2WQYB

Remodelling of carboxin binding to the q-site of avian respiratory complex ii
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
239
Chain Sequence
b'TSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Remodelling of Carboxin Binding to the Q-Site of Avian Respiratory Complex II
rcsb
molecule tags Oxidoreductase
total genus 69
structure length 239
sequence length 239
chains with identical sequence O
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wqyB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wqyB01
1JALA 1J7AA 2K9XA 2PIAA 5EE9A 1OQRA 3B9JA 1RYJA 1N5WA 3AE8B 1XLNA 2KAJA 1TYGB 3P4RB 2CJNA 4ITKA 1I7HA 1VDVA 3EUB2 2WLBA 1QT9A 1JRPA 2M19A 4WQMA 3DWGC 4YSYB 1N61A 1XLOA 3AB5A 1DOIA 1TKYA 2LEKA 1OQQA 1L5PA 1L0VB 5MPOA 2H89B 4YT0B 3VRBB 3HUIA 3PO0A 2WDVB 4A9AA 5AUIA 1YJIA 4YTMB 1N62A 1QOGA 3ABVB 1JW9D 1NYQA 1EWYC 2WDRB 3L4PA 3AEFB 1VLBA 3AV8A 1KF6B 2WQYB 2PKOA 2Y5CA 2DBYA 4N6EB 1FRDA 1ZUD2 2W3SA 2QIEB 4US8A 2H88B 1SB3C 3HRDD 1XLPA 3AECB 3NS1A 1E0ZA 1TKGA 3CWIA 1ZOYB 1DOYA 1FRRA 1YJJA 4ZHPA 4JWUC 1F0ZA 1DGJA 2G1EA 2PVGC 1ZXIA 1N5XA 4YSXB 1A70A 1XO3A 5EE0A 1YQ3B 3P63A 1QOBA 1NI3A 3ETRA 1FXIA 4C7ZA 2KMMA 5EE3A 1FFUA 1AYFA 4IDIA 4ZOHC 1PUTA 1UWMA 3P4QB 2OHFA 2W3RA 3AE1B 3B2FA 3CIRB 1SF0A 1GAQB 1CZPA 1L6VA 1WXQA 3AMZA 4JX1C 2JQRB 1QF6A 3AN1A 3ZYYX 4KX6B 3VRAB 1RM6C 3WCQA 3VR8B 1CJEA 1L6UA 2N0SB 1N63A 1E9MA 2MJDA 3AE4B 1FIQA 3LB8C 3VR9B 2CJOA 1DOXA 3BIID 1GPXA 3AE5B 1E6EB 1WGKA 4LTUA 3NVWA 1GTEA 1FXAA 2WS3B 3AE6B 1RWSA 1V8CA 2PVOD 1R7SA 3AEEB 5EE1A 2W54A 1RFKA 5C3JB 1JROA 2WU5B 2BS3B 2MH7A 4P6VF 4YTPB 3DWMA 4FXCA 1J7BA 1NENB 1AWDA 2K5PA 3AEAB 2FBWB 1JWBD 2MJEA 5GXGB 2HTME 2ACZB 1T3QA 4USAA 5G5GA 2M56B 1NEKB 3SFDB 3NVZA 3LXFA 5G5HA 5C2TB 2Q5WD 1WWTA 1NYRA 1N60A 4YSZB 3SR6A 2L52A 3AE3B 1PFDA 3KWLA 3HVZA 2W55A 1VJKA 2L83A 3W5UB 3FAHA 1QOAA 1B9RA 2E3TA 4WWMA 1TJEA 3AE2B 2EKIA 3NRZA 1GTHA 1JWAD 1E10A 1QLBB 3RPFC 3P4PB 2AX5A 1WYGA 4YXDB 3AE9B 3AM9A 4N58A 2QJLA 2WP9B 1SIJA 3CF4A 1FFVA 1ROEA 3AE7B 2WDQB 2BS2B 1QOFA 1PDXA 2JX5A 2K22A 3AH7A 3B2GA 4HRSA 4HROA 1H7WA 4ZHOA 1IUEA 4N59A 3SFEB 5H8YE 3P1MA 3AEGB 4US9A 1NVID 3NVYA 1FM0D 2CU3A 1OFFA 1KRHA 5H92C 1KFYB 4YTNB 4C80A 3AEBB 1ZP0B 1E7PB 1GT8A 1H7XA 1TKEA 2DWQA 2B76B 1J7CA 2BS4B 3AEDB 1XLQA 2WU2B 2MJ3A 1V97A 3FC4A 1FMAD 1WRIA 3NVVA 1FO4A 1JQ4A 3P4SB 4JWSC 3W9CB 1YQ4B 2BT6A 5AUKA 4C7YA 3W5VB
chains in the Genus database with same CATH superfamily
