 2GRLA 4JHKA 3FUEA 4IN3B 3IHVA 1LF8A 4WNDA 2IOSA 4I1OB 4L2LA 2E2EA 3CHPA 1NP7A 4GYOA 3QKYA 3IEGA 3D9LA 4EECA 3QJZA 1E90A 2WMOA 5C2YA 1OWLA 4GA1A 5T4YA 2Y3AA 3AU4A 1NZNA 3EHMA 2WXOA 2A4ZA 2I1KA 3PEUB 2I6HA 2IQCA 3B7TA 3PRZA 3CLJA 3L13A 4K0RA 4J8EA 4EBAA 4J6IA 1N52A 4ANUA 4Q94A 4N2SA 2L9BA 1TJCA 4WWNA 3R7RA 4OVVA 1HE8A 3LY8A 3ASGA 4HS2A 5G55A 3ONKA 3QWVA 4MRUA 3NQPA 1YA0A 2IJGX 2OV8A 3CK9A 3NZSA 4V3IA 5JJ6A 3FTYA 2A5UA 4B0ZA 2WXNA 2VJ8A 3HIZA 4GMLA 4HOUA 2NC9A 5KJNA 1B89A 1JWGA 4JW1A 3FUHA 4WAFA 1TEZA 3TG5A 5AENA 2EQXA 4GA2A 5KJLA 4QFVA 5J90A 2J08A 4XKBA 3S7DA 3B7UX 4A55A 3CVQA 1NA3A 2UY1B 2WXKA 5ARGA 4EQFA 1PC2A 2Y4UA 5A23A 3ZHEA 1EYHA 3FTUA 3QB2A 3PUKA 4AY6A 4G2VA 3FUKA 5BT1A 2XRZA 3UMVA 4I6GA 4GZ3A 3I4RB 1H0AA 2I9CA 2I1JA 2X6IA 4LEUA 2FEZA 4F53A 1W3BA 1MQSA 3CVNA 3D9PA 4JA7A 3FEYA 4URKA 3LYAA 4BT8A 3MV3B 4GZCA 5JJTA 1UJKA 3CVYA 2XGSA 4XE0A 3VLEA 2AXVA 3FUJA 3TGOA 2VTBA 1U3DA 2GGFA 2X38A 2XHEA 4Y6CA 3FTZA 1DNPA 3Q15A 4XI9A 3SD5A 1IQRA 4AJWA 4CCAA 2WQ6A 3ZRHA 3CK7A 1ELKA 3RRNB 4FJYA 4C0EA 4L2YA 2WMNA 3PZDA 4UWLA 3P2BA 2WXGA 4NURA 4IULA 4KXKB 4D10C 5C1DA 5LOZA 3RJVA 4JZYA 3CGHA 4GMJA 4CT4A 5D0QD 3ZYKA 5J08A 1P5QA 4AY5A 4OVUA 1JPLA 4FULA 2QY7A 2R17C 3FUNA 4HOQA 2IU1A 2IFUA 5A6CA 5LCWJ 4GCNA 3I5PA 3PREA 3TXNA 2XRYA 5BW8C 3D9KA 2V0PA 3D9MA 2CHZA 5G05J 3D3MA 2ZU6B 3ZYLA 1Z3XA 4KZ0A 4Q96A 2PL2A 3L54A 4I2WA 3LY9A 2WXJA 2XGOA 5FJYA 4K03A 4JHJA 1E8XA 1HZ4A 2CHXA 4U8HA 4EZJA 2MHKA 3CSTA 3SNXA 5CMYA 4ILGA 4U0SA 1EDUA 1UN8A 1Z3YA 5ENNA 2KCLA 5E75A 5FWQA 2HR2A 3ZHEB 4AVXA 2WVIA 2XPYA 4CDMA 3MKQA 3CKBA 2FULA 1KT1A 4I43A 2WXMA 5CCMA 1E7VA 3JYSA 5LX8A 4I17A 3SFZA 4AM9A 3MYVA 2VSYA 1JUQA 5A7DB 3I3NA 4YNDA 3K9IA 4FU3A 2OVFA 2ONDA 3UT7A 2X6JA 3ESKA 4UWFA 5LP0A 2GRMA 3NF1A 3G2WA 4BTAA 3ZYMA 3B13A 4ANWA 2L0IA 3UT8A 1WM5A 2VTBB 3G2SA 2LSVA 3OXFA 2LO6A 2LNIA 3HDXA 4ANXA 4BT9A 1PY1A 1HF8A 2GW1A 4UWGA 1SZ9A 3BG0B 3G2VA 3GW4A 3FTXA 5FQ8A 3VTYA 3CVXA 5D0OD 3AU5A 3B7RL 4JVSA 5BPPA 4PS7A 3QDNA 4AP2A 5KJKA 4CRWA 2VGXB 2XPIA 2KZTA 2DIWA 4MLPA 3QWPA 4PH4B 3SBTB 4ME2A 3SF4A 3U9WA 4C0MA 3LVQE 3MZLB 2VGYA 2IOLA 3D9OA 1JWFA 4J8FA 2FO7A 4WNGA 4AOFA 4N39A 1SQMA 2KM4A 1H6KA 2YQ8A 2KCVA 3E4BA 3FH7A 3T5XA 5KCMA 4JA9A 2C0LA 3O4ZA 4I1AA 3OXGA 3RO2A 1KT0A 3ZN3A 2HO1A 4NACA 4A1GA 4CT0A 2FF4A 2BF0X 5FT9A 4I1MA 4KMOA 2L0TB 3NZUA 3Q4AB 3GZ2A 3B7SA 1E8WA 2WPVA 3HHMA 3UPVA 3RRUA 4ACKA 2AVPA 1A17A 3D9JA 4F7AA 4EZKA 4LUNU 3FWVA 3SGHA 3ENEA 3LXUX 4HXIA 4MKTA 4AEZC 3L17A 2V4LA 2WQHA 2WXIA 1ZBPA 3FUIA 4RSYA 1FCHA 4U07A 3LY7A 1NA0A 5DBKA 3ZEFA 4HVBA 4N2QA 4U0UA 2J07A 4G1TA 5FQ6A 3O48A 4WWOA 2J49A 3QAQA 2DBAA 3N71A 3FY4A 4CDNA 4UI9C 2CFUA 5JJ7A 1H19A 3CK8A 3JQ0A 3PEVB 3LDZA 3CQGB 5EX0A 3MKRA 3FH8A 4BFRA 1S0PA 3PS6A 2JEKA 2YNQA 3KEZA 4FLHA 1ELRA 2KZTB 3P1UA 4UWHA 3ZIMA 2PZIA 5JHBA 3QC1A 2CHWA 2L6JA 1OUVA 5EKQD 3S7FA 3URZA 2WXFA 3RU0A 4GA0A 4B8AA 4UQZA 1HG2A 3FTSA 3L16A 5CHEE 4HOTA 2BUGA 4UWKA 3FP3A 3LCAA 4NQ0A 4XI0A 4G25A 3UUXA 4KZCA 3IHYA 3ZW3A 2X6KA 4PUCA 3GYZA 1XNFA 3TL5A 1E8YA 1UJJA 3ZPJA 1QQEA 1HO8A 3DPDA 2DCPA 3MA5A 4ACLA 4Y6WA 2ILRA 1HG5A 1WAO1 4WNFA 4B8CB 2C2LA 4J8SA 3ASDA 2AW6A 2VYIA 4WNEA 1UN9A 2I2OA 4FJZA 1PAQA 4I9CA 5KJMA 4BTBA 5FZQA 5BV1A 3MEKA 2J4BA 2WQ7A 3GZ1A 3PE4A 3CVVA 3BEEA 4EPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7F A;  1KLX A;  3PE3 A;  4GYW A;  3RO3 A;  2V5F A;  4UI9 J;  2PQR A;  3ULQ A;  4JL0 A;  5AYW D;  4U0Z A;  3ASH A;  3CV0 A;  4XIF A;  2LSU A;  3S7B A;  2UWJ G;  2JLB A;  4YVQ C;  3KAE A;  4F3V A;  4KBQ A;  3KD7 A;  1Y8M A;  2UY1 A;  2VSN A;  2XGM A;  2J9Q A;  4KYO