2WPVA

Crystal structure of s. cerevisiae get4-get5 complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
281
structure length
281
Chain Sequence
KLAKTLQRFENKIKAGDYYEAHQTLRTIANRYVRSKSYEHAIELISQGALSFLKAKQGGSGTDLIFYLLEVYDLAEVKVDDISVARLVRLIAELDPSEPNLKDVITGMNNWSIKFSEYKFGDPYLHNTIGSKLLEGDFVYEAERYFMLGTHDSMIKYVDLLWDWLCQVDDIEDSTVAEFFSRLVFNYLFISNISFAHESKDIFLERFIEKFHPKYEKIDKNGYEIVFFEDYSDLNFLQLLLITCQTKDKSYFLNLKNHYLDFSQAYKSELEFLGQEYFNIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0363 PROTEIN YOR164C
publication title Crystal Structure of Get4-Get5 Complex and its Interactions with Sgt2, Get3, and Ydj1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 121
structure length 281
sequence length 281
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04190 DUF410 Protein of unknown function (DUF410)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wpvA00
4I1AA 4N3AA 3CVQA 3TG4A 3RU0A 1KLXA 4UI9K 1IHGA 1YA0A 4BTBA 2PL2A 4BT9A 2BUGA 1ELRA 4N3CA 3Q47B 4IN3B 5KJMA 4U0SA 1B89A 2Y4TA 5G05C 4AM9A 3U4TA 4ABNA 2FF4A 4GPKA 4N2QA 3QKYA 5EKQD 4UQYA 5FJYA 4WNGA 4XI0A 4EQFA 4G26A 3GW4A 5D0OD 3FP3A 3LY9A 2KATA 2XPIA 2UY1B 3RKVA 2VQ2A 3U3WA 2C2LA 2VYIA 3Q5MA 3GZ2A 4I9EA 2WQHA 2UWJG 5EX3A 1IYGA 5DBKA 4G2VA 2HO1A 4H7YA 1E96B 4G1TA 3MA5A 2IF4A 4G23A 3OXLA 4AY5A 4GA1A 3KS2A 3Q4AB 4YVQC 4GZ5A 4CGWA 2V5FA 5LCWJ 2VGXB 1ZU2A 3ZHEA 5C1DA 1HZ4A 3LY7A 3ZGQA 2C0MA 4A1SA 4U0ZA 3QWPA 3ASGA 2P58C 3CV0A 3AS5A 1Y8MA 3RIBA 3EDTB 4WNFA 5CCLA 3VTYA 3LY8A 5G04J 3TAXA 4AIFA 3TG5A 5BNWA 2I6HA 2XGMA 4J8EA 1A17A 2PQNA 5JJ6A 2FI7A 4UQXA 5BT1A 2L6JA 1WM5A 2KCLA 5JJ7A 5DIZA 4I17A 3KD7A 4HOUA 5M72A 2FO7A 5D0QD 4GA2A 3ASFA 1ZBPA 2XGSA 3HYMB 3S7DA 4AY6A 5FTPA 3NF1A 1OUVA 2GW1A 3ZN3A 3LKUA 4N39A 3CK8A 2QFCA 3CVNA 2HYZA 3GYZA 4Y6WA 2KCKA 3ASDA 2NC9A 2Y4UA 4NRHB 3VTXA 3URZA 2LSUA 1HH8A 3QDNA 2YHCA 3R9AB 3TGOA 1KT1A 3BEEA 4H7XA 4XI9A 4J8FA 3JYSA 2WPVA 5EX0A 4JA9A 2DBAA 4WNDA 1HXIA 4HORA 5FZRA 2XCCA 5KJNA 4KBQA 2IFUA 3LCAA 3Q15A 3FFLA 1WAO1 2JLBA 3OXGA 2HR2A 3QWWA 4BT8A 1NZNA 2AVPA 3SF4A 4HOSA 4UI9J 3CK7A 4N5CA 2UY1A 4GYOA 2ONDA 4RG6A 3IEGA 3UQ3A 1NA0A 2E2EA 4WNEA 5HQ8A 2XGOA 3PDNA 4JL0A 4KXKB 3AS4A 4U04A 3WXXA 3RJVA 4J0UA 2XCBA 2MHKA 4UQZA 2KC7A 4GA0A 2PQRA 3CKCA 3CVPA 2YQ8A 5LCWC 2VGXA 4RG9A 5G05J 3KAEA 3MEKA 3Q49B 4YVOA 4I9CA 5ARGA 2FBNA 3UUXA 5FZQA 3QWVA 4U0UA 2XEVA 4GYWA 3S7JA 3CEQA 4WUYA 1KT0A 1QQEA 3ESKA 4JA7A 3CVLA 5G04C 4BWRA 1PC2A 3SZ7A 4KYOB 5KJLA 5ARFA 2VSNA 1P5QA 5FZSA 5KJKA 4F3VA 4NQ0A 4N3BA 2LNIA 4G24A 4HOQA 2OOEA 4GZ3A 3RO2A 3CK9A 3MKRA 5A7DB 3LYAA 5CHEE 4CGVA 3O48A 1QZ2A 4GCNA 4Y6CA 1TJCA 4XIFA 4N2SA 3ZHEB 4LEUA 3UPVA 3S7BA 5JJTA 5AYWD 4G25A 3AS8A 4B94A 5CCMA 5A6CA 3S7FA 4APOA 1W3BA 5BW8C 2R5SA 4I2ZA 4HOTA 2VGYA 2PZIA 3FWVA 4W9RA 1ELWA 3QOUA 1FCHA 4O6FA 2KCVA 5FT9A 3LPZA 2Q7FA 4JHRA 5HI7A 4U07A 3MV2B 1XNFA 3ULQA 3PE3A 3GZ1A 4J8DA 4I2WA 3MV3B 2VSYA 3ASHA 4GYYA 4CDRA 1NA3A 3CKBA 2J9QA 3N71A 4GZ6A 3ZFWA 3OXFA 3E4BA 3PE4A 2LSVA 4BTAA 4GCOA 2FEZA 3RO3A 2C0LA 4UI9C 4YNDA 4ME2A 3ZPJA 3K9IA
chains in the Genus database with same CATH superfamily
2X3MA 4CEMA 4N3AA 4YDYA 3TG4A 3CVVA 5EIDA 3W9FA 5BV1A 1YA0A 4RSYA 4U63A 4BT9A 1N94A 3FUHA 1N4QA 3QAQA 5B3SE 4IN3B 2LAHA 5KJMA 3FU5A 3R7RA 2DYRE 1FT2A 1DVPA 5EKQD 1HE8A 3NZSA 3UM0A 5B1AE 3FUJA 3I3NA 3FP3A 1UJJA 3LVRE 2UY1B 4DX6D 2PM7A 2WXLA 2C2LA 2RD0A 2L6BA 2VYIA 1XGWA 5A23A 2YHEA 4GB9A 4MLPA 3ASOE 5DBKA 2V0PA 3EIJA 1FT1A 4H7YA 1E96B 4DX2A 1V55E 4EZKA 2IF4A 3PNTB 1MX2A 3FUEA 2CHXA 3PRZA 3Q4AB 5HKPA 4GAAA 2P9KG 4PUCA 4CGWA 2DWZA 2V5FA 3HXFA 2WXKA 1UG3A 4PH4B 1LD8A 1HZ4A 1SQMA 3LY7A 3Q75A 4L7TA 3SFYA 3SFZA 2AXUA 3CLJA 2C0MA 5E76A 5AARA 4U0ZA 2P58C 3CV0A 2WM9A 1H19A 4NIKA 4TUUA 3RIBA 5J08A 4AP2A 3FUFA 2I6HA 1E8ZA 4LUNU 5JJ6A 2IU1A 2OCCE 3PH0C 3ZYMA 2KCLA 1S70B 2GRQB 5M72A 3FTUA 1BI7B 2ETAA 4PS7A 2XGSA 3JXJA 3C3OA 3G2TA 4DX5D 4I6GA 1OUVA 2P2CP 1N9AA 1KPSB 4HBDA 3NB2A 4ACLA 2HYZA 3V30A 3CHQA 3V2XA 2WB2A 3EU5A 2R2LA 3TWTA 4Y6WA 1BLXB 3TWUA 2JABA 2OVFA 1OY3D 4BSZB 4FJZA 3MKQB 3G2VA 3I5PA 5JHAA 2XRYA 3LDZA 4C0EA 3QK0A 3E37A 4H7XA 5CECB 3AG3E 3LJ3A 4JEHA 4K5CA 2V8SE 1OCOE 5EX0A 5J90A 3TWQA 4TRQA 5BPPA 2VSOE 4FULA 4CCAA 4APFA 3UIPC 3IHVA 4G8LA 4FA6A 3CHOA 4G11A 3QWWA 4FP7A 4MRUA 1LF8A 3PUJA 1X81A 2UY1A 3APDA 2CFUA 1MYOA 2LO6A 4OVVA 3PZ4A 4RG6A 2XENA 3D9HA 5HQ8A 4KXKB 1SZAA 1WDYA 2LXMA 2J4DA 3G2SA 3AS4A 4U04A 2AJAA 2WXNA 4WWNA 1SA4A 4J0UA 4HFGA 2XCBA 3IXEA 4GA0A 4UQZA 1D9SA 1TN6A 1NFIE 5LCWC 1QYMA 4TUMA 4GTTA 3ASNE 3B7BA 4CDNA 2XZDG 4YVOA 4I9CA 2F8XK 2WXRA 3MX3A 5AQAA 4B8CB 3QWVA 4U0UA 2XEVA 4GYWA 5G04C 3HXEA 4KYOB 1HO8A 1INZA 2VSNA 5FZSA 4FJYA 5KJKA 5EYLA 1DCEA 2RFAA 3ABKE 1E7UA 2MOWA 3IHYA 1H6OA 4Q96A 2XS8A 4B8AA 1LD7A 3O48A 2Y3AA 1TN7A 4N2SA 4GTVA 4CYMD 4ANXA 1HG5A 3S7BA 2GRRB 2QYJA 3APFA 1W3BA 3ZEFA 3UM2A 4HOTA 2PZIA 3FWVA 1E8XA 1ELWA 3LPZA 4GZDA 4L9PA 3UT7A 3FULA 4U07A 4HLEA 5AENA 3ZIMA 3PE3A 4O1OA 2PNNA 3NQPA 3P1UA 3VLDA 3X2QE 2VSYA 3G2UA 1HX8A 3ABLE 4CDRA 3BG1B 4AV7A 1NA3A 4DLQA 2XEHA 1AWCB 2M63A 3CKBA 3UMVA 2J9QA 3N71A 2IJGX 4GZ6A 3S2AA 3U9WA 4XEIG 1IKND 1TJFA 3PZ3A 1WG0A 4EBAA 3ZXSA 1H0AA 2C0LA 3JUEA 1DCQA 3Q9UC 4UI9C 4I1OB 2BKKB 4TXRA 3QJZA 3ZPJA 3Q9NC 3P2BA 3K9IA 4I1AA 4UWLA 4UI9K 4CT0A 1IHGA 2BF0X 2BUGA 3Q47B 3B7RL 5KBAA 3UT4A 2IONA 1B89A 1MX6A 3ONLA 3L82A 3ABME 4K5AB 3C5RA 5ANRA 3QKYA 1NL4A 4K5BA 2QY7A 3NBNB 3FY4A 5ANLA 4EQFA 3U66A 1EDUA 2KBXA 