2WQ9A

Crystal structure of rbp4 bound to oleic acid
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
174
structure length
173
Chain Sequence
b'ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RETINOL-BINDING PROTEIN 4
publication title Crystal Structure of Rbp4 Bound to Oleic Acid
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 47
structure length 173
sequence length 174
ec nomenclature
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2wq9A00
1KOIA 1G7NA 2YG2A 3O2YA 3P6HA 3RSWA 4ORXA 1FENA 1S2PA 1NGLA 4ORUA 1YWBA 3U03A 3CBSA 1I4UA 4WFVA 4AZOA 3WXQA 2WSJA 5K06A 4LKPA 2R73A 1KT4A 4YFRA 1XCAA 1XKIA 1SXYA 1AVGI 4ORYA 1Z24A 2LBAA 4Y0RA 4YFPA 5LJEA 4TKBA 5HAEA 1IKEA 2K23A 2PY1A 2AT0X 3PP6A 4PSQA 3RZYA 2XSTA 2FS6A 3MVFA 1I04A 3F8AA 4HPAA 4N7DA 4IAWA 1KXOA 1A57A 1LKEA 2BLGA 1ZNGA 4NYRA 5DG4A 4YKOA 3NQ3A 2JOZA 4M6SA 3IFBA 5F7GA 1KT6A 1PBOA 4IBAA 3Q6LA 4YMYA 2IFBA 1TOUA 2WEXA 3FIQA 2ASNX 4IMNA 4LKTA 2ACPX 4GNYA 2W2BA 1BM5A 2R74A 2MJIA 4QAEA 3K3LA 1E06A 3DSZA 3BSZE 5LJKA 1FDQA 2HNXA 2QM9A 4BOEA 4D6AA 3VG4A 1LPJA 3OJYC 1VYFA 3EYCA 5HTDA 1QQSA 1SA8A 3ELZA 3S26A 1TXLA 1YIVA 1BBPA 1IKJA 3APWA 3CQNA 4OMXA 2Q39A 4ARHA 1EPBA 2LKKA 4YBPA 4TJZA 4GRJA 1S44A 1EW3A 3DTQA 1ALBA 1KZXA 1PEEA 2KTDA 5D47A 1B56A 4TNNA 1MUPA 1HQPA 1YP6A 4EFGA 2Q9SA 1B0OA 3G7XA 1FEMA 2CZUA 2ANSA 3CR6A 2Q2PA 2AL0X 4YGHA 1X8OA 4ZHGA 3FA8A 4IAXA 2JU3A 1CBSA 1EXSA 1GT5A 3FLLA 2WWPA 3CWKA 4ZFXA 1GX8A 1JZUA 2RCQA 4YGGA 4CK4A 1UZ2X 1U17A 1E5PA 4ALOA 1YWAA 5KIDA 5EPQA 1KQXA 1KQWA 3NADA 3BX7A 3TZSA 2CBRA 4NNSA 4I9SA 1GT4A 4ALBA 4QZUA 2HMBA 1QFTA 1KT7A 1SXXA 3GAQA 1O8VA 1R0UA 3ZUOA 5HZ9A 3B2KA 3HWFA 1YP7A 4A8ZA 2AKQA 4XMGA 1HBPA 1OBUA 2N93A 4LZUA 2GJ5A 4ZHHA 5EEDA 1LIEA 1BSQA 4GETA 2FR3A 1SXWA 4ZGUA 3PH6A 4YDBA 1GGLA 1DZJA 3P6CA 5LKEA 1T0VA 3SAOA 1E00A 3B2LA 5LJHA 1ZNKA 2WR6A 1RBPA 2A13A 1UREA 1CBIA 3APXA 2RQ0A 3F9DA 1QY2A 5B27A 4ZJ0A 1U0XA 1BLRA 2FS7A 1O1VA 4ZHCA 2NNQA 1ZNEA 5FFHA 1GM6A 3B2JA 3BS2A 5HTEA 4IMOA 1QFVA 2Q4NA 4YDAA 3ZQ3A 1LIBA 3STKA 2WEWA 5H8TA 2AT8X 4QGWA 1DV9A 1YUPA 3EBWA 2ALLX 3P6EA 5EDBA 1QY1A 4A1HA 1JJXA 1MVGA 3FENA 2RCTA 3APUA 4YCHA 4RUUA 4XMHA 4OS8A 3P6FA 3PECA 4D6BA 1ICNA 4YFQA 2R56A 1EIIA 3U0DA 2G79A 4ZHFA 3C77X 3NR3A 2DM5A 1QWDA 4IB9A 3D95A 4MVLA 5F6ZA 1TVQA 3KFGA 1ML7A 1IFCA 3ZUIA 4YGZA 4BVMA 3P6GA 1KGLA 1D2UA 2E4JA 3APVA 3VG5A 3FEPA 5LJDA 2FLJA 1HBQA 4LZVA 3L4RA 2A2UA 1T68X 5FENA 1KT5A 3WJDA 2HZQA 1MX7A 5DPQA 3WVMA 1EIOA 1X8NA 1DF3A 4ZHDA 3HK1A 5JR8A 3B2HA 5EDCA 4ZH6A 2XKLA 4TKJA 5L8NA 2L5PA 4AZPA 1QY0A 3BDRA 4R0BA 1AELA 4NLIA 1RLBE 1QG5A 2NNDA 1EALA 2L9CA 1I06A 4MVIA 2A3FX 4UU2A 1GXAA 1T8VA 5LJGA 2NP1A 2OVAA 1FE3A 1AQBA 1MX8A 1ZNDA 4QZTA 1LNMA 4XMDA 3UEXA 2OVDA 3BU9A 4M7MA 3FA7A 4Y0SA 3VG7A 2X46A 4IB8A 4XMFA 1LICA 4AZQA 2EU7X 1O1UA 3FR2A 2OVEA 1KZWA 4AYHA 4IB7A 5AQ6A 2KT4B 1SY2A 1P6PA 3FELA 1H91A 2CM9A 5EZ2A 3O19A 1BEBA 1GT1A 3U9PC 4AW8A 5L8OA 3FR4A 1G5WA 3STMX 3UEWA 3T1DA 4O9SA 1GT3A 1JYDA 3HWGA 5H9KA 1PMPA 3TF6A 5F58A 1BRQA 1TW4A 4OS0A 2JU8A 3EBKA 1ZNHA 2LBVA 5D48A 3AKMA 1JYJA 4I3CA 1BRPA 3VG3A 1BJ7A 2FTBA 2MO5A 3D96A 4WFUA 4ES7A 3ELXA 1YWCA 3HWEA 4I3BA 4A1YA 3WJGA 1DZMA 1DZPA 5CE4A 4HPBA 4TLJA 4DQ4A 1DFVA 3AKNA 3NX1A 4ORSA 5IO7A 5HZ6A 1EUOA 1X71A 5F6BA 3FEKA 4XMEA 3FW5A 3WBGA 2FWVA 1CJ5A 3CQRA 4KIIA 1ERBA 5H9LA 4YKMA 1B4MA 3P6DA 5HZ5A 5B29A 4AZRA 5HCDC 5HZQA 3CBCA 3TGBA 1D3SA 1EQDA 1OPBA 2QO4A 3B2IA 4NLJA 4WBKA 2X45A 3FA9A 2AH7X 1A18A 4GKCA 5IO6A 1ZRYA 1LIDA 3BY0A 4QYNA 3WJCA 1EPAA 1A3YA 1ZNLA 1B8EA 1HN2A 2G7BA 2L68A 2W2AA 3D97A 1G74A 5D4AA 4I3DA 4TKHA 1KT3A 3NX2A 3KFHA 2HLVA 3BRNA 5KICA 1OEKA 4GH7A 3C78X 1QABE 1VPRA 4UU3A 3KFFA 2QOSC 4IB6A 2LB6A 2AT3X 3BU1A 2L67A 5LJCA 2F73A 2FT9A 4NYQA 2RD7C 1HMRA 3UEUA 3CMPA 1DC9A 2HYSA 5LJBA 2QO5A 4HPDA 4ORWA 5KHPA 4YBUA 4TQ2A 2OZQA 3I17A 4OMWA 2AT5X 4NP1A 5EEEA 3TGAA 2O62A 1CRBA 1U18A 2W2FA 2WQ9A 3KFIA 4ZR2A 5D8JA 4XMCA 1BWYA 1SXUA 1SY3A 4NNTA 1FELA 1ADLA 1I05A 1HMTA 2JN3A 4QGVA 4I9RA 5BVSA 3WJEA 5IO5A 2FR2A 3FMZA 3EMMA 3PH5A 5HA1A 1LFOA 1SY1A 3FR5A 1IW2A 1L6MA 1MDCA 1NP4A 4ZCBA 2CM4A 1VYGA 5HZ8A 2JU7A 2NNEA 2QO6A 1GX9A 5D45A 3WJBA 1LF7A 2WQAE 5F1EA 5LKFA 1OEEA 2K62A 2HZRA 3O22A 4YCEA 1GKAB 3UEVA 4YH0A 3MBTA 2MM3A 4GE1A 5BVTA 3PEDA 1X8QA 1IIUA 1AB0A 1BSYA 2WUTA 4HFOA 1GKAA 1CBQA 4AZNA 1OBPA 2AMMX 4MVKA 4EXZA 5BVQA 1FTPA 4K19A 1A2DA 4ODDA 2AT6X 1OEJA 4AZMA 5HCCC 4A60A 4QYPA 4DQ3A 1G85A 5H9AA 1BSOA 3STNA 2A2GA 1ICMA 3WJFA 3PPTA 2FRSA 1N0SA 4EEJA 5C0NA 3HWDA 2OFMX 3BX8A 1JJJA 1OPAA 3JS1A 4Y0QA 5HWZA 2G78A 4BQUA 3IA8A 3KQ0A 1JV4A 3JSQA 1X8UA 3VG6A 4Y0PA 2CZTA 1OBQA 1YWDA 4ZH9A 1NP1A 5HA0A 3FW4A 2A0AA 1IFBA 3TGCA 1JBHA 2CBSA 5L8IA 3KZAA 1DZKA 1CBRA 3BLGA 1S7DA 4GNWA 4OS3A 3FA6A 3NPOA 3NQ9A 5HCEC 5FAZA 3QKGA 4EDEA 2P8GA 1SY0A 1E02A 1PM1X 2GC9A 1X89A 4N7CA 1X8PA 1TOWA 2LFOA 5HBSA 1ERXA 4RUNA 1LIFA 2Q2MA 4QGXA 2ACOA 2POAA 3C76X 2GTFX 2OFRX 5H9NA 3NP1A 4ORRA 2RA6A 4HPCA 3EM0A 3I0AA 1HMSA 3VG2A 1ACDA
chains in the Genus database with same CATH superfamily