2OOBB 1STEA 1WM2A 1E8YA 4RGMA 2KDEB 2D11A 3A9KB 3AE8B 3M63B 4ANWA 5IA7A 2WX1A 2XBBC 5AEKB 1KM7A 1V6EA 5AUIA 1Z2MA 3B1LX 3L4PA 5I4DA 2MQJA 3I63C 2NVUI 3NS1A 3OJ3A 2AWTA 4XE0A 1WMHA 2MBQA 1H4RA 2BW2A 2IBIB 1ZXIA 2XK5B 1JRUA 4C7ZA 1CQVA 3HVDA 4KGTA 4MM3A 1UWMA 5C1ZA 4KGRA 1FEHA 2KN5A 3VUWA 2JQRB 4ARCA 1E9MA 1UUPA 3LB8C 1WX9A 3PVLA 3TIXA 2L3ZA 4W9IA 4K3BA 1XF5L 4PS8A 1MJDA 2M56B 1GNUA 3ENEA 2C7NB 5HKHA 2DHZA 4YL8A 2J53A 2ON8A 3KUZA 2INPE 1PFDA 2LJIA 3IG3A 2MCNB 1TBEA 2JSVX 1QOAA 5D3DA 3Q6BA 3IT4B 3MTNB 4JLCA 3UQBA 2ZNVC 3ZIMA 3ZNID 3PLUA 1WYGA 3U2SC 2CHWA 1ROEA 1P9DU 1JWMD 1WJUA 2BGFA 1XXGA 1M94A 1ZP0B 2FNJB 5LLIA 2WU2B 4KSLC 4IM2A 3RZWC 2BT6A 1LFDA 1E8WA 3L54A 2BQQA 4CHKA 3I5JC 3VFKA 1WJNA 4JGHB 1I4GA 2FIFA 4ASWC 4ITKA 1I4RA 2DYOA 2IO1B 2IDYA 2O2VA 4HWIB 3K9PB 5KHQA 2L7RA 1YJIA 4YTMB 2ZW0A 1QOGA 2LRWA 1JW9D 1EWYC 4MDKE 3V6EB 3AEFB 3NHEB 3WIMA 1KF6B 2C7MB 2QIEB 4KKIA 4WH4A 3VDZA 1KTKA 2IGDA 3N1YC 4NQKE 2WX0A 4HVBA 3U8ZA 3MFGA 2ASQA 2DX5B 5IOIA 3PT2B 1WGHA 2HJ8A 2VH2A 3DPDA 3DVNU 1QOBA 5HI1A 2YEPB 2E6XA 1YN3A 2FUG1 4L1BA 1AYFA 3JVZX 2MA9B 1JWUD 4ZYSA 3KUDB 1YN5A 5CHWA 3AE5B 1WE7A 2XNAC 3NVWA 3RNAC 1RWSA 2INCC 2UYZB 2W54A 2PW9A 2JRIB 3T3OA 5KHOA 2X8XX 2M0AA 1YQBA 2KN4A 2KWDA 3PS6A 1JCKB 1RAXA 2VZKB 3P2BA 2R2QA 5JHAA 4H2AA 3QX1A 2WXRA 4W9EA 3W5UB 2XEWA 1V80A 4HPMB 4E74A 1QQRA 4DWFA 1QLBB 2MLBA 3A9KA 2QJLA 1FCCC 1V5OA 4WJNA 2GBMA 2M8SA 4PYUA 4NAWA 2FCNA 1ZKHA 3PGEA 2AYOB 2GBRA 1P3QU 2Y5PA 1GT8A 1TKEA 2NCNA 2HD5B 3FC4A 1V97A 3R66C 3P4SB 3QC8B 2RMMA 4B0MA 2PIAA 1E5WA 4PYZA 2CJNA 1X1MA 1YJ1A 3P42A 4GB9A 1TKYA 4PK1A 4GXBA 1V81A 4MGKE 3RN9C 2IZVB 3PZ8A 3ZDMC 3L0WB 3BY4B 2NPTB 3QHTA 4WQOB 1WXSA 1UBIA 2VZKD 3A4RA 1GC7A 2BB6A 4DXGA 1FRDA 4KIKA 3WANA 3EFUA 1J0GA 2GLSA 1DOYA 3IXSA 2BYFA 2WXJA 2AQ2B 4YSXB 2MX2A 2W82A 1F2RI 1HQRD 2OHFA 4GIVA 3TL5A 2BVCA 2JVCA 2KFKA 4IDIA 1N63A 3E56A 3PRPB 2ZW1A 2BF8B 1T0RC 2C7HA 3C19A 1FNUA 3IAS1 3RYTA 1DYQA 3TBLD 1SBBB 2BKFA 3UQAA 2K5PA 4JE3B 1E7UA 2JF5A 2JT4B 3DCGA 2ZVOA 2MEKA 4MT5A 4W9CA 5C2TB 4HXDA 4ICUA 4XGAB 1EM7A 3VTWA 1Y56A 4IWOA 4XYCA 1EUVB 2I1JA 3ZKJC 2E3TA 2EELA 3AE2B 2GBJA 2EKIA 1OTRB 1MG8A 1C77A 3WALA 4LJPB 2RDBC 2WNMA 2MBBB 2FCSA 3HK0A 4QAYA 4K7UA 3RUIB 4F8CB 1CK1A 1E8ZA 1V1PA 1J7CA 3AEDB 3U7ZA 1WRIA 1GB4A 2KDBA 1JMLA 1OQRA 2NBWB 1RYJA 1N5WA 1Q0WB 4HLEA 1VDVA 4BVUC 3EUB2 2WLBA 1F1HA 3BYTB 5BYSA 1K53A 5JZEB 4DHJB 1WJ6A 2Y3AA 3OLMD 2WDVB 2FIDA 4BKGA 4HCNB 4OHJA 4BKTA 2KJRA 2ZCCA 3FILB 4US8A 2DAJA 2D3AA 1ISNA 2LI5A 2V3NA 2NBUA 5BMHA 1XD3B 4ZHPA 4RCOA 3Q3JA 1V2YA 3R7QA 1FXIA 3PLVA 3ZNGC 1D5XC 4RGOS 1FFUA 1PGBA 1WZ0A 3P4QB 4FULA 1L6VA 2K3UA 2J0KA 1MI0A 3AN1A 