2WQYB

Remodelling of carboxin binding to the q-site of avian respiratory complex ii
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
239
Chain Sequence
TSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Remodelling of Carboxin Binding to the Q-Site of Avian Respiratory Complex II
rcsb
molecule tags Oxidoreductase
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
total genus 69
structure length 239
sequence length 239
chains with identical sequence O
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wqyB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wqyB01
2WLBA 1E6EB 1FFUA 2OHFA 2L83A 4C7ZA 2W3RA 3WCQA 4ZHPA 1RM6C 1JW9D 1DGJA 1FRDA 1GTHA 2QIEB 1QOBA 2PVGC 4WQMA 2H89B 2PVOD 1SIJA 2KMMA 3AE9B 2H88B 1E0ZA 2CJOA 1AYFA 1J7AA 3W9CB 2B76B 3SFEB 3B2FA 1JRPA 1ZOYB 3ETRA 2WDVB 3AEFB 4YSZB 3AEGB 2E3TA 4JWUC 2G1EA 3VRBB 4YTMB 2JX5A 3AN1A 3P4PB 2M19A 3P63A 5EE9A 3P4RB 1GPXA 3L4PA 1SF0A 3AB5A 5EE0A 2W55A 1WYGA 4JWSC 5EE1A 4KX6B 1N5XA 2JQRB 1R7SA 1FIQA 5G5GA 1RFKA 2M56B 3P4SB 1J7CA 1KRHA 3AMZA 3LXFA 1T3QA 3W5UB 1KF6B 1JALA 2MH7A 1H7XA 4C7YA 1PUTA 1QT9A 2W54A 2PKOA 2DBYA 1FM0D 1WWTA 2FBWB 3AE1B 3NVZA 1FFVA 1L6UA 1NENB 4YSXB 2EKIA 3AEBB 3AEAB 2Y5CA 3DWGC 3NVWA 1FXIA 1YJIA 3HUIA 1KFYB 2WDRB 4JX1C 2BS3B 2QJLA 2ACZB 2DWQA 1YQ3B 1H7WA 3AEEB 1F0ZA 4YT0B 1FMAD 3VR8B 2K5PA 1DOYA 1E7PB 1FXAA 1JROA 1L5PA 1XO3A 3VRAB 2WDQB 3FAHA 3HRDD 3HVZA 1ZUD2 1XLOA 1GT8A 2WP9B 1XLQA 2K9XA 3B9JA 1UWMA 1OFFA 1QF6A 1TKEA 2K22A 4WWMA 2PIAA 1VLBA 4YTPB 3AE2B 2WS3B 5MPOA 1E9MA 1YQ4B 4P6VF 4A9AA 3EUB2 4HRSA 3AE3B 5C2TB 1CJEA 1WGKA 2AX5A 4YTNB 1L6VA 1I7HA 1RYJA 1TKGA 3P4QB 5EE3A 2L52A 3RPFC 3AEDB 2MJ3A 1DOIA 1NVID 3DWMA 2N0SB 2WU2B 4N58A 4ITKA 3VR9B 4ZOHC 1J7BA 1NYRA 5H92C 2BT6A 1TJEA 4N6EB 1WRIA 3NRZA 1N60A 4YXDB 1QLBB 3AE4B 1N5WA 4YSYB 1N62A 1XLPA 1YJJA 2WU5B 1FRRA 2HTME 2LEKA 3FC4A 1ZP0B 3SR6A 3AE8B 1QOAA 4US9A 5H8YE 3CF4A 4C80A 3ABVB 1ROEA 3LB8C 4N59A 1V8CA 1E10A 1GTEA 1RWSA 1L0VB 1SB3C 1NEKB 1XLNA 1ZXIA 2MJDA 5AUIA 1JWAD 3AE5B 1JWBD 3PO0A 2CU3A 3P1MA 2W3SA 1TKYA 5GXGB 2WQYB 3SFDB 1NYQA 2CJNA 3NVVA 1PDXA 3B2GA 3NVYA 1A70A 4HROA 4LTUA 4US8A 1N61A 3AECB 1JQ4A 2MJEA 1OQRA 2BS4B 2BS2B 3CIRB 2KAJA 5C3JB 1QOFA 1IUEA 4USAA 3AM9A 4IDIA 2Q5WD 1N63A 3NS1A 3AE6B 1GAQB 1WXQA 1VJKA 1B9RA 1TYGB 3AE7B 1OQQA 3AV8A 5G5HA 1PFDA 1QOGA 3ZYYX 1AWDA 3BIID 1CZPA 4ZHOA 1FO4A 1V97A 1DOXA 1NI3A 3KWLA 3W5VB 1VDVA 3AH7A 5AUKA 1EWYC 4FXCA 3CWIA
chains in the Genus database with same CATH superfamily
4ZHPA 4GMVA 1GTHA 1TGZB 4MGZE 2ZNVB 4RNAA 4ASWC 2H88B 3RYTA 4KSKC 2UU7A 3ZDMC 3P4PB 4GIVA 1GPXA 1M94A 4K3CA 2JQRB 1UGJA 3LXFA 2KWVB 5JXVA 1H7XA 3DHIC 2LGIA 3NUHB 3TEWA 3HIZA 1LM8B 3PPAA 5C1ZA 3AE1B 2NS5A 2EKIA 3NVWA 3TUOA 1OTRB 2L76A 1KFYB 5CHVC 1FXAA 3PLUA 2AQ2B 1P0RA 1C3TA 2LD9A 1DYQA 2J0KA 5C2TB 2Y3AA 1I7HA 2KXJA 3SD5A 4Q2JA 1NYRA 2KMAA 2SAKA 1TJEA 4IM2A 1V86A 1WRIA 5AZFA 4FADA 2KJ6A 3ZDTA 3ML9A 2LRUA 1ZP0B 1WGGA 2IO0B 2LXAA 4LCDE 1QOAA 3V3XA 3DBRI 2KANA 3ZNZB 4GB9A 2DZMA 4E3CA 1NYQA 3B2GA 4K3BA 1QKZA 3L08A 4GSWA 3L10B 3AM9A 1PFDA 4PYUA 3BIID 5D3DA 1MG4A 2J0JA 1DOXA 2WXLA 1OQYA 2MRPA 2A4ZA 3WCQA 1VZ7A 1WZ0A 4HVBA 4OVUA 1SGHA 3MC8A 4L23A 2RPQA 2IZVB 1GC7A 5TSSA 4C56C 4PK1A 1I4HA 4F8CB 2ON8A 1C9FA 3WAPA 1V9JA 4M02A 5AZHA 3DBLB 5BYSA 1UELA 4YWGG 1C76A 2SEBD 3ZRCA 1J7CA 1YJ1A 3ZQ4A 2W9NA 3AU5A 3H7PB 1Q1OA 5IO9A 2I38A 2DBYA 1FM0D 2CKHB 5AEKB 3PV1A 3VH3B 3DHGC 2GMIC 2BS3B 1YX6B 2RSUA 5J2RA 2NTSA 2N1WA 1BT0A 2K22A 3FKYA 3AXCA 4XYCA 3KW5B 4DK5A 1WGKA 1OEYA 1B1ZA 3I5JC 3PHWB 2K0PA 2JF5A 1L4DB 2KK8A 4DDGD 3VR9B 3L13A 4G11A 5FR6A 5LNK1 4E71A 2XNAC 4W9GA 2M0AA 1WXAA 1FD6A 2LMCA 3H8HA 1C79A 1ZDXA 2I1JA 1IPGA 3ABVB 1YN5A 5D7GA 4WQOB 1KM7A 4H2AA 3I63C 2KHWB 1ACCA 3Q8AA 2X38A 3QAQA 2N9EB 4DHZB 3A4SC 1JQ4A 1LFDA 3PREA 4TQ1A 5E6JA 1WXQA 4XWTA 3AV8A 4JLCA 2RDGA 3RUIB 4MGIE 2N7JA 1NI3A 2L3ZA 5D6JB 3VQIA 2DHZA 2I1KA 2L83A 4NAMA 3TL5A 2M0XA 3T3NA 3BWUD 1DGJA 1JWUD 3DBHI 2QIEB 4NZLB 5JH5C 2KFJA 4ARCA 4P7IA 4WQMA 2QCZA 2O6VB 3EFCA 1SIJA 1C4CA 3W1SC 2XBBC 4A3PA 1UBQA 3K9OB 1J7AA 2B76B 1WF9A 2LVOA 3QWZB 2BGFA 1WZ3A 5DCNA 1VD2A 1Y56A 1V6EA 1G6JA 4GU2A 2KTRB 1N5XA 1IGCA 2JWZA 5D2MB 4NY0A 3QX1A 1C4PA 2W54A 4MT5A 1NENB 1FXIA 1CQVA 2K6QA 4LNOA 1XO3A 3BYYB 2RDBC 4OZAA 5D3IB 1K53A 2MJ3A 4B6WA 4N58A 3KLSX 1TS3A 2LXCA 4OVZA 2KZRA 2JXTA 1R4NI 1N62A 5FR3A 2INCC 3DDCB 1WI0A 2I2YA 2K25A 4HCPB 4OHJA 4BOZB 2KD0A 3PRPB 2N9LA 2FUHB 1V8CA 1GTEA 2L32A 1ZXIA 1KJTA 2GRIA 5AZGA 3NVYA 4LNFA 1V80A 4XWWA 3MJ5A 1ZXHA 1OQRA 2BPSA 5IA7A 3NS1A 4J6IA 2MP2A 4WWOA 2JRIB 1CZPA 3SEBA 4URKA 3C19A 4MEMA 5D94A 4P1BC 2BVCA 3ALBA 3DCGA 1VDVA 2DYMA 3RD2A 1EWYC 4EZLA 2OHFA 1MPEA 3BINA 3MC9A 4CO7A 2M17A 1Q5WB 2DYOA 2DAFA 1HQRD 1GUAB 3SFEB 1WE6A 3GE3C 5CX3A 3M62B 3ZO5B 2J52A 4IM0A 4DXGA 2OOBB 3L4PA 4HPLB 5EE1A 1TY2A 1KRHA 5IAAC 3DBSA 2ZCCA 3KQ4A 3N1YC 2PKOA 3SHQA 1YJIA 3V61A 2AYOB 3A1QB 1F0ZA 4DHJB 2WP9B 4ANWA 4WURA 4AUQC 4A55A 1V5OA 1HEZE 3VDZA 5EE3A 3IAM1 4W9FA 2N0SB 2WWZA 2K6DB 2BW2A 1TIFA 2OJRA 3APDA 3Q3NC 3RNBC 1I42A 1WFYA 1T0RC 4J3OD 3DPDA 3KUCB 5H8YE 3CF4A 4IKGA 5CHWA 3H7PA 1L0VB 2OJWA 5G55A 2MBOA 1A70A 2WHIA 4ANVA 4NJCA 4HPPA 1WJ6A 3AE6B 2AQ3B 4KV2A 1XF5L 4ZRJA 3KWVA 3ZGZA 2WXNA 3PT2B 4M00A 1LO5D 2V3PA 3NZSA 2KX0A 1HTQA 2KT7A 2HJ1A 4DHJD 1ZOYB 2Z8LA 2WDVB 1MG8A 4M0WA 4FLHA 3IT4B 2M19A 4K7WA 4AQ7A 4FJYA 3JSVA 3W5UB 3CF6E 2NBWB 1WR1A 2LGXA 1E8YA 1K8RB 1QT9A 2MX2A 4S0RA 3KUDB 3DWGC 2KC2A 2MHJA 1N6ZA 1I4RA 2LUEA 4I6NB 4MJSA 3IG3A 3VFKA 4DQOC 4DXFA 4RH6A 3OLMD 4WWPA 2TSSA 2CS4A 4M01A 1CJEA 1GC6A 3N9YC 5BO4B 3U7ZA 3GS2A 2N4FA 2GOWA 4KZCA 3GE8C 3RCZA 2LWPA 3O65B 3N32A 3AI5A 