B;  3Q47 B;  4J0U A;  1HH8 A;  4RG6 A;  2Y4T A;  3Q5M A;  4HOR A;  4N3C A;  4UI9 K;  3R9A B;  5M72 A;  3U3W A;  3QWW A;  3RKV A;  4GYY A;  4G26 A;  2KC7 A;  3Q49 B;  3SZ7 A;  4CGW A;  5FTP A;  1ZU2 A;  4APO A;  4JHR A;  2KAT A;  5FZS A;  3TAX A;  5LCW C;  5DIZ A;  3ZFW A;  4CGV A;  2KCK A;  4N3A A;  1QZ2 A;  1E96 B;  5G05 C;  4AIF A;  3RIB A;  2XCC A;  4G23 A;  4I2Z A;  3S7J A;  1IYG A;  2R5S A;  4G24 A;  2OOE A;  4N5C A;  4BWR A;  3LPZ A;  4UQX A;  2QFC A;  3HYM B;  4N3B A;  4ABN A;  4UQY A;  4HOS A;  3CVL A;  5FZR A;  1HXI A;  2C0M A;  4GCO A;  2XEV A;  4O6F A;  5G04 C;  3EDT B;  4H7Y A;  3CVP A;  3UQ3 A;  5ARF A;  3MV2 B;  3ZGQ A;  4A1S A;  4J8D A;  1ELW A;  3U4T A;  2PQN A;  2VGX A;  4RG9 A;  4I9E A;  3AS4 A;  3OXL A;  4GZ6 A;  3KS2 A;  2VQ2 A;  2YHC A;  2XCB A;  3CEQ A;  2FBN A;  3WXX A;  4GPK A;  4NRH B;  4B94 A;  3LKU A;  4GZ5 A;  5BNW A;  2P58 C;  3FFL A;  4H7X A;  2IF4 A;  3TG4 A;  2HYZ A;  4YVO A;  3CKC A;  3VTX A;  5HI7 A;  2FI7 A;  5EX3 A;  4WUY A;  5HQ8 A;  4W9R A;  3AS5 A;  3QOU A;  4U04 A;  3ASF A;  4CDR A;  5G04 J;  3AS8 A;  3PDN A;  1IHG A;  5CCL A;  4IN3 B;  4WND A;  2E2E A;  4GYO A;  3QKY A;  3IEG A;  4GA1 A;  1NZN A;  2I6H A;  4J8E A;  4N2S A;  1TJC A;  3LY8 A;  3ASG A;  3QWV A;  1YA0 A;  3CK9 A;  5JJ6 A;  4HOU A;  2NC9 A;  5KJN A;  1B89 A;  3TG5 A;  4GA2 A;  5KJL A;  3S7D A;  3CVQ A;  1NA3 A;  2UY1 B;  5ARG A;  4EQF A;  1PC2 A;  2Y4U A;  3ZHE A;  4AY6 A;  4G2V A;  5BT1 A;  4GZ3 A;  4LEU A;  2FEZ A;  1W3B A;  3CVN A;  4JA7 A;  3LYA A;  4BT8 A;  3MV3 B;  5JJT A;  2XGS A;  3TGO A;  4Y6C A;  4XI9 A;  3Q15 A;  3CK7 A;  4KXK B;  5C1D A;  3RJV A;  5D0Q D;  1P5Q A;  4AY5 A;  4HOQ A;  2IFU A;  5A6C A;  5LCW J;  4GCN A;  5BW8 C;  5G05 J;  2PL2 A;  4I2W A;  3LY9 A;  2XGO A;  5FJY A;  1HZ4 A;  2MHK A;  4U0S A;  2KCL A;  3ZHE B;  2HR2 A;  3CKB A;  1KT1 A;  5CCM A;  3JYS A;  4I17 A;  4AM9 A;  2VSY A;  5A7D B;  4YND A;  3K9I A;  2OND A;  3ESK A;  3NF1 A;  4BTA A;  1WM5 A;  2LSV A;  3OXF A;  2LNI A;  4BT9 A;  2GW1 A;  3GW4 A;  3VTY A;  5D0O D;  3QDN A;  2VGX B;  2XPI A;  3QWP A;  3SF4 A;  4ME2 A;  2VGY A;  4J8F A;  4WNG A;  2FO7 A;  4N39 A;  2YQ8 A;  2KCV A;  3E4B A;  4JA9 A;  2C0L A;  4I1A A;  3OXG A;  3RO2 A;  1KT0 A;  3ZN3 A;  2HO1 A;  2FF4 A;  5FT9 A;  3Q4A B;  3GZ2 A;  2WPV A;  3UPV A;  2AVP A;  1A17 A;  3FWV A;  2WQH A;  4U07 A;  1ZBP A;  5KJK A;  1FCH A;  5DBK A;  3LY7 A;  1NA0 A;  4N2Q A;  4U0U A;  4G1T A;  3O48 A;  2DBA A;  3N71 A;  4UI9 C;  5JJ7 A;  3CK8 A;  5EX0 A;  3MKR A;  1ELR A;  2PZI A;  2L6J A;  1OUV A;  5EKQ D;  3S7F A;  3URZ A;  3RU0 A;  4GA0 A;  4UQZ A;  4HOT A;  5CHE E;  2BUG A;  3FP3 A;  3LCA A;  4NQ0 A;  4XI0 A;  4G25 A;  3UUX A;  3GYZ A;  1XNF A;  3ZPJ A;  1QQE A;  3MA5 A;  4Y6W A;  1WAO 1;  4WNF A;  2C2L A;  3ASD A;  2VYI A;  4WNE A;  4I9C A;  5KJM A;  4BTB A;  5FZQ A;  3MEK A;  3GZ1 A;  3PE4 A;  3BEE A; 
#chains in the Genus database with same CATH topology
 1S63 A;  1KLX A;  2F8Y A;  2MRI A;  3FU0 A;  3RO3 A;  4I6E A;  3L6A A;  1HFA A;  2EIL E;  2WXQ A;  2RKK A;  5BV0 A;  2WXL A;  5ENQ D;  3BG1 B;  4GMR A;  1BPO A;  1X81 A;  4BSX A;  1INZ A;  2JLB A;  4TUU A;  4L1B A;  5ENO D;  4L23 A;  4GAA A;  3KD7 A;  2QYJ A;  4GTQ A;  1MHQ A;  3FH5 A;  1Y8M A;  3OAW A;  1E7U A;  5B1B E;  2J9Q A;  3APD A;  3Q47 B;  3Q7A A;  4AV7 A;  1SA5 A;  4GB9 A;  4WWP A;  4DRX E;  4DUI A;  1D8E A;  4O1O A;  3ASO E;  5M72 A;  3LEW A;  3T8K A;  1JCR A;  5AJD A;  4E6H A;  3DSX A;  2P2C P;  5AQB A;  5EYP F;  1EF1 C;  3IBE A;  1VDY A;  3CSF A;  