3LY9A 3RRNB 1SZ9A 1TR4A 4A3VA 2KZTA 3RKVA 4JXTA 3T5XA 1DC2A 3U3WA 4G8KA 3D9JA 4LNGA 2GRNB 4Q94A 5FINA 2WXHA 5EX3A 1JCQA 3PUKA 3T8MA 4G2VA 4OVUA 3BQOA 1OCCE 3V31A 4FU3A 4AOFA 4YVQC 3C3QA 3FUKA 1O1RA 3CHSA 2BKGA 2VGXB 1BPOA 3DSXA 4GTPA 2ZU6B 1QBQA 5D2MC 3SFXA 3QWPA 4RQIA 4LG6A 4C0MA 4BX8A 1WY6A 2XPYA 3LY8A 3TAXA 4AIFA 4AJWA 4DUIA 4HRMB 4GMRA 3FTYA 4JD2G 4JW1A 2XGMA 4UQXA 1BI8B 5JJ7A 5DIZA 4HXIA 3KD7A 4CT4A 4MKTA 3SO8A 3VLEA 4BEPA 5D0QD 1UW4B 4GA2A 1ZBPA 2L0TB 3S7DA 2R17C 3LKUA 3D9MA 2HE0A 4GU5A 5H7PA 4XZ4A 2WVIA 3E32A 3CVNA 2L9BA 3NOGD 3GYZA 4BESA 3UTMA 3MGBA 3MJWA 5FQ7A 3ASDA 4WAFA 3UM3A 3VTXA 1E7VA 5T4YA 3URZA 2LSUA 1HH8A 2YHCA 4GTOA 1OWNA 2FULA 3JXIA 3PEVB 4GMJA 1E8YA 3TGOA 2H6FA 5C2YA 3CVXA 3SHFA 1N52A 2ZIRA 3D9PA 3D9KA 3PS6A 3MCXA 2WPVA 2DBAA 1LTXA 4TV3A 4HORA 5FZRA 2XCCA 3L9TA 3L6AA 1PAQA 3DSVA 1WAO1 3MYVA 4ANWA 3OXGA 2HR2A 2XZTG 2WXIA 5CRUA 4BT8A 2NYJA 1NZNA 4I6JA 2AVPA 3SF4A 2WXQA 4JZYA 3CK7A 4N5CA 4HRLA 3KSQA 2R02A 5B1BE 3UQ3A 1NA0A 3AAAC 3T5VA 4GTSA 2XGOA 4L23A 2EIJE 3ZKJA 2VTBB 4C48B 3WXXA 3C98A 3VLFA 1Z5SC 2Y1LE 3B95A 4PDXA 4K0RA 2MHKA 2KC7A 4ACKA 2PQRA 2MRIA 2V5QC 2VGXA 2B0OE 5G05J 2J8SD 1IXVA 3KAEA 1MX4A 3CGHA 3FU0A 3Q49B 1H6PA 2I1JA 2PM6A 2XPZA 4BY6A 3EHMA 5ARGA 2FBNA 5LFAA 4A3TA 2IY0C 5KNHD 4B0ZA 3FEXA 4AXHA 1QQEA 3ESKA 4JA7A 4OAVB 1N4PA 5EILA 1PC2A 3HHMA 5KJLA 5IY5E 1P5QA 1IQRA 3PNLB 3ESLA 3DRAA 2CFZA 4F3VA 3JCKC 4I43A 4N3BA 2P9SG 1H2UA 2LNIA 3FTZA 2OOEA 3RO2A 3TXNA 4DI3A 3EHQA 2CG2A 3MKRA 2ILRA 4DX1A 5G55A 3DEOA 1L5JA 2AXVA 2OEWA 4ATZD 5CHEE 3CHPA 3SGHA 3EHNA 2IQCA 2X6KA 4AVXA 4GTRA 4J8SA 2WQ6A 5AYWD 2X6IA 2A4ZA 4BETA 4G25A 3AS8A 5CCMA 3IBEA 4JVSA 2ZISA 2R5SA 4DRXE 4ILGA 2A5EA 5AIJA 4L2YA 2I1KA 3UI2A 3UX4A 1YCSB 1OWOA 2OEVA 1FCHA 2J09A 2CG3A 4UWKA 2Q7FA 2DVWA 4GMLA 1K1BA 3TXMA 1HG2A 3Q73A 4I2WA 3MV3B 4C9BB 2QYUA 3D9IA 1MZCA 1MJ0A 3RSEG 3ZFWA 3E4BA 3AU5A 1H6KA 3I4RB 4CDMA 1FVFA 2I9CA 4FLBA 3HDXA 4M3OA 4JEUA 4A1GA 4YNDA 3HVEB 4NACA 3CVQA 3HG0D 2VTBA 1TNOA 2RFMA 4BTBA 1JPLA 5HRYA 2PL2A 3TWSA 2RKKA 4YDOA 4E6HA 1ELRA 4N3CA 3FTWA 4BSXA 2GRLA 1KZOA 1JWGA 4UWHA 3FH7A 2IOLA 3L08A 4U8YD 4M7CA 5EYPF 4ABNA 4UUCA 3QNKA 1TNUA 2XS1A 4N2QA 3W9GA 4HNAD 5ENRD 4UQYA 5LOZA 3C3RA 5FJYA 1UJKA 3T9KA 4DLOA 4K03A 4BERA 3KEAA 2KATA 2XPIA 2IEJA 1U2VG 2DIWA 3PZ2A 4KVMA 5CEDB 4D10C 3Q5MA 1N4SA 2I2OA 2UWJG 3MKQA 5AAOA 1H2TC 3CSFA 3L22A 3CIAA 4LERA 2HO1A 1DNPA 3L13A 3MA5A 4G23A 2DCPA 3OXLA 4AY5A 4GA1A 3KS2A 4QQIA 2R03A 5BXOA 1SA5A 1G3NB 1S64A 3AJIA 4RVBA 1ZU2A 5C1DA 3UIOC 3ZNGA 3E34A 3MZLB 2J49A 3ZGQA 2WXMA 3ZUVB 5AJDA 3APCA 4TXPA 3D9OA 3R9MA 2AXZA 3FUMA 2WXFA 3AS5A 1Y8MA 3EDTB 4WNFA 3BU8A 1ELKA 1JCRA 3O4ZA 4ZHBA 1ZB1A 3VTYA 5AQ7A 4LNBA 2DYSE 2BEDA 4J8EA 1A17A 3EIQC 2FI7A 3NZUA 3C72A 5BT1A 2WXGA 2KXPC 4LNUD 2L6JA 1WM5A 2VSXE 4I17A 4HOUA 4ANUA 1UOHA 2ZGGA 3RRMB 4GPMA 3ASFA 2A5UA 3Q79A 1HF8A 3FTVA 4AY6A 3NF1A 2DZNA 4EBAG 5G2NA 3DSWA 4GZCA 1UN9A 4I6EA 4F7AA 4ZFHA 3IV0A 1JWFA 4UWFA 3ZYLA 3TWVA 3HVEA 4F1SA 3UXGA 2NC9A 2WXPA 1OXJA 3TWWA 1JUQA 1NI1A 3PVLA 4XKBA 1MHQA 2VGEA 3R9AB 1TNBA 3QB2A 5JHBA 1E8WA 4V3IA 2E0IA 5LX8A 4HQDA 4KMOA 2IOSA 2J4BA 3FU6A 5KJNA 4KBQA 3AU4A 3Q15A 4WWPA 2H6HA 3E30A 4U7EB 3NAWA 3CR3A 5KWDA 1FVHA 3JQ1A 1O1SA 5EDSA 3EU9A 2VJ8A 4URKA 3FUNA 3IEGA 2XRZA 4WNEA 3QC1A 3ULEG 3ML8A 5BUZA 3PDNA 4JL0A 3CHRA 4NURA 2LXLA 4A63B 2OV8A 4IYPA 5EIBE 4DK5A 2R05A 4KZ0A 4HVBA 4I1MA 5AN8A 1SVXA 5AQ9A 4P29A 3CVPA 3LS8A 2YQ8A 3PZDA 3PZ1A 1U3DA 2J08A 5CMWA 2OVBA 2F8YA 4HI8A 4TXQA 5ENOD 5ITZF 4HI9A 4JPSA 2F37A 3UUXA 5FZQA 2Y0BG 3J5PA 3S7JA 4JB8P 2WMOA 3CEQA 3EUVA 1KT0A 4WUYA 3AG4E 3UKRG 5CERB 4BWRA 1TNYA 5ARFA 3Q78A 2GRMA 3NOCD 3WG7E 4NQ0A 4KT6B 3FUDA 3HXCA 4G24A 3LEWA 1TYQG 4O1PA 5BXUA 1O5MA 3DBSA 3V79K 3ZVVA 4HOQA 3ZW3A 1TN8A 2RG8A 1SW6A 4OAUC 4WWOA 1OT8A 5E75A 3PREA 5A7DB 3FU3A 4CGVA 3FHEA 3IKOB 3ZHEB 1V54E 5JMND 3ZXPA 4LEUA 5JJTA 3B7TA 3SI5A 5A6CA 2BTDA 4J8YA 4KVOA 1N0QA 5BW8C 3CSTA 3OTNA 3LXUX 4DI4A 3DWLG 3CVUA 3T8KA 4W9RA 1K3ZD 1EPUA 3QOUA 5FQ8A 4O6FA 2KCVA 5FT9A 5T8IA 1N11A 3AG2E 2KM4A 2X6JA 4JHRA 1GW6A 3HIZA 3MV2B 3B13A 2H6IA 1XNFA 3ULQA 4F53A 1FPPA 5ENNA 3GZ1A 3D9LA 2HM8A 1HFAA 1HU3A 4J8DA 3FTSA 4DPRA 1Q2ZA 3ASHA 4GYYA 2L0IA 3HXBA 2GGFA 3PEUB 3PE4A 2LSVA 4JHJA 4DJAA 4BTAA 2XEEA 1YMPA 4OYSA 3ZRHA 1Z3XA 3RO3A 1OWPA 1PY1A 3SBSA 4YDEA 4FADA 2QC9A 1NP7A 4R7LA 2ZGDA 3FH5A 3RK6A 5EN5D 1EYHA 2EINE 5AJLA 4U95D 1KLXA 1K1AA 3RU0A 3SBTB 4XE0A 1D8EA 1HS6A 1S0PA 3CHMA 3DEPA 5CRVA 3FTXA 4PS8A 4U0SA 5FQ6A 2Y4TA 5G05C 4AM9A 3U4TA 2J07A 2B6CA 2FF4A 2ETCA 1Z3YA 4GPKA 3KEZA 3TWXA 3LJNA 4GTMA 5JA4D 4L1BA 4FHJA 4J6IA 4F1PA 3E33A 4WNGA 3TWRA 4CRWA 4XI0A 4G26A 3GW4A 5D0OD 3DSTA 3F6QA 4EPZA 2VQ2A 3DSSA 2CHZA 3HRAA 4E85A 3LVQE 2EIME 3BUAA 3GZ2A 1H2VC 2P9PG 4I9EA 2WQHA 2LUHA 3ULYA 1Y6IA 1IYGA 3ONKA 4FC8A 1N0RA 2XQ0A 4EHMA 4G1TA 3BG0B 5FIOA 1K8KG 4GZ5A 4YDWA 1BD8A 3ZYQA 5LCWJ 3DXMG 3ZHEA 3CQGB 1N54A 3OAWA 4A1SA 3ASGA 3EHRA 4Q69A 2EIKE 5CCLA 1UN8A 2AWIA 5G04J 4CZ2D 3ENEA 3TG5A 4BFRA 5ENTD 4U96D 5BNWA 2QZAA 3CQCB 3SNXA 2P9LG 1AP7A 1BU9A 4HB5A 2PQNA 3AG1E 3L16A 4MS6A 4ILIA 1X5BA 4FLHA 1IHBA 1O1TA 3UKUG 3UM1A 2FO7A 5HS0A 3ISMC 3HYMB 3B7UX 5FTPA 3SD5A 2GW1A 2YNQA 1RW2A 3ZN3A 3Q7AA 4N39A 1VDYA 1Z6TA 3CK8A 2QFCA 3R7QA 3DPDA 3HXDA 3CVYA 2KZTB 1N95A 3D9NA 1OCZE 4DX7D 4IULA 4EZJA 2KCKA 3QARA 3FDHA 2Y4UA 3U64A 4NRHB 2WQ7A 2EQXA 4QFVA 1JCSA 3GZSA 4MBGA 5CMYA 2P9UG 4JHKA 3QDNA 4N5QA 5CBOA 1KT1A 3BEEA 