3R7QA 2KJHB 2WXIA 1XLPA 1EF5A 2BB6A 2V3SA 3TEZA 1E5WA 2BYTA 2PJHA 1E10A 2WYQA 4GDLB 2R2OA 3N20C 2L7RA 4RGOS 3W2DA 2WQYB 4RGTA 3A9JA 4PS8A 2MJEA 2KAJA 5C3JB 3FILA 4XDCA 3BZDB 4N9F4 4C4VA 1AWDA 1RFAA 3JW0X 4PS3A 2EMSA 3A33B 3H1UA 2QHOA 1SE9A 4X57B 3A1QA 4OW0A 5IOIA 1SEBD 1T5XD 4DXAB 2KN4A 1KLVA 3U52E 3H6NA 4JQWC 4DWFA 2MLBA 2G9HD 2QMTA 2K1FA 2XEWA 1KOTA 1J0GA 3AEFB 4YTMB 3ZTDA 4FA6A 2CR5A 5EE9A 3KH0A 3AB5A 1WYGA 4KX6B 3BVZA 1FIQA 2J4XA 2LASA 1UZXB 1X1MA 1UH6A 3K9PB 2LJ5A 4BAXA 2INPE 3HUIA 4WH4A 1FNWA 2FCNA 2NTTA 4G50A 3HHMA 2V4IB 2DLBA 1GT8A 3TIXA 2ICIA 1VLBA 4P6VF 1YQ4B 3TEYA 2REXA 4HRSA 1SBBB 3CMMB 4EE2A 3Q8CA 4W9LA 4UDUC 3Q8FA 3HM6X 3E9SA 1KLUD 5HHDG 1RRBA 4KDIC 5HFYA 4YSYB 3ZJTA 2JWUA 3FC4A 3SR6A 4LJOB 2YVCA 1SB3C 1Q10A 3GP7A 2ZZPB 4W9CA 2ZPYA 4NAWA 3W1YA 3CIRB 5DPWA 4KGTA 3H7SA 2E6XA 3A9KB 2MBBB 2VZKD 5IN7A 3ENEA 4JL9A 1UGMA 3X0WA 3KWLA 3RT3B 2L00B 1C1YB 1TZ1A 2C5LC 3X23A 3RI7C 1JWMD 2KFKA 1QOBA 2PVGC 2IY0B 2HE7A 1CMXB 4IWOA 3QA8A 3TJPA 3V62A 1P7EA 3WAOA 2IPKD 3VRBB 2N1VA 3IHPC 1WGYA 3P4RB 3QQ8B 4XX5A 3ZNGC 1SF0A 4G3XB 3DQVA 2C7HA 3GOEA 3ZJUA 4WJPA 2FCQA 4IOIE 1F52A 1HZ5A 1VRAB 2MA9B 3R3MA 3V6CB 1PUTA 2Z59B 5C23A 3VHTC 2G3QB 5HKHA 3NVZA 1OGWA 3GB1A 4YSXB 2JZZA 2Y5CA 3AEAB 4HLEA 3UGBB 3J9CA 1QILA 1PGXA 3OJ3A 3NOBA 4C4VB 4YT0B 1FMAD 3VR8B 1GB4A 1K51A 2WDTB 2IGDA 2D11A 4A9AA 2ZEQA 1L6VA 1EU3A 1UBIA 1WIAA 2J0MA 2V9HA 3RPFC 3AEDB 2BQQA 2NR2A 5H92C 2WU2B 3A9JB 4OVVA 4KZ0A 3ZRFA 2R2QA 3I9V1 2CHWA 3W1SA 2M1MA 2HTME 5EDSA 4WJOA 3N1ZC 4HKQA 4K7SA 4US9A 2WNMA 4BKTA 4HKZE 4C80A 1WR6E 3DBLI 2IO3B 1L2NA 2RGFA 3PO0A 5IP4D 3NVVA 2WX1A 1LGRA 3AECB 5LLIA 1IUEA 2JVCA 1AN8A 1QOGA 2MSED 2CHXA 3EECA 1PYWD 2D3BA 3EHVA 3PRZA 4RCOA 2NCNA 2QC8A 3NS8A 1MHHE 3O13A 2K8HA 4PYZA 3AULA 2V1YA 1T0YA 2FIFA 2HTHA 3PVLA 2IDYA 4E74A 2H89B 2N9PC 1OEYJ 2MP2B 4II2B 2CU1A 1WJUA 2LUMA 2C9WB 4TSSA 5HG2A 2WXMA 1GB1A 1E8XA 3NG0A 1GJZA 4TV3A 2DZKA 3H9DA 1XD3B 1QZEA 2BYFA 4W9JA 3HVZA 2WDQB 1VZ6A 2WXKA 3VTWA 4NJ6A 1XLQA 2K9XA 4EEWA 1TKEA 3LJ3A 1E9MA 3R7RA 3TBLD 3B1LX 3EUB2 3N3KB 4M8NA 2HDEA 2BYVE 3Q3FA 2FAZA 1VCBA 1QQRA 4MGKE 1D5MC 1TS2A 3WANA 3V6EB 4ZDVA 2L1AA 2KDFB 4WJQA 2ZVOA 1C78A 1WX8A 3L16A 1FXTB 2K3UA 1VZ8A 3Q8BA 2LJIA 4IC7B 1SJED 1TZOA 2IYDB 3V60A 2DYBA 2KC1A 4HROA 1YQBA 1V49A 1WMHA 2ZW1A 4JE3B 4EUTA 3GZNI 2KDBA 4KVGB 2B3AA 2PPHA 4W9IA 3AH7A 2MBEA 4HJGE 2FIDA 1SIFA 1F2RI 2GBKA 2PE9A 1WRDB 3PS6A 1MFWA 2DAJA 4TUUA 2FUG1 4NQLB 3N30A 4XDDA 1JRPA 4L2YA 2KX3A 5TR5A 1IYFA 4HWIB 2MBQA 3RN9C 3ZVVA 5J18A 4DDID 5EE0A 2RMMA 1WGHA 3HVDA 5JHBA 1RLFA 3NZ3A 3AMZA 2GBJA 3L54A 3Q69A 3U4EG 3M63B 2D07B 5DPSA 4M8MA 5HI1A 1V1PB 3LDZE 4DHZE 3KUZA 1ZE3D 3TSSA 1WGDA 4IG7B 3ZXRA 2AX5A 1RYJA 1TKGA 1HA5A 2AQ1B 4NQKE 1PQSA 5FK9C 1DOIA 1WYWB 2FCMA 1R4MI 4AJYB 1U4AA 2BT6A 2INDC 1N60A 3AE4B 1N5WA 4ICUA 3CSTA 3NHEB 2ZPNA 3Q3MC 1XLNA 2MJDA 4A20A 5GXGB 3UF8A 3CSFA 3SDLC 2GLSA 4KKJA 4JIOU 2BS2B 4M0WB 3PLVA 1EWCA 1IBXB 2WXHA 2MEKA 3W5VB 3MHZA 1NBFC 1E6EB 1FFUA 3L0WB 1Z2MA 4B0EA 4RMAA 1FRDA 1MI0A 3OAWA 1WGRA 4RGNA 1E0ZA 2CJOA 1L0XB 4HEA1 1ZKHA 3W9CB 4KIKB 3BK2A 2RPVA 3Q2AC 1L4ZB 2JX5A 2JT4B 2LHEA 2NBVB 2N9XA 1LQBA 2G45B 3P4SB 2JYTA 2DENB 1P7FA 3U30A 1P3QU 5CTRC 2M4NA 2LI5A 5E6NA 1K50A 1C4AA 3VH4B 1WM2A 1K52A 1M4VA 2ACZB 2QJLA 2DWQA 4XE0A 3FAHA 3HRDD 2QILA 1OFFA 4RM9A 1F2RC 2PE6B 2KOXA 3VTVA 3DOWA 2A5UA 3FILB 3P42A 2BWFA 3DWMA 4O1NA 2NVUI 4ANXA 1BMLC 4CHKA 2KQ4X 4EKUA 4KKIA 1FNVA 3ZLZA 2BWES 4HDOA 3C0RB 2LVQA 2UYZB 3P1MA 4HPMB 3ZW3A 3R2TA 3RFZB 1E7UA 1IGDA 4DBGA 1VR9A 2KLGA 4C00A 1QOFA 1N63A 2KVRA 2KTFA 2VRRB 4ACFA 3LYYA 1NI2A 4AWJA 5DPRA 2JU6X 3E56A 4AOFA 2PMVA 3T9LA 3RMKC 5T8IA 4BOSC 2C60A 1WXMA 1JW9D 2AEHA 3BVGA 2X8XX 2LRWA 1PGBA 2KMMA 2D2QA 2EELA 1AYFA 1KLGD 2O6VD 1T6BX 4NAWB 4CYEA 3B2FA 4YSZB 3AEGB 3BK1A 4ZYSA 3OJ4B 4BKSD 3R66C 2PLPA 3UIPB 1XXGA 1YNTE 4GXBA 4JWSC 2RDHA 3IBEA 2IO1B 1WX7A 3QK0A 1KF6B 1H8CA 4KIKA 1YX5B 2WGSA 3P2BA 2FE8A 4TMAB 2YLMA 2VZKB 3MTNB 2V0GA 1F77A 5BMIA 4S17A 2AL3A 1WXSA 1JCKB 4KDLB 4ICVA 4WAAA 2LZ6A 3M95A 4NNJB 3RNGC 2WXPA 2DZIA 3B08A 4MJSB 1JWSD 3DVNV 2L8JA 2OEDA 4YTNB 2L52A 1TY0A 1E90A 4FBJB 2ZVNA 2GB1A 4JGHB 1ET9A 3UIOB 2L05A 5JZEB 1J7BA 3OWEB 4PS7A 2EMTA 1QLBB 1AW7A 4OZBA 1IP9A 3JYUA 2JUOA 1PGAA 3KVFB 2QEJC 3LB8C 5IKCM 4MSMB 3ZXVA 1WY8A 1NEKB 2IBIB 3D32A 1JWAD 3TMPB 3AE5B 1I4PA 1TT5B 1GOZA 3SFDB 3TCAA 1T0QC 3WIMA 3QC8B 4GOCA 5KHOA 2LGYA 4IDIA 2Q5WD 2KWUB 1GAQB 1B9RA 4K7UA 4ZHOA 1FO4A 3QJZA 3RULA 2V3NA 4TKNA 2WLBA 1Z5SB 1XCQL 4EOYA 1RAXA 2D10A 2WXQA 4ANUA 2BTEA 2BBCA 2GBNA 2KTRA 3DVGY 3ZJVA 4BFRA 2G4DB 1I4XA 4JWUC 2E3TA 5G2NA 3KYCD 2K39A 2KNBA 1I4GA 2BF8B 2Y5BB 2C7MB 3BVMA 3DHHC 3ZUNA 1R7SA 2M56B 1T3QA 4LNIA 1JALA 2O2VB 3T8MA 4C7YA 1FPYA 3OG5A 1FFVA 1STEA 1D4BA 1WX9A 4JX1C 2KQSA 1XEEA 1SXTA 2V4LA 1XLOA 2IO2B 4YL8A 4IWPA 4W9DA 3ZNID 4MGYE 4WWMA 2PIAA 4YTPB 4XGAB 2INNE 2DNFA 3Q3OC 4K81A 1NVID 1WJNA 4N6EB 3NRZA 1YN4A 1YJJA 1FCCC 2O2VA 3PZ7A 4MM3A 3PHXB 4K1RB 1HXYD 3WA0A 1TBEA 1ET6A 1XCTL 3AE8B 1J8CA 4LNKA 2KJRA 1LXDA 2L0TA 4D2KA 4W9EA 4B9KA 1V81A 3Q3JA 1JRUA 1EUVB 2HJ8A 1ZGUB 2CJNA 3URYA 1P9DU 1ZW7A 3MJWA 2BS4B 4PT5A 2GBRA 3APFA 3RZWC 3WAMA 3AE7B 2KLCA 1BUIC 3VUWA 2G4SA 2LGSA 1V97A 4P1CC 1I35A 3AU4A 4NJ7A 2KDMA 5AUKA 1F1HA 3CWIA 4C7ZA 3IVFA 1TS4A 2GI9A 2GBMA 1UWXA 2PTLA 2M8SA 4FN2A 2PVOD 4MH8A 3MFGA 1IBXA 3NJTA 2UWQA 4BKGA 3UQBA 2W82A 3T3OA 3ETRA 4FJVB 5E6PA 4RFBA 2FNJB 3EFUA 3ZKJC 4RGMA 3UQAA 3Q14C 2FCSA 5G5GA 1FEHA 2J7QB 2MH7A 2LFIA 3N1XC 4B0MA 2R61A 3Q8EA 4WIPA 4F1SA 2FBWB 2KACA 3PSEB 4F7ZA 3EC8A 2WDRB 4BVUC 2KN5A 1H7WA 4A8XC 2XK5A 2LHDA 4ZRPA 4MELA 5E6OA 4ZRKA 3B0AA 3B9JA 1UWMA 2KDIA 4CQNA 2WXJA 