4WWPA 1WSPA 3OG5A 4FLHA 4IC7B 2N7DA 5BMGA 1J7BA 4B95A 2HTME 4EFOA 4ICVA 3H7PB 3X0WA 4RGTA 3DBLB 2REXA 3HVZA 5BO4B 3L16A 3Q3OC 1I4HA 2KX3A 2V9HA 2QDFA 4YWGG 4A55A 3H6NA 4N58A 1WMHB 3BVGA 2L8JA 4GU2A 2ZNVB 4MH0E 2Z0EB 2CU1A 3AEGB 1NVID 4WWOA 3TSSA 4MGIE 2NPTA 5HFYA 1XLQA 3B08A 5IN7A 2CHXA 1SE9A 1ZDVA 3NZ3A 1ZDXA 4NJCA 2LWPA 1OEYA 3KUCB 5CHVC 3ZRCA 1WGYA 1LO5D 5JH5C 1AW7A 1L0YB 1L4DB 1LM8B 1WXVA 2H89B 1A5RA 2D2QA 2GBNA 4FJZA 1R4MI 1HA5A 2N4FA 2CS4A 5E6NA 2K39A 2N9EB 3APFA 1N5XA 2HE7A 4J6IA 1NI2A 1MFWA 2ZCBA 3B2FA 2ZVNA 2HTHA 2FAZA 3MC9A 2CJOA 2NTTA 2PVOD 4NZLB 4ZRQA 3M3JA 4FHKA 5CX3A 3AULA 4FXCA 5CTRC 3RNEC 2LHDA 4MJSA 2JU6X 2R61A 1UF0A 4AP4C 3SFDB 3TUOA 1SXTA 2JWUA 2O2VB 1RRBA 4DXFA 5D7GA 2PE6B 4ARIA 1IYFA 1HZ6A 3U52E 1ZXHA 3OWEB 1HZ5A 4KZ0A 2EKEC 4L23A 1V9JA 3RT3B 3MJ5A 1SE2A 3N30A 3KH0A 5IO9A 1JWSD 4IW0A 1Q1OA 4MGYE 2JUOA 1E7PB 4OVVA 1G6JA 4FHJA 3W2DA 1YMHE 4A20A 1MHXA 2KFJA 4HKQA 2FCQA 1JQ4A 2Z59B 2D3CA 4URKA 1WX8A 3FILA 1L4ZB 1TTNA 3B0AA 3SU8X 4DHZB 3BINA 2KLGA 3H7SA 1WXMA 4A90A 3GE8C 1CMXB 2N7JA 2JYTA 1MG4A 1OQQA 4HDOA 4HKZE 2MBHA 3O65B 4IWPA 1ET9A 3J9CA 4DBGA 4G0NB 4XX5A 2H88B 4GGQA 1I42A 2DZJA 4LCDE 3DBHB 3CWIA 1Q10A 4NAWB 1P0RA 3ETRA 3DQVA 3H7PA 3SEBA 1TS4A 4ANVA 3CIRB 1CZPA 1WYWB 4BZAA 1EF5A 4L2YA 1QF6A 1VR9A 2JXTA 3WCQA 2J0JA 1L6UA 5DPWA 2FCMA 5G55A 3CF6E 3AI5A 2WS3B 3AE6B 2XN9C 4MH8A 1C4AA 1RFKA 2BS3B 1UGMA 2CKHB 2LVQA 3UI3A 3ZNHB 2MJEA 4D2KA 2ICIA 4USAA 2K8CA 2WGSA 2K8BA 3N32A 4AQ7A 3ZRFA 4AWJA 5DPTA 3QQ8B 3GZNI 1MVKA 3KWLA 4IM0A 1VJKA 3Q8CA 1WE6A 2KC2A 2DYMA 4J3OD 4B6WA 3KLSX 4RF0A 4WWMA 2LGDA 3NRZA 4II2B 1GTHA 4KIKB 1SJHD 4MGZE 1T0SC 5D94A 4XDCA 4GMVA 1KLGD 4W9HA 1WX7A 3LJ3A 2WDQB 3AH7A 2MRPA 2CU3A 1WGRA 1D6EC 2WXPA 2PE9A 1R4NI 2IGHA 2LUEA 2KFKB 2J52A 2LUMA 4FJYA 5AUKA 3W5VB 4F1SA 1JALA 1FNWA 4RH6A 4LNFA 4GDKB 5J17A 2LGSA 1DOIA 5C23A 2LEKA 4KKJA 3WAPA 4X57B 3KWVA 4EKUA 3H1UA 2QHOA 2V3PA 2KXJA 2WDRB 3U7DA 4XWTA 2Y5CA 1UZXB 2WXLA 4W9FA 3UF8A 3VTUA 4KGSA 2KZRA 2LZ6A 2Z0DB 1DGJA 1A70A 1ENFA 1T0QC 5EE3A 4AUQC 4ZOHC 1PUTA 1MHHE 1V1PB 3TJPA 3Q3NC 3AMZA 2KYWA 1PYWD 5DCNA 1P98A 1E90A 4A6QA 2LHEA 3DVGX 3U4EG 1WGKA 3BZDB 2YEPF 5TR5A 3DBRB 4HJKA 1TZOA 3W1YA 4DDID 4ACFA 1FCLA 3IHPC 1I35A 3ZGZA 2FE8A 2L52A 1C79A 3FAHA 2DENB 1SSNA 4C4VB 1V49A 2KQ7A 5D3IB 3NY5A 1T0YA 3VHTC 1IUEA 2IYDB 4JIOU 2G9HD 2AQ1B 5GMVA 3W9CB 4ZYNA 4AOFA 2BB5A 1SIFA 3U30A 4XZ4A 3ZXVA 2LMCA 4IOIE 1KLVA 1QT9A 2M19A 2G3QB 4EZLA 2BPSA 3EFCA 3KQ4A 1XLOA 4TSSA 4Q2JA 2EMTA 2PLPA 2BYEA 3L17A 1GUAB 3BK1A 2WWZA 5BYQA 4P1BC 1WJ4A 4BBNC 