5IRUA 2X56A 2IZAA 1KOIA 1G7NA 1OSPO 2YG2A 3O2YA 3P6HA 3RSWA 4ORXA 1FENA 1S2PA 1NGLA 4ORUA 1YWBA 3OBLA 3SZJA 1I78A 3U03A 3CBSA 1I4UA 4WFVA 4AZOA 3WXQA 2WSJA 5K06A 1VWQB 1VWJB 4LKPA 1RSUB 2R73A 1KT4A 4CDDA 4YFRA 1XCAA 4GK9A 5HA1A 1XKIA 1SXYA 2QMIA 1AVGI 3ZW1B 2IZGB 4ORYA 1Z24A 2LBAA 4Y0RA 1VWEB 4YFPA 4TKBA 5HAEA 5LJEA 1IKEA 3RDOA 3X00A 3P24A 1Y52X 4FQBB 2DJGA 2AT0X 2K23A 2PY1A 3PP6A 4PSQA 3RZYA 2AF5A 2XSTA 2FS6A 3MVFA 1I04A 3F8AA 1SWPA 4HPAA 4O3ZA 3ZW1A 4N7DA 4IAWA 1KXOA 1A57A 1LKEA 2ZAGA 2BLGA 1ZNGA 4NYRA 5DG4A 1VWFB 4YKOA 1I9HA 3NQ3A 2JOZA 2BT9A 4KC7A 4M6SA 3IFBA 2ZAIA 4O3YA 4U9CA 1KT6A 2C4IA 5F7GA 1SWLA 3RKGA 1GX3A 1PBOA 4IBAA 3Q6LA 4JO6A 2RTIB 1STPA 5CSEA 4YMYA 3SLOA 2IFBA 1STRB 1K24A 1TOUA 2WEXA 3FIQA 2ASNX 4IMNA 5B10O 4LKTA 2ACPX 4GNYA 2W2BA 4HWMA 1BM5A 2R74A 2MJIA 4NW4A 3K3LA 4QAEA 1E06A 3DSZA 2RN4A 3BSZE 5LJKA 3WZPA 1FDQA 2BHVA 2HNXA 2QM9A 4BOEA 3VG4A 4D6AA 4Z2VA 1LPJA 2KD2A 3OJYC 1VYFA 3EYCA 4O4XA 5HTDA 1QQSA 1SA8A 3ELZA 2RTNB 3S26A 4JNJA 1IJ8A 1UYOX 1TXLA 2BSZA 4ML7B 4O3WA 1PTSA 1YIVA 1BBPA 1IKJA 3APWA 3CQNA 4OMXA 3T6LA 2Q39A 1NDJA 4I6SA 4BGFA 3WOVA 4B55A 2MWHA 4ARHA 1EPBA 2C1SA 2LKKA 4TJZA 4YBPA 4GRJA 1S44A 1EW3A 3DTQA 1ALBA 1SWAA 1KZXA 1SLFB 1VWOB 2KTDA 1B56A 2RTOB 5D47A 4TNNA 1MUPA 1PEEA 3RDMA 2GTLN 1HQPA 4EKVA 1YP6A 2KTSA 1LUQA 4EFGA 4BX6B 2Q9SA 1B0OA 2OY8A 1FEMA 1HXZA 2RTGB 3G7XA 3WYQA 2OL6O 2CZUA 2ANSA 3CR6A 2Q2PA 2AL0X 4YGHA 2VFBA 1VWAB 4FBRA 1X8OA 4ZHGA 3FA8A 1EI5A 4IAXA 2JU3A 1CBSA 1EXSA 1GT5A 1SWOA 1Y0GA 1Y55X 4BX6A 3FLLA 2WWPA 3CWKA 4ZFXA 1GX8A 1JZUA 4OEMA 2RTFB 2RCQA 4YGGA 5L3YA 4CK4A 1UZ2X 3RE6A 3PDFA 4Z27A 1U17A 1E5PA 2Z4HA 1YWAA 3RDXA 4ALOA 4GJVA 5KIDA 4LQZA 5EPQA 1KQXA 1KQWA 2OL7A 2Z4IA 3NADA 3BX7A 4DCBA 3TZSA 2CBRA 1SLGB 4MEEA 4NNSA 4I9SA 1GT4A 3VGWA 4ALBA 2VFCA 1MK5A 1SWHA 1SWQA 1QFTA 1KT7A 2HMBA 1SXXA 3GAQA 4QZUA 1Y9TA 1SWKA 3MX7A 5AJBA 3RDSA 1O8VA 1R0UA 3ZUOA 5BYPA 5HZ9A 3VE1A 3B2KA 4ID2A 3HWFA 1YP7A 3SLJA 2AKQA 3HOLA 1HBPA 4XMGA 4A8ZA 1OBUA 2N93A 3FDCA 2RTLA 2GJ5A 4LZUA 5EEDA 4ZHHA 3T2XA 1LIEA 2G5LA 4GZVA 1BSQA 4GETA 2G8CO 2FR3A 2CAMA 3RY1A 4O4SA 3WZNA 1SXWA 2Y32A 1VWIB 4ZGUA 3PH6A 4YDBA 1LDOA 1DZJA 1GGLA 3LTWA 3WYPA 3P6CA 5AJCA 1KL5A 2BC3A 5LKEA 1T0VA 2KW1A 3SAOA 1E00A 1SWSA 2F01A 2HKDA 3B2LA 3WZQA 5LJHA 1ZNKA 2WR6A 1RBPA 2A13A 1UREA 1CBIA 2JMBA 2RQ0A 3APXA 1QY2A 1VYOA 3F9DA 1U0XA 5B27A 2FS7A 1O1VA 4IRWA 3UAQA 4ZHCA 2NNQA 1ZNEA 5FFHA 1GM6A 1KFFA 2OVSA 2RTHB 3B2JA 4CPFA 3E3CA 3BS2A 5HTEA 2RTBB 4CPHB 4IMOA 1QFVA 2Q4NA 5IRWA 5AEOA 4WHIA 4YDAA 3MM0A 3ZW2A 3ZQ3A 2X8FA 1LIBA 3Q34A 1VWBB 3STKA 2WEWA 3ZWEA 2RTMA 5H8TA 2AT8X 1Y9LA 4CPHA 2IZFB 4INNA 4L1NA 2FKJA 3VPJE 4QGWA 4U8UN 1YUPA 5B2AO 3EBWA 5B5GA 4BX7B 2ALLX 3P6EA 1DV9A 5EDBA 1QY1A 5CYBA 4A1HA 1MVGA 1RAVA 3FENA 3RDQA 1JJXA 4GJSA 2RCTA 3APUA 3FYFA 4YCHA 4QRLA 4RUUA 2RTAA 4XMHA 4QNIA 3VE2A 4OS8A 3P6FA 4BX7A 3PECA 4D6BA 1ICNA 4GD9A 1HXLA 4OELA 4YFQA 2OY1O 2IZCB 2R56A 1SRHA 1EIIA 1DF8A 3U0DA 2G79A 5FQ6E 4ZHFA 3C77X 1UYNX 1W5RA 1QWDA 2DM5A 3D95A 2WPUA 3NR3A 4IB9A 4MVLA 5F6ZA 1TVQA 4I95A 1NC9A 2AVIA 3KFGA 1ML7A 1IFCA 1VWCB 1E2TA 3ZUIA 4YGZA 4BVMA 1W6FA 3P6GA 2IZHB 1RXHA 1KGLA 1D2UA 2E4JA 1W4TA 1VWHB 3APVA 3VG5A 3FEPA 5LJDA 2FLJA 3QQ2A 1HBQA 4LZVA 4U8UO 3L4RA 2A2UA 1SLEB 1T68X 5FENA 1KT5A 1SWEA 3SZHA 2HZQA 3WJDA 1MX7A 2I5ZO 2BS5A 5DPQA 3WVMA 1EIOA 1X8NA 1DF3A 4ZHDA 4U8UM 1SWGA 3HK1A 5K68A 3B2HA 2IZBA 2IZJA 5JR8A 4L3RA 5EDCA 4ZH6A 2XKLA 4TKJA 5L8NA 2L5PA 2FGSA 4AZPA 1QY0A 3AUMO 1SWRA 3EW2A 4KT5A 2OL8O 3BDRA 4R0BA 2GH7A 1AELA 4Y5DA 2OFAA 4BJ8A 4Z6JA 4NLIA 1RLBE 1QG5A 2NNDA 3VU1A 1LCVA 1SRGA 1I06A 1LELA 2L9CA 2RTDB 1EALA 3RE5A 4MVIA 2A3FX 2LA7A 4UU2A 1GXAA 1T8VA 5LJGA 2NP1A 2OVAA 1MEPA 4Z2OA 1FE3A 1AQBA 5K67A 1MX8A 1ZNDA 4QZTA 3N91A 1LNMA 4XMDA 4GDZA 3UEXA 4IABA 2OVDA 1SREA 1LCZA 3BU9A 4M7MA 3FA7A 3H3IA 4Y0SA 3VG7A 2X46A 4IB8A 4XMFA 4Z2PA 1LICA 3LHNA 4AZQA 2MF6A 2EU7X 1O1UA 3FR2A 2OVEA 2UYWA 4AYHA 4IB7A 5AQ6A 1KZWA 2KT4B 1SY2A 1P6PA 3FELA 1H91A 2CM9A 5EZ2A 3O19A 1BEBA 5CHKA 1GT1A 3U9PC 4AW8A 4EQAC 5L8OA 3FR4A 1G5WA 3STMX 1SWUA 3UEWA 3T1DA 4O9SA 1GT3A 1JYDA 3D4RA 3HWGA 4Z28A 5H9KA 1PMPA 1N9YA 3TF6A 2OF8A 2FHNX 5F58A 1BRQA 1TW4A 4O4UA 4O49A 2JU8A 2X8SA 1ZNHA 3EBKA 1K3BA 2GTLO 3HTYA 4OS0A 2LBVA 3ZI8A 5D48A 3AKMA 1JYJA 4I3CA 1BRPA 3VG3A 1BJ7A 5B3MO 1SWJA 2FTBA 2C1QA 2MO5A 3D96A 4YVBA 1FJ1E 1STSB 2GTLM 4WFUA 3JQOA 4ES7A 2RTPB 1SWFA 2Y3FA 3ELXA 1N4JA 1YWCA 3SOTA 3HWEA 2F09A 4FBOA 4I3BA 4A1YA 3WJGA 1DZMA 3RDUA 1DZPA 3RBYA 5CE4A 4HPBA 4TLJA 4DQ4A 1DFVA 1Y53X 1SWTA 3AKNA 3NX1A 4ORSA 5IRAA 3RWXA 4CDEA 5HZ6A 5IO7A 1EUOA 1X71A 5F6BA 3FEKA 5IXGA 4XMEA 3FW5A 2OY7A 3WBGA 2QCBA 2FWVA 1JMXA 1VWKB 1CJ5A 3CQRA 4KIIA 1JMZA 1ERBA 5H9LA 4YKMA 1B4MA 3P6DA 5HZ5A 5B29A 4AZRA 4I60A 4U46A 3VHMA 4BBOA 3P02A 5HCDC 1NBXA 5HZQA 3CBCA 3TGBA 1D3SA 1EQDA 1OPBA 2QO4A 3B2IA 3MG5A 4NLJA 4WBKA 2X45A 3FA9A 4ZJ0A 2AH7X 1A18A 4GKCA 5IO6A 2OF9A 1ZRYA 1LIDA 3BY0A 4O3XB 4QYNA 3WJCA 1BLRA 1EPAA 1A3YA 1ZNLA 1SWNA 1B8EA 2RTQB 1HN2A 2G7BA 2L68A 2W2AA 3D97A 1G74A 4U3QA 1HY2A 5D4AA 3S5XA 1SWDA 4DNEA 4I3DA 4TKHA 1KT3A 3NX2A 3KFHA 4CDFA 2RTJA 4COTA 1NQNA 2HLVA 3BRNA 5KICA 1OEKA 4GH7A 3C78X 1QABE 1SRIA 3NQKA 1VPRA 4UU3A 1VWRB 2IZLB 4CDCA 1SWBA 2QOSC 3KFFA 4IB6A 2LB6A 2AT3X 4KCAA 2OFBA 3BU1A 2L67A 3WZOA 5FQ7E 3PQSA 2ZSCA 3V8UA 2X4MA 5LJCA 2F73A 2FKGA 1KL3A 2FT9A 4NYQA 3PK2A 2RD7C 1HMRA 3UEUA 3CMPA 1DC9A 4GGTA 2HYSA 5LJBA 5JD2A 2QO5A 4HPDA 2A5BA 4ORWA 5KHPA 4YBUA 1NQMA 4TQ2A 1HQQA 2OZQA 1KL4A 3I17A 4Y59A 3T2WA 4OMWA 2AT5X 4NP1A 5EEEA 3TGAA 2JGSA 2O62A 1CRBA 1U18A 2W2FA 2WQ9A 3KFIA 5F2BA 4ZR2A 5D8JA 4XMCA 1BWYA 5B5FA 1SRFA 2IZIA 3LV4A 1VWLB 1SXUA 1SY3A 4NNTA 1FELA 1ADLA 1SWCA 1I05A 1HMTA 3FIDA 1SLDB 3OD9A 2JN3A 1RXKA 3PQUA 4I9RA 4QGVA 2FHLA 2OYBO 5BVSA 4PJ2A 3WJEA 5IO5A 1RXJA 2FR2A 1SRJA 4C5PA 2YMSA 3EMMA 3FMZA 3PH5A 1LFOA 1SY1A 3FR5A 4GGRA 1IW2A 1L6MA 1MDCA 1MM9A 1NP4A 2CM4A 4ZCBA 1VYGA 3EC5A 2JU7A 3OE3A 2NNEA 4MIRA 3ZW0B 