2WS3B 3UI3A 4BBNC 4LJPB 3QIJA 1YD8U 2MW5A 4ZOHC 4FHKA 1KTKA 2D5GA 2MWSB 1UF0A 2KQ7A 1HZ6A 1YIWA 2IGGA 3V05A 3PRMB 2J53A 3QCAA 4WWNA 2IJ0A 1RWSA 2QDFA 1TKYA 4EZKA 2QSDA 1PDXA 4G0NB 1XQQA 4USAA 2KMCA 1MVKA 3APCA 3VAWA 1KH0A 1TYGB 1OQQA 4R3DA 3ZYYX 2PEAA 1EO6A 5KHQA 3IT6B 2ZW0A 1SE3A 4FXCA 4REZA 1RM6C 1V1PA 2AL6A 4ZRIA 3RNCC 2ZCBA 5I4DA 4ZRQA 1EF1A 1GNUA 1SE2A 2PW9A 4RF1A 4I6LB 3AN1A 4GGQA 1V5TA 4QAYA 3VUXA 4MSQB 3U2SC 2RD0A 2ZNVC 3IXSA 4A3OA 2Z0EB 1S3SG 1HE8A 4GLSC 2N7EA 3I57A 1XT9B 3RNAC 5JHAA 3VXWA 2BYEA 2D3AA 2KDEB 1WJ4A 3MHSD 1E7PB 1L5PA 4EZJA 1ZUD2 1QF6A 1JMLA 3SU8X 2C7NB 3RNFC 3AE3B 2Z0DB 3MC0B 3P4QB 1ISNA 2KWDA 3DBHB 1V2YA 3L17A 4XC2A 2NPTB 5CHFA 4HXDA 5J17A 3U7DA 4YXDB 2WU5B 4FULA 1YMHE 2JXXA 1WH3A 2JPHA 2NMQA 3JVZX 2NPTA 1ROEA 4EFOA 3HM3A 1JWBD 2ASQA 3DVGX 1L7YA 4US8A 4LTUA 1D5ZC 4P16A 3TEXA 1C77A 2N7DA 3R8BA 5G5HA 3PGEA 3DBRB 3BYTB 1S1QB 1A5RA 2WX0A 4AS1A 1AARA 4RF0A 2WXRA 4HJKA 1I4QA 2L0FA 3A4RA 2NBUA 4HCNB 3JSVB 4WAFA 4BBNF 4IW0A 2MQJA 1R4MB 4W9HA 4WJNA 4LLGM 4L1BA 2WXGA 2JRHA 2G1EA 4BZAA 3P63A 3ML8A 2BB5A 2W55A 2XN9C 4FJZA 4MACA 1RFKA 5BMGA 2VH2A 1ZPSA 1WWTA 4I6PA 5DPTA 1L6UA 2O6VA 3AEBB 3Q6BA 2MCNB 4MDKE 2MBHA 4IM3A 1J19A 2YEPF 3AEEB 1DOYA 1JROA 3VRAB 2N9KA 4II3B 1NDDA 4A6QA 5L95C 2WXOA 3AE2B 4GDKB 4GN1A 3GZNB 3IAS1 2JZ3B 1YOVB 4ITKA 3PZ8A 3EA6A 1UD7A 2XK5B 5LXHA 1UNSA 2DZJA 4W9KA 4ARIA 1ENFA 1FRRA 2K8BA 2LEKA 4GDLA 1MJDA 1SJHD 4KGRA 3M3JA 1FCLA 1HTOA 2D3GA 3U8ZA 3VVWB 1CK1A 1E8WA 3ZTCA 5AUIA 1FNUA 1P1AA 2CU3A 1L0YB 3IFWB 2W3SA 1GG3A 4XZ4A 1WM3A 2JZPA 3RZFA 1N61A 4A90A 2KYWA 2CHZA 5BYQA 1V1OA 2KFKB 1VJKA 3VTUA 3RNEC 1H4RA 2IGHA 1P98A 1SSNA 4FHJA 2W3RA 2J42A 4LNNA 2JSVX 1WXVA 3KYDD 3ECIA 3QHTA 3ZIMA 2KKCA 1EM7A 2KVZA 1WMHB 3AE9B 2LGDA 3HK0A 2BKRB 2KO3A 1UUPA 1YN3A 3A9KA 1ZDVA 1TS5A 3C8YA 1Q0WB 2IY1B 3QARA 5BMHA 4JPSA 4IUMB 1MHXA 2KWCA 2D3CA 4AJWA 4IWQA 4LDTB 3BY4B 4B95A 1F9JA 5GMVA 4LDTD 4HK2A 2HD5B 1YQ3B 1R4NB 2K5PA 1ESFA 5BYRA 3S2AA 3PZDA 1SE4A 1Y8RC 5MPOA 4NPNA 1TTNA 3I3TB 1EU4A 1D3ZA 3NY5A 2DX5B 1E8ZA 4AP4C 4KSLC 2Y5PA 1BXTA 3ZNHB 1D5XC 2ONQA 3MP9A 3R2IA 4OZCA 4LK0M 3VUYA 5LXIB 3NZUA 1E7VA 2JYEA 2ZJDA 4N59A 4KGSA 3WALA 3PTFC 3DVNU 4HDQA 4MM3B 2AWTA 2JY6A 2RR9A 1WSPA 1WE7A 4ZYNA 4TQ0A 3ONSA 5FKAC 2EKEC 4MH0E 2K8CA 5L83A 2BKFA 1D6EC 4GDKA 1T0SC 2YEPB 4RM8A 4BKSA 2LVPA 2WXFA 3UINB 3EGRA 2VH1A
chains in the Genus database with same CATH topology
4C7ZA 4ZHPA 1F2RI 2V3PA 1TS4A 2GI9A 1GTHA 1UWXA 2FUG1 2PTLA 4XDDA 2PVOD 4MH8A 3MFGA 1IBXA 4RNAA 2H88B 3T3OA 1JRPA 2W82A 1ZOYB 2Z8LA 3ETRA 4L2YA 2WDVB 4RFBA 4M0WA 3IT4B 3P4PB 2M19A 4RGMA 1GPXA 4AQ7A 5EE0A 2RMMA 3HVDA 2JQRB 1UGJA 5G5GA 3W5UB 3NZ3A 3AMZA 3LXFA 1FEHA 2MH7A 5JXVA 2LFIA 1H7XA 4B0MA 3NUHB 2LGIA 1QT9A 2R61A 3Q69A 3Q8EA 3U4EG 3TEWA 4WIPA 2FBWB 3AE1B 2KACA 2EKIA 3DWGC 3NVWA 3TUOA 5HI1A 1KFYB 2WDRB 1V1PB 1I4RA 1H7WA 4A8XC 1FXAA 2LHDA 4ZRPA 2AQ2B 3B9JA 1UWMA 1ZE3D 4CQNA 2WXJA 4DQOC 4DXFA 2WS3B 4RH6A 3TSSA 3UI3A 2TSSA 1DYQA 5C2TB 1CJEA 2AX5A 3N9YC 3U7ZA 2Y3AA 1I7HA 1RYJA 1TKGA 1HA5A 3GS2A 2AQ1B 5FK9C 1DOIA 4Q2JA 4ZOHC 1NYRA 2BT6A 2SAKA 1TJEA 1KTKA 1WRIA 2WXIA 1N60A 3AE4B 1N5WA 2D5GA 1XLPA 2BB6A 1ZP0B 3TEZA 1HZ6A 1QOAA 3V3XA 2IGGA 3V05A 2BYTA 2J53A 1E10A 2IJ0A 1RWSA 4GDLB 1XLNA 2MJDA 4RGOS 3W2DA 1TKYA 5GXGB 2WQYB 2QSDA 1NYQA 1PDXA 3B2GA 4RGTA 1QKZA 4KKJA 2MJEA 2BS2B 2KAJA 4USAA 5C3JB 1MVKA 3FILA 3AM9A 4XDCA 1KH0A 3BZDB 1TYGB 1OQQA 4R3DA 1PFDA 3ZYYX 1AWDA 3BIID 1EWCA 1IBXB 5D3DA 2WXHA 1DOXA 2MEKA 3IT6B 2WXLA 3MHZA 3W5VB 2ZW0A 1SE3A 4FXCA 4REZA 1E6EB 1FFUA 4OW0A 3WCQA 1VZ7A 1RM6C 1V1PA 4B0EA 1FRDA 1MI0A 1SEBD 1T5XD 4L23A 2KN4A 3U52E 4C56C 5TSSA 4RGNA 1I4HA 5I4DA 2G9HD 2CJOA 1L0XB 1E0ZA 4HEA1 4ZRQA 2QMTA 2ON8A 3W9CB 1SE2A 1C9FA 3BK2A 3AEFB 2RPVA 1L4ZB 2PW9A 4RF1A 4YTMB 2JX5A 2LHEA 3AN1A 5BYSA 5EE9A 4YWGG 1C76A 2SEBD 3AB5A 1WYGA 4KX6B 3BVZA 1FIQA 3P4SB 1J7CA 2J4XA 2JYTA 3U2SC 3ZQ4A 1P7FA 3IXSA 2I38A 2DBYA 1FM0D 4GLSC 1K50A 3I57A 2INPE 3HUIA 1C4AA 4WH4A 1FNWA 2BS3B 1K52A 2ACZB 1M4VA 2QJLA 2DWQA 2NTTA 4XE0A 1E7PB 1L5PA 3FAHA 2V4IB 3HRDD 2DLBA 1ZUD2 2QILA 1GT8A 2NTSA 1OFFA 1QF6A 2K22A 1JMLA 2ICIA 1VLBA 1F2RC 4P6VF 1YQ4B 3TEYA 4HRSA 3AE3B 3MC0B 1WGKA 1SBBB 1B1ZA 3FILB 3P42A 3P4QB 2KWDA 2K0PA 4EE2A 1L4DB 3Q8CA 4UDUC 3DWMA 3Q8FA 4O1NA 3VR9B 3E9SA 1KLUD 1BMLC 5HHDG 2KQ4X 5LNK1 4KKIA 4YXDB 1FNVA 5HFYA 4YSYB 2XNAC 3ZJTA 2M0AA 2WU5B 2JWUA 3FC4A 1FD6A 1YMHE 2LMCA 3H8HA 3SR6A 2NMQA 1C79A 1ZDXA 3ABVB 1ROEA 1YN5A 5D7GA 4H2AA 1SB3C 1Q10A 3GP7A 1ACCA 1JWBD 3P1MA 3Q8AA 2X38A 3R2TA 3RFZB 1IGDA 4US8A 1VR9A 1D5ZC 4LTUA 1JQ4A 3CIRB 1QOFA 4P16A 3TEXA 4KGTA 1C77A 4TQ1A 1N63A 2E6XA 5E6JA 1WXQA 3R8BA 4XWTA 3AV8A 2VZKD 5G5HA 3LYYA 2RDGA 2N7JA 2JU6X 3BYTB 3E56A 1NI3A 3KWLA 2PMVA 3VQIA 4AS1A 4RF0A 4NAMA 2L83A 2WXRA 5T8IA 3T3NA 3BWUD 1JW9D 1DGJA 1JWUD 1I4QA 1JWMD 3BVGA 2QIEB 4NZLB 1QOBA 2PVGC 4ARCA 1PGBA 4WQMA 1SIJA 2KMMA 1C4CA 4WAFA 2EELA 1AYFA 1KLGD 1J7AA 1P7EA 1T6BX 2B76B 4NAWB 3B2FA 4LLGM 4L1BA 2WXGA 4YSZB 3AEGB 2IPKD 2G1EA 3VRBB 3BK1A 4ZYSA 3P63A 2PLPA 3P4RB 1Y56A 1XXGA 1SF0A 1YNTE 2BB5A 3ZJUA 2W55A 4JWSC 2RDHA 1N5XA 1IGCA 2XN9C 4MACA 1RFKA 4IOIE 1KF6B 1HZ5A 1VRAB 5BMGA 1PUTA 1C4PA 2W54A 1ZPSA 4MT5A 2FE8A 4TMAB 1WWTA 3NVZA 2VZKB 1L6UA 1NENB 4YSXB 2Y5CA 3AEBB 3AEAB 3GB1A 2V0GA 3J9CA 1FXIA 1F77A 1QILA 1PGXA 5BMIA 1CQVA 2YEPF 3AEEB 4YT0B 1FMAD 3VR8B 1JCKB 1DOYA 1XO3A 1JROA 3BYYB 1GB4A 3VRAB 4OZAA 2N9KA 4A6QA 1K51A 2WXOA 2WXPA 2IGDA 3AE2B 5D3IB 1K53A 4GDKB 3IAS1 4A9AA 1JWSD 2OEDA 4YTNB 1L6VA 1EU3A 2L52A 1TY0A 3RPFC 3AEDB 2MJ3A 2GB1A 5H92C 2WU2B 1ET9A 4ITKA 3KLSX 1TS3A 1J7BA 3PZ8A 4N58A 3EA6A 3I9V1 4OVZA 1UNSA 3OWEB 2JXTA 1QLBB 1N62A 