3SHQA 1C1YB 1VLBA 2WQYB 3PREA 1D5MC 2L0FA 1SB3C 4JPSA 2RPVA 2JZ3B 2IO3B 1WY8A 2Z8LA 1I4PA 2ZPNA 1WXQA 3HIZA 3Q69A 1DOXA 1GPXA 2J0MA 4YTPB 4P16A 4C56C 1JWBD 3H9DA 5GXGB 1T3QA 4W9KA 1IGDA 1ZE3D 3TEZA 1SGHA 1N60A 2LGXA 3ML9A 2QC8A 1B9RA 3K9OB 1WIAA 2RSUA 1E10A 3PZ7A 2IJ0A 1SIJA 2JY6A 1FFVA 2K22A 3B2GA 3DVNV 3ML8A 4GDKA 4GDLA 4TQ1A 1F2RC 5LXIB 3RNBC 4S17A 5CHFA 3MC8A 4KDLB 3ZXRA 3Q14C 4FBJB 2BS4B 4EUTA 1FO4A 3NVVA 1ZW7A 4P7IA 1GOZA 1WXAA 3IAM1 4HDQA 1HEZE 3EC8A 3VUYA 3PHXB 1QKZA 4MJSB 3ECIA 4A9AA 3V6CB 1YD8U 4M8MA 3ABVB 2V3SA 3PRMB 4KVGB 2HJ1A 4M00A 3C8YA 2L76A 1ESFA 1XT9B 3AECB 5T8IA 1BMLC 2G1EA 3VTVA 2W9NA 1OEYJ 1RFAA 3R2IA 2I38A 1U4AA 3A1QB 2N0SB 3DBSA 2L00B 3UGBB 3BIID 4RM9A 4WJOA 1S1QB 3RNCC 4C4VA 4ZRIA 4K1RB 2N1WA 3VXWA 2FBWB 4I6NB 4FJVB 2N7EA 4M01A 3LDZE 2L32A 2DZMA 3RNFC 2W55A 2RD0A 5IP4D 2KWVB 3BYYB 5L95C 1XCQL 4HEA1 1C76A 2J4XA 1SJED 4K81A 4ZRPA 2WDTB 3AE9B 1K52A 3BK2A 4LNIA 2JX5A 1ACCA 1FNVA 1H7WA 3WAMA 2NMQA 5LXHA 2WXFA 4N9F4 2QMTA 3RMKC 2GI9A 3DDCB 1C3TA 2KC1A 3QJZA 3IFWB 3P4RB 4LNKA 2KD0A 3ONSA 1JRPA 2C5LC 1EF1A 2K6QA 3Q8BA 2KDFB 4YT0B 3VRBB 3R8BA 2M1MA 3V61A 3R3MA 4A3OA 2UU7A 3I3TB 1TGZB 5EDSA 1SE4A 4FN2A 1VZ6A 3HRDD 3PTFC 1XEEA 5HHDG 5FR3A 2LD9A 1WFYA 1N6ZA 3URYA 1VD2A 3P63A 3QARA 4IUMB 3OAWA 3EHVA 2N9PC 2A5UA 5J18A 2Y5BB 3CMMB 3FKYA 5E6PA 3DHGC 2KDMA 4RNAA 3T3NA 2WU5B 5L83A 5FK9C 1E8XA 2K1FA 3AEAB 1F77A 3Q2AC 4C00A 1HXYD 3VH3B 3CSFA 2VH1A 3I57A 4EZKA 4DHZE 1HTQA 4EEWA 1TS3A 4CQNA 1IPGA 2DNFA 1KLUD 1TS2A 5D2MB 5IKCM 2WYQA 5IAAC 5TSSA 1BT0A 1KOTA 3MHSD 3ZDTA 4EZJA 1HTOA 3ZW3A 1XQQA 1FXTB 5J2RA 1D3ZA 3KVFB 3Q8FA 4LLGM 4M0WA 2SEBD 3P1MA 3NVYA 4GN1A 4BKSD 2MP2B 1Q5WB 3AEBB 1D5ZC 4TMAB 4M02A 3HM6X 4OVZA 5G2NA 1UH6A 1SEBD 4MELA 4LNNA 2O6VB 1PGXA 2K9XA 3ZQ4A 3JSVA 3MC0B 1AN8A 1XLNA 4HK2A 2CHZA 3KW5B 2KTFA 2D07B 2M4NA 1WI0A 3NOBA 2IO2B 4DK5A 2RDGA 3AXCA 4DQOC 4FADA 3HUIA 2J7QB 2DLBA 4ZDVA 2QSDA 4BBNF 1N62A 1TT5B 2GBKA 2IY1B 3V3XA 1L2NA 3A1QA 2DBYA 4N6EB 3ZO5B 1C9FA 3D32A 4PT5A 5HG2A 2L0TA 2ZPYA 3DWMA 2W3RA 2L1AA 2ZJDA 1GAQB 2M17A 3TEYA 4RM8A 1CJEA 2ZEQA 1BUIC 3GOEA 1OQYA 1P7FA 4BAXA 1JROA 2LGIA 3SDLC 2O6VD 1AWDA 3LYYA 2NTSA 4DXAB 3V05A 3LXFA 5AZGA 2QCZA 3VVWB 2MBEA 1VZ7A 4NPNA 5D6JB 3L08A 1L7YA 3RFZB 1I4XA 2WXIA 2PMVA 4EE2A 4YXDB 4EOYA 2QILA 1EO6A 2X38A 1V86A 4HRSA 1NDDA 4TV3A 5LNK1 4N59A 4I6LB 2IPKD 3NUHB 1FM0D 4REZA 1OFFA 2OEDA 4B9KA 4YTNB 1LGRA 4C80A 2DWQA 1H7XA 2KTRB 3GE3C 3PV1A 3ZJUA 4JWSC 2MBOA 4ZRJA 5EE9A 1PGAA 1T5XD 5BYRA 2K25A 3VUXA 2KAJA 1I7HA 2J42A 4YSYB 4BKSA 3DBLI 3A33B 