2WQNA

Structure of adp-bound human nek7
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
280
structure length
259
Chain Sequence
ALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK7
publication title An Autoinhibitory Tyrosine Motif in the Cell-Cycle- Regulated Nek7 Kinase is Released Through Binding of Nek9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 259
sequence length 280
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wqnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wqnA01
3QQJA 3E7VA 4BCHA 2ZAZA 3FZ1A 3C4WA 4RWIA 5CI6A 3AG9A 4JI9A 4M66A 1Y57A 4FT7A 4RIXB 4FTLA 2W0JA 5AR7A 3EOCA 4S34A 3DBDA 3PE2A 1WBVA 3P1AA 3DLZA 4PV0A 3ORMA 3CGFA 3PE1A 4O0TA 1GNGA 3R02A 4FK6A 4R5YA 4BL1A 3NPCA 5ETIA 3MA6A 2W1ZA 4BTFA 2I6LA 2YCSA 3DZQA 4JQ7A 4C02A 4C4HA 4WA9A 1O9UA 4G6NA 2RG6A 3LFBA 3PJ2A 4P4CA 3QL8A 4IX5A 1GZ8A 3O8UA 3HDMA 5LJJA 3DDPA 3BHTA 2PMOX 3JY9A 2VTQA 4OLIA 4AT4A 4BDJA 2E2BA 5HU3A 1Q3WA 4BYIA 4XP2A 3HLLA 1SVEA 2Y0AA 3A2CA 3FKLA 4FV0A 3Q9ZA 4IHPA 1XJDA 2XNEA 3U4WA 4EQUA 4GK4A 4FYNA 2XP2A 2GU8A 3D7ZA 5CF5A 3SVVA 1ZYSA 5A4TA 1NXKA 4XV3A 5I9ZA 4RG0A 4WG3A 2BKKA 2WMWA 3MPTA 2BHHA 4U9AA 4FSZA 4H3QA 5IQDA 5CLPA 3WIKA 3D2KA 4W4WA 1UU8A 3DK3A 2GNIA 3QQFA 3N9XA 4PTCA 4YUQA 3KULB 3HA8A 4D1XA 5BVEA 3TM0A 3TV7A 1OL1A 2QKWB 3DCVA 1PKDA 2WQBA 3MA3A 2YM7A 4HYUA 3EFKA 2PWLA 2JD5A 4YPDA 2UZDA 4YO4A 5DOSA 3MVHA 4IX4A 1SNUA 1CSNA 1OBGA 3DAJA 5HLNA 3G6GA 3MFRA 4Y72A 4F9CA 3QWJA 4C61A 5EQPA 1PXKA 3S95A 3SD0A 4YU2A 3QF9A 5IUIA 2W1FA 3O96A 1H1QA 3KXGA 4JX3A 3BHYA 4I94A 4YLLA 4BKZA 1XH5A 4BWXA 3F2RA 5AP6A 5AUWA 3TN8A 5TO8A 5AP3A 2JLDA 4GSBA 4YBJA 5DT0A 5L6PA 3RPSA 3TACA 1FVTA 2VWUA 3QXOA 3NUXA 4ZS0A 2IW9A 4YLJA 3C1XA 1FPUA 5FLFA 4G5PA 1OL2A 5C26A 5IZFA 1YHSA 1KE7A 2F57A 2X2KA 4DT8A 2A1AB 4FEXA 1PYXA 3CTHA 4IAAA 5LMKC 4S2ZA 5LMBA 3THBA 4AZSA 4CZUA 4DYMA 2VWZA 1DAWA 2ZB1A 4FR4A 3KF7A 4FZFB 2X9FA 4FL3A 3ACKA 1H1PA 2OU7A 2GCDA 2B54A 3RK9A 5CEOA 2PZRA 5L8JA 4GUEA 3KMMA 4MD8E 4U6RA 5M4CA 3N4TA 2X7OA 3BU6A 4W8EA 4YZDA 5FP5A 4BDIA 4XG7A 4OBQA 3VAPA 4DGGA 4ZY4A 1JSVA 4G3FA 3FSKA 2Q0BA 4BZNA 2O2UA 2OFUA 3IW5A 5HO7A 1BI7A 1NVQA 3IDBA 4ZEGA 3GC9A 5AIRA 2BTSA 1UKIA 4DEHA 2OF2A 4PMPA 2WQMA 4E4MA 1UU3A 4FL1A 4UZDA 5HE1A 2VZ6A 1XQZA 5IUHA 4GUBA 5EOBA 2VTAA 1H25A 5EI6A 3H4JA 3S2PA 2P33A 3BIZA 3NNWA 4J7BA 4XH6A 2ETKA 4EHGA 1IA9A 4L42A 4ANOA 4HPUE 5LARA 3C9WA 3FZOA 4LOOA 4NCTC 1SYKA 4PY1A 4MF0A 4QYGA 4RA4A 4QMQA 5BVNA 1YXVA 3PXRA 2GHMA 3DK6A 3U8WA 3FDNA 4FTUA 3ZEPA 4MVFA 4JT3A 5J79A 1AGWA 1PYEA 4FKOA 4OTWA 4F6SA 2NO3A 4RC2A 5DPVA 3C0GA 5D11A 3R8LA 1KUTA 1PXMA 2CCIA 4PPAA 2GNLA 3NAYA 2VX3A 3RMFA 3R2BA 3A62A 3ZC6A 1M2PA 3AD6A 4CSVA 1JQHA 2YLEA 4GIHA 2VTOA 3L1SA 2YIWA 1Y6AA 4BHZA 5IISA 3RINA 3CD8A 4L44A 3SG8A 4EOOA 4PMTA 4EKLA 3NNUA 4X7QA 2RFSA 3R9DA 2UUEA 1FVVA 2VTPA 3D0EA 4MTAA 4N6ZA 3WBLA 4Z9LA 2XNOA 4LOQA 3ID6C 3FMMA 4RGJA 4D0WA 1UNGA 3DQXA 2FSMX 3NUYA 2GNHA 3UMXA 3E62A 2B1PA 3DXNA 5IQAA 2OSCA 3QD3A 4I6BA 4FT5A 2UVYA 2A27A 3SXSA 4IVDA 5EHLA 4ANNA 5J1VA 4XG8A 3QUDA 4H3PA 4F7LA 4BY9E 1Q3DA 3GXLA 1VJYA 3VS7A 1LP4A 4MNFA 5AA8A 3MW1A 4MNEA 1ZWSA 4O0YA 4UALA 1Q8UA 3CPBA 4CRSA 3A99A 5L3AA 4CT2A 2QVSE 1Z5MA 2ZV2A 3FSFA 4F4PA 5IA4A 2DYLA 4FKRA 4ALUA 4QP9A 1XH4A 4R77A 5BVOA 3V6SA 2JKMA 4FK3A 3UQGA 1UWHA 2FSLX 3UO6A 1Q24A 3MI9A 2W99B 4F65A 4FSUA 4ACGA 4F9WA 2VWXA 2CKQA 4KABA 5I3OA 2GHGA 3CE3A 2C6KA 3LFSA 2OH0E 4RSSA 4D55A 2OK1A 3VF8A 3MBLA 1OITA 5IPJA 3QKKA 4FKGA 1I44A 4X3FC 4P5QA 1TQPA 4C36A 5AJQA 4YJVA 3FMEA 2X4ZA 3RPVA 2PPQA 4TWPA 2HK5A 5HBEA 1JBPE 2GNGA 1JAMA 3VBWA 1QPEA 4M0YA 2ITPA 4FOCA 3R2YA 1FGKA 3LVPA 5HIDA 3N4VA 3ZS5A 4ANSA 2ITNA 4AG8A 5F95A 4TYHA 2ZV7A 3QCQA 3T8OA 3VBTA 3FLQA 5KKRC 3BEGA 4FGBA 5CEIA 1H26A 2B52A 4CG8A 1KWPA 5DFPA 3OBJA 4TYIA 5KBQA 2BALA 4IC7A 5KMMA 5TKDA 2J0IA 3ACJA 3K54A 2UZTA 4EHVA 2QI8A 3ORKA 2WXVA 5DG5A 2C6EA 4FKUA 3FUPA 4FEQA 5AM7A 4R8QA 4U0IA 4DGLC 3GCVA 4NM0A 5CSPA 2NNWB 4L7SA 3ZBXA 1OL6A 2R3MA 1ZMVA 2LAVA 2WU7A 4K77A 3DA6A 3OUKA 4DBXA 4FEVA 4AZEA 4HVIA 2G9XA 2YM4A 2ZMCA 4NUSA 5CU4A 2XK6A 3IW8A 3HZTA 2IO6A 3UQCA 5AR8A 3HV3A 1RDQE 4XBRA 4YZBA 3Q4TA 5M57A 4DTKA 4CCUA 4ZTSA 4X2JA 4A4LA 1Q99A 4LOPA 3HKOA 3ZM9A 4X2NA 4CLJA 4XCUA 5I3RA 3DT1A 5J1WA 4TZRA 2Q83A 5CY3A 1DI8A 2WMQA 2GNJA 3E3BX 2DUVA 3MH2A 3R6XA 4AGWA 2VRXA 4PF4A 3ZFMA 4KS8A 4OW8A 5DMZA 4G34A 4GJ3A 4J8MA 4RZVA 3R7EA 3FI3A 4ZK5A 2WTVA 3GOKA 1Y8GA 4FBXA 2RFDA 3LW0A 3U4UA 1ZZLA 4PDYA 3PIXA 1KOAA 5DE2A 3TNPC 4UYNA 3ZLSA 2WQNA 2JEDA 4RWLA 2BZHB 4M14A 4QP4A 2VWWA 4OT6A 4U42A 3A60A 3VIDA 5CASA 2RF9A 1WBOA 3OP5A 4C2VA 4DGMA 1K3AA 4AA4A 2UZUE 4KKEA 3T3VA 1M14A 2XCHA 3OY3A 2UW7A 3TNHA 3VS0A 5HX8A 2HCKA 5EW3A 4E6DA 1JOWB 3PY0A 4I24A 4PP7A 2OZAB 3UJGA 2Y6MA 4PRJA 5C8NA 3CKXA 3R8MA 3E63A 1QCFA 5HTBA 4UWBA 4EL9A 5M4FA 4JL9A 3VW8A 4DITA 2QC6A 4YR8A 3FMLA 4MD9E 4YTHA 3UG1A 1OM1A 3ZUVA 3R01A 4DFUA 5IH4A 1GAGA 5HTCA 3PSBA 4I4EA 3QALE 3O8PA 4DEGA 3FL5A 3MH0A 4GFMA 2BDFA 4HVHA 4Y95A 2VWYA 4EOKA 2VTLA 4V0GA 3NEWA 3ZOSA 4LG4A 4NTSA 2W1IA 4BTMA 4G31A 4UEUA 3T9TA 1J91A 4J99A 4DLIA 