1AW7A 3W1SA 5FR3A 4ARIA 1ENFA 1FRRA 4OZBA 2HTME 2LEKA 2I2YA 4HKQA 1SJHD 4KGRA 2WNMA 4US9A 4HKZE 4OHJA 1PGAA 4C80A 1FCLA 2QEJC 3LB8C 2N9LA 1V8CA 1GTEA 2L32A 1CK1A 1NEKB 1ZXIA 5AUIA 1JWAD 3AE5B 1I4PA 1FNUA 2GRIA 2CU3A 1L0YB 3PO0A 2W3SA 1GOZA 3SFDB 2JZPA 3NVVA 3NVYA 4XWWA 1N61A 3AECB 3MJ5A 4A90A 1ZXHA 1OQRA 1IUEA 5BYQA 4IDIA 1V1OA 2Q5WD 3NS1A 1GAQB 1VJKA 1AN8A 1B9RA 1QOGA 1CZPA 3SEBA 4ZHOA 1PYWD 1FO4A 2IGHA 4RCOA 1VDVA 2DYMA 2V3NA 1EWYC 1SSNA 2WLBA 2OHFA 1MPEA 1XCQL 1MHHE 2W3RA 2J42A 3O13A 2JSVX 2WXQA 2BTEA 2BBCA 2IDYA 2H89B 1EM7A 2DYOA 3AE9B 3ZJVA 1HQRD 1UUPA 3SFEB 1YN3A 1I4XA 1ZDVA 4JWUC 2E3TA 2LUMA 1TS5A 3C8YA 4TSSA 1I4GA 2J52A 4DXGA 5BMHA 5HG2A 3L4PA 2WXMA 4JPSA 3BVMA 1GB1A 5EE1A 1MHXA 1R7SA 2M56B 1TY2A 1KRHA 1T3QA 1JALA 4C7YA 3KQ4A 2PKOA 1FFVA 1STEA 1D4BA 1YJIA 4JX1C 1YQ3B 1F0ZA 2K5PA 1ESFA 5BYRA 1XEEA 3HVZA 2WDQB 1SXTA 1VZ6A 2WXKA 1XLOA 2WP9B 1XLQA 2K9XA 1TKEA 4WURA 4WWMA 2PIAA 4YTPB 1SE4A 4A55A 1E9MA 5MPOA 2INNE 3EUB2 1EU4A 1HEZE 2HDEA 5EE3A 3IAM1 2Y5PA 1NVID 2N0SB 1QQRA 2BW2A 1BXTA 1D5XC 4N6EB 1D5MC 2ONQA 1YN4A 3MP9A 3NRZA 3R2IA 1YJJA 1FCCC 1TS2A 4J3OD 4OZCA 3PZ7A 4LK0M 1HXYD 2L1AA 1ET6A 1XCTL 3AE8B 2JYEA 3CF4A 5H8YE 4IKGA 4N59A 1C78A 4KGSA 2K3UA 1VZ8A 3Q8BA 4D2KA 1L0VB 4MM3B 2LJIA 1SJED 1TZOA 2CJNA 3URYA 1WSPA 1A70A 4HROA 4TQ0A 4NJCA 5FKAC 2BS4B 4PT5A 2ZW1A 3AE6B 4JE3B 2AQ3B 3AE7B 1BUIC 1D6EC 1XF5L 2YEPB 1V97A 3KWVA 3ZGZA 2KDMA 2WXNA 2WXFA 3AH7A 4HJGE 5AUKA 3EGRA 3CWIA 1LO5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLB A;  1E6E B;  1FFU A;  2OHF A;  2L83 A;  4C7Z A;  2W3R A;  3WCQ A;  4ZHP A;  1RM6 C;  1JW9 D;  1DGJ A;  1FRD A;  1GTH A;  2QIE B;  1QOB A;  2PVG C;  4WQM A;  2H89 B;  2PVO D;  1SIJ A;  2KMM A;  3AE9 B;  2H88 B;  1E0Z A;  2CJO A;  1AYF A;  1J7A A;  3W9C B;  2B76 B;  3SFE B;  3B2F A;  1JRP A;  1ZOY B;  3ETR A;  2WDV B;  3AEF B;  4YSZ B;  3AEG B;  2E3T A;  4JWU C;  2G1E A;  3VRB B;  4YTM B;  2JX5 A;  3AN1 A;  3P4P B;  2M19 A;  3P63 A;  5EE9 A;  3P4R B;  1GPX A;  3L4P A;  1SF0 A;  3AB5 A;  5EE0 A;  2W55 A;  1WYG A;  4JWS C;  5EE1 A;  4KX6 B;  1N5X A;  2JQR B;  1R7S A;  1FIQ A;  5G5G A;  1RFK A;  2M56 B;  3P4S B;  1J7C A;  1KRH A;  3AMZ A;  3LXF A;  1T3Q A;  3W5U B;  1KF6 B;  1JAL A;  2MH7 A;  1H7X A;  4C7Y A;  1PUT A;  1QT9 A;  2W54 A;  2PKO A;  2DBY A;  1FM0 D;  1WWT A;  2FBW B;  3AE1 B;  3NVZ A;  1FFV A;  1L6U A;  1NEN B;  4YSX B;  2EKI A;  3AEB B;  3AEA B;  2Y5C A;  3DWG C;  3NVW A;  1FXI A;  1YJI A;  3HUI A;  1KFY B;  2WDR B;  4JX1 C;  2BS3 B;  2QJL A;  2ACZ B;  2DWQ A;  1YQ3 B;  1H7W A;  3AEE B;  1F0Z A;  4YT0 B;  1FMA D;  3VR8 B;  2K5P A;  1DOY A;  1E7P B;  1FXA A;  1JRO A;  1L5P A;  1XO3 A;  3VRA B;  2WDQ B;  3FAH A;  3HRD D;  3HVZ A;  1ZUD 2;  1XLO A;  1GT8 A;  2WP9 B;  1XLQ A;  2K9X A;  3B9J A;  1UWM A;  1OFF A;  1QF6 A;  1TKE A;  2K22 A;  4WWM A;  2PIA A;  1VLB A;  4YTP B;  3AE2 B;  2WS3 B;  5MPO A;  1E9M A;  1YQ4 B;  4P6V F;  4A9A A;  3EUB 2;  4HRS A;  3AE3 B;  5C2T B;  1CJE A;  1WGK A;  2AX5 A;  4YTN B;  1L6V A;  1I7H A;  1RYJ A;  1TKG A;  3P4Q B;  5EE3 A;  2L52 A;  3RPF C;  3AED B;  2MJ3 A;  1DOI A;  1NVI D;  3DWM A;  2N0S B;  2WU2 B;  4N58 A;  4ITK A;  3VR9 B;  4ZOH C;  1J7B A;  1NYR A;  5H92 C;  2BT6 A;  1TJE A;  4N6E B;  1WRI A;  3NRZ A;  1N60 A;  4YXD B;  1QLB B;  3AE4 B;  1N5W A;  4YSY B;  1N62 A;  1XLP A;  1YJJ A;  2WU5 B;  1FRR A;  2HTM E;  2LEK A;  3FC4 A;  1ZP0 B;  3SR6 A;  3AE8 B;  1QOA A;  4US9 A;  5H8Y E;  3CF4 A;  4C80 A;  3ABV B;  1ROE A;  3LB8 C;  4N59 A;  1V8C A;  1E10 A;  1GTE A;  1RWS A;  1L0V B;  1SB3 C;  1NEK B;  1XLN A;  1ZXI A;  2MJD A;  5AUI A;  1JWA D;  3AE5 B;  1JWB D;  3PO0 A;  2CU3 A;  3P1M A;  2W3S A;  1TKY A;  5GXG B;  2WQY B;  3SFD B;  1NYQ A;  2CJN A;  3NVV A;  1PDX A;  3B2G A;  3NVY A;  1A70 A;  4HRO A;  4LTU A;  4US8 A;  1N61 A;  3AEC B;  1JQ4 A;  2MJE A;  1OQR A;  2BS4 B;  2BS2 B;  3CIR B;  2KAJ A;  5C3J B;  1QOF A;  1IUE A;  4USA A;  3AM9 A;  4IDI A;  2Q5W D;  1N63 A;  3NS1 A;  3AE6 B;  1GAQ B;  1WXQ A;  1VJK A;  1B9R A;  1TYG B;  3AE7 B;  1OQQ A;  3AV8 A;  5G5H A;  1PFD A;  1QOG A;  3ZYY X;  1AWD A;  3BII D;  1CZP A;  4ZHO A;  1FO4 A;  1V97 A;  1DOX A;  1NI3 A;  3KWL A;  3W5V B;  1VDV A;  3AH7 A;  5AUK A;  1EWY C;  4FXC A;  3CWI A; 
#chains in the Genus database with same CATH topology
 4ZHP A;  4GMV A;  1GTH A;  1TGZ B;  4MGZ E;  2ZNV B;  4RNA A;  4ASW C;  2H88 B;  3RYT A;  4KSK C;  2UU7 A;  3ZDM C;  3P4P B;  4GIV A;  1GPX A;  1M94 A;  4K3C A;  2JQR B;  1UGJ A;  3LXF A;  2KWV B;  5JXV A;  1H7X A;  3DHI C;  2LGI A;  3NUH B;  3TEW A;  3HIZ A;  1LM8 B;  3PPA A;  5C1Z A;  3AE1 B;  2NS5 A;  2EKI A;  3NVW A;  3TUO A;  1OTR B;  2L76 A;  1KFY B;  5CHV C;  1FXA A;  3PLU A;  2AQ2 B;  1P0R A;  1C3T A;  2LD9 A;  1DYQ A;  2J0K A;  5C2T B;  2Y3A A;  1I7H A;  2KXJ A;  3SD5 A;  4Q2J A;  1NYR A;  2KMA A;  2SAK A;  1TJE A;  4IM2 A;  1V86 A;  1WRI A;  5AZF A;  4FAD A;  2KJ6 A;  3ZDT A;  3ML9 A;  2LRU A;  1ZP0 B;  1WGG A;  2IO0 B;  2LXA A;  4LCD E;  1QOA A;  3V3X A;  3DBR I;  2KAN A;  3ZNZ B;  4GB9 A;  2DZM A;  4E3C A;  1NYQ A;  3B2G A;  4K3B A;  1QKZ A;  3L08 A;  4GSW A;  3L10 B;  3AM9 A;  1PFD A;  4PYU A;  3BII D;  5D3D A;  1MG4 A;  2J0J A;  1DOX A;  2WXL A;  1OQY A;  2MRP A;  2A4Z A;  3WCQ A;  1VZ7 A;  1WZ0 A;  4HVB A;  4OVU A;  1SGH A;  3MC8 A;  4L23 A;  2RPQ A;  2IZV B;  1GC7 A;  5TSS A;  4C56 C;  4PK1 A;  1I4H A;  4F8C B;  2ON8 A;  1C9F A;  3WAP A;  1V9J A;  4M02 A;  5AZH A;  3DBL B;  5BYS A;  1UEL A;  4YWG G;  1C76 A;  2SEB D;  3ZRC A;  1J7C A;  1YJ1 A;  3ZQ4 A;  2W9N A;  3AU5 A;  3H7P B;  1Q1O