5CBN A;  3FDH A;  3UXG A;  3EHN A;  4JD2 G;  4CGW A;  1OWN A;  1ZU2 A;  1N0Q A;  4JHR A;  4L7T A;  5FZS A;  4YDO A;  4B89 A;  2KCK A;  5BUZ A;  1MX4 A;  2VSO E;  1ZB1 A;  4KVM A;  4G23 A;  3PVL A;  3S7J A;  2R5S A;  2X6F A;  4FAD A;  4LER A;  4J7W A;  4XKC A;  4FC8 A;  3PH0 C;  2QFC A;  3UKR G;  2XEE A;  3AG2 E;  3DXM G;  1L5J A;  4LNG A;  3TWT A;  2WXR A;  5FZR A;  2X3M A;  5CBO A;  1Y6I A;  3CHS A;  4H7Y A;  3AG4 E;  1RW2 A;  2R59 A;  3B7B A;  4J8D A;  4FA6 A;  5ENT D;  4RG9 A;  3TWX A;  3GZS A;  1OWM A;  3U66 A;  2VQ2 A;  3KEA A;  4KT6 B;  2B0O E;  3HXF A;  4NRH B;  1KPS B;  2ZGD A;  3OTN A;  3SHF A;  4OAV B;  2X6H A;  4K5C A;  4CYM D;  3X2Q E;  1NL4 A;  3HXD A;  3LKU A;  5AQ7 A;  5BNW A;  3PUJ A;  3HVE B;  3FFL A;  2IF4 A;  4LNU D;  3TG4 A;  1HS6 A;  4YVO A;  3CKC A;  5LFA A;  4CZ2 D;  2VSX E;  1N94 A;  4U63 A;  3C98 A;  4CDR A;  3T5V A;  3JUE A;  2JAB A;  1IHG A;  5CCL A;  2IOS A;  3QJZ A;  1E90 A;  5BXU A;  5C2Y A;  1OWL A;  2A4Z A;  3PEU B;  2IQC A;  4J8E A;  2EIJ E;  1N52 A;  1LTX A;  2L9B A;  4MRU A;  2GRQ B;  2IJG X;  4V3I A;  2A5U A;  2VJ8 A;  1K1A A;  1B89 A;  1JWG A;  4WAF A;  4GA2 A;  4XKB A;  3Q73 A;  4OAU C;  5D2M C;  1NA3 A;  2UY1 B;  2WXK A;  5A23 A;  2Y4U A;  1EYH A;  3QB2 A;  5BT1 A;  2XRZ A;  3I4R B;  1H0A A;  2I9C A;  2X6I A;  2FEZ A;  1W3B A;  3CVN A;  4TUM A;  3FEY A;  2EIN E;  3LYA A;  3W9G A;  4GZC A;  3DEP A;  2AXV A;  3J5P A;  2X38 A;  3FTZ A;  5AAR A;  3T9K A;  2WQ6 A;  3ZRH A;  3ZUV B;  4HB5 A;  3Q79 A;  5C1D A;  3E34 A;  2LXL A;  3ZYK A;  1P5Q A;  3AAA C;  4FUL A;  3FUN A;  4HOQ A;  2IU1 A;  5LCW J;  3I5P A;  4BSZ B;  5BW8 C;  3D9M A;  3EHQ A;  5G05 J;  3D3M A;  3ZYL A;  4KZ0 A;  2ETA A;  1V54 E;  2AJA A;  1E8X A;  1HZ4 A;  2XEN A;  4ILG A;  3SY2 A;  2KCL A;  4AVX A;  2HR2 A;  2WVI A;  2DZO A;  3MKQ A;  3CKB A;  1KT1 A;  4BEP A;  2P9L G;  2OVF A;  1MYO A;  3ESK A;  5ITZ F;  4UWF A;  5LP0 A;  2XEH A;  3ZYM A;  3G2S A;  4A63 B;  3HDX A;  4JB8 P;  3FTX A;  3CVX A;  5D0O D;  2H6I A;  3ASN E;  4C0M A;  3LVQ E;  4WNG A;  4N39 A;  4M7C A;  1SQM A;  3FH7 A;  3T5X A;  4F1P A;  3RO2 A;  4A1G A;  2FF4 A;  5FT9 A;  3NZU A;  2ETB A;  3GZ2 A;  2Y1L E;  2BKG A;  4ACK A;  2AVP A;  4EZK A;  1OT8 A;  4LUN U;  1IKN D;  3FWV A;  5CEA A;  5CEC B;  3ENE A;  4HXI A;  2V4L A;  4RSY A;  4U95 D;  4HVB A;  3V2O A;  2J49 A;  3QAQ A;  4HI8 A;  3FY4 A;  4UI9 C;  3CK8 A;  2F37 A;  4LNB A;  3DSU A;  3PS6 A;  5CER B;  3P1U A;  3ZIM A;  2L6J A;  2WXF A;  5CHE E;  1QQE A;  4HLL A;  2ILR A;  4WNF A;  1OY3 D;  1PAQ A;  4BTB A;  1Z5S C;  5BV1 A;  4GTV A;  2Q7F A;  4JC8 A;  1MJ0 A;  3L22 A;  1UG3 A;  1N9A A;  3APF A;  1H2T C;  4IRU A;  2KXP C;  2V5F A;  3QK0 A;  4JL0 A;  1O1R A;  2H6H A;  3FUL A;  3MCX A;  3SQV A;  4LRZ A;  3CV0 A;  1WY6 A;  2UWJ G;  4DLO A;  4YVQ C;  3L08 A;  3RRM B;  3CVW A;  3AJI A;  3KSQ A;  3LJ3 A;  5EDS A;  2M63 A;  2DYR E;  2QZA A;  4BET A;  3VLD A;  1DVP A;  3V79 K;  4ANV A;  3DRA A;  2J09 A;  1KZP A;  2XS1 A;  3IV0 A;  4HOR A;  4BER A;  4N3C A;  1H2U A;  2BTD A;  3CHR A;  5H7P A;  4ILH B;  4R7L A;  3ABK E;  3CIA A;  4JXT A;  5CMW A;  4K5A B;  3VLF A;  4BY6 A;  2CG2 A;  2Y0B G;  2HM8 A;  5FTP A;  1OWP A;  1E8Z A;  3HXE A;  2Y69 E;  2BED A;  2LAI A;  3ZXS A;  4N3A A;  4BES A;  1QZ2 A;  3IKO B;  4LCT A;  3RIB A;  3DSS A;  3PNT B;  4I2Z A;  3HRA A;  4EHM A;  4GTR A;  4G24 A;  1Q2Z A;  3ML8 A;  3JXJ A;  3DWL G;  1GW6 A;  5T3R A;  3JQ1 A;  2XS8 A;  2XPZ A;  3UIN C;  2L6B A;  3S2A A;  1HU3 A;  3DBS A;  2CFZ A;  4HOS A;  3G2T A;  3NOG D;  