3FKOA 2R3JA 3U54A 4ONAA 4R3RA 1SVHA 2XH5A 4GT3A 2YWVA 3LLAA 2VGPA 3TTJA 5IU2A 5HE3A 1IRKA 1ZRZA 1GIIA 4L01A 3ATSA 4X2KA 3CBLA 1YDRE 1STCE 3D2IA 3OG7A 4I23A 5DR6A 3ZO4A 1A06A 4C62A 4FSQA 3AC8A 2QOLA 2QQ7A 4QQCA 3II5A 3SC1A 3BRBA 4IMYA 3V3VA 4AOIA 4LGGA 3KCFA 4KWPA 4Y8DA 4AE9A 5DI1A 4XS2A 3I5ZA 4FTIA 1YDSE 4RLLA 4BIBA 4ASDA 5AAGA 4XOZA 5FDPA 3MGYA 4DH8A 2HW7A 3SV0A 4O7VA 4BB4A 4F09A 4G9RA 3D94A 2GTMA 4FSNA 3W2PA 1O6LA 3LJ2A 3NMUF 4F0GA 5IDPA 5AUUA 4E6QA 2C69A 4MK0A 2A4LA 3QTRA 1XWSA 4R1YA 4QMXA 4BBFA 3BYMA 5JFWA 5E1EA 5GZ8A 5L2WA 3P9JA 3QA0A 3TIZA 2XNNA 3HMOA 2A2AA 4FV6A 5CT7A 3W1FA 5CSXA 4CG9A 3LKMA 4PPCA 4DE4A 2WELA 3GP0A 4EH3A 2QO2A 1G8AA 3ORPA 5K4IA 4BN1A 2YIQA 3C0HA 2IPXA 3KK9A 5EYDA 1PXJA 2VN9A 3BX5A 2O8YA 2J7TA 2R3IA 4YP8A 3EQIA 3F7WA 2O3PA 2YDJA 3OBGA 5H3QA 3OEZA 4ASXA 4WSQA 4AQCA 3BWJA 4FTAA 1QPJA 2CHLA 5IQCA 2ESMA 2R3KA 5CU2A 2AC5A 3LCSA 4O81A 3IK3A 4XHKB 4FSRA 4U8ZA 2W5BA 2WTJA 5CU0A 3ZONA 4V05A 5E8VA 4L8MA 5HGIA 4ALWA 5CTPA 2X2MA 2DQ7X 4BDGA 4L67A 4DG0E 2AC3A 3UDBA 2VNYA 2J50A 3W33A 3FQHA 3WI6A 4EH9A 4I41A 1R78A 4GCJA 4TYGA 2ACXA 4X0MA 3MDYA 4D9TA 3V8SA 3KREA 2WU6A 3FL4A 5LWMA 5K9IA 2BIYA 2Y7JA 4OAVB 2IVVA 4O0WA 3KC3A 4ZZOA 3AC4A 4QMLA 2RIOA 1RQQA 4FNZA 4IM0A 4KA3A 4M84A 3DJ6A 4IZYA 4MQ2A 2XB7A 1URCA 5DBXA 3SXRA 3SOAA 2BFXA 4TWNA 2PE1A 4FZ6A 4PDPA 5J95A 4QRCA 4TYEA 4U40A 4BR3A 1RJBA 2ONLA 1XBBA 3U6IA 5HI2A 3VRYA 4CFUA 3VJOA 1V0BA 2CGVA 3D7TA 1HCKA 4QPAA 3A4PA 3LXPA 3FC1X 4PQNA 3UZTA 3QTSA 5HORA 4NFNA 4IQ6A 4OR5A 3Q4UA 4RJ5A 1ZOHA 3MH1A 2C3JA 5A3XA 3NYOA 3Q4ZA 3WZJA 4F0IA 3LMHA 3ENHA 3ORXA 2YAAA 2IJMA 1U54A 1H00A 5BQ0A 3NCZA 4J95A 5A9UA 4F9AA 1OIYA 5A6NA 2YABA 4MQ1A 2Z8CA 4BFMA 3P79A 2VTHA 1I09A 3H9FA 2PVRA 3FLYA 3C0IA 4FT0A 3WE8A 3UOLA 4D4SA 4QD6A 4Z16A 4NKSA 3KXZA 3MTLA 5I9UA 4EOJA 4QTAA 5AP7A 5CEMA 3KRWA 5JZJA 3ORZA 5EI2A 4YNEA 4YHFA 3NUAA 3FLSA 2P2IA 3F5PA 2JKKA 1CMKE 3FV8A 4O7ZA 3I81A 2BZKB 2FVDA 3LHJA 4O0SA 4TY1A 3MTFA 4WT6A 2H8HA 1R0EA 3LM0A 3EQPA 1XKKA 3CJGA 5A4CA 4P90A 3NVMB 3UIBA 4C58A 4YZCA 5JN2A 4LGHA 5HLPA 3HNGA 3O7LD 3PVWA 1BMKA 1PMEA 3WF6A 1M17A 4R1VA 2WOUA 3TUBA 3A61A 2IW6A 1J1BA 4HCTA 4F1TA 4YJRA 5CVFA 2QLQA 5JK3A 5DR2A 3UTOA 5M4IA 4KS7A 4EH7A 3Q96A 2P2HA 5AX3A 1GOLA 3G9LX 3H3CA 3LMIA 5CSVA 5L8KA 2VO7A 3B2TA 4XG9A 4WIHA 5AMNA 4EJNA 4BIEA 4A06A 4G2FA 5LQFA 1NY3A 2J0JA 3LCTA 4QMWA 4W8DA 3R9NA 3TZMA 4BCFA 2BZJA 3LFQA 1VZOA 3QX2A 5K0KA 2AYPA 4CQGA 4DEAA 4O7LA 1F5QA 4USEA 5BPYA 5KMKA 2OGVA 4CFNA 4C2WA 3PSCA 3PSDA 4Y85A 4ACCA 3E8NA 2CKEA 4KRCA 3KXXA 5J5SA 3GU8A 5D41A 2C5OA 3E8DA 3TI1A 3TZ8A 1H8FA 3HAMA 3HP5A 4CYIA 4KIOA 1XH8A 4O0XA 4FL2A 4YC6A 3R8VA 2ZMDA 1YXXA 3WOWA 4NIFA 3NUUA 5EM5A 3LFAA 3E93A 3MN3A 4PTEA 5JSMA 3TUDA 3EHAA 4I5HA 4NU1A 4NZWB 3VUDA 1BL6A 1FMKA 1UA2A 4IDTA 1V1KA 5LWNA 4IC8A 3TDVA 1H1SA 3E8CA 2R3FA 2OJGA 5C01A 3OTUA 2JDSA 3TV6A 3BE2A 4UBAA 5IMEA 1QPDA 1T46A 2EB2A 3DPKA 4FC0A 2XCKA 4RJ3A 3WF8A 4M3QA 2WZJA 4DEIA 5HIEA 5KNJA 2H9VA 1OL7A 3ULZA 3PUPA 2OJ9A 2EU9A 5AAFA 1PXLA 2VNWA 3CTJA 2YACA 3N51A 3Q6UA 3ELJA 3G33A 3OOGA 5KMJA 1REJA 1CKJA 1WVWA 3R7YA 3V5JA 2VAGA 4F6WA 4ZMFA 1E9HA 4BCNA 5CF6A 3AT3A 3EL7A 3VO3A 4D0XA 1A9UA 4Q5HA 4EK3A 4HNFA 2J9MA 4MEDA 4XG3A 4EH6A 4BDFA 5IQFA 3DV3A 5HCZA 4RJ7A 5TOZA 4C0TA 4LV5A 5E4HA 4BZOA 2CDZA 3H0ZA 5EDRA 4JG6A 3ZZWA 4QTCA 4C4GA 4CTBA 1BUHA 3CQWA 4D58A 4TPTA 5CVGA 3R1YA 2WTIA 4XOYA 4G6OA 4U45A 3QC4A 5CS6A 4N6YA 4D28A 5KHWA 3P7BA 3WYXA 1UNHA 2JIVA 4LRMA 4A4XA 3FXWA 1Q41A 5HD4A 2XEZA 2Y4PA 4FG7A 3ATTA 3FI4A 3BYVA 1LR4A 2BTRA 4NEUA 4O1PA 4ANBA 5I9YA 4JOAA 3VULA 1ZMWA 3LXLA 2J6MA 2WMUA 4PL4A 4IWQA 3EFJA 1P4OA 1OPJA 4FVQA 3CC6A 3DGKA 5HG5A 3A8XA 2WTWA 4UV0A 3B2WA 3F66A 3F61A 3FXXA 1JSUA 4UXLA 2DWBA 2P0CA 1H27A 1XBAA 3EL8A 4QMPA 1NT2A 4FTMA 1S9IA 2E9UA 2IVUA 4LV8A 1YXTA 1ZYDA 4BI2A 3EFLA 3AC5A 4ALVA 4PTGA 3O51A 2SRCA 3QRKA 1VYWA 4A9TA 2R5TA 3ANRA 3E8EA 4TWCA 3UNKA 1QPCA 3MPMA 4EK5A 4X6QC 2I0VA 5FWKK 3R30A 3Q9WA 1OUKA 3O0GA 4AS0A 4RZWA 5T3QA 2WNTA 4G3CA 3U87A 3JVSA 5JH6A 4E4XA 2XNGA 5LMKA 4RVKA 5AWMA 4JG7A 2GFSA 2YFXA 2RFNA 5CYIA 4RMZA 5M56A 1FMOE 1LEZA 4F7SA 4JRVA 3Q9XA 4FICA 3HUCA 5A4EA 2X6EA 5LCJA 4CFVA 4Z7HA 4OBOA 3WZUA 4L3JA 4F08A 4GYIA 2HWOA 3LMGA 3TG1A 3QYZA 3ZM4A 3DU8A 3I1AA 4B4LA 4C34A 2QOCA 4FSYA 3R73A 2FA2A 5L6WL 4CKJA 3F3VA 4RLKA 4D1SA 3LM5A 4Q9ZA 1DS5A 5K3YA 3DQWA 4ZTQA 2BCJA 4FKPA 4MBJA 2XM8A 4TNDA 5GZ9A 4IWPA 4K6ZA 3RZBA 3TXOA 3ZO2A 3MY0A 4BCIA 4J53A 3PJ8A 2IVSA 3CKWA 1APME 4W9WA 5HESA 3TDWA 3MYGA 1K9AA 4USDA 4AOJA 3S4QA 3A7JA 4EK4A 4ZZNA 3PG1A 3TZ9A 4B0GA 5CEPA 2JGZA 3LFNA 4JVGA 4NCTA 5GINE 1NVRA 4AA0A 3V51A 1OVEA 2UZWE 1JKTA 2E9VA 4JR7A 5J87A 3F7ZA 3C5IA 3AMAA 1JKKA 5HVJA 3PA5A 2B4SB 3B8QA 4WG5A 3QKMA 4OGRA 3OHTA 4YJSA 4AWIA 4L6QA 2UZVA 4L45A 4MAOA 5M07A 5DHJA 3GFEA 3BV2A 4GK2A 4BCMA 5DYJA 4WNPA 4ZJJA 3IGOA 5L6OA 4AW2A 4KIKA 4EYJA 2WQEA 2OXXA 2XIKA 2JDTA 5AX9A 2QODA 4A9SA 4EH8A 2YEXA 2J51A 3LCDA 3VBYA 4AW1A 2W1CA 3TNWA 3KMWA 4FTNA 3GT8A 3PXQA 2IZUA 3VW6A 2YCRA 3K3IA 4DN5A 4U97A 5BUIA 3UBDA 1J7LA 3D5VA 2PMIA 4OTPA 2YJRA 3D5XA 3TJCA 3W8LA 4CMTA 3OUNB 