A;  5IO9 A;  2I38 A;  2DBY A;  1FM0 D;  2CKH B;  5AEK B;  3PV1 A;  3VH3 B;  3DHG C;  2GMI C;  2BS3 B;  1YX6 B;  2RSU A;  5J2R A;  2NTS A;  2N1W A;  1BT0 A;  2K22 A;  3FKY A;  3AXC A;  4XYC A;  3KW5 B;  4DK5 A;  1WGK A;  1OEY A;  1B1Z A;  3I5J C;  3PHW B;  2K0P A;  2JF5 A;  1L4D B;  2KK8 A;  4DDG D;  3VR9 B;  3L13 A;  4G11 A;  5FR6 A;  5LNK 1;  4E71 A;  2XNA C;  4W9G A;  2M0A A;  1WXA A;  1FD6 A;  2LMC A;  3H8H A;  1C79 A;  1ZDX A;  2I1J A;  1IPG A;  3ABV B;  1YN5 A;  5D7G A;  4WQO B;  1KM7 A;  4H2A A;  3I63 C;  2KHW B;  1ACC A;  3Q8A A;  2X38 A;  3QAQ A;  2N9E B;  4DHZ B;  3A4S C;  1JQ4 A;  1LFD A;  3PRE A;  4TQ1 A;  5E6J A;  1WXQ A;  4XWT A;  3AV8 A;  4JLC A;  2RDG A;  3RUI B;  4MGI E;  2N7J A;  1NI3 A;  2L3Z A;  5D6J B;  3VQI A;  2DHZ A;  2I1K A;  2L83 A;  4NAM A;  3TL5 A;  2M0X A;  3T3N A;  3BWU D;  1DGJ A;  1JWU D;  3DBH I;  2QIE B;  4NZL B;  5JH5 C;  2KFJ A;  4ARC A;  4P7I A;  4WQM A;  2QCZ A;  2O6V B;  3EFC A;  1SIJ A;  1C4C A;  3W1S C;  2XBB C;  4A3P A;  1UBQ A;  3K9O B;  1J7A A;  2B76 B;  1WF9 A;  2LVO A;  3QWZ B;  2BGF A;  1WZ3 A;  5DCN A;  1VD2 A;  1Y56 A;  1V6E A;  1G6J A;  4GU2 A;  2KTR B;  1N5X A;  1IGC A;  2JWZ A;  5D2M B;  4NY0 A;  3QX1 A;  1C4P A;  2W54 A;  4MT5 A;  1NEN B;  1FXI A;  1CQV A;  2K6Q A;  4LNO A;  1XO3 A;  3BYY B;  2RDB C;  4OZA A;  5D3I B;  1K53 A;  2MJ3 A;  4B6W A;  4N58 A;  3KLS X;  1TS3 A;  2LXC A;  4OVZ A;  2KZR A;  2JXT A;  1R4N I;  1N62 A;  5FR3 A;  2INC C;  3DDC B;  1WI0 A;  2I2Y A;  2K25 A;  4HCP B;  4OHJ A;  4BOZ B;  2KD0 A;  3PRP B;  2N9L A;  2FUH B;  1V8C A;  1GTE A;  2L32 A;  1ZXI A;  1KJT A;  2GRI A;  5AZG A;  3NVY A;  4LNF A;  1V80 A;  4XWW A;  3MJ5 A;  1ZXH A;  1OQR A;  2BPS A;  5IA7 A;  3NS1 A;  4J6I A;  2MP2 A;  4WWO A;  2JRI B;  1CZP A;  3SEB A;  4URK A;  3C19 A;  4MEM A;  5D94 A;  4P1B C;  2BVC A;  3ALB A;  3DCG A;  1VDV A;  2DYM A;  3RD2 A;  1EWY C;  4EZL A;  2OHF A;  1MPE A;  3BIN A;  3MC9 A;  4CO7 A;  2M17 A;  1Q5W B;  2DYO A;  2DAF A;  1HQR D;  1GUA B;  3SFE B;  1WE6 A;  3GE3 C;  5CX3 A;  3M62 B;  3ZO5 B;  2J52 A;  4IM0 A;  4DXG A;  2OOB B;  3L4P A;  4HPL B;  5EE1 A;  1TY2 A;  1KRH A;  5IAA C;  3DBS A;  2ZCC A;  3KQ4 A;  3N1Y C;  2PKO A;  3SHQ A;  1YJI A;  3V61 A;  2AYO B;  3A1Q B;  1F0Z A;  4DHJ B;  2WP9 B;  4ANW A;  4WUR A;  4AUQ C;  4A55 A;  1V5O A;  1HEZ E;  3VDZ A;  5EE3 A;  3IAM 1;  4W9F A;  2N0S B;  2WWZ A;  2K6D B;  2BW2 A;  1TIF A;  2OJR A;  3APD A;  3Q3N C;  3RNB C;  1I42 A;  1WFY A;  1T0R C;  4J3O D;  3DPD A;  3KUC B;  5H8Y E;  3CF4 A;  4IKG A;  5CHW A;  3H7P A;  1L0V B;  2OJW A;  5G55 A;  2MBO A;  1A70 A;  2WHI A;  4ANV A;  4NJC A;  4HPP A;  1WJ6 A;  3AE6 B;  2AQ3 B;  4KV2 A;  1XF5 L;  4ZRJ A;  3KWV A;  3ZGZ A;  2WXN A;  3PT2 B;  4M00 A;  1LO5 D;  2V3P A;  3NZS A;  2KX0 A;  1HTQ A;  2KT7 A;  2HJ1 A;  4DHJ D;  1ZOY B;  2Z8L A;  2WDV B;  1MG8 A;  4M0W A;  4FLH A;  3IT4 B;  2M19 A;  4K7W A;  4AQ7 A;  4FJY A;  3JSV A;  3W5U B;  3CF6 E;  2NBW B;  1WR1 A;  2LGX A;  1E8Y A;  1K8R B;  1QT9 A;  2MX2 A;  4S0R A;  3KUD B;  3DWG C;  2KC2 A;  2MHJ A;  1N6Z A;  1I4R A;  2LUE A;  4I6N B;  4MJS A;  3IG3 A;  3VFK A;  4DQO C;  4DXF A;  4RH6 A;  3OLM D;  4WWP A;  2TSS A;  2CS4 A;  4M01 A;  1CJE A;  1GC6 A;  3N9Y C;  5BO4 B;  3U7Z A;  3GS2 A;  2N4F A;  2GOW A;  4KZC A;  3GE8 C;  3RCZ A;  2LWP A;  3O65 B;  3N32 A;  3AI5 A;  3R7Q A;  2KJH B;  2WXI A;  1XLP A;  1EF5 A;  2BB6 A;  2V3S A;  3TEZ A;  1E5W A;  2BYT A;  2PJH A;  1E10 A;  2WYQ A;  4GDL B;  2R2O A;  3N20 C;  2L7R A;  4RGO S;  3W2D A;  2WQY B;  4RGT A;  3A9J A;  4PS8 A;  2MJE A;  2KAJ A;  5C3J B;  3FIL A;  4XDC A;  3BZD B;  4N9F 4;  4C4V A;  1AWD A;  1RFA A;  3JW0 X;  4PS3 A;  2EMS A;  3A33 B;  3H1U A;  2QHO A;  1SE9 A;  4X57 B;  3A1Q A;  4OW0 A;  5IOI A;  1SEB D;  1T5X D;  4DXA B;  2KN4 A;  1KLV A;  3U52 E;  3H6N A;  4JQW C;  4DWF A;  2MLB A;  2G9H D;  2QMT A;  2K1F A;  2XEW A;  1KOT A;  1J0G A;  3AEF B;  4YTM B;  3ZTD A;  4FA6 A;  2CR5 A;  5EE9 A;  3KH0 A;  3AB5 A;  1WYG A;  4KX6 B;  3BVZ A;  1FIQ A;  2J4X A;  2LAS A;  1UZX B;  1X1M A;  1UH6 A;  3K9P B;  2LJ5 A;  4BAX A;  2INP E;  3HUI A;  4WH4 A;  1FNW A;  2FCN A;  2NTT A;  4G50 A;  3HHM A;  2V4I B;  2DLB A;  1GT8 A;  3TIX A;  2ICI A;  1VLB A;  4P6V F;  1YQ4 B;  3TEY A;  2REX A;  4HRS A;  1SBB B;  3CMM B;  4EE2 A;  3Q8C A;  4W9L A;  4UDU C;  3Q8F A;  3HM6 X;  3E9S A;  1KLU D;  5HHD G;  1RRB A;  4KDI C;  5HFY A;  4YSY B;  3ZJT A;  2JWU A;  3FC4 A;  3SR6 A;  4LJO B;  2YVC A;  1SB3 C;  1Q10 A;  3GP7 A;  2ZZP B;  4W9C A;  2ZPY A;  4NAW A;  3W1Y A;  3CIR B;  5DPW A;  4KGT A;  3H7S A;  2E6X A;  3A9K B;  2MBB B;  2VZK D;  5IN7 A;  3ENE A;  4JL9 A;  1UGM A;  3X0W A;  3KWL A;  3RT3 B;  2L00 B;  1C1Y B;  1TZ1 A;  2C5L C;  3X23 A;  3RI7 C;  1JWM D;  2KFK A;  1QOB A;  2PVG C;  2IY0 B;  2HE7 A;  1CMX B;  4IWO A;  3QA8 A;  3TJP A;  3V62 A;  1P7E A;  3WAO A;  2IPK D;  3VRB B;  2N1V A;  3IHP C;  1WGY A;  3P4R B;  3QQ8 B;  4XX5 A;  3ZNG C;  1SF0 A;  4G3X B;  3DQV A;  2C7H A;  3GOE A;  3ZJU A;  4WJP A;  2FCQ A;  4IOI E;  1F52 A;  1HZ5 A;  1VRA B;  2MA9 B;  3R3M A;  3V6C B;  1PUT A;  2Z59 B;  5C23 A;  3VHT C;  2G3Q B;  5HKH A;  3NVZ A;  1OGW A;  3GB1 A;  4YSX B;  2JZZ A;  2Y5C A;  3AEA B;  4HLE A;  3UGB B;  3J9C A;  1QIL A;  1PGX A;  3OJ3 A;  3NOB A;  4C4V B;  4YT0 B;  1FMA D;  3VR8 B;  1GB4 A;  1K51 A;  2WDT B;  2IGD A;  2D11 A;  4A9A A;  2ZEQ A;  1L6V A;  1EU3 A;  1UBI A;  1WIA A;  2J0M A;  2V9H A;  3RPF C;  3AED B;  2BQQ A;  2NR2 A;  5H92 C;  2WU2 B;  3A9J B;  4OVV A;  4KZ0 A;  3ZRF A;  2R2Q A;  3I9V 1;  2CHW A;  3W1S