4GUZA 5HZ8A 1JQPA 2QO6A 4KH8A 1GX9A 5D45A 3S60A 1MOYA 2BS6A 4OKAA 2X8TA 1LF7A 3WJBA 2IZEB 2WQAE 5F1EA 5LKFA 3RY2A 2I5VO 4ON1A 1OEEA 2X32A 3ZW0A 1VWMB 2HZRA 2K62A 3O22A 4YCEA 1GKAB 3UEVA 4YH0A 3MBTA 4MVEA 2MM3A 4GE1A 4GDAA 4CPEA 1WBIA 5BVTA 3PEDA 1X8QA 4ZGFA 1IIUA 1AB0A 2RTCB 2IZDB 1BSYA 2WUTA 3KVNA 4HFOA 1VWNB 1GKAA 1JJUA 1CBQA 4AZNA 2IZKA 1OBPA 2AMMX 4MVKA 3NBXX 4EXZA 5BVQA 1FTPA 4K19A 1A2DA 2DJFA 4ODDA 2AT6X 4CV7A 1OEJA 4AZMA 5HCCC 1RSTB 4A60A 4JHQA 4QYPA 4DQ3A 2RTKA 4O4OA 1G85A 5H9AA 1SMPI 1N7YA 1BSOA 1JIWI 3CKFA 3STNA 4CSBA 1N43A 2A2GA 1ICMA 3WJFA 5B11O 3HOEA 3S5VA 3PPTA 2FRSA 1N0SA 4FGIB 4EEJA 4CPIA 3HWDA 2OFMX 5C0NA 2M4LA 3BX8A 1JJJA 1LCWA 2X34A 3VHIA 1OPAA 3JS1A 4Y0QA 5HWZA 2G78A 4NV7A 4BQUA 3IA8A 3KQ0A 1JV4A 1WUBA 3EW1A 3JSQA 2Y3EA 2PI3O 2RTEB 2A5CA 1X8UA 3VG6A 1VWPB 2VDFA 4Y0PA 2RTRB 1LDQA 1AVEA 1OBQA 2CZTA 1YWDA 4ZH9A 4BX5B 3T6FA 1NP1A 3HPEA 5HA0A 1PBYA 2A0AA 3FW4A 4JGLA 1IFBA 3TGCA 3GE2A 2CBSA 1JBHA 1VWDB 5L8IA 3AEHA 3KZAA 1DZKA 1CBRA 3BLGA 4QQ1A 3SLTA 1S7DA 4GNWA 4OS3A 3F6ZB 4BX5A 3FA6A 3NPOA 3NQ9A 5HCEC 5FAZA 4KC8A 2OY5O 4GGZA 4BCSA 3QKGA 4EDEA 2P8GA 1SY0A 3ZZVA 3VHHA 1E02A 1PM1X 2JW1A 2A8GA 2GC9A 1X89A 4N7CA 1X8PA 1TOWA 2LFOA 1VWGB 5HBSA 1ERXA 3D9WA 4RUNA 1LIFA 4MISA 2Q2MA 1N9MA 2QOMA 4QGXA 2ACOA 2UZ2A 3CKGA 5FQ8E 4GU8A 2POAA 3C76X 2GTFX 3SZIA 2OFRX 5H9NA 2MHDA 3NP1A 4ORRA 2RA6A 2X55A 3EM0A 4HPCA 4NV8A 1AVDA 3I0AA 4FBVA 1HMSA 3VG2A 1ACDA
chains in the Genus database with same CATH topology
1KOIA 1G7NA 2YG2A 3O2YA 3P6HA 3RSWA 4ORXA 1FENA 1S2PA 1NGLA 4ORUA 1YWBA 3OBLA 3U03A 3CBSA 1I4UA 4WFVA 4AZOA 3WXQA 2WSJA 5K06A 4LKPA 2R73A 1KT4A 4YFRA 1XCAA 4GK9A 1XKIA 1SXYA 2QMIA 1AVGI 3ZW1B 4ORYA 1Z24A 2LBAA 4Y0RA 4YFPA 5LJEA 4TKBA 5HAEA 1IKEA 3P24A 4FQBB 2K23A 2PY1A 2AT0X 3PP6A 4PSQA 3RZYA 2XSTA 2FS6A 3MVFA 1I04A 3F8AA 4HPAA 4O3ZA 3ZW1A 4N7DA 4IAWA 1KXOA 1A57A 1LKEA 2ZAGA 2BLGA 1ZNGA 4NYRA 5DG4A 4YKOA 3NQ3A 2JOZA 2BT9A 4KC7A 4M6SA 3IFBA 2ZAIA 4O3YA 4U9CA 1KT6A 5F7GA 3RKGA 1PBOA 4IBAA 3Q6LA 4YMYA 2IFBA 1TOUA 2WEXA 3FIQA 2ASNX 4IMNA 4LKTA 2ACPX 4GNYA 2W2BA 4HWMA 1BM5A 2R74A 2MJIA 4NW4A 3K3LA 4QAEA 1E06A 3DSZA 2RN4A 3BSZE 5LJKA 1FDQA 2BHVA 2HNXA 2QM9A 4BOEA 3VG4A 4D6AA 1LPJA 2KD2A 3OJYC 1VYFA 3EYCA 4O4XA 5HTDA 1QQSA 1SA8A 3ELZA 3S26A 1TXLA 4ML7B 4O3WA 1YIVA 1BBPA 1IKJA 3APWA 3CQNA 4OMXA 2Q39A 4I6SA 3WOVA 2MWHA 4ARHA 1EPBA 2LKKA 4YBPA 4TJZA 4GRJA 1S44A 1EW3A 3DTQA 1ALBA 1KZXA 1PEEA 2KTDA 5D47A 1B56A 4TNNA 1MUPA 2GTLN 1HQPA 1YP6A 2KTSA 4EFGA 2Q9SA 1B0OA 3G7XA 1FEMA 2CZUA 2ANSA 3CR6A 2Q2PA 2AL0X 4YGHA 4FBRA 1X8OA 4ZHGA 3FA8A 1EI5A 4IAXA 2JU3A 1CBSA 1EXSA 1GT5A 3FLLA 2WWPA 3CWKA 4ZFXA 1GX8A 1JZUA 2RCQA 4YGGA 4CK4A 1UZ2X 1U17A 1E5PA 2Z4HA 1YWAA 4ALOA 5KIDA 4LQZA 5EPQA 1KQXA 1KQWA 2Z4IA 3NADA 3BX7A 3TZSA 2CBRA 4NNSA 4I9SA 1GT4A 4ALBA 4QZUA 2HMBA 1QFTA 1KT7A 5AJBA 1SXXA 3GAQA 1Y9TA 3MX7A 1O8VA 1R0UA 3ZUOA 5BYPA 5HZ9A 3B2KA 4ID2A 3HWFA 1YP7A 4A8ZA 2AKQA 3HOLA 1HBPA 4XMGA 1OBUA 2N93A 4LZUA 2GJ5A 4ZHHA 5EEDA 1LIEA 4GZVA 1BSQA 4GETA 2FR3A 4O4SA 1SXWA 4ZGUA 3PH6A 4YDBA 1GGLA 1DZJA 3P6CA 5AJCA 5LKEA 1T0VA 2KW1A 3SAOA 1E00A 3B2LA 5LJHA 1ZNKA 2WR6A 1RBPA 2A13A 1UREA 1CBIA 2JMBA 2RQ0A 3APXA 1QY2A 3F9DA 5B27A 1U0XA 3RBYA 2FS7A 1O1VA 3UAQA 4ZHCA 2NNQA 1ZNEA 5FFHA 1GM6A 2OVSA 3B2JA 3E3CA 3BS2A 5HTEA 4IMOA 1QFVA 2Q4NA 5AEOA 4WHIA 4YDAA 3ZW2A 3ZQ3A 2X8FA 1LIBA 3STKA 2WEWA 3ZWEA 5H8TA 2AT8X 1Y9LA 4INNA 4L1NA 3VPJE 4QGWA 4U8UN 1YUPA 1DV9A 3EBWA 2ALLX 3P6EA 5EDBA 1QY1A 5CYBA 4A1HA 1MVGA 3FENA 1JJXA 2RCTA 3APUA 3FYFA 4YCHA 4QRLA 4RUUA 4XMHA 3VE2A 4QNIA 4OS8A 3P6FA 3PECA 4D6BA 1ICNA 4YFQA 2R56A 1EIIA 3U0DA 2G79A 5FQ6E 4ZHFA 3C77X 3NR3A 2DM5A 1QWDA 4IB9A 3D95A 4MVLA 5F6ZA 1TVQA 4I95A 3KFGA 1ML7A 1IFCA 3ZUIA 4YGZA 4BVMA 3P6GA 1KGLA 1D2UA 2E4JA 3APVA 3VG5A 3FEPA 5LJDA 2FLJA 1HBQA 4LZVA 4U8UO 3L4RA 2A2UA 1T68X 5FENA 1KT5A 3WJDA 2HZQA 1MX7A 2BS5A 5DPQA 3WVMA 1EIOA 1X8NA 1DF3A 4ZHDA 4U8UM 3HK1A 5JR8A 3B2HA 4L3RA 5EDCA 4ZH6A 2XKLA 4TKJA 5L8NA 2L5PA 4AZPA 1QY0A 4KT5A 3BDRA 4R0BA 1AELA 4NLIA 1RLBE 1QG5A 2NNDA 3VU1A 1EALA 2L9CA 1I06A 4MVIA 2A3FX 2LA7A 4UU2A 1GXAA 1T8VA 5LJGA 2NP1A 2OVAA 1FE3A 1AQBA 1MX8A 1ZNDA 4QZTA 3N91A 1LNMA 4XMDA 4GDZA 3UEXA 4IABA 2OVDA 3BU9A 4M7MA 3FA7A 3H3IA 4Y0SA 3VG7A 2X46A 4IB8A 4XMFA 1LICA 3LHNA 4AZQA 2EU7X 1O1UA 3FR2A 2OVEA 1KZWA 4AYHA 4IB7A 5AQ6A 2KT4B 1SY2A 1P6PA 3FELA 1H91A 2CM9A 5EZ2A 3O19A 1BEBA 1GT1A 3U9PC 4AW8A 4EQAC 5L8OA 3FR4A 1G5WA 3STMX 3UEWA 3T1DA 4O9SA 1GT3A 1JYDA 3D4RA 3HWGA 5H9KA 1PMPA 3TF6A 5F58A 1BRQA 1TW4A 4O4UA 4O49A 2JU8A 2X8SA 1ZNHA 3EBKA 2GTLO 3HTYA 4OS0A 2LBVA 3ZI8A 5D48A 3AKMA 1JYJA 4I3CA 1BRPA 3VG3A 1BJ7A 2FTBA 2MO5A 3D96A 2GTLM 4WFUA 3JQOA 4ES7A 3SOTA 3ELXA 1YWCA 3HWEA 2F09A 4FBOA 4I3BA 4A1YA 3WJGA 1DZMA 1DZPA 5CE4A 4HPBA 4TLJA 4DQ4A 1DFVA 3AKNA 3NX1A 4ORSA 5IO7A 3RWXA 5HZ6A 1EUOA 1X71A 5F6BA 3FEKA 4XMEA 3FW5A 3WBGA 2FWVA 1CJ5A 3CQRA 4KIIA 1ERBA 5H9LA 4YKMA 1B4MA 3P6DA 5HZ5A 5B29A 4AZRA 3P02A 5HCDC 5HZQA 3CBCA 3TGBA 1D3SA 1EQDA 1OPBA 2QO4A 3B2IA 4NLJA 4WBKA 4ZJ0A 2X45A 3FA9A 2AH7X 1A18A 4GKCA 5IO6A 1ZRYA 1LIDA 3BY0A 4O3XB 4QYNA 3WJCA 1BLRA 1EPAA 1A3YA 1ZNLA 1B8EA 1HN2A 2G7BA 2L68A 2W2AA 3D97A 1G74A 4U3QA 3S5XA 5D4AA 4I3DA 4TKHA 1KT3A 3NX2A 3KFHA 4COTA 2HLVA 3BRNA 5KICA 1OEKA 4GH7A 3C78X 1QABE 3NQKA 1VPRA 4UU3A 3KFFA 2QOSC 4IB6A 2LB6A 2AT3X 4KCAA 3BU1A 2L67A 5FQ7E 3PQSA 3V8UA 5LJCA 2F73A 2FT9A 4NYQA 2RD7C 1HMRA 3UEUA 3CMPA 1DC9A 2HYSA 5LJBA 2QO5A 4HPDA 4ORWA 5KHPA 4YBUA 4TQ2A 2OZQA 3I17A 4OMWA 