2Z02A 2UW9A 1Y91A 3AC3A 4I0RA 2PY3A 4IW0A 4RT7A 3BGZA 3OS3A 4EEVA 5TF9A 4EOLA 2CLQA 4JDKA 5E90A 2W06A 2QNJA 3ZMMA 2IVTA 3NW5A 3QKLA 3PXYA 3L8PA 5J8IA 3HL7A 4YLKA 4HCUA 1XR1A 4CQEA 2JBPA 3U51A 2ZB0A 5CNNA 5B2KA 2NRYA 4CMUA 2A0CX 2OO8X 2VTTA 4QTEA 1A48A 4O86A 3DXPA 3SW4A 2ZVAA 5E1SA 3ZZEA 3NUNA 5HG7A 3PY3A 4B99A 2JFLA 3I7BA 5GIOE 4KKGA 3SQQA 4BBMA 5IMXA 3CIKA 3DY7A 1KOBA 4L00A 3BLHA 5CAUA 3ZRMA 5M4UA 3O23A 4ZSGA 2BILB 4DHFA 5CXZA 5KMOA 4BDHA 3IW6A 3Q32A 4X3FA 4ZJIA 2BDJA 4FKIA 4CRLA 2IG7A 2WEVA 3FZPA 3LAUA 2I0EA 4FZAB 1PMNA 3R7OA 5CXHA 4C8BA 2B0QA 1H07A 2X8DA 3P23A 2BR1A 3TKHA 1R39A 4MXXA 4C59A 2BKZA 3JVRA 2IZSA 4XP3A 2I7QA 5IQIA 3IPHA 2W1HA 4I0TA 1UNLA 5J9ZA 5EG3A 2W05A 4IB0A 4JQ8A 4BGGA 3RPOA 5C8MA 2PL0A 5EHYA 5HKMA 4EH2A 5J9YA 1YDTE 2OBJA 2ZDUA 3H9RA 2FUMA 3ZFXA 2V7AA 3EYGA 4IAIA 2PK9A 3HDNA 3K2LA 2OIQA 4B6LA 5M55A 2NRUA 3ALNA 3NGAA 5BYZA 2YIRA 2A19B 2BZIB 4JX7A 4RRVA 3CD3A 3ZRLA 3PJ1A 4FF8A 4FV7A 5A6OA 3GBZA 4EK6A 4GFOA 4AZVA 1OUYA 4XNEA 3CP9A 1LUFA 4Y46A 2XK3A 2B9HA 1PJKA 1GZKA 2WMRA 4MXZA 4F1OA 2HELA 5FM2A 4TN6A 1HCLA 4I93A 3QD2B 3AXWA 1UU9A 2FGIA 2V5QA 3BCEA 2XIXA 3IW7A 4I5MA 5AIKA 5KCVA 4MNEB 2E9OA 3E88A 3MV5A 4W4YA 4D2PA 4DFZE 5JMSA 5LOHA 5FEDA 3UIMA 5L2SA 2NPQA 2PE2A 2QO9A 3VRZA 4ZLOA 4FUXA 1KE6A 3EQBA 4H39A 4QYFA 3ZLXA 3TZ7A 1IEPA 2OH4A 1PXOA 1H01A 3F69A 4JBVA 1EH4A 3QD4A 4D2RA 3LQ5A 1MQ4A 1XHAA 2C6LA 4A7CA 2Y9QA 2BRMA 4MXOA 1CDKA 2XKCA 4YJUA 4N0SA 3K3JA 1KE8A 2G15A 3VUIA 1YXSA 1CKIA 4G9CA 2EUFB 4RFYA 5ANEA 4ANMA 2X2LA 3FZRA 3PY1A 3UNJA 2XMYA 4DFLA 1RE8A 4YC3A 3NCGA 4S32A 1V0OA 1W0XC 2VWBA 2BAJA 5HIBA 2C6TA 1OZ1A 5D7AA 4II5A 3I4BA 4HW7A 4E5BA 3VC4A 3R7VA 2F7EE 3EN5A 5DRDA 4GL9A 2R0IA 4M15A 1G3NA 4YSMA 3GFWA 5DEWA 3MPAA 4WNKA 3QTIA 4QP2A 5M06A 5DGZA 4IXPA 2C30A 3LLTA 4TYHB 2C47A 2R3HA 4EZ5A 5EQYA 4XP0A 2HY0A 2HENA 4XV2A 4FEUA 2YM3A 1OPLA 2UW0A 2CNUA 4BC6A 4RJ8A 2EVAA 3EYHA 4O7RA 3POZA 5HHWA 3Q3BA 4AAAA 3O71A 3OW3A 5CI7A 2PTKA 1P4FA 2W4OA 5E8YA 2PZYA 3ZDIA 4ASEA 1R3CA 4AOTA 2ITVA 4Y5QA 2Y4IB 4QP3A 5HBHA 2BUJA 1R0PA 3UIXA 1OB3A 2OICA 4G3GA 3DJ5A 4RIYA 1JKLA 1WBPA 5M53A 4HVSA 2PYWA 3VUTA 3NUSA 4CTCA 4QMSA 1JLUE 3OCBA 3OCSA 5F94A 5G1XA 3DZOA 3NNVA 3QUEA 4GH2A 3W2RA 3CQEA 3FI2A 4NM7A 4EONA 2G1TA 4ZP5A 4H36A 3M1SA 2X8EA 4YJPA 5TE0A 3BLQA 4P2KA 2JITA 1GJOA 3F82A 3BWFA 1W98A 4IFGA 5KBRA 4E6CA 3ULIA 4E93A 5A46A 4JQEA 1MRYA 4HYHA 4Y73A 2R4BA 2W5AA 4ZXTA 4FTOA 3R8PA 4I5CA 4GRBA 4GS6A 3R7GA 1BL7A 1PHKA 3HV6A 3ODZX 4WNMA 3F5XA 3RM7A 4IB5A 2P3GX 5JRSA 4AACA 3NIZA 3FYJX 2P55A 5H8GA 3QYWA 1OPKA 2PZ5A 3PXFA 2BROA 2ITYA 4IFCA 3DFCB 5AR4A 3RCDA 3VNTA 3ZEWA 4TXCA 4WHZA 4D4YA 1PXNA 3VUGA 4AE6A 3IO7A 4RIWA 4CCBA 3FMKA 2PVJA 1WBWA 3VWAA 3ZSIA 2WTKB 3QQLA 3RJCA 3BYOA 3DB6A 3OXZA 3LOKA 3QRTA 3OCTA 2F2CB 4CT1A 2BRNA 4HPTE 4M7IA 4ASZA 2JDVA 4M69A 3C7QA 1H1RA 2J5FA 4IAKA 1ND4A 3GU6A 3W2OA 4XX9A 4EOPA 4EHEA 4IB3A 3FI8A 3KXMA 3C4XA 4I6QA 4JIKA 4HYSA 1CM8A 1M52A 2C0IA 4L3PA 2C0OA 4BGQA 5C1QB 3PLAE 5JFVA 1SVGA 3IONA 4S33A 4MYGA 3LCKA 4XLVA 4EK8A 5EH0A 3M2WA 5ANGA 4UWCA 3CSVA 4ARKA 3F5UA 4E4LA 1W82A 3NYVA 3BHUA 5F4NA 4FVRA 3OWPA 2IW8A 1L8TA 3LFCA 5A14A 3MH3A 4O96A 3AMBA 5AEPA 4B7TA 4L7FA 3IGGA 4RFMA 4V0GB 3RAKA 3FBVA 1MQBA 1B6CB 4PX6A 2VWIA 5CVHA 5AUXA 3RM6A 3HMMA 4AX8A 4KINA 2CN8A 5L2QA 1PMVA 3PZEA 5FTOA 3NYNA 2HZ4A 2E9PA 3VUHA 2BFYA 4GJ2A 4XG4A 5FBOA 1PY5A 2O63A 3PJ3A 4O84A 3AMYA 1TKIA 3DXQA 5CAPA 3I60A 1PW2A 2UZBA 3FC2A 2CPKE 3UYTA 2PVHA 1QL6A 3EKNA 4HOKA 1ZXEA 4DINA 4DFNA 2B55A 3SG9A 4FV4A 2XIYA 3G90X 3IECA 2JDOA 4RC3A 4O6LA 5JQ8A 3E64A 4QMNA 5M08A 5KMIA 3TV4A 1FGIA 3BZ3A 3QRIA 4E8AA 4O7YA 2JC6A 3DFAA 5ICPA 4K2RA 5HZNA 4GIIA 4UWYA 3NX8A 3FQEA 3K5UA 2JIUA 2WD1A 5BVKA 2HZIA 2XKFA 2WGJA 5I9XA 3BLRA 3ORLA 3FYKX 4EWHA 2GNFA 4HGLA 3QQGA 4YBKA 4DFXE 1J7IA 1TQIA 3GCPA 2X7GA 3ZC5A 2ZOQA 5JZNA 3GU7A 5AUTA 4NTTA 5E92A 4C38A 5JKGA 5H8EA 5J7BA 5EKNA 4AP7A 4QMTA 4KIQA 2J4ZA 2QG5A 3NRMA 4IWOA 3NVKI 3D83A 3O8TA 4XYFA 1E1XA 4ACMA 3ROYA 3HX4A 3EFWA 4F9YA 1VR2A 4ACDA 4V01A 4EKKA 3U55A 3F5GA 3NDMA 3NLBA 3UQFA 4AZTA 2HIWA 4FG8A 4E5WA 4U79A 1NVSA 3PPZA 2YIYA 3MFTA 3W55A 5I9WA 4I92A 4FMQA 4FTTA 4PL3A 4DG3E 3VS3A 4IZ5A 3BE9A 5DT3A 3R8UA 3MFSA 2F49A 4MBIA 4ID7A 2PVFA 1JPAA 2JFMA 4K1BA 3VF9A 4O82A 5C4LA 4YURA 1XH6A 1Q8YA 4QP8A 2ITZA 5HNBA 1UV5A 4G3DA 4WBOA 2WPAA 4M67A 4W9XA 3ZCLA 3A7IA 3Q5ZA 3QTZA 5DVRA 2QOFA 5EOLA 4NW5A 3UVPA 4FSTA 1P14A 5FXRA 4AN9A 4MF1A 3GUBA 3CY3A 4NH1A 2XF0A 2XKEA 3UIUA 5AP2A 1WCCA 4BBEA 3OROA 4HNIA 4ENYA 4MWIA 4PUZA 2Z60A 3RHKA 4ZTMA 3Q4CA 4F63A 4GEOA 2C5VA 3MJ2A 3P08A 2ERKA 4UXQA 5E91A 2R7BA 4R6VA 5C4KA 3RGFA 3HEGA 1JKSA 2HAKA 1CKPA 3GCUA 4MHAA 1H28A 3D7TB 3DJ7A 4QPMA 4XV9A 4FA2A 5FP6A 4OAUC 2F2UA 4K18A 5AUVA 2DS1A 4I6FA 3V5WA 2GDOA 1WZYA 2VV9A 5ACKA 4FGRA 3MFUA 4Q2AA 1W84A 3HV5A 1U54B 4GV1A 3VBXA 2RG5A 2UZOA 5ETFA 4EOMA 2IZTA 2XM9A 2YCQA 1H0VA 2QOOA 3PRIA 3UZPA 3E3PA 4BGHA 2PE0A 2QU5A 3QLGA 4TYJA 2GQGA 5HO8A 3FE3A 3V5LA 4DH5A 3AD5A 3Q9YA 4EORA 2BMCA 4F99A 3C4EA 4BDEA 1VYZA 4M8TA 1Y6BA 4R7HA 3UPZA 2P4IA 4KIPA 1U5QA 5EM8A 5AA9A 4ERKA 4NK9A 4E5AX 