4XI9A 4HLLA 2YINA 5AQBA 4J8FA 2NXPA 1KZPA 5ENQD 5CEAA 5LP0A 3JYSA 3J5QB 4JA9A 4WNDA 1HXIA 2NSZA 5ENSD 2IFUA 3FUIA 3LCAA 1S63A 3FFLA 2JLBA 4JC8A 4FHKA 4HOSA 3TL5A 4B89A 4UI9J 5CBNA 2V4LA 1E90A 2Y69E 4GYOA 2ONDA 2X38A 4U8VD 3DSUA 2E2EA 2EILE 3L17A 1EF1C 2IO2C 3JQ0A 1OWLA 2WXOA 4AEZC 2P9NG 2X6FA 3RJVA 4KZCA 3FH8A 1D8DA 4O60A 2XHEA 4XX5A 3CKCA 3UINC 4RG9A 4LSZE 3MEKA 4ANVA 3JUIA 2GRPB 2V4HC 3KSLA 4X8QA 2X6HA 3SQVA 2DZOA 4BX9A 4EECA 2AW6A 5FQ4A 1YYHA 4ILHB 4J7WA 3CVLA 2ETBA 3SZ7A 3RRUA 1N4RA 3ML9A 3SY2A 4Z68A 2H6GA 2LAIA 5BV0A 1QNFA 4GZ3A 4A55A 4PS3A 3CK9A 4L2LA 1OCRE 4XKCA 5KCMA 3LYAA 1QZ2A 4GCNA 4Y6CA 1TJCA 4XIFA 4IRUA 3RAUA 3UPVA 4GTQA 2JEKA 2CHWA 4HRNA 4F6RD 3CVWA 2WXJA 4B94A 2MYOA 3S7FA 4APOA 2GROB 4HS2A 4I2ZA 3V2OA 3ZYKA 2IO3C 4ATGA 3EJNA 2F0YA 2VGYA 2WMNA 3G2WA 3UT8A 1TEZA 4UWGA 5D66A 3FEYA 4U8HA 5HI7A 2ZXWE 2FO1E 4RLYA 5T3RA 3L54A 1A5EA 1OWMA 3D3MA 1IQUA 3Q7FA 4LRZA 3DXKG 5FWQA 1RZ4A 5KNGA 3TJPA 2R59A 3OXFA 4LCTA 3B7SA 5ENPD 3ZU7B 4GCOA 2FEZA 2P9IG 1TNZA 4EZLA 3I4GA 4B93B 4ME2A 1MQSA 1U3CA 3DPYA
chains in the Genus database with same CATH topology
2X3MA 4CEMA 4I1AA 4N3AA 3CVQA 3FH5A 4UWLA 3CVVA 3TG4A 3RK6A 1EYHA 5AJLA 3RU0A 1KLXA 2VTBA 4UI9K 3SBTB 4CT0A 5BV1A 1IHGA 1YA0A 4RSYA 4BTBA 1JPLA 2PL2A 4U63A 4XE0A 4BT9A 1HS6A 4E6HA 1S0PA 3FUHA 3CHMA 2BF0X 2BUGA 1ELRA 4N3CA 3Q47B 3FTWA 4BSXA 2GRLA 3QAQA 4UWHA 1JWGA 3FH7A 3FTXA 3B7RL 4IN3B 2LAHA 5KJMA 4PS8A 4U0SA 3UT4A 2IONA 5FQ6A 1B89A 2IOLA 2Y4TA 5G05C 3L08A 4AM9A 3ONLA 3FU5A 3U4TA 2J07A 4ABNA 3R7RA 3QNKA 2FF4A 1Z3YA 4GPKA 3KEZA 1DVPA 5ANRA 4N2QA 3QKYA 5EKQD 4L1BA 4FHJA 4J6IA 1HE8A 4UQYA 5LOZA 2QY7A 3NZSA 5FJYA 1UJKA 4WNGA 3FY4A 4DLOA 4CRWA 4K03A 4XI0A 5ANLA 4G26A 4EQFA 3U66A 3GW4A 1EDUA 5D0OD 3FUJA 3I3NA 3FP3A 3LY9A 3RRNB 1SZ9A 2KATA 2XPIA 4A3VA 1UJJA 4EPZA 3LVRE 2KZTA 2UY1B 4JXTA 3RKVA 3T5XA 2VQ2A 3U3WA 2DIWA 3D9JA 2CHZA 2PM7A 2WXLA 2C2LA 4E85A 2RD0A 3LVQE 2VYIA 4KVMA 1XGWA 4Q94A 4D10C 3Q5MA 3GZ2A 1H2VC 5A23A 2YHEA 4I9EA 4GB9A 2WQHA 2I2OA 4MLPA 2WXHA 2UWJG 1Y6IA 3MKQA 5EX3A 1IYGA 3ONKA 4FC8A 5DBKA 1H2TC 3CSFA 2V0PA 3EIJA 3PUKA 3L22A 3CIAA 3T8MA 2XQ0A 4G2VA 4LERA 2HO1A 4H7YA 4OVUA 1DNPA 1E96B 3L13A 4G1TA 3MA5A 4EZKA 2IF4A 3PNTB 4G23A 2DCPA 3BG0B 3FUEA 3OXLA 2CHXA 3PRZA 4FU3A 4AY5A 4GA1A 3KS2A 3Q4AB 4AOFA 4YVQC 4GZ5A 4GAAA 4PUCA 3FUKA 4CGWA 2V5FA 3CHSA 3ZYQA 4RVBA 5LCWJ 2VGXB 2WXKA 1ZU2A 1UG3A 3ZHEA 5C1DA 4PH4B 3CQGB 1BPOA 3MZLB 1HZ4A 1SQMA 2J49A 3LY7A 1N54A 3OAWA 4L7TA 2AXUA 3SFZA 3ZGQA 2ZU6B 2WXMA 3CLJA 2C0MA 5E76A 4A1SA 4U0ZA 5AJDA 3QWPA 3APCA 3ASGA 3D9OA 2AXZA 2P58C 3CV0A 3FUMA 4Q69A 4C0MA 2WM9A 2WXFA 1Y8MA 3AS5A 1H19A 3EDTB 4TUUA 3RIBA 4BX8A 4WNFA 1ELKA 1WY6A 3O4ZA 5J08A 5CCLA 3VTYA 2XPYA 1UN8A 2AWIA 3LY8A 5G04J 3TAXA 4AIFA 4AJWA 3ENEA 3TG5A 4AP2A 4BFRA 3FUFA 5BNWA 3FTYA 2I6HA 3CQCB 3SNXA 4JW1A 2XGMA 4J8EA 1A17A 3EIQC 1E8ZA 4LUNU 2PQNA 5JJ6A 2IU1A 2FI7A 4UQXA 3NZUA 3PH0C 3L16A 3ZYMA 5BT1A 4R7LA 2WXGA 4MS6A 2L6JA 1WM5A 2KCLA 4ILIA 5JJ7A 5DIZA 2VSXE 1X5BA 4FLHA 4HXIA 4I17A 3KD7A 4HOUA 4ANUA 4CT4A 5M72A 3RRMB 2FO7A 3FTUA 4MKTA 3VLEA 5D0QD 1UW4B 4GA2A 3ASFA 4PS7A 1ZBPA 2A5UA 2XGSA 1HF8A 3HYMB 3FTVA 2L0TB 3B7UX 3S7DA 2R17C 3G2TA 4I6GA 4AY6A 5FTPA 3NF1A 1OUVA 3SD5A 2GW1A 2YNQA 3ZN3A 4EBAG 5G2NA 3LKUA 4N39A 1VDYA 4GZCA 3CK8A 1Z6TA 2QFCA 1UN9A 3R7QA 3D9MA 4I6EA 4F7AA 4GU5A 3IV0A 4ACLA 1JWFA 3DPDA 4UWFA 4XZ4A 3CVYA 2WVIA 3CVNA 2KZTB 2HYZA 2L9BA 3ZYLA 3CHQA 3D9NA 2WB2A 3GYZA 3HVEA 4Y6WA 3MGBA 3MJWA 2KCKA 4IULA 4F1SA 4EZJA 5FQ7A 3QARA 3FDHA 3ASDA 2OVFA 2NC9A 2Y4UA 2WXPA 3U64A 4WAFA 4NRHB 2WQ7A 4FJZA 3MKQB 3VTXA 1E7VA 3G2VA 5T4YA 3URZA 2EQXA 4QFVA 3I5PA 1JUQA 2LSUA 5JHAA 3GZSA 1HH8A 3PVLA 2XRYA 4XKBA 1MHQA 3LDZA 3QDNA 2YHCA 4JHKA 5CMYA 1OWNA 2FULA 4C0EA 3R9AB 3TGOA 3PEVB 3QK0A 1E8YA 1KT1A 4GMJA 3QB2A 3BEEA 4H7XA 4XI9A 5C2YA 5JHBA 3CVXA 3SHFA 1E8WA 4V3IA 2YINA 2E0IA 5LX8A 4J8FA 1N52A 2NXPA 3LJ3A 3D9PA 4JEHA 4KMOA 2V8SE 5LP0A 3D9KA 3PS6A 2IOSA 3JYSA 2WPVA 3MCXA 5EX0A 5J90A 2DBAA 4JA9A 4WNDA 1HXIA 2J4BA 2NSZA 3FU6A 4TV3A 4TRQA 5FZRA 4HORA 5BPPA 2VSOE 2XCCA 5KJNA 4KBQA 2IFUA 3AU4A 3FUIA 3LCAA 3Q15A 3L6AA 4FULA 4CCAA 1PAQA 3FFLA 1WAO1 4WWPA 4APFA 2JLBA 3MYVA 4ANWA 3OXGA 2HR2A 3IHVA 4JC8A 4FA6A 3CHOA 4G11A 3QWWA 2WXIA 3CR3A 4BT8A 1FVHA 1NZNA 4I6JA 4FP7A 2AVPA 4MRUA 3JQ1A 3SF4A 4FHKA 4HOSA 2WXQA 3TL5A 4B89A 4JZYA 4UI9J 1LF8A 5EDSA 3CK7A 4N5CA 3PUJA 2VJ8A 2V4LA 1E90A 2UY1A 3APDA 2CFUA 4GYOA 4OVVA 2LO6A 4URKA 2ONDA 2X38A 4RG6A 3FUNA 3IEGA 3UQ3A 1NA0A 2E2EA 2XRZA 3T5VA 4WNEA 3L17A 3QC1A 1EF1C 3ML8A 5HQ8A 5BUZA 2XGOA 3PDNA 4L23A 4JL0A 3CHRA 3JQ0A 4KXKB 4NURA 1SZAA 1OWLA 2J4DA 3G2SA 2VTBB 2OV8A 3AS4A 2WXOA 4AEZC 4U04A 4IYPA 3WXXA 2X6FA 2WXNA 3C98A 3VLFA 4DK5A 4KZ0A 4PDXA 4HVBA 4K0RA 3RJVA 4WWNA 4J0UA 4HFGA 4KZCA 2XCBA 4I1MA 2MHKA 3FH8A 2KC7A 4GA0A 4UQZA 2PQRA 4ACKA 2XHEA 4P29A 4XX5A 2MRIA 3CKCA 3CVPA 3LS8A 2YQ8A 5LCWC 2VGXA 4RG9A 5G05J 3PZDA 1U3DA 2J08A 5CMWA 3KAEA 3MEKA 3CGHA 3FU0A 2OVBA 3Q49B 4ANVA 3JUIA 4CDNA 2I1JA 4I9CA 4YVOA 2PM6A 2XPZA 4BY6A 3EHMA 5ARGA 2FBNA 2WXRA 3MX3A 2X6HA 4JPSA 3UUXA 4A3TA 5LFAA 5FZQA 4B8CB 3QWVA 4BX9A 4U0UA 2XEVA 4GYWA 4B0ZA 4EECA 3S7JA 3FEXA 2AW6A 2WMOA 5FQ4A 4AXHA 4ILHB 3CEQA 4WUYA 1KT0A 1QQEA 3ESKA 4JA7A 3CVLA 5G04C 4BWRA 1PC2A 3HHMA 3SZ7A 4KYOB 3RRUA 1HO8A 5ARFA 5KJLA 1INZA 2VSNA 1P5QA 1IQRA 5FZSA 4FJYA 2GRMA 3PNLB 5KJKA 3ESLA 2CFZA 3ML9A 3JCKC 4I43A 4F3VA 4NQ0A 4KT6B 4N3BA 1H2UA 2LNIA 3FUDA 