2MOW A;  4GPM A;  1MX2 A;  5AJL A;  3D9I A;  1HXI A;  4EZL A;  4PS3 A;  4BX9 A;  4DJA A;  3UQ3 A;  4ILI A;  3ZGQ A;  4A1S A;  3DST A;  4ATG A;  3G2U A;  3U4T A;  5ANL A;  4CEM A;  2R2L A;  4DI4 A;  5CRU A;  5G2N A;  3UIP C;  3FTW A;  2XCB A;  3CEQ A;  2FBN A;  3WXX A;  4YDW A;  3FU6 A;  1OCR E;  2OVB A;  2XQ0 A;  2V8S E;  3SO8 A;  2ZXW E;  5EYL A;  2HYZ A;  2FI7 A;  2RFA A;  5AAO A;  3D9N A;  4BX8 A;  4O60 A;  1BI7 B;  4DX5 D;  4W9R A;  3AS5 A;  2RD0 A;  3ASF A;  3UTM A;  1AP7 A;  3PDN A;  4TV3 A;  3C72 A;  3FUE A;  5KBA A;  5ENP D;  4WND A;  3CHP A;  1NP7 A;  3QKY A;  2IEJ A;  4EEC A;  2WMO A;  2FO1 E;  4GA1 A;  2Y3A A;  2WXO A;  3B7T A;  3PRZ A;  2H6G A;  4K0R A;  4ANU A;  4Q94 A;  1QBQ A;  3UM3 A;  1RZ4 A;  2B6C A;  1OCO E;  5G55 A;  3NQP A;  2OV8 A;  4U8Y D;  2WXN A;  4GML A;  3HIZ A;  5AQ9 A;  4HOU A;  5KJN A;  1TEZ A;  5J90 A;  3E37 A;  3CVQ A;  5ARG A;  4EQF A;  3ZHE A;  5EID A;  3PUK A;  3FUK A;  3UMV A;  4I6G A;  1K1B A;  4F53 A;  3NOC D;  1MQS A;  4JA7 A;  4URK A;  3AG3 E;  3E30 A;  3W9F A;  4TXP A;  3MV3 B;  1UJK A;  4XE0 A;  3VLE A;  3FUJ A;  2VTB A;  1U3D A;  2XHE A;  1MX6 A;  4Y6C A;  1DNP A;  3Q15 A;  4XI9 A;  3SD5 A;  4CCA A;  3CK7 A;  4L2Y A;  2WMN A;  3P2B A;  4KXK B;  5B1A E;  1N0R A;  4HRL A;  4GMJ A;  4CT4 A;  5D0Q D;  3NAW A;  1JPL A;  2IFU A;  3E33 A;  3TXN A;  1FT2 A;  2XRY A;  4YDY A;  2PL2 A;  3LY9 A;  2XGO A;  3Q7F A;  2CHX A;  2MHK A;  1EDU A;  4U7E B;  5D66 A;  5ENN A;  2XPY A;  3DSW A;  5LX8 A;  4GTM A;  1S64 A;  5A7D B;  1TR4 A;  3ULY A;  1A5E A;  3K9I A;  5CRV A;  4FU3 A;  2OND A;  3UT7 A;  2GRM A;  1WM5 A;  3OXF A;  2LO6 A;  2LNI A;  1TN8 A;  3E32 A;  3GW4 A;  4AP2 A;  2J8S D;  3SBT B;  2VGX B;  2KZT A;  2DIW A;  3U9W A;  3SF4 A;  2FO7 A;  2KM4 A;  2EIK E;  1H6K A;  2KCV A;  3B95 A;  3O4Z A;  3OXG A;  4CT0 A;  3ABL E;  2BKK B;  4I1M A;  4C48 B;  5EIB E;  3Q4A B;  1E8W A;  3RRU A;  1TN7 A;  1A17 A;  5EN5 D;  2WXI A;  5KJK A;  5DBK A;  3LY7 A;  1NA0 A;  4N2Q A;  4TXR A;  4WWO A;  2F8X K;  4CDN A;  5JJ7 A;  1H19 A;  3EU9 A;  3JQ0 A;  3PEV B;  4BFR A;  4UWH A;  5JHB A;  3NBN B;  2CHW A;  1OUV A;  3S7F A;  3RU0 A;  1HG2 A;  2BUG A;  4UWK A;  3FP3 A;  4XI0 A;  1TYQ G;  4G25 A;  3UUX A;  4KZC A;  3ZW3 A;  3TL5 A;  3ZPJ A;  1HO8 A;  3HXC A;  3DPD A;  3MA5 A;  2OCC E;  4GTP A;  4ACL A;  4B8C B;  2C2L A;  4UUC A;  2VYI A;  4WNE A;  2I2O A;  4I9C A;  2J4B A;  3GZ1 A;  3PE3 A;  1BD8 A;  4DPR A;  3IXE A;  3ZYQ A;  4GYW A;  2ETC A;  2HE0 A;  2QYU A;  4UI9 J;  2PQR A;  3ULQ A;  5FIN A;  3EIJ A;  2NXP A;  3FHE A;  3UM0 A;  3PZ4 A;  4KVO A;  2E0I A;  3HXB A;  2LSU A;  3S7B A;  4DLQ A;  3TJP A;  1LD8 A;  1N4P A;  4KBQ A;  3TWV A;  2UY1 A;  3R7Q A;  1N11 A;  4U8V D;  4HLE A;  1TN6 A;  4KYO B;  1WG0 A;  4J0U A;  1HH8 A;  2Y4T A;  3Q5M A;  3LVR E;  4EBA G;  3FUM A;  4UI9 K;  2LXM A;  5KNH D;  3ESL A;  3U3W A;  4PDX A;  3QWW A;  1K3Z D;  3RKV A;  1H2V C;  4GYY A;  4G26 A;  3QAR A;  3Q49 B;  3LJN A;  3FU5 A;  1S70 B;  5LCW C;  2F0Y A;  5DIZ A;  3RSE G;  1OCZ E;  1YMP A;  3C3Q A;  5G05 C;  2P9K G;  1DC2 A;  3EJN A;  4HNA D;  2WM9 A;  2RG8 A;  2OOE A;  1IQU A;  4JEH A;  2VGE A;  1OWO A;  2NYJ A;  3ZXP A;  3Q78 A;  4UQX A;  2EIM E;  1BI8 B;  4ABN A;  4UQY A;  3ML9 A;  2WXH A;  4ZHB A;  1G3N B;  3CHQ A;  2V5Q C;  4O6F A;  3APC A;  5G04 C;  3UKU G;  4AXH A;  3MV2 B;  5JHA A;  3CQC B;  2R02 A;  3Q75 A;  3CVU A;  3ZU7 B;  1ELW A;  4IYP A;  4I9E A;  3AS4 A;  3OXL A;  3MGB A;  1FVF A;  2YIN A;  4HFG A;  2J4D A;  1EPU A;  2YHC A;  2IY0 C;  3UT4 A;  