2AT5X 4NP1A 5EEEA 3TGAA 2O62A 1CRBA 1U18A 2W2FA 2WQ9A 3KFIA 4ZR2A 5D8JA 4XMCA 1BWYA 3LV4A 1SXUA 1SY3A 4NNTA 1FELA 1ADLA 1I05A 1HMTA 3OD9A 2JN3A 3PQUA 4QGVA 4I9RA 5BVSA 4PJ2A 3WJEA 5IO5A 2FR2A 2YMSA 3EMMA 3FMZA 3PH5A 1LFOA 1SY1A 3FR5A 5HA1A 1IW2A 1L6MA 1MDCA 1NP4A 4ZCBA 2CM4A 3VE1A 1VYGA 5HZ8A 2JU7A 3OE3A 2NNEA 4MIRA 3ZW0B 2QO6A 4KH8A 1GX9A 5D45A 3S60A 2BS6A 2X8TA 1LF7A 3WJBA 2WQAE 5F1EA 5LKFA 4ON1A 1OEEA 3ZW0A 2K62A 2HZRA 3O22A 4YCEA 1GKAB 3UEVA 4YH0A 3MBTA 4MVEA 2MM3A 4GE1A 5BVTA 3PEDA 1X8QA 4ZGFA 1IIUA 1AB0A 1BSYA 2WUTA 4HFOA 1GKAA 1CBQA 4AZNA 1OBPA 2AMMX 4MVKA 3NBXX 4EXZA 5BVQA 1FTPA 4K19A 1A2DA 4ODDA 2AT6X 4CV7A 1OEJA 4AZMA 5HCCC 4A60A 4QYPA 4DQ3A 4O4OA 1G85A 5H9AA 1SMPI 1BSOA 1JIWI 4CSBA 3STNA 2A2GA 1ICMA 3WJFA 3HOEA 3S5VA 3PPTA 2FRSA 1N0SA 4FGIB 4EEJA 5C0NA 3HWDA 2OFMX 2M4LA 3BX8A 1JJJA 1OPAA 3JS1A 4Y0QA 5HWZA 2G78A 4BQUA 3IA8A 3KQ0A 1JV4A 3JSQA 1X8UA 3VG6A 4Y0PA 2CZTA 1OBQA 1YWDA 4ZH9A 1NP1A 5HA0A 3FW4A 2A0AA 4JGLA 1IFBA 3TGCA 3GE2A 2CBSA 1JBHA 5L8IA 3KZAA 1DZKA 1CBRA 3BLGA 4QQ1A 1S7DA 4GNWA 4OS3A 3F6ZB 3FA6A 3NPOA 3NQ9A 5HCEC 5FAZA 4KC8A 3QKGA 4EDEA 2P8GA 1SY0A 3ZZVA 1E02A 1PM1X 2JW1A 2GC9A 1X89A 4N7CA 1X8PA 1TOWA 2LFOA 5HBSA 1ERXA 4RUNA 1LIFA 4MISA 2Q2MA 4QGXA 2ACOA 5FQ8E 4GU8A 2POAA 3C76X 2GTFX 2OFRX 5H9NA 2MHDA 3NP1A 4ORRA 2RA6A 4HPCA 3EM0A 3I0AA 4FBVA 1HMSA 3VG2A 1ACDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KOI A;  1G7N A;  2YG2 A;  3O2Y A;  3P6H A;  3RSW A;  4ORX A;  1FEN A;  1S2P A;  1NGL A;  4ORU A;  1YWB A;  3U03 A;  3CBS A;  1I4U A;  4WFV A;  4AZO A;  3WXQ A;  2WSJ A;  5K06 A;  4LKP A;  2R73 A;  1KT4 A;  4YFR A;  1XCA A;  1XKI A;  1SXY A;  1AVG I;  4ORY A;  1Z24 A;  2LBA A;  4Y0R A;  4YFP A;  5LJE A;  4TKB A;  5HAE A;  1IKE A;  2K23 A;  2PY1 A;  2AT0 X;  3PP6 A;  4PSQ A;  3RZY A;  2XST A;  2FS6 A;  3MVF A;  1I04 A;  3F8A A;  4HPA A;  4N7D A;  4IAW A;  1KXO A;  1A57 A;  1LKE A;  2BLG A;  1ZNG A;  4NYR A;  5DG4 A;  4YKO A;  3NQ3 A;  2JOZ A;  4M6S A;  3IFB A;  5F7G A;  1KT6 A;  1PBO A;  4IBA A;  3Q6L A;  4YMY A;  2IFB A;  1TOU A;  2WEX A;  3FIQ A;  2ASN X;  4IMN A;  4LKT A;  2ACP X;  4GNY A;  2W2B A;  1BM5 A;  2R74 A;  2MJI A;  4QAE A;  3K3L A;  1E06 A;  3DSZ A;  3BSZ E;  5LJK A;  1FDQ A;  2HNX A;  2QM9 A;  4BOE A;  4D6A A;  3VG4 A;  1LPJ A;  3OJY C;  1VYF A;  3EYC A;  5HTD A;  1QQS A;  1SA8 A;  3ELZ A;  3S26 A;  1TXL A;  1YIV A;  1BBP A;  1IKJ A;  3APW A;  3CQN A;  4OMX A;  2Q39 A;  4ARH A;  1EPB A;  2LKK A;  4YBP A;  4TJZ A;  4GRJ A;  1S44 A;  1EW3 A;  3DTQ A;  1ALB A;  1KZX A;  1PEE A;  2KTD A;  5D47 A;  1B56 A;  4TNN A;  1MUP A;  1HQP A;  1YP6 A;  4EFG A;  2Q9S A;  1B0O A;  3G7X A;  1FEM A;  2CZU A;  2ANS A;  3CR6 A;  2Q2P A;  2AL0 X;  4YGH A;  1X8O A;  4ZHG A;  3FA8 A;  4IAX A;  2JU3 A;  1CBS A;  1EXS A;  1GT5 A;  3FLL A;  2WWP A;  3CWK A;  4ZFX A;  1GX8 A;  1JZU A;  2RCQ A;  4YGG A;  4CK4 A;  1UZ2 X;  1U17 A;  1E5P A;  4ALO A;  1YWA A;  5KID A;  5EPQ A;  1KQX A;  1KQW A;  3NAD A;  3BX7 A;  3TZS A;  2CBR A;  4NNS A;  4I9S A;  1GT4 A;  4ALB A;  4QZU A;  2HMB A;  1QFT A;  1KT7 A;  1SXX A;  3GAQ A;  1O8V A;  1R0U A;  3ZUO A;  5HZ9 A;  3B2K A;  3HWF A;  1YP7 A;  4A8Z A;  2AKQ A;  4XMG A;  1HBP A;  1OBU A;  2N93 A;  4LZU A;  2GJ5 A;  4ZHH A;  5EED A;  1LIE A;  1BSQ A;  4GET A;  2FR3 A;  1SXW A;  4ZGU A;  3PH6 A;  4YDB A;  1GGL A;  1DZJ A;  3P6C A;  5LKE A;  1T0V A;  3SAO A;  1E00 A;  3B2L A;  5LJH A;  1ZNK A;  2WR6 A;  1RBP A;  2A13 A;  1URE A;  1CBI A;  3APX A;  2RQ0 A;  3F9D A;  1QY2 A;  5B27 A;  4ZJ0 A;  1U0X A;  1BLR A;  2FS7 A;  1O1V A;  4ZHC A;  2NNQ A;  1ZNE A;  5FFH A;  1GM6 A;  3B2J A;  3BS2 A;  5HTE A;  4IMO A;  1QFV A;  2Q4N A;  4YDA A;  3ZQ3 A;  1LIB A;  3STK A;  2WEW A;  5H8T A;  2AT8 X;  4QGW A;  1DV9 A;  1YUP A;  3EBW A;  2ALL X;  3P6E A;  5EDB A;  1QY1 A;  4A1H A;  1JJX A;  1MVG A;  3FEN A;  2RCT A;  3APU A;  4YCH A;  4RUU A;  4XMH A;  4OS8 A;  3P6F A;  3PEC A;  4D6B A;  1ICN A;  4YFQ A;  2R56 A;  1EII A;  3U0D A;  2G79 A;  4ZHF A;  3C77 X;  3NR3 A;  2DM5 A;  1QWD A;  4IB9 A;  3D95 A;  4MVL A;  5F6Z A;  1TVQ A;  3KFG A;  1ML7 A;  1IFC A;  3ZUI A;  4YGZ A;  4BVM A;  3P6G A;  1KGL A;  1D2U A;  2E4J A;  3APV A;  3VG5 A;  3FEP A;  5LJD A;  2FLJ A;  1HBQ A;  4LZV A;  3L4R A;  2A2U A;  1T68 X;  5FEN A;  1KT5 A;  3WJD A;  2HZQ A;  1MX7 A;  5DPQ A;  3WVM A;  1EIO A;  1X8N A;  1DF3 A;  4ZHD A;  3HK1 A;  5JR8 A;  3B2H A;  5EDC A;  4ZH6 A;  2XKL A;  4TKJ A;  5L8N A;  2L5P A;  4AZP A;  1QY0 A;  3BDR A;  4R0B A;  1AEL A;  4NLI A;  1RLB E;  1QG5 A;  2NND A;  1EAL A;  2L9C A;  1I06 A;  4MVI A;  2A3F X;  4UU2 A;  1GXA A;  1T8V A;  5LJG A;  2NP1 A;  2OVA A;  1FE3 A;  1AQB A;  1MX8 A;  1ZND A;  4QZT A;  1LNM A;  4XMD A;  3UEX A;  2OVD A;  3BU9 A;  4M7M A;  3FA7 A;  4Y0S A;  3VG7 A;  2X46 A;  4IB8 A;  4XMF A;  1LIC A;  4AZQ A;  2EU7 X;  1O1U A;  3FR2 A;  2OVE A;  1KZW A;  4AYH A;  4IB7 A;  5AQ6 A;  2KT4 B;  1SY2 A;  1P6P A;  3FEL A;  1H91 A;  2CM9 A;  5EZ2 A;  3O19 A;  1BEB A;  1GT1 A;  3U9P C;  4AW8 A;  5L8O A;  3FR4 A;  1G5W A;  3STM X;  3UEW A;  3T1D A;  4O9S A;  1GT3 A;  1JYD A;  3HWG A;  5H9K A;  1PMP A;  3TF6 A;  5F58 A;  1BRQ A;  1TW4 A;  4OS0 A;  2JU8 A;  3EBK A;  1ZNH A;  2LBV A;  5D48 A;  3AKM A;  1JYJ A;  4I3C A;  1BRP A;  3VG3 A;  1BJ7 A;  2FTB A;  2MO5 A;  3D96 A;  4WFU A;  4ES7 A;  3ELX A;  1YWC A;  3HWE A;  4I3B A;  4A1Y A;  3WJG A;  1DZM A;  1DZP A;  5CE4 A;  4HPB A;  