4G24A 3FTZA 3LEWA 2LAIA 5BV0A 1QNFA 3DBSA 3ZVVA 4HOQA 2OOEA 3ZW3A 2RG8A 4GZ3A 3RO2A 4A55A 4PS3A 3TXNA 4DI3A 1E7UA 3CK9A 2CG2A 2MOWA 3IHYA 3MKRA 4L2LA 4XKCA 2ILRA 4WWOA 4Q96A 5E75A 5G55A 5KCMA 1L5JA 3PREA 5A7DB 4B8AA 3FU3A 2AXVA 3LYAA 5CHEE 4CGVA 3O48A 3CHPA 3FHEA 2Y3AA 3SGHA 3EHNA 1QZ2A 4GCNA 2IQCA 2X6KA 3IKOB 4Y6CA 1TJCA 4XIFA 4AVXA 4N2SA 3ZHEB 4IRUA 4ANXA 4LEUA 3UPVA 4J8SA 1HG5A 2JEKA 2CHWA 3S7BA 5JJTA 5AYWD 2WQ6A 3B7TA 2X6IA 3CVWA 2A4ZA 2WXJA 4G25A 3AS8A 4B94A 5CCMA 3SI5A 3APFA 5A6CA 3S7FA 4APOA 3IBEA 2BTDA 4KVOA 4HS2A 1W3BA 4JVSA 3ZEFA 5BW8C 2R5SA 4I2ZA 4HOTA 3CSTA 3OTNA 3LXUX 4DI4A 3ZYKA 4ATGA 4ILGA 3EJNA 5AIJA 2VGYA 3CVUA 2PZIA 3FWVA 2I1KA 4L2YA 3UX4A 1E8XA 2WMNA 1OWOA 1ELWA 3G2WA 4W9RA 1EPUA 3QOUA 1FCHA 2J09A 5FQ8A 3UT8A 1TEZA 4O6FA 2KCVA 2CG3A 5FT9A 5T8IA 4UWGA 3LPZA 4UWKA 3FEYA 4GZDA 2KM4A 2Q7FA 2X6JA 4U8HA 4JHRA 3UT7A 5HI7A 1GW6A 3FULA 3HIZA 3MV2B 4U07A 3B13A 1XNFA 4HLEA 3ULQA 4F53A 4GMLA 5T3RA 3L54A 5ENNA 5AENA 3ZIMA 3PE3A 3GZ1A 3D9LA 2HM8A 3TXMA 1HFAA 3NQPA 1OWMA 3P1UA 1HU3A 1IQUA 1HG2A 3D3MA 4J8DA 3MV3B 4I2WA 3VLDA 3FTSA 4C9BB 2VSYA 3ASHA 3G2UA 1HX8A 4GYYA 4DPRA 4LRZA 5FWQA 4CDRA 3BG1B 3D9IA 4AV7A 1NA3A 4DLQA 2M63A 3TJPA 3CKBA 2R59A 2J9QA 3N71A 3UMVA 2IJGX 2L0IA 4GZ6A 3S2AA 3ZFWA 3OXFA 4LCTA 2GGFA 3U9WA 3B7SA 3E4BA 3PEUB 3PE4A 1TJFA 2LSVA 1H6KA 3AU5A 3I4RB 4CDMA 1FVFA 4JHJA 4DJAA 2I9CA 4BTAA 4GCOA 2FEZA 4EBAA 4EZLA 3ZRHA 4OYSA 1Z3XA 3RO3A 3ZXSA 1H0AA 2C0LA 3I4GA 4FLBA 3HDXA 1OWPA 4UI9C 1PY1A 4I1OB 4M3OA 4JEUA 4A1GA 3SBSA 3QJZA 4YNDA 4ME2A 4FADA 1MQSA 3HVEB 4NACA 3ZPJA 1U3CA 1NP7A 3P2BA 3K9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1A A;  4N3A A;  3CVQ A;  3TG4 A;  3RU0 A;  1KLX A;  4UI9 K;  1IHG A;  1YA0 A;  4BTB A;  2PL2 A;  4BT9 A;  2BUG A;  1ELR A;  4N3C A;  3Q47 B;  4IN3 B;  5KJM A;  4U0S A;  1B89 A;  2Y4T A;  5G05 C;  4AM9 A;  3U4T A;  4ABN A;  2FF4 A;  4GPK A;  4N2Q A;  3QKY A;  5EKQ D;  4UQY A;  5FJY A;  4WNG A;  4XI0 A;  4EQF A;  4G26 A;  3GW4 A;  5D0O D;  3FP3 A;  3LY9 A;  2KAT A;  2XPI A;  2UY1 B;  3RKV A;  2VQ2 A;  3U3W A;  2C2L A;  2VYI A;  3Q5M A;  3GZ2 A;  4I9E A;  2WQH A;  2UWJ G;  5EX3 A;  1IYG A;  5DBK A;  4G2V A;  2HO1 A;  4H7Y A;  1E96 B;  4G1T A;  3MA5 A;  2IF4 A;  4G23 A;  3OXL A;  4AY5 A;  4GA1 A;  3KS2 A;  3Q4A B;  4YVQ C;  4GZ5 A;  4CGW A;  2V5F A;  5LCW J;  2VGX B;  1ZU2 A;  3ZHE A;  5C1D A;  1HZ4 A;  3LY7 A;  3ZGQ A;  2C0M A;  4A1S A;  4U0Z A;  3QWP A;  3ASG A;  2P58 C;  3CV0 A;  3AS5 A;  1Y8M A;  3RIB A;  3EDT B;  4WNF A;  5CCL A;  3VTY A;  3LY8 A;  5G04 J;  3TAX A;  4AIF A;  3TG5 A;  5BNW A;  2I6H A;  2XGM A;  4J8E A;  1A17 A;  2PQN A;  5JJ6 A;  2FI7 A;  4UQX A;  5BT1 A;  2L6J A;  1WM5 A;  2KCL A;  5JJ7 A;  5DIZ A;  4I17 A;  3KD7 A;  4HOU A;  5M72 A;  2FO7 A;  5D0Q D;  4GA2 A;  3ASF A;  1ZBP A;  2XGS A;  3HYM B;  3S7D A;  4AY6 A;  5FTP A;  3NF1 A;  1OUV A;  2GW1 A;  3ZN3 A;  3LKU A;  4N39 A;  3CK8 A;  2QFC A;  3CVN A;  2HYZ A;  3GYZ A;  4Y6W A;  2KCK A;  3ASD A;  2NC9 A;  2Y4U A;  4NRH B;  3VTX A;  3URZ A;  2LSU A;  1HH8 A;  3QDN A;  2YHC A;  3R9A B;  3TGO A;  1KT1 A;  3BEE A;  4H7X A;  4XI9 A;  4J8F A;  3JYS A;  2WPV A;  5EX0 A;  4JA9 A;  2DBA A;  4WND A;  1HXI A;  4HOR A;  5FZR A;  2XCC A;  5KJN A;  4KBQ A;  2IFU A;  3LCA A;  3Q15 A;  3FFL A;  1WAO 1;  2JLB A;  3OXG A;  2HR2 A;  3QWW A;  4BT8 A;  1NZN A;  2AVP A;  3SF4 A;  4HOS A;  4UI9 J;  3CK7 A;  4N5C A;  2UY1 A;  4GYO A;  2OND A;  4RG6 A;  3IEG A;  3UQ3 A;  1NA0 A;  2E2E A;  4WNE A;  5HQ8 A;  2XGO A;  3PDN A;  4JL0 A;  4KXK B;  3AS4 A;  4U04 A;  3WXX A;  3RJV A;  4J0U A;  2XCB A;  2MHK A;  4UQZ A;  2KC7 A;  4GA0 A;  2PQR A;  3CKC A;  3CVP A;  2YQ8 A;  5LCW C;  2VGX A;  4RG9 A;  5G05 J;  3KAE A;  3MEK A;  3Q49 B;  4YVO A;  4I9C A;  5ARG A;  2FBN A;  3UUX A;  5FZQ A;  3QWV A;  4U0U A;  2XEV A;  4GYW A;  3S7J A;  3CEQ A;  4WUY A;  1KT0 A;  1QQE A;  3ESK A;  4JA7 A;  3CVL A;  5G04 C;  4BWR A;  1PC2 A;  3SZ7 A;  4KYO B;  5KJL A;  5ARF A;  2VSN A;  1P5Q A;  5FZS A;  5KJK A;  4F3V A;  4NQ0 A;  4N3B A;  2LNI A;  4G24 A;  4HOQ A;  2OOE A;  4GZ3 A;  3RO2 A;  3CK9 A;  3MKR A;  5A7D B;  3LYA A;  5CHE E;  4CGV A;  3O48 A;  1QZ2 A;  4GCN A;  4Y6C A;  1TJC A;  4XIF A;  4N2S A;  3ZHE B;  4LEU A;  3UPV A;  3S7B A;  5JJT A;  5AYW D;  4G25 A;  3AS8 A;  4B94 A;  5CCM A;  5A6C A;  3S7F A;  4APO A;  1W3B A;  5BW8 C;  2R5S A;  4I2Z A;  4HOT A;  2VGY A;  2PZI A;  3FWV A;  4W9R A;  1ELW A;  3QOU A;  1FCH A;  4O6F A;  2KCV A;  5FT9 A;  3LPZ A;  2Q7F A;  4JHR A;  5HI7 A;  4U07 A;  3MV2 B;  1XNF A;  3ULQ A;  3PE3 A;  3GZ1 A;  4J8D A;  4I2W A;  3MV3 B;  2VSY A;  3ASH A;  4GYY A;  4CDR A;  1NA3 A;  3CKB A;  2J9Q A;  3N71 A;  4GZ6 A;  3ZFW A;  3OXF A;  3E4B A;  3PE4 A;  2LSV A;  4BTA A;  4GCO A;  2FEZ A;  3RO3 A;  2C0L A;  4UI9 C;  4YND A;  4ME2 A;  3ZPJ A;  3K9I A; 
#chains in the Genus database with same CATH topology
 2X3M A;  4CEM A;  4N3A A;  4YDY A;  3TG4 A;  3CVV A;  5EID A;  3W9F A;  5BV1 A;  1YA0 A;  4RSY A;  4U63 A;  4BT9 A;  1N94 A;  3FUH A;  1N4Q A;  3QAQ A;  5B3S E;  4IN3 B;  2LAH A;  5KJM A;  3FU5 A;  3R7R A;  2DYR E;  1FT2 A;  1DVP A;  5EKQ D;  1HE8 A;  3NZS A;  3UM0 A;  5B1A E;  3FUJ A;  3I3N A;  3FP3 A;  1UJJ A;  3LVR E;  2UY1 B;  4DX6 D;  2PM7 A;  2WXL A;  2C2L A;  2RD0 A;  2L6B A;  2VYI A;  1XGW A;  5A23 A;  2YHE A;  4GB9 A;  4MLP A;  3ASO E;  5DBK A;  2V0P A;  3EIJ A;  1FT1 A;  4H7Y A;  1E96 B;  4DX2 A;  1V55 E;  4EZK A;  2IF4 A;  3PNT B;  1MX2 A;  3FUE A;  2CHX A;  3PRZ A;  3Q4A B;  5HKP A;  4GAA A;  2P9K G;  4PUC A;  4CGW A;  2DWZ A;  2V5F A;  3HXF A;  2WXK A;  1UG3 A;  4PH4 B;  1LD8 A;  1HZ4 A;  1SQM A;  3LY7 A;  3Q75 A;  4L7T A;  3SFY A;  3SFZ A;  2AXU A;  3CLJ A;  2C0M A;  5E76 A;  5AAR A;  4U0Z A;  2P58 C;  3CV0 A;  2WM9 A;  1H19 A;  4NIK A;  4TUU A;  3RIB A;  5J08 A;  4AP2 A;  3FUF A;  2I6H A;  1E8Z A;  4LUN U;  5JJ6 A;  2IU1 A;  2OCC E;  3PH0 C;  3ZYM A;  2KCL A;  1S70 B;  2GRQ B;  5M72 A;  3FTU A;  1BI7 B;  2ETA A;  4PS7 A;  2XGS A;  3JXJ A;  3C3O A;  3G2T A;  4DX5 D;  4I6G A;  1OUV A;  2P2C P;  1N9A A;  1KPS B;  4HBD A;  3NB2 A;  4ACL A;  2HYZ A;  3V30 A;  3CHQ A;  3V2X A;  2WB2 A;  3EU5 A;  2R2L A;  3TWT A;  4Y6W A;  1BLX B;  3TWU A;  2JAB A;  2OVF A;  1OY3 D;  4BSZ B;  4FJZ A;  3MKQ B;  3G2V A;  3I5P A;  5JHA A;  2XRY A;  3LDZ A;  4C0E A;  3QK0 A;  3E37 A;  4H7X A;  5CEC B;  3AG3 E;  3LJ3 A;  4JEH A;  4K5C A;  2V8S E;  1OCO E;  5EX0 A;  5J90 A;  3TWQ A;  4TRQ A;  5BPP A;  2VSO E;  4FUL A;  4CCA A;  4APF A;  3UIP C;  3IHV A;  4G8L A;  4FA6 A;  3CHO A;  4G11 A;  3QWW A;  4FP7 A;  4MRU A;  1LF8 A;  3PUJ A;  1X81 A;  2UY1 A;  3APD A;  2CFU A;  1MYO A;  2LO6 A;  4OVV A;  3PZ4 A;  4RG6 A;  2XEN A;  3D9H A;  5HQ8 A;  4KXK B;  1SZA A;  1WDY A;  2LXM A;  2J4D A;  3G2S A;  3AS4 A;  4U04 A;  2AJA A;  2WXN A;  4WWN A;  1SA4 A;  4J0U A;  4HFG A;  2XCB A;  3IXE A;  4GA0 A;  4UQZ A;  1D9S A;  1TN6 A;  1NFI E;  5LCW C;  1QYM A;  4TUM A;  4GTT A;  3ASN E;  3B7B A;  4CDN A;  2XZD G;  4YVO A;  4I9C A;  2F8X K;  2WXR A;  3MX3 A;  5AQA A;  4B8C B;  3QWV A;  4U0U A;  2XEV A;  4GYW A;  5G04 C;  3HXE A;  4KYO B;  1HO8 A;  1INZ A;  2VSN A;  5FZS A;  4FJY A;  5KJK A;  5EYL A;  1DCE A;  2RFA A;  3ABK E;  1E7U A;  2MOW A;  3IHY A;  1H6O A;  4Q96 A;  2XS8 A;  4B8A A;  1LD7 A;  3O48 A;  2Y3A A;  1TN7 A;  4N2S A;  4GTV A;  4CYM D;  4ANX A;  1HG5 A;  3S7B A;  2GRR B;  2QYJ A;  3APF A;  1W3B A;  3ZEF A;  3UM2 A;  4HOT A;  2PZI A;  3FWV A;  1E8X A;  1ELW A;  3LPZ A;  4GZD A;  4L9P A;  3UT7 A;  3FUL A;  4U07 A;  4HLE A;  5AEN A;  3ZIM A;  3PE3 A;  4O1O A;  2PNN A;  3NQP A;  3P1U A;  3VLD A;  3X2Q E;  2VSY A;  3G2U A;  1HX8 A;  3ABL E;  4CDR A;  3BG1 B;  4AV7 A;  1NA3 A;  4DLQ A;  2XEH A;  1AWC B;  2M63 A;  3CKB A;  3UMV A;  2J9Q A;  3N71 A;  2IJG X;  4GZ6 A;  3S2A A;  3U9W A;  4XEI G;  1IKN D;  1TJF A;  3PZ3 A;  1WG0 A;  4EBA A;  3ZXS A;  1H0A A;  2C0L A;  3JUE A;  1DCQ A;  3Q9U C;  4UI9 C;  4I1O B;  2BKK B;  4TXR A;  3QJZ A;  3ZPJ A;  3Q9N C;  3P2B A;  3K9I A;  4I1A A;  4UWL A;  4UI9 K;  4CT0 A;  1IHG A;  2BF0 X;  2BUG A;  3Q47 B;  3B7R L;  5KBA A;  3UT4 A;  2ION A;  1B89 A;  1MX6 A;  3ONL A;  3L82 A;  3ABM E;  4K5A B;  3C5R A;  5ANR A;  3QKY A;  1NL4 A;  4K5B A;  2QY7 A;  3NBN B;  3FY4 A;  5ANL A;  4EQF A;  3U66 A;  1EDU A;  2KBX A;  3LY9 A;  3RRN B;  1SZ9 A;  1TR4 A;  4A3V A;  2KZT A;  3RKV A;  4JXT A;  3T5X A;  1DC2 A;  3U3W A;  4G8K A;  3D9J A;  4LNG A;  2GRN B;  4Q94 A;  5FIN A;  2WXH A;  5EX3 A;  1JCQ A;  3PUK A;  3T8M A;  4G2V A;  4OVU A;  3BQO A;  1OCC E;  3V31 A;  4FU3 A;  4AOF A;  4YVQ C;  3C3Q A;  3FUK A;  1O1R A;  3CHS A;  2BKG A;  2VGX B;  1BPO A;  3DSX A;  4GTP A;  2ZU6 B;  1QBQ A;  5D2M C;  3SFX A;  3QWP A;  4RQI A;  4LG6 A;  4C0M A;  4BX8 A;  1WY6 A;  2XPY A;  3LY8 A;  3TAX A;  4AIF A;  4AJW A;  4DUI A;  4HRM B;  4GMR A;  3FTY A;  4JD2 G;  4JW1 A;  2XGM A;  4UQX A;  1BI8 B;  5JJ7 A;  5DIZ A;  4HXI A;  3KD7 A;  4CT4 A;  4MKT A;  3SO8 A;  3VLE A;  4BEP A;  5D0Q D;  1UW4 B;  4GA2 A;  1ZBP A;  2L0T B;  3S7D A;  2R17 C;  3LKU A;  3D9M A;  2HE0 A;  4GU5 A;  5H7P A;  4XZ4 A;  2WVI A;  3E32 A;  3CVN A;  2L9B A;  3NOG D;  3GYZ A;  4BES A;  3UTM A;  3MGB A;  3MJW A;  5FQ7 A;  3ASD A;  4WAF A;  3UM3 A;  3VTX A;  1E7V A;  5T4Y A;  3URZ A;  2LSU A;  1HH8 A;  2YHC A;  4GTO A;  1OWN A;  2FUL A;  3JXI A;  3PEV B;  4GMJ A;  1E8Y A;  3TGO A;  2H6F A;  5C2Y A;  3CVX A;  3SHF A;  1N52 A;  2ZIR A;  3D9P A;  3D9K A;  3PS6 A;  3MCX A;  2WPV A;  2DBA A;  1LTX A;  4TV3 A;  4HOR A;  5FZR A;  2XCC A;  3L9T A;  3L6A A;  1PAQ A;  3DSV A;  1WAO 1;  3MYV A;  4ANW A;  3OXG A;  2HR2 A;  2XZT G;  2WXI A;  5CRU A;  4BT8 A;  2NYJ A;  1NZN A;  4I6J A;  2AVP A;  3SF4 A;  2WXQ A;  4JZY A;  3CK7 A;  4N5C A;  4HRL A;  3KSQ A;  2R02 A;  5B1B E;  3UQ3 A;  1NA0 A;  3AAA C;  3T5V A;  4GTS A;  2XGO A;  4L23 A;  2EIJ E;  3ZKJ A;  2VTB B;  4C48 B;  3WXX A;  3C98 A;  3VLF A;  1Z5S C;  2Y1L E;  3B95 A;  4PDX A;  4K0R A;  2MHK A;  2KC7 A;  4ACK A;  2PQR A;  2MRI A;  2V5Q C;  2VGX A;  2B0O E;  5G05 J;  2J8S D;  1IXV A;  3KAE A;  1MX4 A;  3CGH A;  3FU0 A;  3Q49 B;  1H6P A;  2I1J A;  2PM6 A;  2XPZ A;  4BY6 A;  3EHM A;  5ARG A;  2FBN A;  5LFA A;  4A3T A;  2IY0 C;  5KNH D;  4B0Z A;  3FEX A;  4AXH A;  1QQE A;  3ESK A;  4JA7 A;  4OAV B;  1N4P A;  5EIL A;  1PC2 A;  3HHM A;  5KJL A;  5IY5 E;  1P5Q A;  1IQR A;  3PNL B;  3ESL A;  3DRA A;  2CFZ A;  4F3V A;  3JCK C;  4I43 A;  4N3B A;  2P9S G;  1H2U A;  2LNI A;  3FTZ A;  2OOE A;  3RO2 A;  3TXN A;  4DI3 A;  3EHQ A;  2CG2 A;  3MKR A;  2ILR A;  4DX1 A;  5G55 A;  3DEO A;  1L5J A;  2AXV A;  2OEW A;  4ATZ D;  5CHE E;  3CHP A;  3SGH A;  3EHN A;  2IQC A;  2X6K A;  4AVX A;  4GTR A;  4J8S A;  2WQ6 A;  5AYW D;  2X6I A;  