3UE4A 4HGEA 4BWPA 1DI9A 5AP5A 5KHXA 4IM2A 2PVYA 3C13A 5B2LA 5FXSA 3UGCA 3AQVA 3ETAA 2QO7A 3GC8A 4OTIA 3Q5IA 4FV9A 4TW9A 3Q6WA 5DRBA 4JR3A 4BTKA 5IA5A 2JBOA 4RC4A 3EZVA 5BX0A 2BPMA 4NKAA 3V8WA 5LCKA 2X81A 4IVBA 1ATPE 3RZFA 4ENXA 1J7UA 3R21A 1YI4A 4H1MA 3PA4A 2JAMA 4IJ9A 5ETCA 1ERKA 3RBWA 4D5KA 4N4SA 4IAZA 4DH1A 2WTDA 3RPRA 1JVPP 1FVRA 2ITOA 2QOBA 3KEXA 5C03A 3REPA 4EJ7A 3DS6A 2BRGA 2FYSA 2UW8A 4TKSA 3RNYA 4BCKA 4H3BA 4RX7A 5L8LA 3LFFA 2GSFA 2R64A 3DKFA 1GZOA 3QZHA 3E87A 4IH8A 3FMJA 3R8ZA 3RALA 4EBVA 1ZOEA 1ZYCA 3RTPA 3V6RA 2VTSA 1H1WA 5EDPA 5H9BA 4IX6A 2I0HA 4CFMA 1P5EA 5L2IA 1M7NA 4ITHA 4W4VA 2XJ0A 5CQWA 2I40A 4WO5A 4DCAA 5KMNA 4R3PA 4ZJVA 1XBCA 4NIFB 4GT4A 4YO6A 4F70A 3BEAA 2QONA 2HWPA 3P86A 1ZLTA 4FIHA 4AN2A 3UO4A 5AFVA 4RIOA 2O64A 4WRSA 4E20A 4GMYA 4DBNA 4BKJA 5GZAA 1DM2A 2YM8A 2EXCX 2FSOX 2YLFA 5FXQA 4FV2A 3VS1A 4EC8A 3F2NA 5EHOA 3V5QA 5D9HA 2FO0A 3FY0A 4I5PA 4NFMA 4HJOA 3V04A 3PYYA 4C33A 3D5WA 4FNWA 3R83A 4DCEA 2OJJA 2J90A 5AR5A 5E9EA 4BCPA 3QQHA 4O22A 3L9LA 1W83A 1YWRA 4DG2E 5TT7A 3MESA 3KL8A 3LFEA 4QMVA 4RWKA 3CJFA 2QG7A 3D5UA 3T3UA 3KK8A 4U43A 1IAJA 5IQEA 2C1BA 3TJDA 4FODA 1RW8A 3UOKA 2R2PA 3DBCA 5BNJA 2I0YA 5K5NA 4L68A 3OT8A 4DTBA 2G2HA 3QQKA 1R1WA 4QQTA 1XO2B 2YCFA 1DAYA 3W2SA 3MB6A 5JRQA 2UVZA 5J5TA 5ETAA 5JGDA 3UYSA 5EM7A 5AUYA 2Y6OA 2F7ZE 5HG8A 3UP7A 2XZSA 5F9EA 1OMWA 2X1NA 3SRVA 1UKHA 1TQMA 2EXMA 3P7AA 4FKVA 4D4RA 4L52A 4FSWA 2F9GA 2BIKB 3TTIA 3VBVA 2G2IA 5CT0A 2QOHA 4ANQA 3Q52A 3FWQA 3OY1A 1J1CA 3PIYA 3BHHA 4P5ZA 1JWHA 2Z7SA 2CLXA 3M11A 4F6UA 4J98A 3UVQA 3GB2A 2XJ1A 3ODYX 3NW7A 3EQDA 1WFCA 2VX0A 3BELA 2VUWA 4OT5A 1Q8ZA 2GMXA 3GOPA 4FIGA 4QNYA 4XG2A 3ZSGA 4GKHA 3BQCA 3VS5A 2B9IA 2UW6A 4YJTA 3R7UA 3QGYA 3HRFA 4X2GA 4ZTRA 3GQIA 4QQJA 5C27A 4FKJA 4OTDA 4FKQA 1Y8YA 4AGDA 4KNBA 1M2RA 5D7VA 5ITAA 3RWQA 5A4LA 2ITWA 3ZO1A 4F0FA 5E8TA 4RVTA 1KE5A 4DLJA 5JGAA 4R5SA 5JQ5A 3RVGA 4AGCA 4AW0A 1ZAOA 2XYNA 5BMMA 4OBPA 3ZRKA 4IZAA 5FGKA 1P2AA 3IS5A 2EWAA 3H30A 2GS2A 2VU3A 3KVXA 2W4JA 2YISA 4JAJA 4GW8A 3FLWA 3EQHA 3MVLA 3QTXA 4IANA 3G0FA 4TTHB 4TNBA 3RAHA 3PP0A 4WBBB 3ITZA 1E1VA 3WIGA 3QTWA 4XBUA 2C6DA 3KVWA 4FTRA 1MRUA 4RWJA 5AM6A 2Z7RA 3NSZA 1YKRA 3V5PA 1KV1A 3GGFA 2X4FA 4BCJA 3GU5A 4X2FA 1AD5A 4YSJA 3LZBA 3FHIA 4HZSA 4C3FA 4E6AA 4U3ZA 3KN5A 5B0XA 3R00A 2CN5A 1JSTA 2O65A 5HE0A 2VO6A 4FT3A 4G1WA 4EHZA 1IASA 4MD7E 4PDOA 4EOQA 2J5EA 5FQDC 5IA1A 3AOXA 2UZEA 3FLZA 4J71A 5C8KA 4NT4A 2EB3A 3FZTA 3IW4A 2V7OA 2R3GA 2KULA 4G17A 5DA3A 3F3ZA 4GFGA 3W2QA 3MSSA 3HRCA 4XRJA 3EQFA 4GU9A 1UU7A 4CXAA 1OIRA 2YM5A 3Q60A 5HVYA 2QKRA 2WIPA 5EYKA 5HX6A 2R9SA 3IQ7A 3EH9A 3GQLA 1SNXA 3KU2A 4Q5EA 3VUKA 4RA5A 4I21A 1BLXA 1BKXA 3DB8A 4JXFA 4P7EA 4RQVA 4F1MA 2R3OA 1K2PA 3CTQA 2YDIA 1IAHA 2OWBA 2H34A 3UG2A 2JIIA 2H96A 4G5JA 2GTNA 5DN3A 3FMNA 4IE9A 2PUNA 3W10A 4YJQA 4KIKB 5ANIA 1PXIA 1PKGA 1PXPA 4EUUA 2LGCA 3ALOA 2YWPA 2X9EA 3RK5A 2HW6A 3UOHA 3R04A 3AD4A 3HV7A 4QYHA 2VO0A 4LMNA 3ZUTA 1WAKA 2JKQA 3A8WA 3BU3A 5I0BA 5EDQA 4KBAA 4ZY5A 3O17A 2ZM4A 3H0YA 5IEXA 3C50A 4RFZA 3D9VA 4JG8A 3KY2A 4QMYA 5D1JA 3QLFA 3W8QA 3COKA 4KUJA 1GY3A 3R9OA 2WMXA 4KRDA 4EQMA 2C0TA 1MRVA 1OKYA 1ZY5A 3ERKA 4FI1A 3CXWA 4JJRA 4AF3A 2REIA 3MVJA 2C68A 5CSWA 3QZGA 3KCKA 1LEWA 2X7FA 3DTWA 4F64A 4C4EA 3COHA 1PRYA 3G2FA 5FG8A 3JYAA 5LMAA 3G51A 4TRLA 2J0KA 3OWJA 4O6EA 4O7SA 3G5DA 5E7RA 4CKRA 5CZHA 2Y8OA 2W4KA 2Z2WA 4CD0A 3UC3A 2W5HA 3EQCA 2QR8A 4MKCA 3R28A 3NAXA 3G0EA 5CANA 3A4OX 3OC1A 3OMVA 4M12A 4X3FB 1FOTA 4GT5A 1YWNA 3F3UA 3Q2MA 3VJNA 5M09A 3RAWA 4MBLA 4CEGA 4EC9A 3GCQA 3PZHA 4LI5A 4FUYA 3R9RA 3KXHA 2WQOA 3RKBA 3WZKA 4IAYA 4USFA 3QU0A 3Q53A 5IDNA 2WKMA 2HYYA 3R1QA 1O6KA 5IEYA 3HRBA 4H1JA 3FQSA 5LVOA 3MY5A 4FIJA 4CMOA 3ZXZA 4MCVA 2UZLA 2VTRA 5AV1A 2GPHA 5KKRB 3SGCA 3TL8A 5JGBA 1W7HA 4HVGA 4UMQA 4FZ7A 2OLCA 5HTIA 5I9VA 1OKZA 3RP9A 4Y5HA 4G6LA 4ERWA 3POOA 1YOMA 4Q9SA 5AUZA 5G6VA 3C5UA 3HMPA 3PA3A 4FTCA 3PP1A 2YJSA 2FB8A 2OF4A 5HG9A 3I5NA 4RIXA 3PWYA 2PULA 2PU8A 4ITJA 2CGWA 2WTCA 3JUHA 4RJ4A 4AT3A 2UV2A 2XA4A 2WOTA 1Q61A 4LL0A 4LRJA 3S1HA 3FLNC 2WMSA 4WSYA 3NWWA 1B39A 3KGAA 4IM3A 4D2WA 4YC8A 4JBQA 3JS2A 4G16A 4J96A 2XJ2A 3QBNA 4QP1A 5DT4A 5HOAA 3OD6X 4BI1A 3VVHA 3CS9A 2PVLA 3GEQA 4KBKA 4PNIA 5FM3A 4AN3A 3PFQA 4QQ5A 5M44A 3TUCA 3M42A 1G8SA 2OKRA 3ZTXA 3OWLA 4EWQA 4RX8A 4C4JA 4PNKA 5DIAA 4E73A 3GU4A 4IADA 5DWRA 5LVPA 2ZM3A 1Q8WA 2QOQA 2BDWA 2YN8A 3R1NA 5FTQA 4KD1A 1OECA 4ANLA 4GKIA 3TCPA 2IWIA 2OZOA 4L3LA 4BWKA 4N70A 4JRNA 4EBWA 2E9NA 4M68A 4MXAA 3IKAA 3KULA 1OIQA 3IDPA 3VS4A 5BYLA 3PRFA 2X0GA 4MXCA 2VTJA 3IOPA 4I20A 4UN0C 5LXMA 1H0WA 5M51A 4I4FA 3P7CA 3ZYAA 4G3EA 3F6XA 3FMHA 4MXYA 4X6RA 3B8RA 3F9NA 2IZRA 4U80A 1LPUA 2CCHA 3LE6A 4QMMA 4YJOA 5E8WA 5KE0A 1M2QA 3TT0A 4CFXA 3O2MA 4QMZA 4E4NA 2ZJWA 4OTFA 2PVMA 4ZAUA 5HCXA 3VHEA 4N57A 2C3IB 2R0UA 3EN7A 1S9JA 4R7IA 1REKA 1YRPA 1IR3A 3QWKA 4FT9A 4RIYB 3HA6A 4YGAA 4QOXA 1B38A 2F4JA 2XK8A 3OFMA 3ORNA 3PG3A 3NW6A 5E8ZA 4O1OA 3GNIB 2G2FA 5GJGA 3ZFYA 2RSVA 3BYUA 2PUUA 1WMKA 3HAVA 4GYGA 3TKUA 3KN6A 4ZTLA 4RBLA 3DKGA 3EJ1A 2B9FA 3P5KA 3HUBA 2W7XA 3PTGA 3ZHPC 