4TLJ A;  4DQ4 A;  1DFV A;  3AKN A;  3NX1 A;  4ORS A;  5IO7 A;  5HZ6 A;  1EUO A;  1X71 A;  5F6B A;  3FEK A;  4XME A;  3FW5 A;  3WBG A;  2FWV A;  1CJ5 A;  3CQR A;  4KII A;  1ERB A;  5H9L A;  4YKM A;  1B4M A;  3P6D A;  5HZ5 A;  5B29 A;  4AZR A;  5HCD C;  5HZQ A;  3CBC A;  3TGB A;  1D3S A;  1EQD A;  1OPB A;  2QO4 A;  3B2I A;  4NLJ A;  4WBK A;  2X45 A;  3FA9 A;  2AH7 X;  1A18 A;  4GKC A;  5IO6 A;  1ZRY A;  1LID A;  3BY0 A;  4QYN A;  3WJC A;  1EPA A;  1A3Y A;  1ZNL A;  1B8E A;  1HN2 A;  2G7B A;  2L68 A;  2W2A A;  3D97 A;  1G74 A;  5D4A A;  4I3D A;  4TKH A;  1KT3 A;  3NX2 A;  3KFH A;  2HLV A;  3BRN A;  5KIC A;  1OEK A;  4GH7 A;  3C78 X;  1QAB E;  1VPR A;  4UU3 A;  3KFF A;  2QOS C;  4IB6 A;  2LB6 A;  2AT3 X;  3BU1 A;  2L67 A;  5LJC A;  2F73 A;  2FT9 A;  4NYQ A;  2RD7 C;  1HMR A;  3UEU A;  3CMP A;  1DC9 A;  2HYS A;  5LJB A;  2QO5 A;  4HPD A;  4ORW A;  5KHP A;  4YBU A;  4TQ2 A;  2OZQ A;  3I17 A;  4OMW A;  2AT5 X;  4NP1 A;  5EEE A;  3TGA A;  2O62 A;  1CRB A;  1U18 A;  2W2F A;  2WQ9 A;  3KFI A;  4ZR2 A;  5D8J A;  4XMC A;  1BWY A;  1SXU A;  1SY3 A;  4NNT A;  1FEL A;  1ADL A;  1I05 A;  1HMT A;  2JN3 A;  4QGV A;  4I9R A;  5BVS A;  3WJE A;  5IO5 A;  2FR2 A;  3FMZ A;  3EMM A;  3PH5 A;  5HA1 A;  1LFO A;  1SY1 A;  3FR5 A;  1IW2 A;  1L6M A;  1MDC A;  1NP4 A;  4ZCB A;  2CM4 A;  1VYG A;  5HZ8 A;  2JU7 A;  2NNE A;  2QO6 A;  1GX9 A;  5D45 A;  3WJB A;  1LF7 A;  2WQA E;  5F1E A;  5LKF A;  1OEE A;  2K62 A;  2HZR A;  3O22 A;  4YCE A;  1GKA B;  3UEV A;  4YH0 A;  3MBT A;  2MM3 A;  4GE1 A;  5BVT A;  3PED A;  1X8Q A;  1IIU A;  1AB0 A;  1BSY A;  2WUT A;  4HFO A;  1GKA A;  1CBQ A;  4AZN A;  1OBP A;  2AMM X;  4MVK A;  4EXZ A;  5BVQ A;  1FTP A;  4K19 A;  1A2D A;  4ODD A;  2AT6 X;  1OEJ A;  4AZM A;  5HCC C;  4A60 A;  4QYP A;  4DQ3 A;  1G85 A;  5H9A A;  1BSO A;  3STN A;  2A2G A;  1ICM A;  3WJF A;  3PPT A;  2FRS A;  1N0S A;  4EEJ A;  5C0N A;  3HWD A;  2OFM X;  3BX8 A;  1JJJ A;  1OPA A;  3JS1 A;  4Y0Q A;  5HWZ A;  2G78 A;  4BQU A;  3IA8 A;  3KQ0 A;  1JV4 A;  3JSQ A;  1X8U A;  3VG6 A;  4Y0P A;  2CZT A;  1OBQ A;  1YWD A;  4ZH9 A;  1NP1 A;  5HA0 A;  3FW4 A;  2A0A A;  1IFB A;  3TGC A;  1JBH A;  2CBS A;  5L8I A;  3KZA A;  1DZK A;  1CBR A;  3BLG A;  1S7D A;  4GNW A;  4OS3 A;  3FA6 A;  3NPO A;  3NQ9 A;  5HCE C;  5FAZ A;  3QKG A;  4EDE A;  2P8G A;  1SY0 A;  1E02 A;  1PM1 X;  2GC9 A;  1X89 A;  4N7C A;  1X8P A;  1TOW A;  2LFO A;  5HBS A;  1ERX A;  4RUN A;  1LIF A;  2Q2M A;  4QGX A;  2ACO A;  2POA A;  3C76 X;  2GTF X;  2OFR X;  5H9N A;  3NP1 A;  4ORR A;  2RA6 A;  4HPC A;  3EM0 A;  3I0A A;  1HMS A;  3VG2 A;  1ACD A; 
#chains in the Genus database with same CATH topology
 5IRU A;  2X56 A;  2IZA A;  1KOI A;  1G7N A;  1OSP O;  2YG2 A;  3O2Y A;  3P6H A;  3RSW A;  4ORX A;  1FEN A;  1S2P A;  1NGL A;  4ORU A;  1YWB A;  3OBL A;  3SZJ A;  1I78 A;  3U03 A;  3CBS A;  1I4U A;  4WFV A;  4AZO A;  3WXQ A;  2WSJ A;  5K06 A;  1VWQ B;  1VWJ B;  4LKP A;  1RSU B;  2R73 A;  1KT4 A;  4CDD A;  4YFR A;  1XCA A;  4GK9 A;  5HA1 A;  1XKI A;  1SXY A;  2QMI A;  1AVG I;  3ZW1 B;  2IZG B;  4ORY A;  1Z24 A;  2LBA A;  4Y0R A;  1VWE B;  4YFP A;  4TKB A;  5HAE A;  5LJE A;  1IKE A;  3RDO A;  3X00 A;  3P24 A;  1Y52 X;  4FQB B;  2DJG A;  2AT0 X;  2K23 A;  2PY1 A;  3PP6 A;  4PSQ A;  3RZY A;  2AF5 A;  2XST A;  2FS6 A;  3MVF A;  1I04 A;  3F8A A;  1SWP A;  4HPA A;  4O3Z A;  3ZW1 A;  4N7D A;  4IAW A;  1KXO A;  1A57 A;  1LKE A;  2ZAG A;  2BLG A;  1ZNG A;  4NYR A;  5DG4 A;  1VWF B;  4YKO A;  1I9H A;  3NQ3 A;  2JOZ A;  2BT9 A;  4KC7 A;  4M6S A;  3IFB A;  2ZAI A;  4O3Y A;  4U9C A;  1KT6 A;  2C4I A;  5F7G A;  1SWL A;  3RKG A;  1GX3 A;  1PBO A;  4IBA A;  3Q6L A;  4JO6 A;  2RTI B;  1STP A;  5CSE A;  4YMY A;  3SLO A;  2IFB A;  1STR B;  1K24 A;  1TOU A;  2WEX A;  3FIQ A;  2ASN X;  4IMN A;  5B10 O;  4LKT A;  2ACP X;  4GNY A;  2W2B A;  4HWM A;  1BM5 A;  2R74 A;  2MJI A;  4NW4 A;  3K3L A;  4QAE A;  1E06 A;  3DSZ A;  2RN4 A;  3BSZ E;  5LJK A;  3WZP A;  1FDQ A;  2BHV A;  2HNX A;  2QM9 A;  4BOE A;  3VG4 A;  4D6A A;  4Z2V A;  1LPJ A;  2KD2 A;  3OJY C;  1VYF A;  3EYC A;  4O4X A;  5HTD A;  1QQS A;  1SA8 A;  3ELZ A;  2RTN B;  3S26 A;  4JNJ A;  1IJ8 A;  1UYO X;  1TXL A;  2BSZ A;  4ML7 B;  4O3W A;  1PTS A;  1YIV A;  1BBP A;  1IKJ A;  3APW A;  3CQN A;  4OMX A;  3T6L A;  2Q39 A;  1NDJ A;  4I6S A;  4BGF A;  3WOV A;  4B55 A;  2MWH A;  4ARH A;  1EPB A;  2C1S A;  2LKK A;  4TJZ A;  4YBP A;  4GRJ A;  1S44 A;  1EW3 A;  3DTQ A;  1ALB A;  1SWA A;  1KZX A;  1SLF B;  1VWO B;  2KTD A;  1B56 A;  2RTO B;  5D47 A;  4TNN A;  1MUP A;  1PEE A;  3RDM A;  2GTL N;  1HQP A;  4EKV A;  1YP6 A;  2KTS A;  1LUQ A;  4EFG A;  4BX6 B;  2Q9S A;  1B0O A;  2OY8 A;  1FEM A;  1HXZ A;  2RTG B;  3G7X A;  3WYQ A;  2OL6 O;  2CZU A;  2ANS A;  3CR6 A;  2Q2P A;  2AL0 X;  4YGH A;  2VFB A;  1VWA B;  4FBR A;  1X8O A;  4ZHG A;  3FA8 A;  1EI5 A;  4IAX A;  2JU3 A;  1CBS A;  1EXS A;  1GT5 A;  1SWO A;  1Y0G A;  1Y55 X;  4BX6 A;  3FLL A;  2WWP A;  3CWK A;  4ZFX A;  1GX8 A;  1JZU A;  4OEM A;  2RTF B;  2RCQ A;  4YGG A;  5L3Y A;  4CK4 A;  1UZ2 X;  3RE6 A;  3PDF A;  4Z27 A;  1U17 A;  1E5P A;  2Z4H A;  1YWA A;  3RDX A;  4ALO A;  4GJV A;  5KID A;  4LQZ A;  5EPQ A;  1KQX A;  1KQW A;  2OL7 A;  2Z4I A;  3NAD A;  3BX7 A;  4DCB A;  3TZS A;  2CBR A;  1SLG B;  4MEE A;  4NNS A;  4I9S A;  1GT4 A;  3VGW A;  4ALB A;  2VFC A;  1MK5 A;  1SWH A;  1SWQ A;  1QFT A;  1KT7 A;  2HMB A;  1SXX A;  