1YYH A;  3QNK A;  3WG7 E;  4B94 A;  2P9P G;  2LAH A;  2OEV A;  3TWW A;  2P58 C;  3UX4 A;  5AQA A;  2AXU A;  1UW4 B;  1SZA A;  4TRQ A;  2V4H C;  1KZO A;  3RAU A;  1N54 A;  1U3C A;  4WUY A;  3QOU A;  4XEI G;  4GU5 A;  3RK6 A;  3FUF A;  5HRY A;  1TNO A;  1FVH A;  2GRL A;  3SFY A;  3IHV A;  4I1O B;  2E2E A;  1AWC B;  3AU4 A;  2I1K A;  2I6H A;  3L13 A;  4EBA A;  4J6I A;  3NB2 A;  4N2S A;  1TJC A;  4WWN A;  4HS2 A;  3ONK A;  3QWV A;  4B0Z A;  1NI1 A;  4JW1 A;  1DCE A;  3TG5 A;  5AEN A;  2EQX A;  5KJL A;  2XZT G;  2J08 A;  4A55 A;  2ZGG A;  2IO3 C;  2MYO A;  4AY6 A;  5EIL A;  3ZKJ A;  4GZ3 A;  4TXQ A;  3EU5 A;  4X8Q A;  2XGS A;  3TGO A;  2GGF A;  2P9N G;  1IQR A;  3RRN B;  2WXG A;  4NUR A;  4IUL A;  5LOZ A;  3RJV A;  3CGH A;  4OVU A;  2R17 C;  4GCN A;  4HRM B;  2CHZ A;  2ZU6 B;  4ZFH A;  4Q96 A;  3L54 A;  4I2W A;  4K03 A;  4JHJ A;  4DX6 D;  4U8H A;  4EZJ A;  5CMY A;  4U0S A;  5FWQ A;  3ZHE B;  3HG0 D;  1D8D A;  2FUL A;  2WXM A;  5CCM A;  3SFZ A;  4AM9 A;  3MYV A;  3UIO C;  3I3N A;  3EHR A;  1SVX A;  3NF1 A;  1LD7 A;  2VTB B;  4BTA A;  3B13 A;  4ANW A;  4ANX A;  2GW1 A;  4UWG A;  1SZ9 A;  3BG0 B;  3VTY A;  1TNB A;  3UM1 A;  5BPP A;  4PS7 A;  3QDN A;  4C0E A;  2XPI A;  4L9P A;  4MLP A;  3QWP A;  4ME2 A;  3D9O A;  4J8F A;  4B93 B;  2ZIS A;  5KCM A;  4JA9 A;  2C0L A;  4HI9 A;  2HO1 A;  3UI2 A;  1FPP A;  2KBX A;  4KMO A;  1SA4 A;  2L0T B;  2R05 A;  3HHM A;  3V30 A;  2GRO B;  4F7A A;  3PZ3 A;  4MKT A;  2WQH A;  3FUI A;  1ZBP A;  4U07 A;  4GTT A;  4U0U A;  2J07 A;  5FQ6 A;  2DBA A;  3N71 A;  5JMN D;  1IHB A;  3C5R A;  1O5M A;  4ATZ D;  2QC9 A;  5EX0 A;  3TWU A;  1S0P A;  1UOH A;  2JEK A;  4FLH A;  2KZT B;  3DXK G;  5KWD A;  4GA0 A;  4UQZ A;  4HOT A;  3FTS A;  3L16 A;  4NIK A;  3LCA A;  4NQ0 A;  3IHY A;  2X6K A;  4PUC A;  3GYZ A;  2DYS E;  1HG5 A;  1WAO 1;  3ASD A;  2AW6 A;  1UN9 A;  4FJZ A;  5FZQ A;  3PE4 A;  3JUI A;  3FU3 A;  1NFI E;  5T8I A;  3BUA A;  4PS8 A;  3CR3 A;  4M3O A;  4FHJ A;  2H6F A;  3U64 A;  4F1S A;  5AYW D;  4FHK A;  4U0Z A;  3ASH A;  1Z6T A;  5ANR A;  4XIF A;  3MX3 A;  5AN8 A;  4MS6 A;  3KAE A;  4F3V A;  1N4S A;  3TWS A;  5IY5 E;  5AIJ A;  3CHO A;  2VSN A;  3ONL A;  4A3T A;  2XGM A;  3ZVV A;  3T8M A;  3FEX A;  4XZ4 A;  1X5B A;  4RG6 A;  5FQ7 A;  4Z68 A;  2AWI A;  3JCK C;  3J5Q B;  3R9A B;  1N4R A;  4XX5 A;  5JA4 D;  1QNF A;  2PM7 A;  1JCS A;  2KC7 A;  3MKQ B;  3SZ7 A;  3MJW A;  4APO A;  4HRN A;  4Q69 A;  2KAT A;  3I4G A;  5ENS D;  3TAX A;  2DZN A;  3ZFW A;  4CGV A;  3DSV A;  4DI3 A;  1E96 B;  4DK5 A;  4AIF A;  1DCQ A;  4APF A;  4GZD A;  1HX8 A;  2XCC A;  2DWZ A;  4FLB A;  3FUD A;  1YCS B;  1O1S A;  1IYG A;  3HVE A;  3ABM E;  3SI5 A;  4N5C A;  4BWR A;  4MBG A;  1BU9 A;  1O1T A;  2YHE A;  3LPZ A;  4OYS A;  3HYM B;  4N3B A;  3KSL A;  1SW6 A;  3SBS A;  3CVL A;  3TXM A;  3Q9U C;  4G11 A;  2C0M A;  1OXJ A;  4HQD A;  4GCO A;  2XEV A;  4JPS A;  2WB2 A;  3EDT B;  4A3V A;  3CVP A;  1MZC A;  5ARF A;  1U2V G;  2PNN A;  4P29 A;  3BQO A;  4I6J A;  3FTV A;  2PQN A;  2VGX A;  3TWR A;  1TJF A;  4GZ6 A;  3KS2 A;  2NSZ A;  3CHM A;  3L9T A;  1OCC E;  2WXP A;  4FP7 A;  2IO2 C;  4JEU A;  1V55 E;  4GPK A;  2ION A;  4G8K A;  4DX1 A;  5HS0 A;  2PM6 A;  4GZ5 A;  3EIQ C;  2XZD G;  4YDE A;  4H7X A;  2CG3 A;  3C3R A;  4E85 A;  5FQ4 A;  3PNL B;  3VTX A;  1XGW A;  5HI7 A;  4G8L A;  5ENR D;  2DVW A;  5CED B;  3LS8 A;  2AXZ A;  5EX3 A;  5HQ8 A;  1N95 A;  4U04 A;  5E76 A;  5G04 J;  4C9B B;  3AS8 A;  1TNU A;  3V2X A;  4RVB A;  4JHK A;  3ZNG A;  4IN3 B;  1LF8 A;  3PZ1 A;  4L2L A;  