4QO9A 3EN4A 1GIJA 1ZZ2A 5CALA 5HLWA 2OW3A 2W9FB 1OKWA 3DAKA 2YITA 5T6KA 3O7LB 3OEFX 4C57A 3OXIA 4FNYA 3VQUA 4ZSJA 4BVUA 5J9LA 2XYUA 3Q2JA 3ROCA 4JBOA 4YZ9A 1F3MC 3R7IA 4LL5A 4U5JA 3ET7A 4Y83A 2J0MB 3GC0A 3L9MA 3DK7A 2CGUA 2X6DA 3OWKA 3BQRA 5IQBA 4Z55A 2WMVA 3E92A 4DEDA 5IA3A 2CGXA 4M97A 4FNXA 5AADA 4ZMEA 5KZIA 1T45A 3UODA 3MB7A 4LYNA 3NUPA 1Z9XA 3PJCA 4WNOA 4E1ZA 3MIAA 5DH3A 3SAYA 5IQGA 5DR9A 2HY81 1G5SA 4CFFA 5L2TA 3QRUA 3EN6A 1JNKA 4XJ0A 4IBMA 4RIWB 4HVDA 4IACA 4DEBA 2J2IB 4FV5A 2PZIA 3QFVA 4CLIA 4EOIA 3JXWA 3LJ0A 4GG7A 4M69B 1OL5A 4YTIA 2Z7QA 3QAME 4C3RA 5KO1A 2UZNA 2OJIA 5KX8A 3I79A 4HYIA 4D1ZA 4E26A 2CKPA 3BKBA 2GQRA 3OOMA 4I0SA 1FBNA 5CAQA 3DTCA 2XBAA 1TVOA 4C35A 4Z7GA 4CGAA 4NSTA 5HD7A 4IWDA 4RVMA 4DEEA 4R3CA 4ZZMA 4CV8A 4WD5A 4LGDA 4HCVA 5DNRA 5EW9A 4E7WA 4CYJA 1PF8A 4EZ3A 5I5ZA 1Q62A 5BVFA 1U5RA 4QTBA 2ZV9A 5ANDA 5FUTA 4ITIA 3D14A 1GIHA 3NS9A 4QP6A 3C4ZA 1YHVA 3PLSA 4I22A 5IA0A 2CNQA 4U3YA 3SX9A 2ETMA 5C9CA 4D4VA 5AV2A 3WARA 5CX9A 1FQ1B 5IKWA 4X21A 4EH5A 3L8VA 3F3TA 3LJ1A 4FV3A 3C4CA 5LVMA 4FKSA 3R22A 4FOBA 3ZLYA 3BGQA 3WZEA 4B8MA 2OJFE 4C37A 4L43A 4PMMA 2XNPA 5EYMA 5IG1A 3AC2A 1ZMUA 1MUOA 4FTKA 2YA9A 2JAVA 4U41A 5HU9A 4AT5A 5ANKA 2W96B 3CLYA 3RAIA 3TEIA 3EMGA 4O27B 4IDVA 2OXDA 5AP0A 3MVMA 4GK3A 5AV0A 5CU6A 4K33A 2RL5A 2QCSA 3ZBFA 4BZDA 5CAOA 1OKVA 2V0DA 2XKDA 4CZYB 5CZIA 4ZS4A 5CF8A 4BTJA 4BIDA 3DNEA 3AC1A 1Q4LA 2BVAA 1KSWA 3MWUA 3G9NA 4IB1A 3HV4A 1YQJA 1Q5KA 3IDCA 4QYYA 5JFXA 3L8XA 4XUFA 4BDCA 4DA5A 3VBQA 2JKOA 3SHEA 4FE2A 4DF3A 3UC4A 4L46A 2WMBA 4EI4A 5CEQA 1FINA 5EYCA 1ZOGA 3PIZA 3ZDUA 4O83A 5GHVA 4S30A 3WF9A 3QZIA 5D12A 4EYMA 4XMOA 5DLSA 1IG1A 5EKOA 1U4DA 3D4QA 4HZRA 1WVYA 4J52A 4NJ3A 4A07A 4L9IA 5JT2A 1YOLA 5CENA 4ZLYA 3CQUA 3KRJA 5HQ0A 1X8BA 2RGPA 4FTQA 1PMUA 4FX3A 4QNAA 2C1AA 4UY9A 3VS2A 4BDAA 3SA0A 2VTNA 5FD2A 3PVGA 3ZUUA 4OTQA 4Z3VA 1H08A 2XRWA 2BAKA 3UVRA 4UMUA 3HYHA 4LRKA 4O2PA 5BUJA 1V0PA 1O6YA 2PVNA 3FMDA 4PL5A 2X8IA 4MH7A 4FIIA 1H24A 2CJMA 2XVDA 2HXLA 5B7VA 2XBJA 3L9PA 2OFVA 2YERA 4IAFA 3V5TA 3AT2A 3L9NA 4F7NA 3QZFA 2R3NA 3DLSA 3IOKA 3FEGA 4K8AA 2PZPA 2FSTX 4FKWA 3V01A 3WE4A 2QOIA 4FVPA 2VTMA 3PPKA 2B53A 2BRBA 2FH9A 3ORIA 4V04A 4BHNA 3CCNA 4FTJA 4CFWA 5IEVA 2HOGA 1WBTA 2WO6A 2YZLA 2ETRA 2XIRA 4K9YA 4M13A 5IUGA 3ANQA 3MY1A 3KKVA 3TKIA 4E3CA 3G6HA 4CVAA 4O7WA 3I0QA 3LQ3A 3H10A 3PDTA 4FIFA 2C4GA 4JDIA 4OTHA 4X3JA 3KFAA 2IN6A 5HNGA 1XH9A 1KV2A 4L53A 4UMTA 2HZ0A 2RFEA 5CWZA 5BYYA 3QTQA 3UMWA 4O21A 3R9HA 4BDDA 2YZAA 2PMNX 1GZNA 4K11A 4BCGA 4AW5A 4DGNA 3EQGA 4F7JA 1J3HA 3PXZA 5CNOA 2V22A 3FXZA 4IJPA 3N4UA 5AV3A 3U9NA 3TNQB 2I1MA 2XNBA 4BKYA 4GU6A 4LUDA 3DBFA 4ZSEA 4OTRA 4O2ZA 5KUPA 4FG9A 3BU5A 2YHVA 4AZWA 4KB8A 3UPXA 2Z7LA 3LCOA 5JEBA 5DEYA 3WZDA 4RX9A 2OG8A 3HMNA 4IX3A 4J97A 2YDKA 2ZV8A 2V55A 2OZAA 2CKOA 3TNIA 2Y4IC 3RCJA 3BV3A 3VN9A 4WOVA 4DGOA 5LVNA 2W1EA 2PSQA 2W17A 4QPSA 4CZTA 3F3WA 5BMSA 3WYYA 2GFCA 2UW4A 3JPVA 3JY0A 2VD5A 5H2UA 4AA5A 3FAAA 5AR3A 4ZLZA 3IG7A 4NYEA 3ZLWA 4FKLA 2BAQA 5H8BA 5AP1A 4U44A 3AT4A 4FEWA 1CTPE 3FPMA 4PPBA 4JDHA 3VHKA 3EZRA 1Q8TA 2R3PA 4CKIA 3OCGA 3OW4A 5IQHA 2ERZE 3OVVA 3T9IA 4O7TA 4XG6A 4LUEA 2QD9A 5K4JA 4WUAA 4DFYA 2O5KA 4R78A 3U6HA 3DOGA 3W16A 4IEBA 1KE9A 4TL0A 1VEBA 4UMPA 2C6IA 1AQ1A 1W8CA 3OF0A 1YI6A 3RI1A 3I0OA 3QRJA 5HBJA 3LIJA 3OXTA 3F88A 2XEYA 3PPJA 3ZO3A 3W18A 4LM5A 5J7HA 2R3RA 2PUIA 3KF4A 4FZDB 1YXUA 3NIEA 4BICA 4QP7A 3UO5A 3I6WA 4C4IA 3U6JA 3COIA 2VWVA 4O0RA 1YOJA 2XIZA 1YW2A 4AGUA 2PUPA 4JIAA 3RNIA 4QT1A 3ORTA 3DKOA 4FYOA 1OBDA 4YHTA 2GHLA 3QUPA 3UP2A 3QD0A 4QMUA 5EM6A 2WTKC 2B7AA 1OGUA 1QMZA 4FKTA 2BRHA 4YTFA 5JFSA 5AAEA 3CPCA 3UOJA 2CNVA 4A9YA 3QCSA 4BF2A 4F9BA 4TT7A 4C3PA 2W1GA 3KA0A 4UB7A 4O0UA 3F2AA 2VTIA 2VGOA 4B9DA 4EZ7A 2XS0A 3P0MA 4EQCA 5GNKA 3EQRA 3NYXA 4FSMA 4BCOA 3EKKA 2XK4A 2WIHA 4JBPA 3VQHA 4NM5A 5K5XA 1BX6A 5ANOA 4U7ZA 5T68A 3S3IA 4QYEA 3WILA 3FHRA 2C5YA 2UW3A 3BPRA 3KRXA 5EK7A 1ZYLA 4WRGA 3VUMA 4H58A 3KMUA 2H6DA 4OTGA 3SLSA 3ZH8A 1UVRA 5F20A 2R7IA 4CV9A 4DC2A 4C7TA 4I6HA 3QGWA 4NWMA 4XRLA 3SW7A 4XEYA 5FEEA 5LVLA 4NL0A 4ZTHA 4BDBA 4TWOA 4LQMA 3DKCA 2W9ZB 4APPA 3QQUA 2WMAA 4W4XA 5FBNC 3QTUA 5HEZA 2XK7A 4R7BA 3COMA 3L8SA 4YTCA 3BBWA 5CSHA 5BVWA 4YZNA 2C3LA 3SKCA 5HE2A 3R71A 5EQEA 4EH4A 3SRVB 5AV4A 3W32A 5IH5A 2BHEA 4AFJA 4ZY6A 1OIUA 5AP4A 5E8SA 4NM3A 5A4QA 5EW8A 3I7CA 4DT9A 4BDKA 5IF1A 5E8UA 1YHWA 3E5AA 2GS7A 4DH3A 3WF7A 1ZYJA 2J0LA 4KAOA 3VS6A 2B9JA 4AUAA 3E7OA 2OIBA 3QA8A 2QR7A 4QMOA 2C3KA 3MJ1A 5HO6A 3G15A 3CR0A 3EB0A 3P4KA 5FTGA 4O91A 4H05A 2NP8A 3KXNA 4RPVA 4S31A 5E8XA 3BBTB 5I4NA 3DAEA 2C5XA 3QHRA 4MX9A 4BRXA 4B8LA 3WF5A 3UZRA 2OXYA 3DBQA 4JLCA 1WBSA 5F1ZA 3FKNA 2W1DA 3AGLA 3A7HA 2XK9A 1IA8A 4XV1A 3LXNA 1MP8A 4ZOGA 3PVBA 5GIPE 3GCSA 2HXQA 3LQ8A 4A4OA 3QCYA 4ZSAA 5BUEA 3H9OA 4WUNA 2C5NA 4UX9A 2AUHA 4O0VA 3GENA 4K0YA 2UW5A 4EOSA 4LMUA 3EN9A 3EWHA 4IIRA 3HGKA 4AFEA 3R0TA 2PVKA 3DBEA 2F7XE 4XLIA 4NJDA 4APCA 3TIYA 5GJFA 2ITXA 3SOCA 5CAVA 3MS9A 1HOWA 3GI3A 2XNMA 4DAWA 4ORKA 2WAJA 1OI9A 3V8TA 3HVCA 1WVXA 3NNXA 4FV1A 3SXFA 4BI0A 3FPQA 5FRIA 5K0XA 1UWJA 