2JRHA 2GB1A 3RCZA 3BWUD 3TMPB 3KYDD 2LJ5A 2KQ4X 3ZVVA 3UIPB 1GB1A 2KWCA 4HPPA 2LFIA 2D10A 3AV8A 4XWWA 2KDIA 1ZUD2 4RGNA 2K8HA 3V60A 1IBXA 1TKGA 3OJ4B 4O1NA 4WAFA 2N9XA 3TEXA 4IWQA 4GDLB 1YQ3B 1ZPSA 1TIFA 1UELA 1WRDB 1KJTA 2BWFA 2RPQA 2V1YA 4OVUA 3JW0X 4KX6B 2KO3A 2KACA 2BTEA 3VR8B 2OJRA 4GSWA 1FIQA 2GOWA 1F9JA 4WJPA 5DPRA 3ZLZA 2YLMA 4PS3A 5H92C 1FXAA 2NR2A 1TY2A 3L13A 1WF9A 5C3JB 1WZ3A 2MW5A 2MH7A 4PS7A 5E6JA 2JXXA 3Q3FA 3SR6A 2MP2A 4MSQB 2V0GA 2AEHA 2DZKA 3IT6B 2D3GA 4WURA 2KVZA 4LJOB 2O6VA 4XDDA 2YVCA 3AM9A 2WP9B 1VCBA 3AE7B 1QOFA 4HROA 4ZHOA 5H8YE 3A4SC 4OZAA 4NAMA 3ZTDA 3T9LA 1TS5A 5JXVA 3HHMA 2IO0B 3N3KB 1KFYB 3T8MA 4HCPB 1V5TA 2G4SA 2R2OA 1QILA 2BWES 4AJYB 1LQBA 4K7WA 3PZDA 4JL9A 3MJWA 1NBFC 4IM3A 4R3DA 4LNOA 5FKAC 2KJHB 2KHWB 1I4QA 3PO0A 1NYQA 4P1CC 3ZJVA 3DHIC 4LK0M 3GP7A 3QCAA 2W3SA 2LRUA 3BVMA 4NQLB 2INDC 3RNGC 4AS1A 3UIOB 1QZEA 4TKNA 2KX0A 2HDEA 4WWNA 4G50A 1YOVB 4NNJB 2N1VA 2V4IB 1GTEA 1R7SA 4LDTB 2WXNA 5JHBA 3HM3A 4HPLB 3QA8A 2ACZB 3Q8EA 3H8HA 3IBEA 2DAFA 4KZCA 2M0XA 2DZIA 4G11A 4WIPA 2KTRA 1WGGA 3DBHI 2KQSA 1WGDA 2FUHB 1R4MB 2AQ3B 1ZGUB 3O13A 2JZZA 1UWXA 1E7VA 2RR9A 2XK5A 2PPHA 2KK8A 2LXCA 1UGJA 3M95A 1EU4A 3RULA 4CYEA 3RD2A 4F7ZA 3A9JB 4W9DA 2LVPA 3X23A 4C7YA 1J7AA 4WJQA 1H8CA 3C0RB 2VRRB 3B9JA 3WAOA 4E71A 2ZZPB 1TYGB 3W1SA 2RGFA 2WXOA 2IY0B 4GOCA 3AB5A 4LDTD 4OZCA 2N9KA 2L05A 1L0VB 1Z5SB 4OZBA 4OW0A 2OJWA 3EECA 1YX5B 2LVOA 2I1KA 3JYUA 1Y8RC 4RF1A 4W9GA 3SD5A 1E0ZA 3MHZA 2KMCA 1ZOYB 1AARA 4M0WB 1FRRA 4JWUC 1EWCA 1XO3A 2GMIC 2UWQA 4II3B 1VRAB 2DYBA 2K0PA 4BOZB 1FPYA 3Q3MC 3ZYYX 4G3XB 3MP9A 2JWZA 1L0XB 3W1SC 3VR9B 1GC6A 3WA0A 1E6EB 1J19A 1V8CA 1XCTL 3JSVB 3QAQA 4M8NA 3NG0A 4ANUA 2WXHA 2WXKA 1C4CA 1RLFA 3UINB 5G5GA 1B1ZA 3NVZA 1K51A 1EU3A 2RDHA 2WHIA 4YSZB 4E3CA 1F52A 4ZRKA 2KOXA 4TUUA 5E6OA 1UD7A 3EGRA 1TJEA 4JQWC 3ZTCA 1WM3A 4I6PA 3RI7C 2AX5A 3TEWA 2WXMA 2D5GA 1K50A 1TY0A 3S2AA 1FD6A 2C9WB 1GJZA 2A4ZA 1UNSA 2KKCA 1KH0A 1WR1A 2IGGA 3GS2A 2MJ3A 2QEJC 5AZHA 4B0EA 2LXAA 1VZ8A 3L10B 3APDA 3DBRI 5AZFA 4W9JA 2KWUB 4WQMA 3DWGC 4TQ0A 1N61A 3N1XC 4NJ6A 3PPAA 2GRIA 2B3AA 2BYVE 4S0RA 1ET6A 3R7RA 5MPOA 1YNTE 2MHJA 2NBVB 2PEAA 3GZNB 2PKOA 4NJ7A 4MACA 3IVFA 4A3PA 1XLPA 2SAKA 1YIWA 4UDUC 2PVGC 4HJGE 1IP9A 4K3CA 4CO7A 1P7EA 2V4LA 3AE1B 2MWSB 3ZNZB 3E9SA 1YN4A 4JX1C 1WR6E 4DHJD 3N9YC 3PSEB 3VRAB 3AE4B 4W9LA 2INNE 1R4NB 2KNBA 4RFBA 3NZUA 5EE1A 3AEEB 2LGYA 3N1ZC 3APCA 4K7SA 2KT7A 1NEKB 4XC2A 5G5HA 2G4DB 2Q5WD 4KSKC 4MM3B 1WWTA 3ALBA 4KDIC 2MSED 1OGWA 2KMAA 3KYCD 4NY0A 2C60A 4ANXA 3V62A 3Q8AA 4DDGD 