4GYO A;  1H6P A;  4GTO A;  3IEG A;  3D9L A;  3EUV A;  5KNG A;  1JCQ A;  5T4Y A;  1NZN A;  3EHM A;  3CLJ A;  2P9U G;  4LSZ E;  5B3S E;  3R7R A;  4OVV A;  1HE8 A;  3LY8 A;  3ASG A;  2GRR B;  1YA0 A;  3CK9 A;  3NZS A;  5JJ6 A;  3FTY A;  2NC9 A;  3FUH A;  4QFV A;  3S7D A;  3B7U X;  1PC2 A;  4O1P A;  3FTU A;  4GTS A;  3PZ2 A;  4G2V A;  4LG6 A;  2I1J A;  4LEU A;  3AG1 E;  4N5Q A;  3D9P A;  4BT8 A;  5JJT A;  3CVY A;  1H6O A;  3L82 A;  4AJW A;  1ELK A;  4FJY A;  1TNZ A;  3PZD A;  4UWL A;  2OEW A;  4U96 D;  4D10 C;  4JZY A;  5J08 A;  4AY5 A;  3UM2 A;  2QY7 A;  5A6C A;  1IXV A;  3PRE A;  3D9K A;  2V0P A;  1Z3X A;  2WXJ A;  5FJY A;  4HBD A;  2GRP B;  3BU8 A;  3R9M A;  3V31 A;  3CST A;  3SNX A;  4K5B A;  1UN8 A;  1Z3Y A;  5E75 A;  4CDM A;  4I43 A;  5HKP A;  1E7V A;  2P9I G;  3JYS A;  4I17 A;  1BLX B;  2VSY A;  1JUQ A;  2A5E A;  4YND A;  2X6J A;  3G2W A;  2L0I A;  3UT8 A;  2LSV A;  4BT9 A;  1PY1 A;  1HF8 A;  3G2V A;  3F6Q A;  5FQ8 A;  3AU5 A;  3B7R L;  3TWQ A;  4JVS A;  4CRW A;  4PH4 B;  4F6R D;  3ULE G;  3MZL B;  2VGY A;  2IOL A;  1JWF A;  4AOF A;  1QYM A;  1N4Q A;  2YQ8 A;  4J8Y A;  3E4B A;  4RQI A;  1TNY A;  3DEO A;  4I1A A;  3ZN3 A;  1KT0 A;  4NAC A;  2R03 A;  1D9S A;  1FT1 A;  2BF0 X;  2P9S G;  3B7S A;  3ISM C;  2WPV A;  3UPV A;  3D9J A;  3SGH A;  2GRN B;  3LXU X;  4AEZ C;  3L17 A;  1FCH A;  3ZEF A;  4G1T A;  3O48 A;  2CFU A;  4DX7 D;  1WDY A;  3DPY A;  5FIO A;  2RFM A;  3LDZ A;  3CQG B;  3MKR A;  1K8K G;  3FH8 A;  2LUH A;  2YNQ A;  3KEZ A;  5BXO A;  3SFX A;  1ELR A;  2PZI A;  3D9H A;  3QC1 A;  3JXI A;  5EKQ D;  3URZ A;  4B8A A;  2ZIR A;  4QQI A;  1XNF A;  1E8Y A;  1UJJ A;  3Q9N C;  2DCP A;  4DX2 A;  4Y6W A;  4RLY A;  4J8S A;  5KJM A;  3C3O A;  2WQ7 A;  3MEK A;  3CVV A;  3BEE A;  4EPZ A; 
#chains in the Genus database with same CATH homology
 3JUI A;  2Q7F A;  3FU3 A;  1KLX A;  3PE3 A;  2MRI A;  4JC8 A;  3L22 A;  5T8I A;  1UG3 A;  3FU0 A;  3ZYQ A;  4DPR A;  4PS8 A;  4GYW A;  3CR3 A;  4M3O A;  3RO3 A;  4I6E A;  3L6A A;  3APF A;  4FHJ A;  1H2T C;  1HFA A;  4IRU A;  2WXQ A;  2V5F A;  4UI9 J;  5BV0 A;  2PQR A;  3ULQ A;  3QK0 A;  3U64 A;  4JL0 A;  4F1S A;  3EIJ A;  2WXL A;  3FUL A;  3MCX A;  5AYW D;  4FHK A;  4U0Z A;  2NXP A;  3ASH A;  3FHE A;  3BG1 B;  1BPO A;  4LRZ A;  1Z6T A;  4BSX A;  4KVO A;  5ANR A;  1INZ A;  3CV0 A;  2E0I A;  4XIF A;  2LSU A;  3S7B A;  1WY6 A;  2UWJ G;  4DLO A;  4DLQ A;  2JLB A;  4YVQ C;  4TUU A;  4L1B A;  3MX3 A;  3L08 A;  3RRM B;  4MS6 A;  3CVW A;  3KAE A;  4L23 A;  3TJP A;  4F3V A;  4KBQ A;  3LJ3 A;  4GAA A;  5EDS A;  2M63 A;  3KD7 A;  1MHQ A;  5AIJ A;  3FH5 A;  1Y8M A;  2UY1 A;  3CHO A;  2VSN A;  3ONL A;  4A3T A;  3VLD A;  1DVP A;  3OAW A;  3R7Q A;  1E7U A;  2XGM A;  3ZVV A;  3T8M A;  2J9Q A;  3FEX A;  4HLE A;  3APD A;  4KYO B;  4ANV A;  3Q47 B;  4AV7 A;  4XZ4 A;  4GB9 A;  4J0U A;  1HH8 A;  2J09 A;  1X5B A;  4RG6 A;  4WWP A;  5FQ7 A;  2Y4T A;  3Q5M A;  3IV0 A;  4HOR A;  3LVR E;  2AWI A;  4EBA G;  3JCK C;  4N3C A;  3FUM A;  4UI9 K;  3R9A B;  5M72 A;  3LEW A;  1H2U A;  3ESL A;  2BTD A;  3CHR A;  5AJD A;  4E6H A;  4ILH B;  4R7L A;  3U3W A;  4PDX A;  3CIA A;  3QWW A;  1EF1 C;  3IBE A;  4JXT A;  3RKV A;  1H2V C;  5CMW A;  1VDY A;  4XX5 A;  3CSF A;  1QNF A;  4GYY A;  4G26 A;  2PM7 A;  3FDH A;  3QAR A;  2KC7 A;  3Q49 B;  3VLF A;  3MKQ B;  4BY6 A;  3EHN A;  2CG2 A;  3SZ7 A;  4CGW A;  2HM8 A;  5FTP A;  3FU5 A;  1OWN A;  1OWP A;  1E8Z A;  1ZU2 A;  3MJW A;  4JHR A;  4APO A;  4Q69 A;  2KAT A;  3I4G A;  4L7T A;  5FZS A;  3TAX A;  2LAI A;  5LCW