A;  2M1M A;  2HTM E;  5EDS A;  4WJO A;  3N1Z C;  4HKQ A;  4K7S A;  4US9 A;  2WNM A;  4BKT A;  4HKZ E;  4C80 A;  1WR6 E;  3DBL I;  2IO3 B;  1L2N A;  2RGF A;  3PO0 A;  5IP4 D;  3NVV A;  2WX1 A;  1LGR A;  3AEC B;  5LLI A;  1IUE A;  2JVC A;  1AN8 A;  1QOG A;  2MSE D;  2CHX A;  3EEC A;  1PYW D;  2D3B A;  3EHV A;  3PRZ A;  4RCO A;  2NCN A;  2QC8 A;  3NS8 A;  1MHH E;  3O13 A;  2K8H A;  4PYZ A;  3AUL A;  2V1Y A;  1T0Y A;  2FIF A;  2HTH A;  3PVL A;  2IDY A;  4E74 A;  2H89 B;  2N9P C;  1OEY J;  2MP2 B;  4II2 B;  2CU1 A;  1WJU A;  2LUM A;  2C9W B;  4TSS A;  5HG2 A;  2WXM A;  1GB1 A;  1E8X A;  3NG0 A;  1GJZ A;  4TV3 A;  2DZK A;  3H9D A;  1XD3 B;  1QZE A;  2BYF A;  4W9J A;  3HVZ A;  2WDQ B;  1VZ6 A;  2WXK A;  3VTW A;  4NJ6 A;  1XLQ A;  2K9X A;  4EEW A;  1TKE A;  3LJ3 A;  1E9M A;  3R7R A;  3TBL D;  3B1L X;  3EUB 2;  3N3K B;  4M8N A;  2HDE A;  2BYV E;  3Q3F A;  2FAZ A;  1VCB A;  1QQR A;  4MGK E;  1D5M C;  1TS2 A;  3WAN A;  3V6E B;  4ZDV A;  2L1A A;  2KDF B;  4WJQ A;  2ZVO A;  1C78 A;  1WX8 A;  3L16 A;  1FXT B;  2K3U A;  1VZ8 A;  3Q8B A;  2LJI A;  4IC7 B;  1SJE D;  1TZO A;  2IYD B;  3V60 A;  2DYB A;  2KC1 A;  4HRO A;  1YQB A;  1V49 A;  1WMH A;  2ZW1 A;  4JE3 B;  4EUT A;  3GZN I;  2KDB A;  4KVG B;  2B3A A;  2PPH A;  4W9I A;  3AH7 A;  2MBE A;  4HJG E;  2FID A;  1SIF A;  1F2R I;  2GBK A;  2PE9 A;  1WRD B;  3PS6 A;  1MFW A;  2DAJ A;  4TUU A;  2FUG 1;  4NQL B;  3N30 A;  4XDD A;  1JRP A;  4L2Y A;  2KX3 A;  5TR5 A;  1IYF A;  4HWI B;  2MBQ A;  3RN9 C;  3ZVV A;  5J18 A;  4DDI D;  5EE0 A;  2RMM A;  1WGH A;  3HVD A;  5JHB A;  1RLF A;  3NZ3 A;  3AMZ A;  2GBJ A;  3L54 A;  3Q69 A;  3U4E G;  3M63 B;  2D07 B;  5DPS A;  4M8M A;  5HI1 A;  1V1P B;  3LDZ E;  4DHZ E;  3KUZ A;  1ZE3 D;  3TSS A;  1WGD A;  4IG7 B;  3ZXR A;  2AX5 A;  1RYJ A;  1TKG A;  1HA5 A;  2AQ1 B;  4NQK E;  1PQS A;  5FK9 C;  1DOI A;  1WYW B;  2FCM A;  1R4M I;  4AJY B;  1U4A A;  2BT6 A;  2IND C;  1N60 A;  3AE4 B;  1N5W A;  4ICU A;  3CST A;  3NHE B;  2ZPN A;  3Q3M C;  1XLN A;  2MJD A;  4A20 A;  5GXG B;  3UF8 A;  3CSF A;  3SDL C;  2GLS A;  4KKJ A;  4JIO U;  2BS2 B;  4M0W B;  3PLV A;  1EWC A;  1IBX B;  2WXH A;  2MEK A;  3W5V B;  3MHZ A;  1NBF C;  1E6E B;  1FFU A;  3L0W B;  1Z2M A;  4B0E A;  4RMA A;  1FRD A;  1MI0 A;  3OAW A;  1WGR A;  4RGN A;  1E0Z A;  2CJO A;  1L0X B;  4HEA 1;  1ZKH A;  3W9C B;  4KIK B;  3BK2 A;  2RPV A;  3Q2A C;  1L4Z B;  2JX5 A;  2JT4 B;  2LHE A;  2NBV B;  2N9X A;  1LQB A;  2G45 B;  3P4S B;  2JYT A;  2DEN B;  1P7F A;  3U30 A;  1P3Q U;  5CTR C;  2M4N A;  2LI5 A;  5E6N A;  1K50 A;  1C4A A;  3VH4 B;  1WM2 A;  1K52 A;  1M4V A;  2ACZ B;  2QJL A;  2DWQ A;  4XE0 A;  3FAH A;  3HRD D;  2QIL A;  1OFF A;  4RM9 A;  1F2R C;  2PE6 B;  2KOX A;  3VTV A;  3DOW A;  2A5U A;  3FIL B;  3P42 A;  2BWF A;  3DWM A;  4O1N A;  2NVU I;  4ANX A;  1BML C;  4CHK A;  2KQ4 X;  4EKU A;  4KKI A;  1FNV A;  3ZLZ A;  2BWE S;  4HDO A;  3C0R B;  2LVQ A;  2UYZ B;  3P1M A;  4HPM B;  3ZW3 A;  3R2T A;  3RFZ B;  1E7U A;  1IGD A;  4DBG A;  1VR9 A;  2KLG A;  4C00 A;  1QOF A;  1N63 A;  2KVR A;  2KTF A;  2VRR B;  4ACF A;  3LYY A;  1NI2 A;  4AWJ A;  5DPR A;  2JU6 X;  3E56 A;  4AOF A;  2PMV A;  3T9L A;  3RMK C;  5T8I A;  4BOS C;  2C60 A;  1WXM A;  1JW9 D;  2AEH A;  3BVG A;  2X8X X;  2LRW A;  1PGB A;  2KMM A;  2D2Q A;  2EEL A;  1AYF A;  1KLG D;  2O6V D;  1T6B X;  4NAW B;  4CYE A;  3B2F A;  4YSZ B;  3AEG B;  3BK1 A;  4ZYS A;  3OJ4 B;  4BKS D;  3R66 C;  2PLP A;  3UIP B;  1XXG A;  1YNT E;  4GXB A;  4JWS C;  2RDH A;  3IBE A;  2IO1 B;  1WX7 A;  3QK0 A;  1KF6 B;  1H8C A;  4KIK A;  1YX5 B;  2WGS A;  3P2B A;  2FE8 A;  4TMA B;  2YLM A;  2VZK B;  3MTN B;  2V0G A;  1F77 A;  5BMI A;  4S17 A;  2AL3 A;  1WXS A;  1JCK B;  4KDL B;  4ICV A;  4WAA A;  2LZ6 A;  3M95 A;  4NNJ B;  3RNG C;  2WXP A;  2DZI A;  3B08 A;  4MJS B;  1JWS D;  3DVN V;  2L8J A;  2OED A;  4YTN B;  2L52 A;  1TY0 A;  1E90 A;  4FBJ B;  2ZVN A;  2GB1 A;  4JGH B;  1ET9 A;  3UIO B;  2L05 A;  5JZE B;  1J7B A;  3OWE B;  4PS7 A;  2EMT A;  1QLB B;  1AW7 A;  4OZB A;  1IP9 A;  3JYU A;  2JUO A;  1PGA A;  3KVF B;  2QEJ C;  3LB8 C;  5IKC M;  4MSM B;  3ZXV A;  1WY8 A;  1NEK B;  2IBI B;  3D32 A;  1JWA D;  3TMP B;  3AE5 B;  1I4P A;  1TT5 B;  1GOZ A;  3SFD B;  3TCA A;  1T0Q C;  3WIM A;  3QC8 B;  4GOC A;  5KHO A;  2LGY A;  4IDI A;  2Q5W D;  2KWU B;  1GAQ B;  1B9R A;  4K7U A;  4ZHO A;  1FO4 A;  3QJZ A;  3RUL A;  2V3N A;  4TKN A;  2WLB A;  1Z5S B;  1XCQ L;  4EOY A;  1RAX A;  2D10 A;  2WXQ A;  4ANU A;  2BTE A;  2BBC A;  2GBN A;  2KTR A;  3DVG Y;  3ZJV A;  4BFR A;  2G4D B;  1I4X A;  4JWU C;  2E3T A;  5G2N A;  3KYC D;  2K39 A;  2KNB A;  1I4G A;  2BF8 B;  2Y5B B;  2C7M B;  3BVM A;  3DHH C;  3ZUN A;  1R7S A;  2M56 B;  1T3Q A;  4LNI A;  1JAL A;  2O2V B;  3T8M A;  4C7Y A;  1FPY A;  3OG5 A;  1FFV A;  1STE A;  1D4B A;  1WX9 A;  4JX1 C;  2KQS A;  1XEE A;  1SXT A;  2V4L A;  1XLO A;  2IO2 B;  4YL8 A;  4IWP A;  4W9D A;  3ZNI D;  4MGY E;  4WWM A;  2PIA A;  4YTP B;  4XGA B;  2INN E;  2DNF A;  3Q3O C;  4K81 A;  1NVI D;  1WJN A;  4N6E B;  3NRZ A;  1YN4 A;  1YJJ A;  1FCC C;  2O2V A;  3PZ7 A;  4MM3 A;  3PHX B;  4K1R B;  1HXY D;  3WA0 A;  1TBE A;  1ET6 A;  1XCT L;  3AE8 B;  1J8C A;  4LNK A;  2KJR A;  1LXD A;  2L0T A;  4D2K A;  4W9E A;  4B9K A;  1V81 A;  3Q3J A;  1JRU A;  1EUV B;  2HJ8 A;  1ZGU B;  2CJN A;  3URY A;  1P9D U;  1ZW7 A;  3MJW A;  2BS4 B;  4PT5 A;  2GBR A;  3APF A;  3RZW C;  3WAM A;  3AE7 B;  2KLC A;  1BUI C;  3VUW A;  2G4S A;  2LGS A;  1V97 A;  4P1C C;  1I35 A;  3AU4 A;  4NJ7 A;  2KDM A;  5AUK A;  1F1H A;  3CWI A;  4C7Z A;  3IVF A;  1TS4 