3A9JA 1GG3A 2NS5A 1IBXB 4AJWA 1M4VA 2K6DB 4MEMA 2BYTA 2G45B 3CF4A 3BVZA 1PDXA 3SFEB 1K8RB 4WAAA 3AU5A 1KRHA 3NS8A 1HE8A 3CSTA 1YX6B 2KVRA 2KLCA 3I9V1 1T6BX 1FMAD 3NZSA 2ONQA 4KV2A 1PQSA 4BFRA 1WH3A 3DVGY 1D4BA 2PTLA 1L5PA 4IG7B 3QIJA 2KJ6A 1P1AA 4MSMB 3QK0A 3PRZA 1TZ1A 3AU4A 3PHWB 3M62B 3RZFA 2EMSA 1F0ZA 1YJJA 2JZPA 5EE0A 3TCAA 1NI3A 2KMMA 5DPSA 1SF0A 2TSSA 5BMIA 1RM6C 2BBCA 1C4PA 2MJDA 3QWZB 4A8XC 4LTUA 5FR6A 2WXQA 2LASA 1IGCA 4P6VF 1NENB 1S3SG 2N9LA 3DOWA 1NYRA 3VAWA 1V1OA 4GLSC 3ZUNA 3AE3B 2L83A 3R2TA 3DHHC 2JPHA 3VH4B 1SE3A 1JWAD 1BXTA 2AL6A 4IKGA 3RPFC 2AL3A 3P4PB 3GB1A 1C78A 2BKRB 2JYEA 3ZJTA 2BS2B 1MPEA 1LXDA 3VQIA 4US9A 2WXGA 1UBQA 3EA6A 2KANA 2CR5A 2D3BA 1J8CA 3NJTA 2B76B 2I2YA 4BOSC 3N20C 4RMAA 2PJHA 1YQ4B 4FA6A
chains in the Genus database with same CATH topology
1GOZA 1ZDXA 4NJCA 1STEA 3IAM1 4RGMA 1HEZE 3AE8B 4R3DA 1LO5D 5FKAC 1QKZA 1AW7A 1L0YB 1L4DB 2H89B 1I4QA 4A9AA 3PO0A 5AUIA 3ABVB 1NYQA 3L4PA 3ZJVA 5I4DA 4LK0M 3GP7A 1HA5A 2W3SA 3C8YA 3BVMA 1ESFA 3AECB 3NS1A 5T8IA 4AS1A 4XE0A 1BMLC 2BW2A 2G1EA 1ZXIA 1N5XA 4C7ZA 1CQVA 3HVDA 4KGTA 1UWMA 2HDEA 3B2FA 4KGRA 1FEHA 2JQRB 3R2IA 2I38A 4ARCA 2N0SB 1E9MA 1UUPA 3LB8C 2CJOA 2NTTA 3BIID 2V4IB 1GTEA 2PVOD 1R7SA 4NZLB 4ZRQA 1XF5L 2WXNA 4FXCA 2FBWB 2LHDA 2ACZB 3Q8EA 3H8HA 2JU6X 2R61A 2M56B 3SFDB 3TUOA 1SXTA 2JWUA 2L32A 4DXFA 2J53A 2ON8A 5D7GA 2INPE 1PFDA 2LJIA 2W55A 4WIPA 4ARIA 2JSVX 1QOAA 3BYYB 5D3DA 1XCQL 3IT4B 4HEA1 1C76A 1HZ6A 3U52E 2J4XA 1SJED 1ZXHA 3OWEB 1HZ5A 2AQ3B 3O13A 4ZRPA 1WYGA 3U2SC 4L23A 3AE9B 1K52A 3BK2A 1UWXA 1ROEA 2JX5A 1ACCA 1SE2A 3MJ5A 1JWMD 1FNVA 1H7WA 2NMQA 1JWSD 1UGJA 1XXGA 1EU4A 2WXFA 1ZP0B 1E7PB 2QMTA 3W2DA 1YMHE 1MHXA 2WU2B 4HKQA 1JQ4A 2GI9A 2BT6A 4C7YA 1J7AA 3FILA 1L4ZB 3B9JA 1I4GA 1TYGB 3W1SA 3P4RB 4ITKA 1JRPA 1I4RA 2WXOA 4A90A 2DYOA 3AB5A 2N7JA 2JYTA 3Q8BA 2N9KA 4OZCA 1OQQA 2IDYA 1L0VB 4OZBA 4YT0B 3VRBB 1YJIA 4YTMB 2ZW0A 4OW0A 1QOGA 1JW9D 3R8BA 1EWYC 3AEFB 4HKZE 1KF6B 1ET9A 3J9CA 4RF1A 1SE4A 2QIEB 2H88B 4KKIA 4WH4A 1VZ6A 3HRDD 1KTKA 2IGDA 1E0ZA 1XEEA 3MHZA 3CWIA 5HHDG 1ZOYB 5FR3A 1FRRA 1Q10A 4JWUC 4NAWB 3MFGA 3URYA 1EWCA 1XO3A 5HI1A 3P63A 1QOBA 3ETRA 2YEPB 2E6XA 1YN3A 1VRAB 2FUG1 4L1BA 3SEBA 1AYFA 1TS4A 3CIRB 1CZPA 1JWUD 4L2YA 2K0PA 4ZYSA 1QF6A 3ZYYX 1VR9A 2JXTA 3WCQA 1YN5A 1L6UA 3MP9A 1L0XB 3VR9B 3AE5B 1E6EB 2XNAC 3NVWA 2WS3B 1XCTL 3AE6B 1RWSA 1V8CA 1C4AA 2KDMA 2XN9C 2W54A 1RFKA 2PW9A 4MH8A 4RNAA 2WU5B 2BS3B 2WXHA 2WXKA 3T3OA 3UI3A 1C4CA 5FK9C 3AEAB 2MJEA 2M0AA 4D2KA 1F77A 2ICIA 5G5GA 4USAA 1HXYD 2KN4A 1B1ZA 