3S0OA 4ZIMA 2R3QA 2OI4X 4I3ZA 4BYJA 4D9UA 3LPBA 4DH7A 3QX4A 5AR2A 1NW1A 3CY2A 5ANJA 4GG5A 4PWNA 5CEKA 3BI6A 5BVDA 4J8NA 4YHJA 3S00A 2VX1A 3DNDA 2Q0NA 4RJ6A 2EXEA 1ZARA 2QURA 3C51A 3FY2A 4YPSA 5HNIX 4M0ZA 3BHVA 2C6MA 4JNWA 3KQ7A 3GVUA 4DFBA 3CGOA 4KBCA 3BYSA 2CSNA 3AGMA 2ONLC 1ZY4A 4GVJA 4QTDA 3SDJA 4HGTA 5FDXA 4KSPA 4A9UA 5IA2A 2WMTA 3U9CA 2JDRA 4ZTNA 1L3RE 2UVXA 3LFDA 2YIXA 5L4QA 3ZU7A 5HCYA 3MIYA 3PVUA 4D5HA 1BI8A 3HMIA 4DTAA 3KRRA 4UMRA 2V62A 2WEIA 3FJQE 4AZFA 3QCXA 3GC7A 2OIDA 2QLUA 2QHMA 2QU6A 5IH6A 3R63A 2PMLX 1F0QA 2WHBA 3O50A 1SM2A 1Q97A 1WBNA 1M7QA 2HZNA 3BGPA 3OTVA 3OZ6A 4FIEA 3KB7A 2O0UA 3QXPA 4OUCA 3HECA 2GQSA 4LFIA 3LXKA 3CEKA 3QHWA 2KTYA 3DDQA 4IVCA 4ACHA 4AXAA 5A54A 1XH7A 3RPYA 2ITUA 3K5VA 5CQUA 3JR1A 1NA7A 4KSQA 4ZSLA 2PHKA 4RQKA 4UZHA 1SZMA 1BYGA 2ITQA 4PMSA 4D2VA 4WG4A 4BCQA 2C6OA 2WB8A 3ENMA 4JS8A 5D10A 3P78A 3R1SA 4JAIA 5EI8A 5HICA 2XRUA 4PP9A 4RVLA 2YAKA 1U59A 4YNOA 5KZ0A 3TWJA 1URWA 2CMWA 4O38A 4WKQA 4IZ7A 2R3LA 3FZSA 3EIDA 4A9RA 2X39A 3W2CA 3QC9A 2VO3A 1SMHA 2QOKA 3NR9A 5GJDA 2QHNA 3UNZA 3ZXTA 4AU8A 5HVKA 2ZYBA 2WFYA 5EFQA 3Q04A 5TR6A 4U81A 1H4LA 4JDJA 4O7NA 4C4FA 3I6UA 5FEQA 5CF4A 2GS6A 4HGSA 3RK7A 3PXKA 2ZDTA 4RX5A 2ZM1A 1YVJA 4EUTA 3NZ0A 4I1ZA 1U46A 2ITTA 4FV8A 3C4FA 4MWHA 3OT3A 4J1RA 4YZMA 5ACBC 4D2SA 5B2MA 3KRLA 4IVAA 3HP2A 5KMLA 1Z57A 3ZSHA 4PDSA 3PWDA 4CNHA 2XUUA 3D15A 2RKUA 4GVAA 2YM6A 4NW6A 5CU3A 4D2TA 1YWVA 3A7FA 3RHXA 3RWPA 4YMJA 3A7GA 4UYAA 4YJNA 4KKHA 2G01A 1YI3A
chains in the Genus database with same CATH superfamily
3QQJA 3E7VA 4BCHA 2ZAZA 3FZ1A 3C4WA 4RWIA 5CI6A 3AG9A 4JI9A 4M66A 1Y57A 4FT7A 4RIXB 4FTLA 2W0JA 5AR7A 3EOCA 4S34A 3DBDA 3PE2A 1WBVA 3P1AA 3DLZA 4PV0A 3ORMA 3CGFA 3PE1A 4O0TA 1GNGA 3R02A 4FK6A 4R5YA 4BL1A 3NPCA 5ETIA 3MA6A 2W1ZA 4BTFA 2I6LA 2YCSA 3DZQA 4JQ7A 4C02A 4C4HA 4WA9A 4LV7A 1O9UA 4G6NA 2RG6A 3LFBA 3PJ2A 4P4CA 3QL8A 4IX5A 1GZ8A 3O8UA 3HDMA 5LJJA 3DDPA 3BHTA 2PMOX 3JY9A 2VTQA 4O4FA 4OLIA 4AT4A 2E2BA 4BDJA 1Q3WA 5HU3A 4BYIA 4XP2A 3HLLA 1SVEA 2Y0AA 3A2CA 3FKLA 4FV0A 3Q9ZA 4IHPA 1XJDA 2XNEA 3U4WA 4EQUA 4GK4A 4FYNA 2XP2A 2GU8A 3D7ZA 5CF5A 3SVVA 1ZYSA 5A4TA 1NXKA 4XV3A 5I9ZA 4RG0A 4WG3A 2BKKA 2WMWA 3MPTA 2BHHA 4U9AA 4FSZA 4H3QA 5IQDA 5CLPA 3WIKA 3D2KA 4W4WA 1UU8A 3DK3A 1VLRA 2GNIA 3QQFA 3N9XA 4PTCA 4YUQA 3KULB 3HA8A 4D1XA 5BVEA 3TM0A 3TV7A 1OL1A 2QKWB 3DCVA 1PKDA 2WQBA 3MA3A 2YM7A 4HYUA 3EFKA 2PWLA 2JD5A 4YPDA 2UZDA 4YO4A 5DOSA 3MVHA 4IX4A 1SNUA 1CSNA 1OBGA 3DAJA 5HLNA 3G6GA 3MFRA 4Y72A 4F9CA 3QWJA 4C61A 5EQPA 1PXKA 3S95A 3SD0A 4YU2A 3QF9A 5IUIA 2W1FA 3O96A 1H1QA 3KXGA 4JX3A 3BHYA 4I94A 4YLLA 4BKZA 1XH5A 4BWXA 3F2RA 5AP6A 5AUWA 3TN8A 5TO8A 5AP3A 2JLDA 4GSBA 4YBJA 5DT0A 5L6PA 3RPSA 3TACA 1FVTA 2VWUA 3QXOA 3NUXA 4ZS0A 2IW9A 4YLJA 3C1XA 1FPUA 5FLFA 4G5PA 1OL2A 5C26A 5IZFA 1YHSA 1KE7A 2F57A 2X2KA 4DT8A 2A1AB 4FEXA 1PYXA 3CTHA 4IAAA 5LMKC 4S2ZA 5LMBA 3THBA 4AZSA 4CZUA 4DYMA 2VWZA 1DAWA 2ZB1A 4FR4A 3KF7A 4FZFB 2X9FA 4FL3A 3ACKA 1H1PA 2OU7A 2GCDA 2B54A 3RK9A 5CEOA 2PZRA 5L8JA 4GUEA 3KMMA 4MD8E 4U6RA 5M4CA 3N4TA 2X7OA 3BU6A 4W8EA 4YZDA 5FP5A 4BDIA 4XG7A 4OBQA 3VAPA 4DGGA 4ZY4A 1JSVA 4G3FA 3FSKA 2Q0BA 4BZNA 2O2UA 2OFUA 3IW5A 5HO7A 1BI7A 1NVQA 3IDBA 4ZEGA 3GC9A 5AIRA 2BTSA 1UKIA 4DEHA 2OF2A 4PMPA 2WQMA 4E4MA 1UU3A 4FL1A 4UZDA 5HE1A 2VZ6A 1XQZA 5IUHA 4GUBA 5EOBA 2VTAA 1H25A 5EI6A 3H4JA 3S2PA 2P33A 3BIZA 3NNWA 4J7BA 4XH6A 2ETKA 4EHGA 1IA9A 4L42A 4ANOA 4HPUE 5LARA 3C9WA 3FZOA 4LOOA 4NCTC 1SYKA 4PY1A 4MF0A 4QYGA 4RA4A 4QMQA 5BVNA 1YXVA 3PXRA 2GHMA 3DK6A 3U8WA 3AKKA 3FDNA 4FTUA 3ZEPA 4MVFA 4JT3A 5J79A 1AGWA 1PYEA 4FKOA 4OTWA 4F6SA 2NO3A 4RC2A 5DPVA 3C0GA 5D11A 4FJVA 3R8LA 1KUTA 1PXMA 2CCIA 4PPAA 2GNLA 3NAYA 2VX3A 3RMFA 3R2BA 3A62A 3ZC6A 1M2PA 3AD6A 4CSVA 1JQHA 2YLEA 4GIHA 4AXCA 2VTOA 3L1SA 2YIWA 1Y6AA 4BHZA 5IISA 3RINA 3CD8A 4L44A 3SG8A 4EOOA 4PMTA 4EKLA 3NNUA 4X7QA 2RFSA 3R9DA 2UUEA 1FVVA 2VTPA 3D0EA 4MTAA 4N6ZA 3WBLA 4Z9LA 2XNOA 4LOQA 3ID6C 3FMMA 4RGJA 4D0WA 1UNGA 3DQXA 2FSMX 3NUYA 2GNHA 3UMXA 3E62A 2B1PA 3DXNA 5IQAA 2OSCA 3QD3A 4I6BA 4FT5A 2UVYA 2A27A 3SXSA 4IVDA 5EHLA 4ANNA 5J1VA 4XG8A 3QUDA 4H3PA 4F7LA 4BY9E 1Q3DA 3GXLA 1VJYA 3VS7A 1LP4A 4MNFA 5AA8A 3MW1A 4MNEA 1ZWSA 4O0YA 4UALA 1Q8UA 3CPBA 4CRSA 3A99A 5L3AA 4CT2A 2QVSE 1Z5MA 2ZV2A 3FSFA 4F4PA 5IA4A 3UDZA 2DYLA 4FKRA 4ALUA 4QP9A 1XH4A 4R77A 5BVOA 3V6SA 2JKMA 4FK3A 3UQGA 1UWHA 2FSLX 3UO6A 1Q24A 3MI9A 2W99B 4F65A 4FSUA 4ACGA 4F9WA 2VWXA 2CKQA 4KABA 5I3OA 2GHGA 3CE3A 2C6KA 3LFSA 2OH0E 4RSSA 4D55A 2OK1A 3VF8A 3MBLA 1OITA 5IPJA 3QKKA 4FKGA 1I44A 4X3FC 4P5QA 1TQPA 4C36A 5AJQA 4YJVA 3FMEA 2X4ZA 3RPVA 2PPQA 4TWPA 2HK5A 5HBEA 1JBPE 2GNGA 1JAMA 3VBWA 1QPEA 4M0YA 2ITPA 4FOCA 3R2YA 1FGKA 3LVPA 5HIDA 3N4VA 3ZS5A 4ANSA 2ITNA 4AG8A 5F95A 4TYHA 2ZV7A 3QCQA 3T8OA 3VBTA 3FLQA 5KKRC 3VONA 4O4DA 3BEGA 4FGBA 5CEIA 1H26A 2B52A 4CG8A 1KWPA 5DFPA 3OBJA 4TYIA 5KBQA 2BALA 4IC7A 5KMMA 5TKDA 2J0IA 4AXFA 3ACJA 3K54A 2UZTA 1G8KA 4EHVA 2QI8A 3ORKA 2WXVA 5DG5A 2C6EA 4FKUA 3FUPA 4FEQA 5AM7A 4R8QA 4U0IA 4DGLC 3GCVA 4NM0A 5CSPA 2NNWB 4L7SA 3ZBXA 1OL6A 2R3MA 1ZMVA 2LAVA 