A;  2GI9 A;  2GBM A;  1UWX A;  2PTL A;  2M8S A;  4FN2 A;  2PVO D;  4MH8 A;  3MFG A;  1IBX A;  3NJT A;  2UWQ A;  4BKG A;  3UQB A;  2W82 A;  3T3O A;  3ETR A;  4FJV B;  5E6P A;  4RFB A;  2FNJ B;  3EFU A;  3ZKJ C;  4RGM A;  3UQA A;  3Q14 C;  2FCS A;  5G5G A;  1FEH A;  2J7Q B;  2MH7 A;  2LFI A;  3N1X C;  4B0M A;  2R61 A;  3Q8E A;  4WIP A;  4F1S A;  2FBW B;  2KAC A;  3PSE B;  4F7Z A;  3EC8 A;  2WDR B;  4BVU C;  2KN5 A;  1H7W A;  4A8X C;  2XK5 A;  2LHD A;  4ZRP A;  4MEL A;  5E6O A;  4ZRK A;  3B0A A;  3B9J A;  1UWM A;  2KDI A;  4CQN A;  2WXJ A;  2WS3 B;  3UI3 A;  4BBN C;  4LJP B;  3QIJ A;  1YD8 U;  2MW5 A;  4ZOH C;  4FHK A;  1KTK A;  2D5G A;  2MWS B;  1UF0 A;  2KQ7 A;  1HZ6 A;  1YIW A;  2IGG A;  3V05 A;  3PRM B;  2J53 A;  3QCA A;  4WWN A;  2IJ0 A;  1RWS A;  2QDF A;  1TKY A;  4EZK A;  2QSD A;  1PDX A;  4G0N B;  1XQQ A;  4USA A;  2KMC A;  1MVK A;  3APC A;  3VAW A;  1KH0 A;  1TYG B;  1OQQ A;  4R3D A;  3ZYY X;  2PEA A;  1EO6 A;  5KHQ A;  3IT6 B;  2ZW0 A;  1SE3 A;  4FXC A;  4REZ A;  1RM6 C;  1V1P A;  2AL6 A;  4ZRI A;  3RNC C;  2ZCB A;  5I4D A;  4ZRQ A;  1EF1 A;  1GNU A;  1SE2 A;  2PW9 A;  4RF1 A;  4I6L B;  3AN1 A;  4GGQ A;  1V5T A;  4QAY A;  3VUX A;  4MSQ B;  3U2S C;  2RD0 A;  2ZNV C;  3IXS A;  4A3O A;  2Z0E B;  1S3S G;  1HE8 A;  4GLS C;  2N7E A;  3I57 A;  1XT9 B;  3RNA C;  5JHA A;  3VXW A;  2BYE A;  2D3A A;  2KDE B;  1WJ4 A;  3MHS D;  1E7P B;  1L5P A;  4EZJ A;  1ZUD 2;  1QF6 A;  1JML A;  3SU8 X;  2C7N B;  3RNF C;  3AE3 B;  2Z0D B;  3MC0 B;  3P4Q B;  1ISN A;  2KWD A;  3DBH B;  1V2Y A;  3L17 A;  4XC2 A;  2NPT B;  5CHF A;  4HXD A;  5J17 A;  3U7D A;  4YXD B;  2WU5 B;  4FUL A;  1YMH E;  2JXX A;  1WH3 A;  2JPH A;  2NMQ A;  3JVZ X;  2NPT A;  1ROE A;  4EFO A;  3HM3 A;  1JWB D;  2ASQ A;  3DVG X;  1L7Y A;  4US8 A;  4LTU A;  1D5Z C;  4P16 A;  3TEX A;  1C77 A;  2N7D A;  3R8B A;  5G5H A;  3PGE A;  3DBR B;  3BYT B;  1S1Q B;  1A5R A;  2WX0 A;  4AS1 A;  1AAR A;  4RF0 A;  2WXR A;  4HJK A;  1I4Q A;  2L0F A;  3A4R A;  2NBU A;  4HCN B;  3JSV B;  4WAF A;  4BBN F;  4IW0 A;  2MQJ A;  1R4M B;  4W9H A;  4WJN A;  4LLG M;  4L1B A;  2WXG A;  2JRH A;  2G1E A;  4BZA A;  3P63 A;  3ML8 A;  2BB5 A;  2W55 A;  2XN9 C;  4FJZ A;  4MAC A;  1RFK A;  5BMG A;  2VH2 A;  1ZPS A;  1WWT A;  4I6P A;  5DPT A;  1L6U A;  2O6V A;  3AEB B;  3Q6B A;  2MCN B;  4MDK E;  2MBH A;  4IM3 A;  1J19 A;  2YEP F;  3AEE B;  1DOY A;  1JRO A;  3VRA B;  2N9K A;  4II3 B;  1NDD A;  4A6Q A;  5L95 C;  2WXO A;  3AE2 B;  4GDK B;  4GN1 A;  3GZN B;  3IAS 1;  2JZ3 B;  1YOV B;  4ITK A;  3PZ8 A;  3EA6 A;  1UD7 A;  2XK5 B;  5LXH A;  1UNS A;  2DZJ A;  4W9K A;  4ARI A;  1ENF A;  1FRR A;  2K8B A;  2LEK A;  4GDL A;  1MJD A;  1SJH D;  4KGR A;  3M3J A;  1FCL A;  1HTO A;  2D3G A;  3U8Z A;  3VVW B;  1CK1 A;  1E8W A;  3ZTC A;  5AUI A;  1FNU A;  1P1A A;  2CU3 A;  1L0Y B;  3IFW B;  2W3S A;  1GG3 A;  4XZ4 A;  1WM3 A;  2JZP A;  3RZF A;  1N61 A;  4A90 A;  2KYW A;  2CHZ A;  5BYQ A;  1V1O A;  2KFK B;  1VJK A;  3VTU A;  3RNE C;  1H4R A;  2IGH A;  1P98 A;  1SSN A;  4FHJ A;  2W3R A;  2J42 A;  4LNN A;  2JSV X;  1WXV A;  3KYD D;  3ECI A;  3QHT A;  3ZIM A;  2KKC A;  1EM7 A;  2KVZ A;  1WMH B;  3AE9 B;  2LGD A;  3HK0 A;  2BKR B;  2KO3 A;  1UUP A;  1YN3 A;  3A9K A;  1ZDV A;  1TS5 A;  3C8Y A;  1Q0W B;  2IY1 B;  3QAR A;  5BMH A;  4JPS A;  4IUM B;  1MHX A;  2KWC A;  2D3C A;  4AJW A;  4IWQ A;  4LDT B;  3BY4 B;  4B95 A;  1F9J A;  5GMV A;  4LDT D;  4HK2 A;  2HD5 B;  1YQ3 B;  1R4N B;  2K5P A;  1ESF A;  5BYR A;  3S2A A;  3PZD A;  1SE4 A;  1Y8R C;  5MPO A;  4NPN A;  1TTN A;  3I3T B;  1EU4 A;  1D3Z A;  3NY5 A;  2DX5 B;  1E8Z A;  4AP4 C;  4KSL C;  2Y5P A;  1BXT A;  3ZNH B;  1D5X C;  2ONQ A;  3MP9 A;  3R2I A;  4OZC A;  4LK0 M;  3VUY A;  5LXI B;  3NZU A;  1E7V A;  2JYE A;  2ZJD A;  4N59 A;  4KGS A;  3WAL A;  3PTF C;  3DVN U;  4HDQ A;  4MM3 B;  2AWT A;  2JY6 A;  2RR9 A;  1WSP A;  1WE7 A;  4ZYN A;  4TQ0 A;  3ONS A;  5FKA C;  2EKE C;  4MH0 E;  2K8C A;  5L83 A;  2BKF A;  1D6E C;  4GDK A;  1T0S C;  2YEP B;  4RM8 A;  4BKS A;  2LVP A;  2WXF A;  3UIN B;  3EGR A;  2VH1 A; 
#chains in the Genus database with same CATH homology
 4C7Z A;  4ZHP A;  1F2R I;  2V3P A;  1TS4 A;  2GI9 A;  1GTH A;  1UWX A;  2FUG 1;  2PTL A;  4XDD A;  2PVO D;  4MH8 A;  3MFG A;  1IBX A;  4RNA A;  2H88 B;  3T3O A;  1JRP A;  2W82 A;  1ZOY B;  2Z8L A;  3ETR A;  4L2Y A;  2WDV B;  4RFB A;  4M0W A;  3IT4 B;  3P4P B;  2M19 A;  4RGM A;  1GPX A;  4AQ7 A;  5EE0 A;  2RMM A;  3HVD A;  2JQR B;  1UGJ A;  5G5G A;  3W5U B;  3NZ3 A;  3AMZ A;  3LXF A;  1FEH A;  2MH7 A;  5JXV A;  2LFI A;  1H7X A;  4B0M A;  3NUH B;  2LGI A;  1QT9 A;  2R61 A;  3Q69 A;  3Q8E A;  3U4E G;  3TEW A;  4WIP A;  2FBW B;  3AE1 B;  2KAC A;  2EKI A;  3DWG C;  3NVW A;  3TUO A;  5HI1 A;  1KFY B;  2WDR B;  1V1P B;  1I4R A;  1H7W A;  4A8X C;  1FXA A;  2LHD A;  4ZRP A;  2AQ2 B;  3B9J A;  1UWM A;  1ZE3 D;  4CQN A;  2WXJ A;  4DQO C;  4DXF A;  2WS3 B;  4RH6 A;  3TSS A;  3UI3 A;  2TSS A;  1DYQ A;  5C2T B;  1CJE A;  2AX5 A;  3N9Y C;  3U7Z A;  2Y3A A;  1I7H A;  1RYJ A;  1TKG A;  1HA5 A;  3GS2 A;  2AQ1 B;  5FK9 C;  1DOI A;  4Q2J A;  4ZOH C;  1NYR A;  2BT6 A;  2SAK A;  1TJE A;  1KTK A;  1WRI A;  2WXI A;  1N60 A;  3AE4 B;  1N5W A;  2D5G A;  1XLP A;  2BB6 A;  1ZP0 B;  3TEZ A;  1HZ6 A;  1QOA A;  3V3X A;  2IGG A;  3V05 A;  2BYT A;  2J53 A;  1E10 A;  2IJ0 A;  1RWS A;  4GDL B;  1XLN A;  2MJD A;  4RGO S;  3W2D A;  1TKY A;  5GXG B;  2WQY B;  2QSD A;  1NYQ A;  1PDX A;  3B2G A;  4RGT A;  1QKZ A;  4KKJ A;  2MJE A;  2BS2 B;  2KAJ A;  4USA A;  5C3J B;  1MVK A;  3FIL A;  3AM9 A;  4XDC A;  1KH0 