3NVZA 2KWDA 1K51A 4AQ7A 3I57A 1JCKB 1EU3A 2VZKB 1TS3A 4CQNA 2RDHA 4YSZB 1KLUD 4H2AA 1MVKA 1TS2A 3KWLA 1VJKA 2WXRA 3Q8CA 3W5UB 5TSSA 2DYMA 4J3OD 3KLSX 4RF0A 4WWMA 3EGRA 1TJEA 3NRZA 1QQRA 1GTHA 1QLBB 1SJHD 2AX5A 3TEWA 2WXMA 3Q8FA 1KLGD 4XDCA 2D5GA 2QJLA 1FCCC 1K50A 1TY0A 4LLGM 4M0WA 2WDQB 3AH7A 2SEBD 3P1MA 1FD6A 3NVYA 2CU3A 1UNSA 2Y5PA 1KH0A 3AEBB 1D5ZC 4TMAB 1GT8A 1D6EC 1TKEA 2WXPA 2IGGA 4OVZA 2IGHA 3GS2A 2MJ3A 3FC4A 1V97A 2J52A 1SEBD 2QEJC 3P4SB 2LUMA 5AUKA 4B0EA 3W5VB 1PGXA 1JALA 2K9XA 2RMMA 3ZQ4A 2PIAA 4B0MA 1VZ8A 3MC0B 1AN8A 1XLNA 1FNWA 4RH6A 2CJNA 4WQMA 4GDKB 3DWGC 4TQ0A 1N61A 3P42A 1DOIA 1TKYA 2GRIA 2LEKA 1ET6A 2RDGA 3PZ8A 4KKJA 4DQOC 3HUIA 5MPOA 1YNTE 2DLBA 2QSDA 1N62A 3KWVA 2V3PA 2WDRB 2VZKD 4XWTA 3V3XA 2BB6A 2PKOA 2DBYA 2Y5CA 4MACA 4DXGA 4N6EB 2WXLA 1FRDA 1C9FA 4KGSA 1XLPA 2SAKA 4PT5A 4UDUC 5HG2A 3IXSA 1DOYA 2WXJA 1DGJA 2PVGC 4HJGE 2AQ2B 4YSXB 1A70A 2W82A 1ENFA 5EE3A 4ZOHC 1F2RI 1P7EA 1HQRD 1PUTA 2L1AA 2OHFA 2W3RA 3AE1B 1MHHE 3DWMA 1GAQB 1V1PB 3AMZA 3E9SA 1YN4A 4JX1C 3T3NA 3N9YC 3TEYA 3VRAB 4IDIA 1CJEA 1PYWD 1N63A 3AE4B 1BUIC 2INNE 2LHEA 3E56A 4A6QA 3U4EG 1WGKA 4RFBA 2ZW1A 3BZDB 5EE1A 1P7FA 2YEPF 3AEEB 1JROA 1FNUA 3IAS1 1DYQA 2LGIA 1SBBB 1AWDA 2K5PA 3LYYA 4JE3B 1TZOA 2NTSA 1NEKB 2MEKA 3V05A 4MT5A 3LXFA 5G5HA 1FCLA 5C2TB 2Q5WD 4MM3B 1WWTA 1EM7A 3ZGZA 1Y56A 1VZ7A 2FE8A 2L52A 1C79A 3FAHA 3Q8AA 2E3TA 2EELA 3AE2B 3RFZB 1I4XA 1SSNA 2EKIA 2WXIA 2PMVA 4EE2A 1IBXB 1M4VA 4YXDB 1C77A 2QILA 2BYTA 5D3IB 3CF4A 3BVZA 2X38A 4HRSA 1PDXA 2WNMA 5LNK1 1IUEA 4N59A 3SFEB 2IPKD 3NUHB 1FM0D 4REZA 1OFFA 2OEDA 1KRHA 4YTNB 1CK1A 2G9HD 1V1PA 4C80A 2DWQA 1H7XA 2AQ1B 1J7CA 3AEDB 3U7ZA 3I9V1 1T6BX 1FMAD 1WRIA 3ZJUA 1GB4A 4JWSC 2ONQA 3W9CB 2BB5A 1JMLA 5EE9A 1OQRA 2LMCA 1PGAA 1T5XD 5BYRA 1RYJA 1N5WA 4IOIE 2KAJA 1I7HA 1VDVA 3EUB2 2WLBA 1QT9A 2M19A 3BYTB 1D4BA 2J42A 5BYSA 4YSYB 1K53A 1XLOA 3KQ4A 4TSSA 4Q2JA 2GB1A 1L5PA 2PTLA 2Y3AA 2PLPA 3BWUD 2WDVB 3BK1A 4OHJA 2KQ4X 5BYQA 1GB1A 2LFIA 1VLBA 3AV8A 2WQYB 4XWWA 1D5MC 1ZUD2 4RGNA 3FILB 4US8A 1SB3C 1IBXA 2V3NA 4JPSA 1TKGA 2RPVA 4O1NA 4WAFA 5BMHA 4ZHPA 1YJJA 4RCOA 1F0ZA 2JZPA 3TEXA 5EE0A 4GDLB 1YQ3B 1NI3A 1ZPSA 1FXIA 2KMMA 1D5XC 4RGOS 1FFUA 1PGBA 1I4PA 2Z8LA 3P4QB 1SF0A 1L6VA 2TSSA 1WXQA 2K3UA 1MI0A 3AN1A 5BMIA 4KX6B 1RM6C 2KACA 2BTEA 3VR8B 1WSPA 2BBCA 3Q69A 1C4PA 2MJDA 1FIQA 1DOXA 1GPXA 4A8XC 4LTUA 5H92C 1FXAA 1TY2A 2WXQA 5C3JB 1IGCA 2MH7A 4P6VF 4YTPB 5BMGA 1J7BA 1NENB 4P16A 4C56C 1JWBD 5E6JA 5GXGB 2HTME 1T3QA 1IGDA 2N9LA 1ZE3D 3TEZA 1NYRA 1N60A 4RGTA 1V1OA 4GLSC 3SR6A 3AE3B 