2A4Z A;  4BET A;  4G25 A;  3AS8 A;  5CCM A;  3IBE A;  4JVS A;  2ZIS A;  2R5S A;  4DRX E;  4ILG A;  2A5E A;  5AIJ A;  4L2Y A;  2I1K A;  3UI2 A;  3UX4 A;  1YCS B;  1OWO A;  2OEV A;  1FCH A;  2J09 A;  2CG3 A;  4UWK A;  2Q7F A;  2DVW A;  4GML A;  1K1B A;  3TXM A;  1HG2 A;  3Q73 A;  4I2W A;  3MV3 B;  4C9B B;  2QYU A;  3D9I A;  1MZC A;  1MJ0 A;  3RSE G;  3ZFW A;  3E4B A;  3AU5 A;  1H6K A;  3I4R B;  4CDM A;  1FVF A;  2I9C A;  4FLB A;  3HDX A;  4M3O A;  4JEU A;  4A1G A;  4YND A;  3HVE B;  4NAC A;  3CVQ A;  3HG0 D;  2VTB A;  1TNO A;  2RFM A;  4BTB A;  1JPL A;  5HRY A;  2PL2 A;  3TWS A;  2RKK A;  4YDO A;  4E6H A;  1ELR A;  4N3C A;  3FTW A;  4BSX A;  2GRL A;  1KZO A;  1JWG A;  4UWH A;  3FH7 A;  2IOL A;  3L08 A;  4U8Y D;  4M7C A;  5EYP F;  4ABN A;  4UUC A;  3QNK A;  1TNU A;  2XS1 A;  4N2Q A;  3W9G A;  4HNA D;  5ENR D;  4UQY A;  5LOZ A;  3C3R A;  5FJY A;  1UJK A;  3T9K A;  4DLO A;  4K03 A;  4BER A;  3KEA A;  2KAT A;  2XPI A;  2IEJ A;  1U2V G;  2DIW A;  3PZ2 A;  4KVM A;  5CED B;  4D10 C;  3Q5M A;  1N4S A;  2I2O A;  2UWJ G;  3MKQ A;  5AAO A;  1H2T C;  3CSF A;  3L22 A;  3CIA A;  4LER A;  2HO1 A;  1DNP A;  3L13 A;  3MA5 A;  4G23 A;  2DCP A;  3OXL A;  4AY5 A;  4GA1 A;  3KS2 A;  4QQI A;  2R03 A;  5BXO A;  1SA5 A;  1G3N B;  1S64 A;  3AJI A;  4RVB A;  1ZU2 A;  5C1D A;  3UIO C;  3ZNG A;  3E34 A;  3MZL B;  2J49 A;  3ZGQ A;  2WXM A;  3ZUV B;  5AJD A;  3APC A;  4TXP A;  3D9O A;  3R9M A;  2AXZ A;  3FUM A;  2WXF A;  3AS5 A;  1Y8M A;  3EDT B;  4WNF A;  3BU8 A;  1ELK A;  1JCR A;  3O4Z A;  4ZHB A;  1ZB1 A;  3VTY A;  5AQ7 A;  4LNB A;  2DYS E;  2BED A;  4J8E A;  1A17 A;  3EIQ C;  2FI7 A;  3NZU A;  3C72 A;  5BT1 A;  2WXG A;  2KXP C;  4LNU D;  2L6J A;  1WM5 A;  2VSX E;  4I17 A;  4HOU A;  4ANU A;  1UOH A;  2ZGG A;  3RRM B;  4GPM A;  3ASF A;  2A5U A;  3Q79 A;  1HF8 A;  3FTV A;  4AY6 A;  3NF1 A;  2DZN A;  4EBA G;  5G2N A;  3DSW A;  4GZC A;  1UN9 A;  4I6E A;  4F7A A;  4ZFH A;  3IV0 A;  1JWF A;  4UWF A;  3ZYL A;  3TWV A;  3HVE A;  4F1S A;  3UXG A;  2NC9 A;  2WXP A;  1OXJ A;  3TWW A;  1JUQ A;  1NI1 A;  3PVL A;  4XKB A;  1MHQ A;  2VGE A;  3R9A B;  1TNB A;  3QB2 A;  5JHB A;  1E8W A;  4V3I A;  2E0I A;  5LX8 A;  4HQD A;  4KMO A;  2IOS A;  2J4B A;  3FU6 A;  5KJN A;  4KBQ A;  3AU4 A;  3Q15 A;  4WWP A;  2H6H A;  3E30 A;  4U7E B;  3NAW A;  3CR3 A;  5KWD A;  1FVH A;  3JQ1 A;  1O1S A;  5EDS A;  3EU9 A;  2VJ8 A;  4URK A;  3FUN A;  3IEG A;  2XRZ A;  4WNE A;  3QC1 A;  3ULE G;  3ML8 A;  5BUZ A;  3PDN A;  4JL0 A;  3CHR A;  4NUR A;  2LXL A;  4A63 B;  2OV8 A;  4IYP A;  5EIB E;  4DK5 A;  2R05 A;  4KZ0 A;  4HVB A;  4I1M A;  5AN8 A;  1SVX A;  5AQ9 A;  4P29 A;  3CVP A;  3LS8 A;  2YQ8 A;  3PZD A;  3PZ1 A;  1U3D A;  2J08 A;  5CMW A;  2OVB A;  2F8Y A;  4HI8 A;  4TXQ A;  5ENO D;  5ITZ F;  4HI9 A;  4JPS A;  2F37 A;  3UUX A;  5FZQ A;  2Y0B G;  3J5P A;  3S7J A;  4JB8 P;  2WMO A;  3CEQ A;  3EUV A;  1KT0 A;  4WUY A;  3AG4 E;  3UKR G;  5CER B;  4BWR A;  1TNY A;  5ARF A;  3Q78 A;  2GRM A;  3NOC D;  3WG7 E;  4NQ0 A;  4KT6 B;  3FUD A;  3HXC A;  4G24 A;  3LEW A;  1TYQ G;  4O1P A;  5BXU A;  1O5M A;  3DBS A;  3V79 K;  3ZVV A;  4HOQ A;  3ZW3 A;  1TN8 A;  2RG8 A;  1SW6 A;  4OAU C;  4WWO A;  1OT8 A;  5E75 A;  3PRE A;  5A7D B;  3FU3 A;  4CGV A;  3FHE A;  3IKO B;  3ZHE B;  1V54 E;  5JMN D;  3ZXP A;  4LEU A;  5JJT A;  3B7T A;  3SI5 A;  5A6C A;  2BTD A;  4J8Y A;  4KVO A;  1N0Q A;  5BW8 C;  3CST A;  3OTN A;  3LXU X;  4DI4 A;  3DWL G;  3CVU A;  3T8K A;  4W9R A;  1K3Z D;  1EPU A;  3QOU A;  5FQ8 A;  4O6F A;  2KCV A;  5FT9 A;  5T8I A;  1N11 A;  3AG2 E;  2KM4 A;  2X6J A;  4JHR A;  1GW6 A;  3HIZ A;  3MV2 B;  3B13 A;  2H6I A;  1XNF A;  3ULQ A;  4F53 A;  1FPP A;  5ENN A;  3GZ1 A;  3D9L A;  2HM8 A;  1HFA A;  1HU3 A;  4J8D A;  3FTS A;  4DPR A;  1Q2Z A;  3ASH A;  4GYY A;  2L0I A;  3HXB A;  2GGF A;  3PEU B;  3PE4 A;  2LSV A;  4JHJ A;  4DJA A;  4BTA A;  2XEE A;  1YMP A;  4OYS A;  3ZRH A;  1Z3X A;  3RO3 A;  1OWP A;  1PY1 A;  3SBS A;  4YDE A;  4FAD A;  2QC9 A;  1NP7 A;  4R7L A;  2ZGD A;  3FH5 A;  3RK6 A;  5EN5 D;  1EYH A;  2EIN E;  5AJL A;  4U95 D;  1KLX A;  1K1A A;  3RU0 A;  3SBT B;  4XE0 A;  1D8E A;  1HS6 A;  1S0P A;  3CHM A;  3DEP A;  5CRV A;  3FTX A;  4PS8 A;  4U0S A;  5FQ6 A;  2Y4T A;  5G05 C;  4AM9 A;  3U4T A;  2J07 A;  2B6C A;  2FF4 A;  2ETC A;  1Z3Y A;  4GPK A;  3KEZ A;  3TWX A;  3LJN A;  4GTM A;  5JA4 D;  4L1B A;  4FHJ A;  4J6I A;  4F1P A;  3E33 A;  4WNG A;  3TWR A;  4CRW A;  4XI0 A;  4G26 A;  3GW4 A;  5D0O D;  3DST A;  3F6Q A;  4EPZ A;  2VQ2 A;  3DSS A;  2CHZ A;  3HRA A;  4E85 A;  3LVQ E;  2EIM E;  3BUA A;  3GZ2 A;  1H2V C;  2P9P G;  4I9E A;  2WQH A;  2LUH A;  3ULY A;  1Y6I A;  1IYG A;  3ONK A;  4FC8 A;  1N0R A;  2XQ0 A;  4EHM A;  4G1T A;  3BG0 B;  5FIO A;  1K8K G;  4GZ5 A;  4YDW A;  1BD8 A;  3ZYQ A;  5LCW J;  3DXM G;  3ZHE A;  3CQG B;  1N54 A;  3OAW A;  4A1S A;  3ASG A;  3EHR A;  4Q69 A;  2EIK E;  5CCL A;  1UN8 A;  2AWI A;  5G04 J;  4CZ2 D;  3ENE A;  3TG5 A;  4BFR A;  5ENT D;  4U96 D;  5BNW A;  2QZA A;  3CQC B;  3SNX A;  2P9L G;  1AP7 A;  1BU9 A;  4HB5 A;  2PQN A;  3AG1 E;  3L16 A;  4MS6 A;  4ILI A;  1X5B A;  4FLH A;  1IHB A;  1O1T A;  3UKU G;  3UM1 A;  2FO7 A;  5HS0 A;  3ISM C;  3HYM B;  3B7U X;  5FTP A;  3SD5 A;  2GW1 A;  2YNQ A;  1RW2 A;  3ZN3 A;  3Q7A A;  4N39 A;  1VDY A;  1Z6T A;  3CK8 A;  2QFC A;  3R7Q A;  3DPD A;  3HXD A;  3CVY