2WU7A 4K77A 3DA6A 3OUKA 4DBXA 4FEVA 4AZEA 4HVIA 2G9XA 4JMQA 2IF8A 2YM4A 2ZMCA 4NUSA 5CU4A 2XK6A 3IW8A 3HZTA 2IO6A 3UQCA 5AR8A 3HV3A 1RDQE 4XBRA 4YZBA 3Q4TA 5M57A 4DTKA 4CCUA 4ZTSA 4X2JA 4A4LA 1Q99A 4LOPA 3HKOA 3ZM9A 4X2NA 4CLJA 4XCUA 5I3RA 3DT1A 5J1WA 4TZRA 2Q83A 5CY3A 1DI8A 2WMQA 2GNJA 3E3BX 2DUVA 3MH2A 3R6XA 4AGWA 2VRXA 4PF4A 3ZFMA 4KS8A 4OW8A 5DMZA 4G34A 4GJ3A 4J8MA 4RZVA 3R7EA 3FI3A 4ZK5A 2WTVA 3GOKA 1Y8GA 4FBXA 2RFDA 3LW0A 3U4UA 1ZZLA 4PDYA 3PIXA 1KOAA 5DE2A 3TNPC 4UYNA 3ZLSA 2WQNA 2JEDA 4RWLA 2BZHB 4M14A 4QP4A 2VWWA 4OT6A 4U42A 3A60A 3VIDA 5CASA 2RF9A 1WBOA 3OP5A 4C2VA 4DGMA 1K3AA 4AA4A 2UZUE 4KKEA 3T3VA 1M14A 2XCHA 3OY3A 2UW7A 3TNHA 3VS0A 5HX8A 2HCKA 5EW3A 4E6DA 1JOWB 3PY0A 4I24A 4PP7A 2OZAB 3UJGA 2Y6MA 4PRJA 5C8NA 3CKXA 3R8MA 3E63A 1QCFA 5HTBA 4UWBA 4EL9A 5M4FA 4JL9A 3VW8A 4DITA 2QC6A 4YR8A 3FMLA 4MD9E 4YTHA 3UG1A 1OM1A 3ZUVA 3R01A 4DFUA 5IH4A 1GAGA 5HTCA 3PSBA 4I4EA 3QALE 3O8PA 4DEGA 3FL5A 3MH0A 4GFMA 2BDFA 4HVHA 4Y95A 2VWYA 4EOKA 2VTLA 4V0GA 3NEWA 3ZOSA 4LG4A 4NTSA 2W1IA 4BTMA 4G31A 4UEUA 3T9TA 1J91A 4J99A 4DLIA 3FKOA 2R3JA 3U54A 4ONAA 4R3RA 1SVHA 2XH5A 4GT3A 2YWVA 3LLAA 2VGPA 3TTJA 5IU2A 5HE3A 1IRKA 1ZRZA 1GIIA 4L01A 3ATSA 4X2KA 3CBLA 1YDRE 1STCE 3D2IA 3OG7A 4I23A 5DR6A 3ZO4A 1A06A 4C62A 4FSQA 3AC8A 2QOLA 2QQ7A 4QQCA 3II5A 3SC1A 3BRBA 4IMYA 3V3VA 4AOIA 4LGGA 3KCFA 4KWPA 4Y8DA 4AE9A 5DI1A 4XS2A 3I5ZA 4FTIA 1YDSE 4RLLA 4BIBA 4ASDA 5AAGA 4XOZA 5FDPA 3MGYA 4DH8A 2HW7A 3SV0A 4O7VA 4BB4A 4F09A 4G9RA 3D94A 2GTMA 4FSNA 3W2PA 1O6LA 3LJ2A 3NMUF 4F0GA 5IDPA 5AUUA 4E6QA 2C69A 4MK0A 2A4LA 3QTRA 1XWSA 4R1YA 4QMXA 4BBFA 3W0PA 3BYMA 5JFWA 5E1EA 5GZ8A 5L2WA 3P9JA 3QA0A 3TIZA 2XNNA 3HMOA 2A2AA 4FV6A 5CT7A 3W1FA 5CSXA 4CG9A 3LKMA 4PPCA 4DE4A 2WELA 3GP0A 4EH3A 2QO2A 1G8AA 3ORPA 5K4IA 4BN1A 2YIQA 3C0HA 2IPXA 3KK9A 5EYDA 1PXJA 2VN9A 3BX5A 2O8YA 2J7TA 2R3IA 4YP8A 3EQIA 3F7WA 2O3PA 2YDJA 3OBGA 5H3QA 3OEZA 4ASXA 4WSQA 4AQCA 3BWJA 4FTAA 1QPJA 2CHLA 5IQCA 2ESMA 2R3KA 5CU2A 2AC5A 3LCSA 4O81A 3IK3A 4XHKB 4FSRA 4U8ZA 2W5BA 2WTJA 5CU0A 3ZONA 4V05A 5E8VA 4L8MA 5HGIA 4ALWA 5CTPA 2X2MA 2DQ7X 4BDGA 4FRFA 4L67A 4DG0E 2AC3A 3UDBA 2VNYA 2J50A 3W33A 3FQHA 3WI6A 4EH9A 4I41A 1R78A 4GCJA 4TYGA 2ACXA 4X0MA 3MDYA 4D9TA 3V8SA 3KREA 2WU6A 3FL4A 5LWMA 5K9IA 2BIYA 2Y7JA 4OAVB 2IVVA 4O0WA 3KC3A 4ZZOA 3AC4A 4QMLA 2RIOA 1RQQA 4FNZA 4IM0A 4KA3A 4M84A 3DJ6A 4IZYA 4MQ2A 2XB7A 1URCA 5DBXA 3SXRA 3SOAA 2BFXA 4TWNA 2X0OA 2PE1A 4FZ6A 4PDPA 5J95A 4QRCA 4TYEA 4U40A 4BR3A 1RJBA 2ONLA 1XBBA 3U6IA 5HI2A 3VRYA 4CFUA 3VJOA 1V0BA 2CGVA 3D7TA 1HCKA 4QPAA 3A4PA 3LXPA 3FC1X 4PQNA 3UZTA 3QTSA 5HORA 4NFNA 4IQ6A 4OR5A 3Q4UA 4RJ5A 1ZOHA 3MH1A 2C3JA 5A3XA 3NYOA 3Q4ZA 3WZJA 4F0IA 3LMHA 3ENHA 3ORXA 2YAAA 2IJMA 1U54A 1H00A 5BQ0A 3NCZA 4J95A 5A9UA 4F9AA 1OIYA 5A6NA 2YABA 4MQ1A 2Z8CA 4BFMA 3P79A 2VTHA 1I09A 3H9FA 2PVRA 3FLYA 3C0IA 4FT0A 3WE8A 4DHIB 3UOLA 4D4SA 4QD6A 4Z16A 4NKSA 3KXZA 3MTLA 5I9UA 4EOJA 4QTAA 5AP7A 5CEMA 3KRWA 5JZJA 3ORZA 5EI2A 4YNEA 4YHFA 3NUAA 3FLSA 2P2IA 3F5PA 2JKKA 1CMKE 3FV8A 4O7ZA 3I81A 2BZKB 2FVDA 3LHJA 4O0SA 4TY1A 3MTFA 4WT6A 2H8HA 1R0EA 3LM0A 3EQPA 1XKKA 3CJGA 5A4CA 4P90A 3NVMB 3UIBA 4C58A 4YZCA 5JN2A 4LGHA 5HLPA 3HNGA 3O7LD 3PVWA 1BMKA 1PMEA 3WF6A 1M17A 4R1VA 2WOUA 3TUBA 3A61A 2IW6A 1J1BA 4HCTA 4F1TA 4YJRA 5CVFA 2QLQA 5JK3A 5DR2A 3UTOA 5M4IA 4KS7A 4EH7A 3Q96A 2P2HA 5AX3A 1GOLA 3G9LX 3H3CA 3LMIA 5CSVA 5L8KA 2VO7A 3B2TA 4XG9A 4WIHA 5AMNA 4EJNA 4BIEA 4A06A 4G2FA 5LQFA 1NY3A 2A98A 2J0JA 3LCTA 4QMWA 4W8DA 3R9NA 3TZMA 4BCFA 2BZJA 3LFQA 1VZOA 3QX2A 5K0KA 2AYPA 4CQGA 4DEAA 4O7LA 1F5QA 4USEA 5BPYA 5KMKA 2OGVA 4CFNA 4C2WA 3PSCA 3PSDA 4Y85A 4ACCA 3E8NA 2CKEA 4KRCA 3KXXA 5J5SA 3GU8A 5D41A 2C5OA 3E8DA 3TI1A 3TZ8A 3TMOA 1H8FA 3HAMA 3HP5A 4CYIA 4KIOA 1XH8A 4O0XA 4FL2A 4YC6A 3R8VA 2ZMDA 1YXXA 3WOWA 4NIFA 3NUUA 5EM5A 3LFAA 3E93A 3MN3A 4PTEA 5JSMA 3TUDA 3EHAA 4I5HA 4NU1A 4NZWB 3VUDA 1BL6A 1FMKA 1UA2A 4IDTA 1V1KA 5LWNA 4IC8A 3TDVA 1H1SA 3E8CA 2R3FA 2OJGA 5C01A 3OTUA 2JDSA 3TV6A 3BE2A 4UBAA 5IMEA 1QPDA 1T46A 2EB2A 3DPKA 4FC0A 2XCKA 4RJ3A 3WF8A 4M3QA 2WZJA 4DEIA 5HIEA 5KNJA 2H9VA 1OL7A 3ULZA 3PUPA 2OJ9A 2EU9A 5AAFA 1PXLA 2VNWA 3CTJA 2YACA 3N51A 3Q6UA 3ELJA 3G33A 3OOGA 5KMJA 1REJA 1CKJA 1WVWA 3R7YA 3V5JA 2VAGA 4F6WA 4ZMFA 1E9HA 4BCNA 5CF6A 3AT3A 3EL7A 3VO3A 4D0XA 1A9UA 4Q5HA 1W2FA 4EK3A 4HNFA 2J9MA 4MEDA 4XG3A 4EH6A 4BDFA 5IQFA 3DV3A 5HCZA 4RJ7A 5TOZA 4C0TA 4LV5A 5E4HA 4BZOA 2CDZA 3H0ZA 5EDRA 4JG6A 3ZZWA 4QTCA 4C4GA 4CTBA 1BUHA 3CQWA 4D58A 4TPTA 5CVGA 3R1YA 2WTIA 4XOYA 4G6OA 4U45A 3QC4A 5CS6A 4N6YA 4D28A 5KHWA 3P7BA 3WYXA 1UNHA 2JIVA 4LRMA 4A4XA 3FXWA 1Q41A 5HD4A 2XEZA 2Y4PA 4FG7A 3ATTA 3FI4A 3BYVA 1LR4A 2BTRA 4NEUA 4O1PA 4ANBA 5I9YA 4JOAA 3VULA 1ZMWA 3LXLA 2J6MA 2WMUA 4PL4A 4IWQA 3EFJA 1P4OA 1OPJA 4FVQA 3CC6A 3DGKA 5HG5A 3A8XA 2WTWA 4UV0A 3B2WA 3F66A 3F61A 3FXXA 1JSUA 4UXLA 2DWBA 2P0CA 1H27A 1XBAA 3EL8A 4QMPA 1NT2A 4FTMA 1S9IA 2E9UA 2IVUA 4LV8A 1YXTA 1ZYDA 4BI2A 3EFLA 3AC5A 4ALVA 4PTGA 3O51A 2SRCA 3QRKA 1VYWA 4A9TA 2R5TA 3ANRA 3E8EA 4TWCA 3UNKA 1QPCA 3MPMA 4EK5A 4X6QC 2I0VA 5FWKK 3R30A 