C;  5DIZ A;  3ZFW A;  5G2N A;  2KCK A;  3ZXS A;  4B89 A;  4CGV A;  4DI3 A;  4N3A A;  5BUZ A;  1QZ2 A;  1E96 B;  3IKO B;  4LCT A;  5G05 C;  4DK5 A;  4AIF A;  4APF A;  2VSO E;  3RIB A;  3PNT B;  4GZD A;  4KVM A;  1HX8 A;  2XCC A;  3EJN A;  4G23 A;  3PVL A;  4I2Z A;  3S7J A;  4FLB A;  3FUD A;  1IYG A;  2R5S A;  2WM9 A;  2RG8 A;  2X6F A;  4FAD A;  4G24 A;  2OOE A;  1IQU A;  3HVE A;  4LER A;  3ML8 A;  4JEH A;  3SI5 A;  1OWO A;  4N5C A;  4XKC A;  4BWR A;  1GW6 A;  4FC8 A;  3PH0 C;  5T3R A;  2YHE A;  3LPZ A;  4UQX A;  3JQ1 A;  2XPZ A;  2QFC A;  4OYS A;  3S2A A;  1HU3 A;  3HYM B;  4N3B A;  3DBS A;  4ABN A;  2CFZ A;  4UQY A;  3G2T A;  3SBS A;  4HOS A;  1L5J A;  3CVL A;  3ML9 A;  2MOW A;  2WXH A;  3TXM A;  2WXR A;  5FZR A;  5AJL A;  2X3M A;  3D9I A;  3CHQ A;  1HXI A;  4EZL A;  4PS3 A;  4G11 A;  2C0M A;  4BX9 A;  1Y6I A;  4GCO A;  2XEV A;  3APC A;  4JPS A;  4O6F A;  5G04 C;  3CHS A;  3EDT B;  2WB2 A;  4H7Y A;  4A3V A;  4DJA A;  3CVP A;  3UQ3 A;  4AXH A;  5ARF A;  2R59 A;  3MV2 B;  4ILI A;  3ZGQ A;  4P29 A;  5JHA A;  3CQC B;  4A1S A;  3CVU A;  4J8D A;  4ATG A;  1ELW A;  4I6J A;  3FTV A;  3G2U A;  5ANL A;  3U4T A;  4CEM A;  4FA6 A;  2PQN A;  2VGX A;  4IYP A;  4I9E A;  4RG9 A;  3AS4 A;  4DI4 A;  3GZS A;  3OXL A;  1TJF A;  3MGB A;  3KS2 A;  1OWM A;  2NSZ A;  1FVF A;  2YIN A;  3FTW A;  4GZ6 A;  4HFG A;  2J4D A;  3CHM A;  3U66 A;  1EPU A;  2VQ2 A;  2YHC A;  2WXP A;  4KT6 B;  4FP7 A;  2XCB A;  3CEQ A;  2FBN A;  4JEU A;  3WXX A;  4GPK A;  4NRH B;  2ION A;  3FU6 A;  2OVB A;  3OTN A;  3SHF A;  3UT4 A;  3QNK A;  2X6H A;  2XQ0 A;  4B94 A;  2PM6 A;  2LAH A;  3LKU A;  4GZ5 A;  5BNW A;  3EIQ C;  3PUJ A;  2P58 C;  3HVE B;  3FFL A;  2V8S E;  4H7X A;  3UX4 A;  2CG3 A;  2AXU A;  2IF4 A;  1UW4 B;  1SZA A;  3TG4 A;  1HS6 A;  4TRQ A;  4E85 A;  2HYZ A;  5FQ4 A;  4YVO A;  3PNL B;  3CKC A;  3VTX A;  5LFA A;  1XGW A;  5HI7 A;  2FI7 A;  1N54 A;  3D9N A;  2VSX E;  3LS8 A;  1U3C A;  2AXZ A;  4BX8 A;  5EX3 A;  4U63 A;  4WUY A;  5HQ8 A;  4W9R A;  3AS5 A;  3C98 A;  3QOU A;  4U04 A;  2RD0 A;  3ASF A;  4GU5 A;  3RK6 A;  4CDR A;  3T5V A;  5E76 A;  5G04 J;  4C9B B;  3AS8 A;  3PDN A;  4TV3 A;  4RVB A;  3FUF A;  1IHG A;  5CCL A;  1FVH A;  2GRL A;  4JHK A;  3FUE A;  4IN3 B;  3IHV A;  1LF8 A;  4WND A;  2IOS A;  4I1O B;  4L2L A;  2E2E A;  3CHP A;  1NP7 A;  4GYO A;  3QKY A;  3IEG A;  3D9L A;  4EEC A;  3QJZ A;  1E90 A;  2WMO A;  5C2Y A;  1OWL A;  4GA1 A;  5T4Y A;  2Y3A A;  3AU4 A;  1NZN A;  3EHM A;  2WXO A;  2A4Z A;  2I1K A;  3PEU B;  2I6H A;  2IQC A;  3B7T A;  3PRZ A;  3CLJ A;  3L13 A;  4K0R A;  4J8E A;  4EBA A;  4J6I A;  1N52 A;  4ANU A;  4Q94 A;  4N2S A;  2L9B A;  1TJC A;  4WWN A;  3R7R A;  4OVV A;  1HE8 A;  3LY8 A;  3ASG A;  4HS2 A;  5G55 A;  3ONK A;  3QWV A;  4MRU A;  3NQP A;  1YA0 A;  2IJG X;  2OV8 A;  3CK9 A;  3NZS A;  4V3I A;  5JJ6 A;  3FTY A;  2A5U A;  4B0Z A;  2WXN A;  2VJ8 A;  3HIZ A;  4GML A;  4HOU A;  2NC9 A;  5KJN A;  1B89 A;  1JWG A;  4JW1 A;  3FUH A;  4WAF A;  1TEZ A;  3TG5 A;  5AEN A;  2EQX A;  4GA2 A;  5KJL A;  4QFV A;  5J90 A;  2J08 A;  4XKB A;  3S7D A;  3B7U X;  4A55 A;  3CVQ A;  1NA3 A;  2UY1 B;  2WXK A;  5ARG A;  4EQF A;  1PC2 A;  2Y4U A;  5A23 A;  3ZHE A;  1EYH A;  3FTU A;  3QB2 A;  3PUK A;  4AY6 A;  4G2V A;  3FUK A;  5BT1 A;  2XRZ A;  3UMV A;  4I6G A;  4GZ3 A;  3I4R B;  1H0A A;  2I9C A;  2I1J A;  2X6I A;  4LEU A;  2FEZ A;  4F53 A;  1W3B A;  1MQS A;  3CVN A;  3D9P A;  4JA7 A;  3FEY A;  4URK A;  3LYA A;  4BT8 A;  3MV3 B;  4GZC A;  5JJT A;  1UJK A;  3CVY A;  2XGS A;  4XE0 A;  3VLE