A;  2KZT B;  1N95 A;  3D9N A;  1OCZ E;  4DX7 D;  4IUL A;  4EZJ A;  2KCK A;  3QAR A;  3FDH A;  2Y4U A;  3U64 A;  4NRH B;  2WQ7 A;  2EQX A;  4QFV A;  1JCS A;  3GZS A;  4MBG A;  5CMY A;  2P9U G;  4JHK A;  3QDN A;  4N5Q A;  5CBO A;  1KT1 A;  3BEE A;  4XI9 A;  4HLL A;  2YIN A;  5AQB A;  4J8F A;  2NXP A;  1KZP A;  5ENQ D;  5CEA A;  5LP0 A;  3JYS A;  3J5Q B;  4JA9 A;  4WND A;  1HXI A;  2NSZ A;  5ENS D;  2IFU A;  3FUI A;  3LCA A;  1S63 A;  3FFL A;  2JLB A;  4JC8 A;  4FHK A;  4HOS A;  3TL5 A;  4B89 A;  4UI9 J;  5CBN A;  2V4L A;  1E90 A;  2Y69 E;  4GYO A;  2OND A;  2X38 A;  4U8V D;  3DSU A;  2E2E A;  2EIL E;  3L17 A;  1EF1 C;  2IO2 C;  3JQ0 A;  1OWL A;  2WXO A;  4AEZ C;  2P9N G;  2X6F A;  3RJV A;  4KZC A;  3FH8 A;  1D8D A;  4O60 A;  2XHE A;  4XX5 A;  3CKC A;  3UIN C;  4RG9 A;  4LSZ E;  3MEK A;  4ANV A;  3JUI A;  2GRP B;  2V4H C;  3KSL A;  4X8Q A;  2X6H A;  3SQV A;  2DZO A;  4BX9 A;  4EEC A;  2AW6 A;  5FQ4 A;  1YYH A;  4ILH B;  4J7W A;  3CVL A;  2ETB A;  3SZ7 A;  3RRU A;  1N4R A;  3ML9 A;  3SY2 A;  4Z68 A;  2H6G A;  2LAI A;  5BV0 A;  1QNF A;  4GZ3 A;  4A55 A;  4PS3 A;  3CK9 A;  4L2L A;  1OCR E;  4XKC A;  5KCM A;  3LYA A;  1QZ2 A;  4GCN A;  4Y6C A;  1TJC A;  4XIF A;  4IRU A;  3RAU A;  3UPV A;  4GTQ A;  2JEK A;  2CHW A;  4HRN A;  4F6R D;  3CVW A;  2WXJ A;  4B94 A;  2MYO A;  3S7F A;  4APO A;  2GRO B;  4HS2 A;  4I2Z A;  3V2O A;  3ZYK A;  2IO3 C;  4ATG A;  3EJN A;  2F0Y A;  2VGY A;  2WMN A;  3G2W A;  3UT8 A;  1TEZ A;  4UWG A;  5D66 A;  3FEY A;  4U8H A;  5HI7 A;  2ZXW E;  2FO1 E;  4RLY A;  5T3R A;  3L54 A;  1A5E A;  1OWM A;  3D3M A;  1IQU A;  3Q7F A;  4LRZ A;  3DXK G;  5FWQ A;  1RZ4 A;  5KNG A;  3TJP A;  2R59 A;  3OXF A;  4LCT A;  3B7S A;  5ENP D;  3ZU7 B;  4GCO A;  2FEZ A;  2P9I G;  1TNZ A;  4EZL A;  3I4G A;  4B93 B;  4ME2 A;  1MQS A;  1U3C A;  3DPY A; 
#chains in the Genus database with same CATH homology
 2X3M A;  4CEM A;  4I1A A;  4N3A A;  3CVQ A;  3FH5 A;  4UWL A;  3CVV A;  3TG4 A;  3RK6 A;  1EYH A;  5AJL A;  3RU0 A;  1KLX A;  2VTB A;  4UI9 K;  3SBT B;  4CT0 A;  5BV1 A;  1IHG A;  1YA0 A;  4RSY A;  4BTB A;  1JPL A;  2PL2 A;  4U63 A;  4XE0 A;  4BT9 A;  1HS6 A;  4E6H A;  1S0P A;  3FUH A;  3CHM A;  2BF0 X;  2BUG A;  1ELR A;  4N3C A;  3Q47 B;  3FTW A;  4BSX A;  2GRL A;  3QAQ A;  4UWH A;  1JWG A;  3FH7 A;  3FTX A;  3B7R L;  4IN3 B;  2LAH A;  5KJM A;  4PS8 A;  4U0S A;  3UT4 A;  2ION A;  5FQ6 A;  1B89 A;  2IOL A;  2Y4T A;  5G05 C;  3L08 A;  4AM9 A;  3ONL A;  3FU5 A;  3U4T A;  2J07 A;  4ABN A;  3R7R A;  3QNK A;  2FF4 A;  1Z3Y A;  4GPK A;  3KEZ A;  1DVP A;  5ANR A;  4N2Q A;  3QKY A;  5EKQ D;  4L1B A;  4FHJ A;  4J6I A;  1HE8 A;  4UQY A;  5LOZ A;  2QY7 A;  3NZS A;  5FJY A;  1UJK A;  4WNG A;  3FY4 A;  4DLO A;  4CRW A;  4K03 A;  4XI0 A;  5ANL A;  4G26 A;  4EQF A;  3U66 A;  3GW4 A;  1EDU A;  5D0O D;  3FUJ A;  3I3N A;  3FP3 A;  3LY9 A;  3RRN B;  1SZ9 A;  2KAT A;  2XPI A;  4A3V A;  1UJJ A;  4EPZ A;  3LVR E;  2KZT A;  2UY1 B;  4JXT A;  3RKV A;  3T5X A;  2VQ2 A;  3U3W A;  2DIW A;  3D9J A;  2CHZ A;  2PM7 A;  2WXL A;  2C2L A;  4E85 A;  2RD0 A;  3LVQ E;  2VYI A;  4KVM A;  1XGW A;  4Q94 A;  4D10 C;  3Q5M A;  3GZ2 A;  1H2V C;  5A23 A;  2YHE A;  4I9E A;  4GB9 A;  2WQH A;  2I2O A;  4MLP A;  2WXH A;  2UWJ G;  1Y6I A;  3MKQ A;  5EX3 A;  1IYG A;  3ONK A;  4FC8 A;  5DBK A;  1H2T C;  3CSF A;  2V0P A;  3EIJ A;  3PUK A;  3L22 A;  3CIA A;  3T8M A;  2XQ0 A;  4G2V A;  4LER A;  2HO1 A;  4H7Y A;  4OVU A;  1DNP A;  1E96 B;  3L13 A;  4G1T A;  3MA5 A;  4EZK A;  2IF4 A;  3PNT B;  4G23 A;  2DCP A;  3BG0 B;  3FUE A;  3OXL A;  2CHX A;  3PRZ A;  4FU3 A;  4AY5 A;  4GA1 A;  3KS2 A;  3Q4A B;  4AOF A;  4YVQ C;  4GZ5 A;  4GAA A;  4PUC A;  3FUK A;  4CGW A;  2V5F A;  3CHS A;  3ZYQ A;  4RVB A;  5LCW J;  2VGX B;  2WXK A;  1ZU2 A;  1UG3 A;  3ZHE A;  5C1D A;  4PH4 B;  3CQG B;  1BPO A;  3MZL B;  1HZ4 A;  1SQM A;  2J49 A;  3LY7 A;  1N54 A;  3OAW A;  4L7T A;  2AXU A;  3SFZ A;  3ZGQ A;  2ZU6 B;  2WXM A;  3CLJ A;  2C0M A;  5E76 A;  4A1S A;  4U0Z A;  5AJD A;  3QWP A;  3APC A;  3ASG A;  3D9O A;  2AXZ A;  2P58 C;  3CV0 A;  3FUM A;  4Q69 A;  4C0M A;  2WM9 A;  2WXF A;  1Y8M A;  3AS5 A;  1H19 A;  3EDT B;  4TUU A;  3RIB A;  4BX8 A;  4WNF A;  1ELK A;  1WY6 A;  3O4Z A;  5J08 A;  5CCL A;  3VTY A;  2XPY A;  1UN8 A;  2AWI A;  3LY8 A;  5G04 J;  3TAX A;  4AIF A;  4AJW A;  3ENE A;  3TG5 A;  4AP2 A;  4BFR A;  3FUF A;  5BNW A;  3FTY A;  2I6H A;  3CQC B;  3SNX A;  4JW1 A;  2XGM A;  4J8E A;  1A17 A;  3EIQ C;  1E8Z A;  4LUN U;  2PQN A;  5JJ6 A;  2IU1 A;  2FI7 A;  4UQX A;  3NZU A;  3PH0 C;  3L16 A;  3ZYM A;  5BT1 A;  4R7L A;  2WXG A;  4MS6 A;  2L6J A;  1WM5 A;  2KCL A;  4ILI A;  5JJ7 A;  5DIZ A;  2VSX E;  1X5B A;  4FLH A;  4HXI A;  4I17 A;  3KD7 A;  4HOU A;  4ANU A;  4CT4 A;  5M72 A;  3RRM B;  2FO7 A;  3FTU A;  4MKT A;  3VLE A;  5D0Q D;  1UW4 B;  4GA2 A;  3ASF A;  4PS7 A;  1ZBP A;  2A5U A;  2XGS A;  1HF8 A;  3HYM B;  3FTV A;  2L0T B;  3B7U X;  3S7D A;  2R17 C;  3G2T A;  4I6G A;  4AY6 A;  5FTP A;  3NF1 A;  1OUV A;  3SD5 A;  2GW1 A;  2YNQ A;  3ZN3 A;  4EBA G;  5G2N A;  3LKU A;  4N39 A;  1VDY A;  4GZC A;  3CK8 A;  1Z6T A;  2QFC A;  1UN9 A;  3R7Q A;  3D9M A;  4I6E A;  4F7A A;  4GU5 A;  3IV0 A;  4ACL A;  1JWF A;  3DPD A;  4UWF A;  4XZ4 A;  3CVY A;  2WVI A;  3CVN A;  2KZT B;  2HYZ A;  2L9B A;  3ZYL A;  3CHQ A;  3D9N A;  2WB2 A;  3GYZ A;  3HVE A;  