3Q9WA 1OUKA 3O0GA 4AS0A 4RZWA 5T3QA 2WNTA 4G3CA 3U87A 3JVSA 5JH6A 4E4XA 2XNGA 5LMKA 4RVKA 5AWMA 4JG7A 2GFSA 2YFXA 2RFNA 5CYIA 4RMZA 5M56A 1FMOE 1LEZA 4F7SA 4JRVA 3Q9XA 4FICA 3HUCA 5A4EA 2XAMA 2X6EA 5LCJA 4CFVA 4Z7HA 4OBOA 3WZUA 4L3JA 4F08A 4GYIA 2HWOA 3LMGA 3TG1A 3QYZA 3ZM4A 3DU8A 3I1AA 4B4LA 4C34A 2QOCA 4FSYA 3R73A 2FA2A 5L6WL 4CKJA 3F3VA 4RLKA 4D1SA 3LM5A 4Q9ZA 1DS5A 5K3YA 3DQWA 4ZTQA 2BCJA 4FKPA 4MBJA 2XM8A 4TNDA 5GZ9A 4IWPA 4K6ZA 3RZBA 3TXOA 3ZO2A 3MY0A 4BCIA 4J53A 3PJ8A 2IVSA 3CKWA 1APME 4W9WA 5HESA 3TDWA 3MYGA 1K9AA 4USDA 4AOJA 3S4QA 3A7JA 4EK4A 4ZZNA 3PG1A 3TZ9A 4B0GA 5CEPA 2JGZA 3LFNA 4JVGA 4NCTA 5GINE 1NVRA 4AA0A 3V51A 4AXDA 1OVEA 2UZWE 1JKTA 2E9VA 4JR7A 5J87A 3F7ZA 3C5IA 3AMAA 1JKKA 5HVJA 3PA5A 2B4SB 3B8QA 4WG5A 3QKMA 4OGRA 3OHTA 4YJSA 4AWIA 4L6QA 2UZVA 4L45A 4MAOA 5M07A 5DHJA 3GFEA 3BV2A 4GK2A 4BCMA 5DYJA 4WNPA 4ZJJA 3IGOA 5L6OA 4AW2A 4KIKA 4EYJA 2WQEA 2OXXA 2XIKA 2JDTA 5AX9A 2QODA 4A9SA 4EH8A 2YEXA 2J51A 3LCDA 3VBYA 4AW1A 3W0NA 2W1CA 3TNWA 3KMWA 4FTNA 3GT8A 3PXQA 2IZUA 3VW6A 2YCRA 3K3IA 4DN5A 3BLAA 4U97A 5BUIA 3UBDA 1J7LA 3D5VA 2PMIA 4OTPA 2YJRA 3D5XA 3TJCA 3W8LA 4CMTA 3OUNB 2Z02A 2UW9A 1Y91A 3AC3A 4I0RA 2PY3A 4IW0A 4RT7A 3BGZA 3OS3A 4EEVA 5TF9A 4EOLA 2CLQA 4JDKA 5E90A 2W06A 2QNJA 3ZMMA 2IVTA 3NW5A 3QKLA 3PXYA 3L8PA 5J8IA 3HL7A 4YLKA 4HCUA 1XR1A 4CQEA 2JBPA 3U51A 2ZB0A 5CNNA 5B2KA 2NRYA 4CMUA 2A0CX 2OO8X 2VTTA 4QTEA 1A48A 4O86A 3DXPA 3SW4A 2ZVAA 5E1SA 3ZZEA 3NUNA 3PFYA 5HG7A 3PY3A 4B99A 2JFLA 3I7BA 5GIOE 4KKGA 3SQQA 4BBMA 5IMXA 3CIKA 3DY7A 1KOBA 4L00A 3BLHA 5CAUA 3ZRMA 5M4UA 3O23A 4ZSGA 2BILB 4DHFA 5CXZA 5KMOA 4BDHA 3IW6A 3Q32A 4X3FA 4ZJIA 2BDJA 4FKIA 4CRLA 2IG7A 4DDGA 2WEVA 3FZPA 3LAUA 2I0EA 4FZAB 1PMNA 3R7OA 5CXHA 4C8BA 2B0QA 5BV3A 1H07A 2X8DA 3P23A 2BR1A 3TKHA 1R39A 4MXXA 4C59A 2BKZA 3JVRA 2IZSA 4XP3A 2I7QA 5IQIA 3IPHA 2W1HA 4I0TA 1UNLA 5J9ZA 5EG3A 2W05A 4IB0A 4JQ8A 4BGGA 3RPOA 5C8MA 2PL0A 5EHYA 5HKMA 4EH2A 5J9YA 1YDTE 2OBJA 2ZDUA 3H9RA 2FUMA 3ZFXA 2V7AA 3EYGA 4IAIA 2PK9A 3HDNA 3K2LA 3ML1A 2OIQA 4B6LA 5M55A 2NRUA 3ALNA 3NGAA 5BYZA 2YIRA 2A19B 2BZIB 4JX7A 4RRVA 3CD3A 3ZRLA 3PJ1A 4FF8A 4FV7A 5A6OA 3GBZA 4EK6A 4GFOA 4AZVA 1OUYA 4XNEA 3CP9A 1LUFA 4Y46A 2XK3A 2B9HA 1PJKA 1GZKA 2WMRA 4MXZA 4F1OA 2HELA 5FM2A 4TN6A 1HCLA 4I93A 3QD2B 3AXWA 1UU9A 2FGIA 2V5QA 3BCEA 2XIXA 3IW7A 4I5MA 5AIKA 5KCVA 4MNEB 2E9OA 3E88A 3MV5A 4O4CA 1TZDA 4W4YA 4D2PA 4DFZE 5JMSA 5LOHA 5FEDA 3UIMA 5L2SA 2NPQA 2PE2A 2QO9A 3VRZA 4ZLOA 4FUXA 1KE6A 3EQBA 4H39A 4QYFA 3ZLXA 3TZ7A 1IEPA 2OH4A 1PXOA 3O5AA 1H01A 3F69A 4JBVA 1EH4A 3QD4A 4D2RA 3LQ5A 1MQ4A 1XHAA 2C6LA 4A7CA 2Y9QA 2BRMA 4MXOA 1CDKA 2XKCA 4YJUA 4N0SA 3K3JA 1KE8A 2G15A 3VUIA 1YXSA 1CKIA 4G9CA 2EUFB 4RFYA 5ANEA 4ANMA 2X2LA 3FZRA 3PY1A 3UNJA 2XMYA 4DFLA 1RE8A 4YC3A 3NCGA 4S32A 1V0OA 1W0XC 2VWBA 2BAJA 5HIBA 2C6TA 1OZ1A 5D7AA 4II5A 3I4BA 4HW7A 4E5BA 4MUQA 3VC4A 3R7VA 2F7EE 3EN5A 5DRDA 4GL9A 2R0IA 4M15A 1G3NA 4YSMA 3GFWA 5DEWA 3MPAA 4WNKA 3QTIA 4QP2A 5M06A 5DGZA 4IXPA 2C30A 3LLTA 4TYHB 2C47A 2R3HA 4EZ5A 5EQYA 4XP0A 2HY0A 2HENA 4XV2A 4FEUA 2YM3A 1OPLA 2UW0A 2CNUA 4BC6A 4RJ8A 2EVAA 3EYHA 4O7RA 3POZA 5HHWA 3Q3BA 4AAAA 3O71A 3OW3A 5CI7A 2PTKA 1P4FA 2W4OA 5E8YA 2PZYA 3ZDIA 4ASEA 1R3CA 4AOTA 2ITVA 4Y5QA 2Y4IB 4QP3A 5HBHA 2BUJA 1R0PA 3UIXA 1OB3A 2OICA 4G3GA 3DJ5A 4RIYA 1JKLA 1WBPA 5M53A 4HVSA 2PYWA 3VUTA 3NUSA 4CTCA 4QMSA 1JLUE 3OCBA 3OCSA 5F94A 5G1XA 3DZOA 3NNVA 3QUEA 4GH2A 3W2RA 3CQEA 3FI2A 4NM7A 4EONA 2G1TA 4ZP5A 4H36A 3M1SA 2X8EA 4YJPA 5TE0A 3BLQA 4P2KA 2JITA 1GJOA 3F82A 3BWFA 1W98A 4IFGA 5KBRA 4E6CA 3ULIA 4E93A 5A46A 4JQEA 1MRYA 4HYHA 4Y73A 2R4BA 2W5AA 4ZXTA 4FTOA 3R8PA 4I5CA 4GRBA 4GS6A 3R7GA 1BL7A 1PHKA 3HV6A 3ODZX 4WNMA 3F5XA 3RM7A 4IB5A 2P3GX 5JRSA 4AACA 3NIZA 4BJJA 3FYJX 2P55A 5H8GA 3QYWA 1OPKA 2PZ5A 3PXFA 2BROA 2ITYA 4IFCA 3DFCB 5AR4A 3RCDA 3VNTA 3ZEWA 4TXCA 4WHZA 4D4YA 1PXNA 3VUGA 4AE6A 3IO7A 4RIWA 4CCBA 3FMKA 2PVJA 1WBWA 3VWAA 3ZSIA 2WTKB 3QQLA 3RJCA 3BYOA 3DB6A 3OXZA 3LOKA 3QRTA 3OCTA 2F2CB 4CT1A 2BRNA 4HPTE 4M7IA 4ASZA 2JDVA 4M69A 3C7QA 1H1RA 2J5FA 4IAKA 1ND4A 3GU6A 3W2OA 4XX9A 4EOPA 4EHEA 4IB3A 3FI8A 3KXMA 3C4XA 4I6QA 4JIKA 3KIOC 4HYSA 1CM8A 1M52A 2C0IA 4L3PA 2C0OA 4BGQA 5C1QB 3PLAE 5JFVA 1SVGA 3IONA 4S33A 4MYGA 3LCKA 4XLVA 4EK8A 5EH0A 3M2WA 5ANGA 4UWCA 3CSVA 4ARKA 3F5UA 4E4LA 1W82A 3NYVA 3BHUA 5F4NA 4FVRA 3OWPA 2IW8A 1L8TA 3LFCA 5A14A 3MH3A 4O96A 3AMBA 5AEPA 4B7TA 4L7FA 3IGGA 4RFMA 4V0GB 3RAKA 3FBVA 1MQBA 1B6CB 4PX6A 2VWIA 5CVHA 5AUXA 3RM6A 1XMLA 3HMMA 4AX8A 4KINA 2CN8A 5L2QA 1PMVA 3PZEA 5FTOA 3NYNA 2HZ4A 2E9PA 3VUHA 2BFYA 4GJ2A 4XG4A 5FBOA 1PY5A 2O63A 3PJ3A 4O84A 3AMYA 1TKIA 3DXQA 5CAPA 3I60A 1PW2A 2UZBA 3FC2A 2CPKE 3UYTA 2PVHA 1QL6A 3EKNA 4HOKA 1ZXEA 4DINA 4DFNA 2B55A 3SG9A 4FV4A 2XIYA 3G90X 3IECA 2JDOA 4RC3A 4O6LA 5JQ8A 3E64A 4QMNA 4DHZA 5M08A 5KMIA 3TV4A 1FGIA 3BZ3A 3QRIA 4E8AA 4O7YA 2JC6A 3DFAA 5ICPA 4K2RA 5HZNA 4GIIA 4UWYA 3NX8A 3FQEA 3K5UA 2JIUA 2WD1A 5BVKA 2HZIA 2XKFA 2WGJA 5I9XA 3BLRA 3ORLA 3FYKX 4EWHA 2GNFA 4HGLA 3QQGA 4YBKA 4DFXE 1J7IA 1TQIA 3GCPA 2X7GA 3ZC5A 2ZOQA 5JZNA 3GU7A