3GAQ A;  4QZU A;  1Y9T A;  1SWK A;  3MX7 A;  5AJB A;  3RDS A;  1O8V A;  1R0U A;  3ZUO A;  5BYP A;  5HZ9 A;  3VE1 A;  3B2K A;  4ID2 A;  3HWF A;  1YP7 A;  3SLJ A;  2AKQ A;  3HOL A;  1HBP A;  4XMG A;  4A8Z A;  1OBU A;  2N93 A;  3FDC A;  2RTL A;  2GJ5 A;  4LZU A;  5EED A;  4ZHH A;  3T2X A;  1LIE A;  2G5L A;  4GZV A;  1BSQ A;  4GET A;  2G8C O;  2FR3 A;  2CAM A;  3RY1 A;  4O4S A;  3WZN A;  1SXW A;  2Y32 A;  1VWI B;  4ZGU A;  3PH6 A;  4YDB A;  1LDO A;  1DZJ A;  1GGL A;  3LTW A;  3WYP A;  3P6C A;  5AJC A;  1KL5 A;  2BC3 A;  5LKE A;  1T0V A;  2KW1 A;  3SAO A;  1E00 A;  1SWS A;  2F01 A;  2HKD A;  3B2L A;  3WZQ A;  5LJH A;  1ZNK A;  2WR6 A;  1RBP A;  2A13 A;  1URE A;  1CBI A;  2JMB A;  2RQ0 A;  3APX A;  1QY2 A;  1VYO A;  3F9D A;  1U0X A;  5B27 A;  2FS7 A;  1O1V A;  4IRW A;  3UAQ A;  4ZHC A;  2NNQ A;  1ZNE A;  5FFH A;  1GM6 A;  1KFF A;  2OVS A;  2RTH B;  3B2J A;  4CPF A;  3E3C A;  3BS2 A;  5HTE A;  2RTB B;  4CPH B;  4IMO A;  1QFV A;  2Q4N A;  5IRW A;  5AEO A;  4WHI A;  4YDA A;  3MM0 A;  3ZW2 A;  3ZQ3 A;  2X8F A;  1LIB A;  3Q34 A;  1VWB B;  3STK A;  2WEW A;  3ZWE A;  2RTM A;  5H8T A;  2AT8 X;  1Y9L A;  4CPH A;  2IZF B;  4INN A;  4L1N A;  2FKJ A;  3VPJ E;  4QGW A;  4U8U N;  1YUP A;  5B2A O;  3EBW A;  5B5G A;  4BX7 B;  2ALL X;  3P6E A;  1DV9 A;  5EDB A;  1QY1 A;  5CYB A;  4A1H A;  1MVG A;  1RAV A;  3FEN A;  3RDQ A;  1JJX A;  4GJS A;  2RCT A;  3APU A;  3FYF A;  4YCH A;  4QRL A;  4RUU A;  2RTA A;  4XMH A;  4QNI A;  3VE2 A;  4OS8 A;  3P6F A;  4BX7 A;  3PEC A;  4D6B A;  1ICN A;  4GD9 A;  1HXL A;  4OEL A;  4YFQ A;  2OY1 O;  2IZC B;  2R56 A;  1SRH A;  1EII A;  1DF8 A;  3U0D A;  2G79 A;  5FQ6 E;  4ZHF A;  3C77 X;  1UYN X;  1W5R A;  1QWD A;  2DM5 A;  3D95 A;  2WPU A;  3NR3 A;  4IB9 A;  4MVL A;  5F6Z A;  1TVQ A;  4I95 A;  1NC9 A;  2AVI A;  3KFG A;  1ML7 A;  1IFC A;  1VWC B;  1E2T A;  3ZUI A;  4YGZ A;  4BVM A;  1W6F A;  3P6G A;  2IZH B;  1RXH A;  1KGL A;  1D2U A;  2E4J A;  1W4T A;  1VWH B;  3APV A;  3VG5 A;  3FEP A;  5LJD A;  2FLJ A;  3QQ2 A;  1HBQ A;  4LZV A;  4U8U O;  3L4R A;  2A2U A;  1SLE B;  1T68 X;  5FEN A;  1KT5 A;  1SWE A;  3SZH A;  2HZQ A;  3WJD A;  1MX7 A;  2I5Z O;  2BS5 A;  5DPQ A;  3WVM A;  1EIO A;  1X8N A;  1DF3 A;  4ZHD A;  4U8U M;  1SWG A;  3HK1 A;  5K68 A;  3B2H A;  2IZB A;  2IZJ A;  5JR8 A;  4L3R A;  5EDC A;  4ZH6 A;  2XKL A;  4TKJ A;  5L8N A;  2L5P A;  2FGS A;  4AZP A;  1QY0 A;  3AUM O;  1SWR A;  3EW2 A;  4KT5 A;  2OL8 O;  3BDR A;  4R0B A;  2GH7 A;  1AEL A;  4Y5D A;  2OFA A;  4BJ8 A;  4Z6J A;  4NLI A;  1RLB E;  1QG5 A;  2NND A;  3VU1 A;  1LCV A;  1SRG A;  1I06 A;  1LEL A;  2L9C A;  2RTD B;  1EAL A;  3RE5 A;  4MVI A;  2A3F X;  2LA7 A;  4UU2 A;  1GXA A;  1T8V A;  5LJG A;  2NP1 A;  2OVA A;  1MEP A;  4Z2O A;  1FE3 A;  1AQB A;  5K67 A;  1MX8 A;  1ZND A;  4QZT A;  3N91 A;  1LNM A;  4XMD A;  4GDZ A;  3UEX A;  4IAB A;  2OVD A;  1SRE A;  1LCZ A;  3BU9 A;  4M7M A;  3FA7 A;  3H3I A;  4Y0S A;  3VG7 A;  2X46 A;  4IB8 A;  4XMF A;  4Z2P A;  1LIC A;  3LHN A;  4AZQ A;  2MF6 A;  2EU7 X;  1O1U A;  3FR2 A;  2OVE A;  2UYW A;  4AYH A;  4IB7 A;  5AQ6 A;  1KZW A;  2KT4 B;  1SY2 A;  1P6P A;  3FEL A;  1H91 A;  2CM9 A;  5EZ2 A;  3O19 A;  1BEB A;  5CHK A;  1GT1 A;  3U9P C;  4AW8 A;  4EQA C;  5L8O A;  3FR4 A;  1G5W A;  3STM X;  1SWU A;  3UEW A;  3T1D A;  4O9S A;  1GT3 A;  1JYD A;  3D4R A;  3HWG A;  4Z28 A;  5H9K A;  1PMP A;  1N9Y A;  3TF6 A;  2OF8 A;  2FHN X;  5F58 A;  1BRQ A;  1TW4 A;  4O4U A;  4O49 A;  2JU8 A;  2X8S A;  1ZNH A;  3EBK A;  1K3B A;  2GTL O;  3HTY A;  4OS0 A;  2LBV A;  3ZI8 A;  5D48 A;  3AKM A;  1JYJ A;  4I3C A;  1BRP A;  3VG3 A;  1BJ7 A;  5B3M O;  1SWJ A;  2FTB A;  2C1Q A;  2MO5 A;  3D96 A;  4YVB A;  1FJ1 E;  1STS B;  2GTL M;  4WFU A;  3JQO A;  4ES7 A;  2RTP B;  1SWF A;  2Y3F A;  3ELX A;  1N4J A;  1YWC A;  3SOT A;  3HWE A;  2F09 A;  4FBO A;  4I3B A;  4A1Y A;  3WJG A;  1DZM A;  3RDU A;  1DZP A;  3RBY A;  5CE4 A;  4HPB A;  4TLJ A;  4DQ4 A;  1DFV A;  1Y53 X;  1SWT A;  3AKN A;  3NX1 A;  4ORS A;  5IRA A;  3RWX A;  4CDE A;  5HZ6 A;  5IO7 A;  1EUO A;  1X71 A;  5F6B A;  3FEK A;  5IXG A;  4XME A;  3FW5 A;  2OY7 A;  3WBG A;  2QCB A;  2FWV A;  1JMX A;  1VWK B;  1CJ5 A;  3CQR A;  4KII A;  1JMZ A;  1ERB A;  5H9L A;  4YKM A;  1B4M A;  3P6D A;  5HZ5 A;  5B29 A;  4AZR A;  4I60 A;  4U46 A;  3VHM A;  4BBO A;  3P02 A;  5HCD C;  1NBX A;  5HZQ A;  3CBC A;  3TGB A;  1D3S A;  1EQD A;  1OPB A;  2QO4 A;  3B2I A;  3MG5 A;  4NLJ A;  4WBK A;  2X45 A;  3FA9 A;  4ZJ0 A;  2AH7 X;  1A18 A;  4GKC A;  5IO6 A;  2OF9 A;  1ZRY A;  1LID A;  3BY0 A;  4O3X B;  4QYN A;  3WJC A;  1BLR A;  1EPA A;  1A3Y A;  1ZNL A;  1SWN A;  1B8E A;  2RTQ B;  1HN2 A;  2G7B A;  2L68 A;  2W2A A;  3D97 A;  1G74 A;  4U3Q A;  1HY2 A;  5D4A A;  3S5X A;  1SWD A;  4DNE A;  4I3D A;  4TKH A;  1KT3 A;  3NX2 A;  3KFH A;  4CDF A;  2RTJ A;  4COT A;  1NQN A;  2HLV A;  3BRN A;  5KIC A;  1OEK A;  4GH7 A;  3C78 X;  1QAB E;  1SRI A;  3NQK A;  1VPR A;  4UU3 A;  1VWR B;  2IZL B;  4CDC A;  1SWB A;  2QOS C;  3KFF A;  4IB6 A;  2LB6 A;  2AT3 X;  4KCA A;  2OFB A;  3BU1 A;  2L67 A;  3WZO A;  5FQ7 E;  3PQS A;  2ZSC A;  3V8U A;  2X4M A;  5LJC A;  2F73 A;  2FKG A;  1KL3 A;  2FT9 A;  4NYQ A;  3PK2 A;  2RD7 C;  1HMR A;  3UEU A;  3CMP A;  1DC9 A;  4GGT A;  2HYS A;  5LJB A;  5JD2 A;  2QO5 A;  4HPD A;  2A5B A;  4ORW A;  5KHP A;  4YBU A;  1NQM A;  4TQ2 A;  1HQQ A;  2OZQ A;  1KL4 A;  3I17 A;  4Y59 A;  3T2W A;  4OMW A;  2AT5 