4Y6W A;  3MGB A;  3MJW A;  2KCK A;  4IUL A;  4F1S A;  4EZJ A;  5FQ7 A;  3QAR A;  3FDH A;  3ASD A;  2OVF A;  2NC9 A;  2Y4U A;  2WXP A;  3U64 A;  4WAF A;  4NRH B;  2WQ7 A;  4FJZ A;  3MKQ B;  3VTX A;  1E7V A;  3G2V A;  5T4Y A;  3URZ A;  2EQX A;  4QFV A;  3I5P A;  1JUQ A;  2LSU A;  5JHA A;  3GZS A;  1HH8 A;  3PVL A;  2XRY A;  4XKB A;  1MHQ A;  3LDZ A;  3QDN A;  2YHC A;  4JHK A;  5CMY A;  1OWN A;  2FUL A;  4C0E A;  3R9A B;  3TGO A;  3PEV B;  3QK0 A;  1E8Y A;  1KT1 A;  4GMJ A;  3QB2 A;  3BEE A;  4H7X A;  4XI9 A;  5C2Y A;  5JHB A;  3CVX A;  3SHF A;  1E8W A;  4V3I A;  2YIN A;  2E0I A;  5LX8 A;  4J8F A;  1N52 A;  2NXP A;  3LJ3 A;  3D9P A;  4JEH A;  4KMO A;  2V8S E;  5LP0 A;  3D9K A;  3PS6 A;  2IOS A;  3JYS A;  2WPV A;  3MCX A;  5EX0 A;  5J90 A;  2DBA A;  4JA9 A;  4WND A;  1HXI A;  2J4B A;  2NSZ A;  3FU6 A;  4TV3 A;  4TRQ A;  5FZR A;  4HOR A;  5BPP A;  2VSO E;  2XCC A;  5KJN A;  4KBQ A;  2IFU A;  3AU4 A;  3FUI A;  3LCA A;  3Q15 A;  3L6A A;  4FUL A;  4CCA A;  1PAQ A;  3FFL A;  1WAO 1;  4WWP A;  4APF A;  2JLB A;  3MYV A;  4ANW A;  3OXG A;  2HR2 A;  3IHV A;  4JC8 A;  4FA6 A;  3CHO A;  4G11 A;  3QWW A;  2WXI A;  3CR3 A;  4BT8 A;  1FVH A;  1NZN A;  4I6J A;  4FP7 A;  2AVP A;  4MRU A;  3JQ1 A;  3SF4 A;  4FHK A;  4HOS A;  2WXQ A;  3TL5 A;  4B89 A;  4JZY A;  4UI9 J;  1LF8 A;  5EDS A;  3CK7 A;  4N5C A;  3PUJ A;  2VJ8 A;  2V4L A;  1E90 A;  2UY1 A;  3APD A;  2CFU A;  4GYO A;  4OVV A;  2LO6 A;  4URK A;  2OND A;  2X38 A;  4RG6 A;  3FUN A;  3IEG A;  3UQ3 A;  1NA0 A;  2E2E A;  2XRZ A;  3T5V A;  4WNE A;  3L17 A;  3QC1 A;  1EF1 C;  3ML8 A;  5HQ8 A;  5BUZ A;  2XGO A;  3PDN A;  4L23 A;  4JL0 A;  3CHR A;  3JQ0 A;  4KXK B;  4NUR A;  1SZA A;  1OWL A;  2J4D A;  3G2S A;  2VTB B;  2OV8 A;  3AS4 A;  2WXO A;  4AEZ C;  4U04 A;  4IYP A;  3WXX A;  2X6F A;  2WXN A;  3C98 A;  3VLF A;  4DK5 A;  4KZ0 A;  4PDX A;  4HVB A;  4K0R A;  3RJV A;  4WWN A;  4J0U A;  4HFG A;  4KZC A;  2XCB A;  4I1M A;  2MHK A;  3FH8 A;  2KC7 A;  4GA0 A;  4UQZ A;  2PQR A;  4ACK A;  2XHE A;  4P29 A;  4XX5 A;  2MRI A;  3CKC A;  3CVP A;  3LS8 A;  2YQ8 A;  5LCW C;  2VGX A;  4RG9 A;  5G05 J;  3PZD A;  1U3D A;  2J08 A;  5CMW A;  3KAE A;  3MEK A;  3CGH A;  3FU0 A;  2OVB A;  3Q49 B;  4ANV A;  3JUI A;  4CDN A;  2I1J A;  4I9C A;  4YVO A;  2PM6 A;  2XPZ A;  4BY6 A;  3EHM A;  5ARG A;  2FBN A;  2WXR A;  3MX3 A;  2X6H A;  4JPS A;  3UUX A;  4A3T A;  5LFA A;  5FZQ A;  4B8C B;  3QWV A;  4BX9 A;  4U0U A;  2XEV A;  4GYW A;  4B0Z A;  4EEC A;  3S7J A;  3FEX A;  2AW6 A;  2WMO A;  5FQ4 A;  4AXH A;  4ILH B;  3CEQ A;  4WUY A;  1KT0 A;  1QQE A;  3ESK A;  4JA7 A;  3CVL A;  5G04 C;  4BWR A;  1PC2 A;  3HHM A;  3SZ7 A;  4KYO B;  3RRU A;  1HO8 A;  5ARF A;  5KJL A;  1INZ A;  2VSN A;  1P5Q A;  1IQR A;  5FZS A;  4FJY A;  2GRM A;  3PNL B;  5KJK A;  3ESL A;  2CFZ A;  3ML9 A;  3JCK C;  4I43 A;  4F3V A;  4NQ0 A;  4KT6 B;  4N3B A;  1H2U A;  2LNI A;  3FUD A;  4G24 A;  3FTZ A;  3LEW A;  2LAI A;  5BV0 A;  1QNF A;  3DBS A;  3ZVV A;  4HOQ A;  2OOE A;  3ZW3 A;  2RG8 A;  4GZ3 A;  3RO2 A;  4A55 A;  4PS3 A;  3TXN A;  4DI3 A;  1E7U A;  3CK9 A;  2CG2 A;  2MOW A;  3IHY A;  3MKR A;  4L2L A;  4XKC A;  2ILR A;  4WWO A;  4Q96 A;  5E75 A;  5G55 A;  5KCM A;  1L5J A;  3PRE A;  5A7D B;  4B8A A;  3FU3 A;  2AXV A;  3LYA A;  5CHE E;  4CGV A;  3O48 A;  3CHP A;  3FHE A;  2Y3A A;  3SGH A;  3EHN A;  1QZ2 A;  4GCN A;  2IQC A;  2X6K A;  3IKO B;  4Y6C A;  1TJC A;  4XIF A;  4AVX A;  4N2S A;  3ZHE B;  4IRU A;  4ANX A;  4LEU A;  3UPV A;  4J8S A;  1HG5 A;  2JEK A;  2CHW A;  3S7B A;  5JJT A;  5AYW D;  2WQ6 A;  3B7T A;  2X6I A;  3CVW A;  2A4Z A;  2WXJ A;  4G25 A;  3AS8 A;  4B94 A;  5CCM A;  3SI5 A;  3APF A;  5A6C A;  3S7F A;  4APO A;  3IBE A;  2BTD A;  4KVO A;  4HS2 A;  1W3B A;  4JVS A;  3ZEF A;  5BW8 C;  2R5S A;  4I2Z A;  4HOT A;  3CST A;  3OTN A;  3LXU X;  4DI4 A;  3ZYK A;  4ATG A;  4ILG A;  3EJN A;  5AIJ A;  2VGY A;  3CVU A;  2PZI A;  3FWV A;  2I1K A;  4L2Y A;  3UX4 A;  1E8X A;  2WMN A;  1OWO A;  1ELW A;  3G2W A;  4W9R A;  1EPU A;  3QOU A;  1FCH A;  2J09 A;  5FQ8 A;  3UT8 A;  1TEZ A;  4O6F A;  2KCV A;  2CG3 A;  5FT9 A;  5T8I A;  4UWG A;  3LPZ A;  4UWK A;  3FEY A;  4GZD A;  2KM4 A;  2Q7F A;  2X6J A;  4U8H A;  4JHR A;  3UT7 A;  5HI7 A;  1GW6 A;  3FUL A;  3HIZ A;  3MV2 B;  4U07 A;  3B13 A;  1XNF A;  4HLE A;  3ULQ A;  4F53 A;  4GML A;  5T3R A;  3L54 A;  5ENN A;  5AEN A;  3ZIM A;  3PE3 A;  3GZ1 A;  3D9L A;  2HM8 A;  3TXM A;  1HFA A;  3NQP A;  1OWM A;  3P1U A;  1HU3 A;  1IQU A;  1HG2 A;  3D3M A;  4J8D A;  3MV3 B;  4I2W A;  3VLD A;  3FTS A;  4C9B B;  2VSY A;  3ASH A;  3G2U A;  1HX8 A;  4GYY A;  4DPR A;  4LRZ A;  5FWQ A;  4CDR A;  3BG1 B;  3D9I A;  4AV7 A;  1NA3 A;  4DLQ A;  2M63 A;  3TJP A;  3CKB A;  2R59 A;  2J9Q A;  3N71 A;  3UMV A;  2IJG X;  2L0I A;  4GZ6 A;  3S2A A;  3ZFW A;  3OXF A;  4LCT A;  2GGF A;  3U9W A;  3B7S A;  3E4B A;  3PEU B;  3PE4 A;  1TJF A;  2LSV A;  1H6K A;  3AU5 A;  3I4R B;  4CDM A;  1FVF A;  4JHJ A;  4DJA A;  2I9C A;  4BTA A;  4GCO A;  2FEZ A;  4EBA A;  4EZL A;  3ZRH A;  4OYS A;  1Z3X A;  3RO3 A;  3ZXS A;  1H0A A;  2C0L A;  3I4G A;  4FLB A;  3HDX A;  1OWP A;  4UI9 C;  1PY1 A;  4I1O B;  4M3O A;  4JEU A;  4A1G A;  3SBS A;  3QJZ A;  4YND A;  4ME2 A;  4FAD A;  1MQS A;  3HVE B;  4NAC A;  3ZPJ A;  1U3C A;  1NP7 A;  3P2B A;  3K9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...