A;  3BZD B;  1TYG B;  1OQQ A;  4R3D A;  1PFD A;  3ZYY X;  1AWD A;  3BII D;  1EWC A;  1IBX B;  5D3D A;  2WXH A;  1DOX A;  2MEK A;  3IT6 B;  2WXL A;  3MHZ A;  3W5V B;  2ZW0 A;  1SE3 A;  4FXC A;  4REZ A;  1E6E B;  1FFU A;  4OW0 A;  3WCQ A;  1VZ7 A;  1RM6 C;  1V1P A;  4B0E A;  1FRD A;  1MI0 A;  1SEB D;  1T5X D;  4L23 A;  2KN4 A;  3U52 E;  4C56 C;  5TSS A;  4RGN A;  1I4H A;  5I4D A;  2G9H D;  2CJO A;  1L0X B;  1E0Z A;  4HEA 1;  4ZRQ A;  2QMT A;  2ON8 A;  3W9C B;  1SE2 A;  1C9F A;  3BK2 A;  3AEF B;  2RPV A;  1L4Z B;  2PW9 A;  4RF1 A;  4YTM B;  2JX5 A;  2LHE A;  3AN1 A;  5BYS A;  5EE9 A;  4YWG G;  1C76 A;  2SEB D;  3AB5 A;  1WYG A;  4KX6 B;  3BVZ A;  1FIQ A;  3P4S B;  1J7C A;  2J4X A;  2JYT A;  3U2S C;  3ZQ4 A;  1P7F A;  3IXS A;  2I38 A;  2DBY A;  1FM0 D;  4GLS C;  1K50 A;  3I57 A;  2INP E;  3HUI A;  1C4A A;  4WH4 A;  1FNW A;  2BS3 B;  1K52 A;  2ACZ B;  1M4V A;  2QJL A;  2DWQ A;  2NTT A;  4XE0 A;  1E7P B;  1L5P A;  3FAH A;  2V4I B;  3HRD D;  2DLB A;  1ZUD 2;  2QIL A;  1GT8 A;  2NTS A;  1OFF A;  1QF6 A;  2K22 A;  1JML A;  2ICI A;  1VLB A;  1F2R C;  4P6V F;  1YQ4 B;  3TEY A;  4HRS A;  3AE3 B;  3MC0 B;  1WGK A;  1SBB B;  1B1Z A;  3FIL B;  3P42 A;  3P4Q B;  2KWD A;  2K0P A;  4EE2 A;  1L4D B;  3Q8C A;  4UDU C;  3DWM A;  3Q8F A;  4O1N A;  3VR9 B;  3E9S A;  1KLU D;  1BML C;  5HHD G;  2KQ4 X;  5LNK 1;  4KKI A;  4YXD B;  1FNV A;  5HFY A;  4YSY B;  2XNA C;  3ZJT A;  2M0A A;  2WU5 B;  2JWU A;  3FC4 A;  1FD6 A;  1YMH E;  2LMC A;  3H8H A;  3SR6 A;  2NMQ A;  1C79 A;  1ZDX A;  3ABV B;  1ROE A;  1YN5 A;  5D7G A;  4H2A A;  1SB3 C;  1Q10 A;  3GP7 A;  1ACC A;  1JWB D;  3P1M A;  3Q8A A;  2X38 A;  3R2T A;  3RFZ B;  1IGD A;  4US8 A;  1VR9 A;  1D5Z C;  4LTU A;  1JQ4 A;  3CIR B;  1QOF A;  4P16 A;  3TEX A;  4KGT A;  1C77 A;  4TQ1 A;  1N63 A;  2E6X A;  5E6J A;  1WXQ A;  3R8B A;  4XWT A;  3AV8 A;  2VZK D;  5G5H A;  3LYY A;  2RDG A;  2N7J A;  2JU6 X;  3BYT B;  3E56 A;  1NI3 A;  3KWL A;  2PMV A;  3VQI A;  4AS1 A;  4RF0 A;  4NAM A;  2L83 A;  2WXR A;  5T8I A;  3T3N A;  3BWU D;  1JW9 D;  1DGJ A;  1JWU D;  1I4Q A;  1JWM D;  3BVG A;  2QIE B;  4NZL B;  1QOB A;  2PVG C;  4ARC A;  1PGB A;  4WQM A;  1SIJ A;  2KMM A;  1C4C A;  4WAF A;  2EEL A;  1AYF A;  1KLG D;  1J7A A;  1P7E A;  1T6B X;  2B76 B;  4NAW B;  3B2F A;  4LLG M;  4L1B A;  2WXG A;  4YSZ B;  3AEG B;  2IPK D;  2G1E A;  3VRB B;  3BK1 A;  4ZYS A;  3P63 A;  2PLP A;  3P4R B;  1Y56 A;  1XXG A;  1SF0 A;  1YNT E;  2BB5 A;  3ZJU A;  2W55 A;  4JWS C;  2RDH A;  1N5X A;  1IGC A;  2XN9 C;  4MAC A;  1RFK A;  4IOI E;  1KF6 B;  1HZ5 A;  1VRA B;  5BMG A;  1PUT A;  1C4P A;  2W54 A;  1ZPS A;  4MT5 A;  2FE8 A;  4TMA B;  1WWT A;  3NVZ A;  2VZK B;  1L6U A;  1NEN B;  4YSX B;  2Y5C A;  3AEB B;  3AEA B;  3GB1 A;  2V0G A;  3J9C A;  1FXI A;  1F77 A;  1QIL A;  1PGX A;  5BMI A;  1CQV A;  2YEP F;  3AEE B;  4YT0 B;  1FMA D;  3VR8 B;  1JCK B;  1DOY A;  1XO3 A;  1JRO A;  3BYY B;  1GB4 A;  3VRA B;  4OZA A;  2N9K A;  4A6Q A;  1K51 A;  2WXO A;  2WXP A;  2IGD A;  3AE2 B;  5D3I B;  1K53 A;  4GDK B;  3IAS 1;  4A9A A;  1JWS D;  2OED A;  4YTN B;  1L6V A;  1EU3 A;  2L52 A;  1TY0 A;  3RPF C;  3AED B;  2MJ3 A;  2GB1 A;  5H92 C;  2WU2 B;  1ET9 A;  4ITK A;  3KLS X;  1TS3 A;  1J7B A;  3PZ8 A;  4N58 A;  3EA6 A;  3I9V 1;  4OVZ A;  1UNS A;  3OWE B;  2JXT A;  1QLB B;  1N62 A;  1AW7 A;  3W1S A;  5FR3 A;  4ARI A;  1ENF A;  1FRR A;  4OZB A;  2HTM E;  2LEK A;  2I2Y A;  4HKQ A;  1SJH D;  4KGR A;  2WNM A;  4US9 A;  4HKZ E;  4OHJ A;  1PGA A;  4C80 A;  1FCL A;  2QEJ C;  3LB8 C;  2N9L A;  1V8C A;  1GTE A;  2L32 A;  1CK1 A;  1NEK B;  1ZXI A;  5AUI A;  1JWA D;  3AE5 B;  1I4P A;  1FNU A;  2GRI A;  2CU3 A;  1L0Y B;  3PO0 A;  2W3S A;  1GOZ A;  3SFD B;  2JZP A;  3NVV A;  3NVY A;  4XWW A;  1N61 A;  3AEC B;  3MJ5 A;  4A90 A;  1ZXH A;  1OQR A;  1IUE A;  5BYQ A;  4IDI A;  1V1O A;  2Q5W D;  3NS1 A;  1GAQ B;  1VJK A;  1AN8 A;  1B9R A;  1QOG A;  1CZP A;  3SEB A;  4ZHO A;  1PYW D;  1FO4 A;  2IGH A;  4RCO A;  1VDV A;  2DYM A;  2V3N A;  1EWY C;  1SSN A;  2WLB A;  2OHF A;  1MPE A;  1XCQ L;  1MHH E;  2W3R A;  2J42 A;  3O13 A;  2JSV X;  2WXQ A;  2BTE A;  2BBC A;  2IDY A;  2H89 B;  1EM7 A;  2DYO A;  3AE9 B;  3ZJV A;  1HQR D;  1UUP A;  3SFE B;  1YN3 A;  1I4X A;  1ZDV A;  4JWU C;  2E3T A;  2LUM A;  1TS5 A;  3C8Y A;  4TSS A;  1I4G A;  2J52 A;  4DXG A;  5BMH A;  5HG2 A;  3L4P A;  2WXM A;  4JPS A;  3BVM A;  1GB1 A;  5EE1 A;  1MHX A;  1R7S A;  2M56 B;  1TY2 A;  1KRH A;  1T3Q A;  1JAL A;  4C7Y A;  3KQ4 A;  2PKO A;  1FFV A;  1STE A;  1D4B A;  1YJI A;  4JX1 C;  1YQ3 B;  1F0Z A;  2K5P A;  1ESF A;  5BYR A;  1XEE A;  3HVZ A;  2WDQ B;  1SXT A;  1VZ6 A;  2WXK A;  1XLO A;  2WP9 B;  1XLQ A;  2K9X A;  1TKE A;  4WUR A;  4WWM A;  2PIA A;  4YTP B;  1SE4 A;  4A55 A;  1E9M A;  5MPO A;  2INN E;  3EUB 2;  1EU4 A;  1HEZ E;  2HDE A;  5EE3 A;  3IAM 1;  2Y5P A;  1NVI D;  2N0S B;  1QQR A;  2BW2 A;  1BXT A;  1D5X C;  4N6E B;  1D5M C;  2ONQ A;  1YN4 A;  3MP9 A;  3NRZ A;  3R2I A;  1YJJ A;  1FCC C;  1TS2 A;  4J3O D;  4OZC A;  3PZ7 A;  4LK0 M;  1HXY D;  2L1A A;  1ET6 A;  1XCT L;  3AE8 B;  2JYE A;  3CF4 A;  5H8Y E;  4IKG A;  4N59 A;  1C78 A;  4KGS A;  2K3U A;  1VZ8 A;  3Q8B A;  4D2K A;  1L0V B;  4MM3 B;  2LJI A;  1SJE D;  1TZO A;  2CJN A;  3URY A;  1WSP A;  1A70 A;  4HRO A;  4TQ0 A;  4NJC A;  5FKA C;  2BS4 B;  4PT5 A;  2ZW1 A;  3AE6 B;  4JE3 B;  2AQ3 B;  3AE7 B;  1BUI C;  1D6E C;  1XF5 L;  2YEP B;  1V97 A;  3KWV A;  3ZGZ A;  2KDM A;  2WXN A;  2WXF A;  3AH7 A;  4HJG E;  5AUK A;  3EGR A;  3CWI A;  1LO5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...