X;  4NP1 A;  5EEE A;  3TGA A;  2JGS A;  2O62 A;  1CRB A;  1U18 A;  2W2F A;  2WQ9 A;  3KFI A;  5F2B A;  4ZR2 A;  5D8J A;  4XMC A;  1BWY A;  5B5F A;  1SRF A;  2IZI A;  3LV4 A;  1VWL B;  1SXU A;  1SY3 A;  4NNT A;  1FEL A;  1ADL A;  1SWC A;  1I05 A;  1HMT A;  3FID A;  1SLD B;  3OD9 A;  2JN3 A;  1RXK A;  3PQU A;  4I9R A;  4QGV A;  2FHL A;  2OYB O;  5BVS A;  4PJ2 A;  3WJE A;  5IO5 A;  1RXJ A;  2FR2 A;  1SRJ A;  4C5P A;  2YMS A;  3EMM A;  3FMZ A;  3PH5 A;  1LFO A;  1SY1 A;  3FR5 A;  4GGR A;  1IW2 A;  1L6M A;  1MDC A;  1MM9 A;  1NP4 A;  2CM4 A;  4ZCB A;  1VYG A;  3EC5 A;  2JU7 A;  3OE3 A;  2NNE A;  4MIR A;  3ZW0 B;  4GUZ A;  5HZ8 A;  1JQP A;  2QO6 A;  4KH8 A;  1GX9 A;  5D45 A;  3S60 A;  1MOY A;  2BS6 A;  4OKA A;  2X8T A;  1LF7 A;  3WJB A;  2IZE B;  2WQA E;  5F1E A;  5LKF A;  3RY2 A;  2I5V O;  4ON1 A;  1OEE A;  2X32 A;  3ZW0 A;  1VWM B;  2HZR A;  2K62 A;  3O22 A;  4YCE A;  1GKA B;  3UEV A;  4YH0 A;  3MBT A;  4MVE A;  2MM3 A;  4GE1 A;  4GDA A;  4CPE A;  1WBI A;  5BVT A;  3PED A;  1X8Q A;  4ZGF A;  1IIU A;  1AB0 A;  2RTC B;  2IZD B;  1BSY A;  2WUT A;  3KVN A;  4HFO A;  1VWN B;  1GKA A;  1JJU A;  1CBQ A;  4AZN A;  2IZK A;  1OBP A;  2AMM X;  4MVK A;  3NBX X;  4EXZ A;  5BVQ A;  1FTP A;  4K19 A;  1A2D A;  2DJF A;  4ODD A;  2AT6 X;  4CV7 A;  1OEJ A;  4AZM A;  5HCC C;  1RST B;  4A60 A;  4JHQ A;  4QYP A;  4DQ3 A;  2RTK A;  4O4O A;  1G85 A;  5H9A A;  1SMP I;  1N7Y A;  1BSO A;  1JIW I;  3CKF A;  3STN A;  4CSB A;  1N43 A;  2A2G A;  1ICM A;  3WJF A;  5B11 O;  3HOE A;  3S5V A;  3PPT A;  2FRS A;  1N0S A;  4FGI B;  4EEJ A;  4CPI A;  3HWD A;  2OFM X;  5C0N A;  2M4L A;  3BX8 A;  1JJJ A;  1LCW A;  2X34 A;  3VHI A;  1OPA A;  3JS1 A;  4Y0Q A;  5HWZ A;  2G78 A;  4NV7 A;  4BQU A;  3IA8 A;  3KQ0 A;  1JV4 A;  1WUB A;  3EW1 A;  3JSQ A;  2Y3E A;  2PI3 O;  2RTE B;  2A5C A;  1X8U A;  3VG6 A;  1VWP B;  2VDF A;  4Y0P A;  2RTR B;  1LDQ A;  1AVE A;  1OBQ A;  2CZT A;  1YWD A;  4ZH9 A;  4BX5 B;  3T6F A;  1NP1 A;  3HPE A;  5HA0 A;  1PBY A;  2A0A A;  3FW4 A;  4JGL A;  1IFB A;  3TGC A;  3GE2 A;  2CBS A;  1JBH A;  1VWD B;  5L8I A;  3AEH A;  3KZA A;  1DZK A;  1CBR A;  3BLG A;  4QQ1 A;  3SLT A;  1S7D A;  4GNW A;  4OS3 A;  3F6Z B;  4BX5 A;  3FA6 A;  3NPO A;  3NQ9 A;  5HCE C;  5FAZ A;  4KC8 A;  2OY5 O;  4GGZ A;  4BCS A;  3QKG A;  4EDE A;  2P8G A;  1SY0 A;  3ZZV A;  3VHH A;  1E02 A;  1PM1 X;  2JW1 A;  2A8G A;  2GC9 A;  1X89 A;  4N7C A;  1X8P A;  1TOW A;  2LFO A;  1VWG B;  5HBS A;  1ERX A;  3D9W A;  4RUN A;  1LIF A;  4MIS A;  2Q2M A;  1N9M A;  2QOM A;  4QGX A;  2ACO A;  2UZ2 A;  3CKG A;  5FQ8 E;  4GU8 A;  2POA A;  3C76 X;  2GTF X;  3SZI A;  2OFR X;  5H9N A;  2MHD A;  3NP1 A;  4ORR A;  2RA6 A;  2X55 A;  3EM0 A;  4HPC A;  4NV8 A;  1AVD A;  3I0A A;  4FBV A;  1HMS A;  3VG2 A;  1ACD A; 
#chains in the Genus database with same CATH homology
 1KOI A;  1G7N A;  2YG2 A;  3O2Y A;  3P6H A;  3RSW A;  4ORX A;  1FEN A;  1S2P A;  1NGL A;  4ORU A;  1YWB A;  3OBL A;  3U03 A;  3CBS A;  1I4U A;  4WFV A;  4AZO A;  3WXQ A;  2WSJ A;  5K06 A;  4LKP A;  2R73 A;  1KT4 A;  4YFR A;  1XCA A;  4GK9 A;  1XKI A;  1SXY A;  2QMI A;  1AVG I;  3ZW1 B;  4ORY A;  1Z24 A;  2LBA A;  4Y0R A;  4YFP A;  5LJE A;  4TKB A;  5HAE A;  1IKE A;  3P24 A;  4FQB B;  2K23 A;  2PY1 A;  2AT0 X;  3PP6 A;  4PSQ A;  3RZY A;  2XST A;  2FS6 A;  3MVF A;  1I04 A;  3F8A A;  4HPA A;  4O3Z A;  3ZW1 A;  4N7D A;  4IAW A;  1KXO A;  1A57 A;  1LKE A;  2ZAG A;  2BLG A;  1ZNG A;  4NYR A;  5DG4 A;  4YKO A;  3NQ3 A;  2JOZ A;  2BT9 A;  4KC7 A;  4M6S A;  3IFB A;  2ZAI A;  4O3Y A;  4U9C A;  1KT6 A;  5F7G A;  3RKG A;  1PBO A;  4IBA A;  3Q6L A;  4YMY A;  2IFB A;  1TOU A;  2WEX A;  3FIQ A;  2ASN X;  4IMN A;  4LKT A;  2ACP X;  4GNY A;  2W2B A;  4HWM A;  1BM5 A;  2R74 A;  2MJI A;  4NW4 A;  3K3L A;  4QAE A;  1E06 A;  3DSZ A;  2RN4 A;  3BSZ E;  5LJK A;  1FDQ A;  2BHV A;  2HNX A;  2QM9 A;  4BOE A;  3VG4 A;  4D6A A;  1LPJ A;  2KD2 A;  3OJY C;  1VYF A;  3EYC A;  4O4X A;  5HTD A;  1QQS A;  1SA8 A;  3ELZ A;  3S26 A;  1TXL A;  4ML7 B;  4O3W A;  1YIV A;  1BBP A;  1IKJ A;  3APW A;  3CQN A;  4OMX A;  2Q39 A;  4I6S A;  3WOV A;  2MWH A;  4ARH A;  1EPB A;  2LKK A;  4YBP A;  4TJZ A;  4GRJ A;  1S44 A;  1EW3 A;  3DTQ A;  1ALB A;  1KZX A;  1PEE A;  2KTD A;  5D47 A;  1B56 A;  4TNN A;  1MUP A;  2GTL N;  1HQP A;  1YP6 A;  2KTS A;  4EFG A;  2Q9S A;  1B0O A;  3G7X A;  1FEM A;  2CZU A;  2ANS A;  3CR6 A;  2Q2P A;  2AL0 X;  4YGH A;  4FBR A;  1X8O A;  4ZHG A;  3FA8 A;  1EI5 A;  4IAX A;  2JU3 A;  1CBS A;  1EXS A;  1GT5 A;  3FLL A;  2WWP A;  3CWK A;  4ZFX A;  1GX8 A;  1JZU A;  2RCQ A;  4YGG A;  4CK4 A;  1UZ2 X;  1U17 A;  1E5P A;  2Z4H A;  1YWA A;  4ALO A;  5KID A;  4LQZ A;  5EPQ A;  1KQX A;  1KQW A;  2Z4I A;  3NAD A;  3BX7 A;  3TZS A;  2CBR A;  4NNS A;  4I9S A;  1GT4 A;  4ALB A;  4QZU A;  2HMB A;  1QFT A;  1KT7 A;  5AJB A;  1SXX A;  3GAQ A;  1Y9T A;  3MX7 A;  1O8V A;  1R0U A;  3ZUO A;  5BYP A;  5HZ9 A;  3B2K A;  4ID2 A;  3HWF A;  1YP7 A;  4A8Z A;  2AKQ A;  3HOL A;  1HBP A;  4XMG A;  1OBU A;  2N93 A;  4LZU A;  2GJ5 A;  4ZHH A;  5EED A;  1LIE A;  4GZV A;  1BSQ A;  4GET A;  2FR3 A;  4O4S A;  1SXW A;  4ZGU A;  3PH6 A;  4YDB A;  1GGL A;  1DZJ A;  3P6C A;  5AJC A;  5LKE A;  1T0V A;  2KW1 A;  3SAO A;  1E00 A;  3B2L A;  5LJH A;  1ZNK A;  2WR6 A;  1RBP A;  2A13 A;  1URE A;  1CBI A;  2JMB A;  2RQ0 A;  3APX A;  1QY2 A;  3F9D A;  5B27 A;  1U0X A;  3RBY A;  2FS7 A;  1O1V A;  3UAQ A;  4ZHC A;  2NNQ A;  1ZNE A;  5FFH A;  1GM6 A;  2OVS A;  3B2J A;  3E3C A;  3BS2 A;  5HTE A;  4IMO A;  1QFV A;  2Q4N A;  5AEO A;  4WHI A;  4YDA A;  3ZW2 A;  3ZQ3 A;  2X8F A;  1LIB A;  3STK A;  2WEW A;  3ZWE A;  5H8T A;  2AT8 X;  1Y9L A;  4INN A;  4L1N A;  3VPJ E;  4QGW A;  4U8U N;  1YUP A;  1DV9 A;  3EBW A;  2ALL X;  3P6E A;  5EDB A;  1QY1 A;  5CYB A;  4A1H A;  1MVG A;  3FEN A;  1JJX A;  2RCT A;  3APU A;  3FYF A;  4YCH A;  4QRL A;  4RUU A;  4XMH A;  3VE2 A;  4QNI A;  4OS8 A;  3P6F A;  3PEC A;  4D6B A;  1ICN A;  4YFQ A;  2R56 A;  1EII A;  3U0D A;  2G79 A;  5FQ6 E;  4ZHF A;  3C77 X;  3NR3 A;  2DM5 A;  1QWD A;  4IB9 A;  3D95 A;  4MVL A;  5F6Z A;  1TVQ A;  4I95 A;  3KFG A;  1ML7 A;  1IFC A;  3ZUI A;  4YGZ A;  4BVM A;  3P6G A;  1KGL A;  1D2U A;  2E4J A;  3APV A;  3VG5 A;  3FEP A;  5LJD A;  2FLJ A;  1HBQ A;  4LZV A;  4U8U O;  3L4R A;  2A2U A;  1T68 X;  5FEN A;  1KT5 A;  3WJD A;  2HZQ A;  1MX7 A;  2BS5 A;  5DPQ A;  3WVM A;  1EIO A;  1X8N A;  1DF3 A;  4ZHD A;  4U8U M;  3HK1 A;  5JR8 A;  3B2H A;  4L3R A;  5EDC A;  4ZH6 A;  2XKL A;  4TKJ A;  5L8N A;  2L5P A;  4AZP A;  1QY0 A;  4KT5 A;  3BDR A;  4R0B A;  1AEL A;  4NLI A;  1RLB E;  1QG5 A;  2NND A;  3VU1 A;  1EAL A;  2L9C A;  1I06 A;  4MVI A;  2A3F X;  2LA7 A;  4UU2 A;  1GXA A;  1T8V A;  5LJG A;  2NP1 A;  2OVA A;  1FE3 A;  1AQB A;  1MX8 A;  1ZND A;  4QZT A;  3N91 A;  1LNM A;  4XMD A;  4GDZ A;  3UEX A;  4IAB A;  2OVD A;  3BU9 A;  4M7M A;  3FA7 A;  3H3I A;  4Y0S A;  3VG7 A;  2X46 A;  4IB8 A;  4XMF A;  1LIC A;  3LHN A;  4AZQ A;  2EU7 X;  1O1U A;  3FR2 A;  2OVE A;  1KZW A;  4AYH A;  4IB7 A;  5AQ6 A;  2KT4 B;  1SY2 A;  1P6P A;  3FEL A;  1H91 A;  2CM9 A;  5EZ2 A;  3O19 A;  1BEB A;  1GT1 A;  3U9P C;  4AW8 A;  4EQA C;  5L8O A;  3FR4 A;  1G5W A;  3STM X;  3UEW A;  3T1D A;  4O9S A;  1GT3 A;  1JYD A;  3D4R A;  3HWG A;  5H9K A;  1PMP A;  3TF6 A;  5F58 A;  1BRQ A;  1TW4 A;  4O4U A;  4O49 A;  2JU8 A;  2X8S A;  1ZNH A;  3EBK A;  2GTL O;  3HTY A;  4OS0 A;  2LBV A;  3ZI8 A;  5D48 A;  3AKM A;  1JYJ A;  4I3C A;  1BRP A;  3VG3 A;  1BJ7 A;  2FTB A;  2MO5 A;  3D96 A;  2GTL M;  4WFU A;  3JQO A;  4ES7 A;  3SOT A;  3ELX A;  1YWC A;  3HWE A;  2F09 A;  4FBO A;  4I3B A;  4A1Y A;  3WJG A;  1DZM A;  1DZP A;  5CE4 A;  4HPB A;  4TLJ A;  4DQ4 A;  1DFV A;  3AKN A;  3NX1 A;  4ORS A;  5IO7 A;  3RWX A;  5HZ6 A;  1EUO A;  1X71 A;  5F6B A;  3FEK A;  4XME A;  3FW5 A;  3WBG A;  2FWV A;  1CJ5 A;  3CQR A;  4KII A;  1ERB A;  5H9L A;  4YKM A;  1B4M A;  3P6D A;  5HZ5 A;  5B29 A;  4AZR A;  3P02 A;  5HCD C;  5HZQ A;  3CBC A;  3TGB A;  1D3S A;  1EQD A;  1OPB A;  2QO4 A;  3B2I A;  4NLJ A;  4WBK A;  4ZJ0 A;  2X45 A;  3FA9 A;  2AH7 X;  1A18 A;  4GKC A;  5IO6 A;  1ZRY A;  1LID A;  3BY0 A;  4O3X B;  4QYN A;  3WJC A;  1BLR A;  1EPA A;  1A3Y A;  1ZNL A;  1B8E A;  1HN2 A;  2G7B A;  2L68 A;  2W2A A;  3D97 A;  1G74 A;  4U3Q A;  3S5X A;  5D4A A;  4I3D A;  4TKH A;  1KT3 A;  3NX2 A;  3KFH A;  4COT A;  2HLV A;  3BRN A;  5KIC A;  1OEK A;  4GH7 A;  3C78 X;  1QAB E;  3NQK A;  1VPR A;  4UU3 A;  3KFF A;  2QOS C;  4IB6 A;  2LB6 A;  2AT3 X;  4KCA A;  3BU1 A;  2L67 A;  5FQ7 E;  3PQS A;  3V8U A;  5LJC A;  2F73 A;  2FT9 A;  4NYQ A;  2RD7 C;  1HMR A;  3UEU A;  3CMP A;  1DC9 A;  2HYS A;  5LJB A;  2QO5 A;  4HPD A;  4ORW A;  5KHP A;  4YBU A;  4TQ2 A;  2OZQ A;  3I17 A;  4OMW A;  2AT5 X;  4NP1 A;  5EEE A;  3TGA A;  2O62 A;  1CRB A;  1U18 A;  2W2F A;  2WQ9 A;  3KFI A;  4ZR2 A;  5D8J A;  4XMC A;  1BWY A;  3LV4 A;  1SXU A;  1SY3 A;  4NNT A;  1FEL A;  1ADL A;  1I05 A;  1HMT A;  3OD9 A;  2JN3 A;  3PQU A;  4QGV A;  4I9R A;  5BVS A;  4PJ2 A;  3WJE A;  5IO5 A;  2FR2 A;  2YMS A;  3EMM A;  3FMZ A;  3PH5 A;  1LFO A;  1SY1 A;  3FR5 A;  5HA1 A;  1IW2 A;  1L6M A;  1MDC A;  1NP4 A;  4ZCB A;  2CM4 A;  3VE1 A;  1VYG A;  5HZ8 A;  2JU7 A;  3OE3 A;  2NNE A;  4MIR A;  3ZW0 B;  2QO6 A;  4KH8 A;  1GX9 A;  5D45 A;  3S60 A;  2BS6 A;  2X8T A;  1LF7 A;  3WJB A;  2WQA E;  5F1E A;  5LKF A;  4ON1 A;  1OEE A;  3ZW0 A;  2K62 A;  2HZR A;  3O22 A;  4YCE A;  1GKA B;  3UEV A;  4YH0 A;  3MBT A;  4MVE A;  2MM3 A;  4GE1 A;  5BVT A;  3PED A;  1X8Q A;  4ZGF A;  1IIU A;  1AB0 A;  1BSY A;  2WUT A;  4HFO A;  1GKA A;  1CBQ A;  4AZN A;  1OBP A;  2AMM X;  4MVK A;  3NBX X;  4EXZ A;  5BVQ A;  1FTP A;  4K19 A;  1A2D A;  4ODD A;  2AT6 X;  4CV7 A;  1OEJ A;  4AZM A;  5HCC C;  4A60 A;  4QYP A;  4DQ3 A;  4O4O A;  1G85 A;  5H9A A;  1SMP I;  1BSO A;  1JIW I;  4CSB A;  3STN A;  2A2G A;  1ICM A;  3WJF A;  3HOE A;  3S5V A;  3PPT A;  2FRS A;  1N0S A;  4FGI B;  4EEJ A;  5C0N A;  3HWD A;  2OFM X;  2M4L A;  3BX8 A;  1JJJ A;  1OPA A;  3JS1 A;  4Y0Q A;  5HWZ A;  2G78 A;  4BQU A;  3IA8 A;  3KQ0 A;  1JV4 A;  3JSQ A;  1X8U A;  3VG6 A;  4Y0P A;  2CZT A;  1OBQ A;  1YWD A;  4ZH9 A;  1NP1 A;  5HA0 A;  3FW4 A;  2A0A A;  4JGL A;  1IFB A;  3TGC A;  3GE2 A;  2CBS A;  1JBH A;  5L8I A;  3KZA A;  1DZK A;  1CBR A;  3BLG A;  4QQ1 A;  1S7D A;  4GNW A;  4OS3 A;  3F6Z B;  3FA6 A;  3NPO A;  3NQ9 A;  5HCE C;  5FAZ A;  4KC8 A;  3QKG A;  4EDE A;  2P8G A;  1SY0 A;  3ZZV A;  1E02 A;  1PM1 X;  2JW1 A;  2GC9 A;  1X89 A;  4N7C A;  1X8P A;  1TOW A;  2LFO A;  5HBS A;  1ERX A;  4RUN A;  1LIF A;  4MIS A;  2Q2M A;  4QGX A;  2ACO A;  5FQ8 E;  4GU8 A;  2POA A;  3C76 X;  2GTF X;  2OFR X;  5H9N A;  2MHD A;  3NP1 A;  4ORR A;  2RA6 A;  4HPC A;  3EM0 A;  3I0A A;  4FBV A;  1HMS A;  3VG2 A;  1ACD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...