A;  2AXV A;  3FUJ A;  3TGO A;  2VTB A;  1U3D A;  2GGF A;  2X38 A;  2XHE A;  4Y6C A;  3FTZ A;  1DNP A;  3Q15 A;  4XI9 A;  3SD5 A;  1IQR A;  4AJW A;  4CCA A;  2WQ6 A;  3ZRH A;  3CK7 A;  1ELK A;  3RRN B;  4FJY A;  4C0E A;  4L2Y A;  2WMN A;  3PZD A;  4UWL A;  3P2B A;  2WXG A;  4NUR A;  4IUL A;  4KXK B;  4D10 C;  5C1D A;  5LOZ A;  3RJV A;  4JZY A;  3CGH A;  4GMJ A;  4CT4 A;  5D0Q D;  3ZYK A;  5J08 A;  1P5Q A;  4AY5 A;  4OVU A;  1JPL A;  4FUL A;  2QY7 A;  2R17 C;  3FUN A;  4HOQ A;  2IU1 A;  2IFU A;  5A6C A;  5LCW J;  4GCN A;  3I5P A;  3PRE A;  3TXN A;  2XRY A;  5BW8 C;  3D9K A;  2V0P A;  3D9M A;  2CHZ A;  5G05 J;  3D3M A;  2ZU6 B;  3ZYL A;  1Z3X A;  4KZ0 A;  4Q96 A;  2PL2 A;  3L54 A;  4I2W A;  3LY9 A;  2WXJ A;  2XGO A;  5FJY A;  4K03 A;  4JHJ A;  1E8X A;  1HZ4 A;  2CHX A;  4U8H A;  4EZJ A;  2MHK A;  3CST A;  3SNX A;  5CMY A;  4ILG A;  4U0S A;  1EDU A;  1UN8 A;  1Z3Y A;  5ENN A;  2KCL A;  5E75 A;  5FWQ A;  2HR2 A;  3ZHE B;  4AVX A;  2WVI A;  2XPY A;  4CDM A;  3MKQ A;  3CKB A;  2FUL A;  1KT1 A;  4I43 A;  2WXM A;  5CCM A;  1E7V A;  3JYS A;  5LX8 A;  4I17 A;  3SFZ A;  4AM9 A;  3MYV A;  2VSY A;  1JUQ A;  5A7D B;  3I3N A;  4YND A;  3K9I A;  4FU3 A;  2OVF A;  2OND A;  3UT7 A;  2X6J A;  3ESK A;  4UWF A;  5LP0 A;  2GRM A;  3NF1 A;  3G2W A;  4BTA A;  3ZYM A;  3B13 A;  4ANW A;  2L0I A;  3UT8 A;  1WM5 A;  2VTB B;  3G2S A;  2LSV A;  3OXF A;  2LO6 A;  2LNI A;  3HDX A;  4ANX A;  4BT9 A;  1PY1 A;  1HF8 A;  2GW1 A;  4UWG A;  1SZ9 A;  3BG0 B;  3G2V A;  3GW4 A;  3FTX A;  5FQ8 A;  3VTY A;  3CVX A;  5D0O D;  3AU5 A;  3B7R L;  4JVS A;  5BPP A;  4PS7 A;  3QDN A;  4AP2 A;  5KJK A;  4CRW A;  2VGX B;  2XPI A;  2KZT A;  2DIW A;  4MLP A;  3QWP A;  4PH4 B;  3SBT B;  4ME2 A;  3SF4 A;  3U9W A;  4C0M A;  3LVQ E;  3MZL B;  2VGY A;  2IOL A;  3D9O A;  1JWF A;  4J8F A;  2FO7 A;  4WNG A;  4AOF A;  4N39 A;  1SQM A;  2KM4 A;  1H6K A;  2YQ8 A;  2KCV A;  3E4B A;  3FH7 A;  3T5X A;  5KCM A;  4JA9 A;  2C0L A;  3O4Z A;  4I1A A;  3OXG A;  3RO2 A;  1KT0 A;  3ZN3 A;  2HO1 A;  4NAC A;  4A1G A;  4CT0 A;  2FF4 A;  2BF0 X;  5FT9 A;  4I1M A;  4KMO A;  2L0T B;  3NZU A;  3Q4A B;  3GZ2 A;  3B7S A;  1E8W A;  2WPV A;  3HHM A;  3UPV A;  3RRU A;  4ACK A;  2AVP A;  1A17 A;  3D9J A;  4F7A A;  4EZK A;  4LUN U;  3FWV A;  3SGH A;  3ENE A;  3LXU X;  4HXI A;  4MKT A;  4AEZ C;  3L17 A;  2V4L A;  2WQH A;  2WXI A;  1ZBP A;  3FUI A;  4RSY A;  1FCH A;  4U07 A;  3LY7 A;  1NA0 A;  5DBK A;  3ZEF A;  4HVB A;  4N2Q A;  4U0U A;  2J07 A;  4G1T A;  5FQ6 A;  3O48 A;  4WWO A;  2J49 A;  3QAQ A;  2DBA A;  3N71 A;  3FY4 A;  4CDN A;  4UI9 C;  2CFU A;  5JJ7 A;  1H19 A;  3CK8 A;  3JQ0 A;  3PEV B;  3LDZ A;  3CQG B;  5EX0 A;  3MKR A;  3FH8 A;  4BFR A;  1S0P A;  3PS6 A;  2JEK A;  2YNQ A;  3KEZ A;  4FLH A;  1ELR A;  2KZT B;  3P1U A;  4UWH A;  3ZIM A;  2PZI A;  5JHB A;  3QC1 A;  2CHW A;  2L6J A;  1OUV A;  5EKQ D;  3S7F A;  3URZ A;  2WXF A;  3RU0 A;  4GA0 A;  4B8A A;  4UQZ A;  1HG2 A;  3FTS A;  3L16 A;  5CHE E;  4HOT A;  2BUG A;  4UWK A;  3FP3 A;  3LCA A;  4NQ0 A;  4XI0 A;  4G25 A;  3UUX A;  4KZC A;  3IHY A;  3ZW3 A;  2X6K A;  4PUC A;  3GYZ A;  1XNF A;  3TL5 A;  1E8Y A;  1UJJ A;  3ZPJ A;  1QQE A;  1HO8 A;  3DPD A;  2DCP A;  3MA5 A;  4ACL A;  4Y6W A;  2ILR A;  1HG5 A;  1WAO 1;  4WNF A;  4B8C B;  2C2L A;  4J8S A;  3ASD A;  2AW6 A;  2VYI A;  4WNE A;  1UN9 A;  2I2O A;  4FJZ A;  1PAQ A;  4I9C A;  5KJM A;  4BTB A;  5FZQ A;  5BV1 A;  3MEK A;  2J4B A;  2WQ7 A;  3GZ1 A;  3PE4 A;  3CVV A;  3BEE A;  4EPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...