3HVZA 2V0GA 2L83A 3R2TA 1B9RA 1I4HA 3IT6B 4WURA 1SE3A 1JWAD 1BXTA 4IKGA 4YWGG 3PZ7A 3RPFC 3P4PB 3GB1A 4A55A 1E10A 2IJ0A 1C78A 4XDDA 3AM9A 4N58A 2JYEA 1SIJA 2WP9B 1FFVA 3ZJTA 3AE7B 2K22A 2BS2B 1QOFA 3B2GA 3BVGA 4HROA 1MPEA 4ZHOA 5H8YE 4TQ1A 3VQIA 1F2RC 3AEGB 4OZAA 4NAMA 1NVID 4US9A 1TS5A 2WXGA 5JXVA 3EA6A 1KFYB 3TSSA 2B76B 2I2YA 2BS4B 5HFYA 1XLQA 1QILA 1FO4A 3NVVA 1YQ4B 1ZDVA 3NZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JAL A;  1J7A A;  2K9X A;  2PIA A;  5EE9 A;  1OQR A;  3B9J A;  1RYJ A;  1N5W A;  3AE8 B;  1XLN A;  2KAJ A;  1TYG B;  3P4R B;  2CJN A;  4ITK A;  1I7H A;  1VDV A;  3EUB 2;  2WLB A;  1QT9 A;  1JRP A;  2M19 A;  4WQM A;  3DWG C;  4YSY B;  1N61 A;  1XLO A;  3AB5 A;  1DOI A;  1TKY A;  2LEK A;  1OQQ A;  1L5P A;  1L0V B;  5MPO A;  2H89 B;  4YT0 B;  3VRB B;  3HUI A;  3PO0 A;  2WDV B;  4A9A A;  5AUI A;  1YJI A;  4YTM B;  1N62 A;  1QOG A;  3ABV B;  1JW9 D;  1NYQ A;  1EWY C;  2WDR B;  3L4P A;  3AEF B;  1VLB A;  3AV8 A;  1KF6 B;  2WQY B;  2PKO A;  2Y5C A;  2DBY A;  4N6E B;  1FRD A;  1ZUD 2;  2W3S A;  2QIE B;  4US8 A;  2H88 B;  1SB3 C;  3HRD D;  1XLP A;  3AEC B;  3NS1 A;  1E0Z A;  1TKG A;  3CWI A;  1ZOY B;  1DOY A;  1FRR A;  1YJJ A;  4ZHP A;  4JWU C;  1F0Z A;  1DGJ A;  2G1E A;  2PVG C;  1ZXI A;  1N5X A;  4YSX B;  1A70 A;  1XO3 A;  5EE0 A;  1YQ3 B;  3P63 A;  1QOB A;  1NI3 A;  3ETR A;  1FXI A;  4C7Z A;  2KMM A;  5EE3 A;  1FFU A;  1AYF A;  4IDI A;  4ZOH C;  1PUT A;  1UWM A;  3P4Q B;  2OHF A;  2W3R A;  3AE1 B;  3B2F A;  3CIR B;  1SF0 A;  1GAQ B;  1CZP A;  1L6V A;  1WXQ A;  3AMZ A;  4JX1 C;  2JQR B;  1QF6 A;  3AN1 A;  3ZYY X;  4KX6 B;  3VRA B;  1RM6 C;  3WCQ A;  3VR8 B;  1CJE A;  1L6U A;  2N0S B;  1N63 A;  1E9M A;  2MJD A;  3AE4 B;  1FIQ A;  3LB8 C;  3VR9 B;  2CJO A;  1DOX A;  3BII D;  1GPX A;  3AE5 B;  1E6E B;  1WGK A;  4LTU A;  3NVW A;  1GTE A;  1FXA A;  2WS3 B;  3AE6 B;  1RWS A;  1V8C A;  2PVO D;  1R7S A;  3AEE B;  5EE1 A;  2W54 A;  1RFK A;  5C3J B;  1JRO A;  2WU5 B;  2BS3 B;  2MH7 A;  4P6V F;  4YTP B;  3DWM A;  4FXC A;  1J7B A;  1NEN B;  1AWD A;  2K5P A;  3AEA B;  2FBW B;  1JWB D;  2MJE A;  5GXG B;  2HTM E;  2ACZ B;  1T3Q A;  4USA A;  5G5G A;  2M56 B;  1NEK B;  3SFD B;  3NVZ A;  3LXF A;  5G5H A;  5C2T B;  2Q5W D;  1WWT A;  1NYR A;  1N60 A;  4YSZ B;  3SR6 A;  2L52 A;  3AE3 B;  1PFD A;  3KWL A;  3HVZ A;  2W55 A;  1VJK A;  2L83 A;  3W5U B;  3FAH A;  1QOA A;  1B9R A;  2E3T A;  4WWM A;  1TJE A;  3AE2 B;  2EKI A;  3NRZ A;  1GTH A;  1JWA D;  1E10 A;  1QLB B;  3RPF C;  3P4P B;  2AX5 A;  1WYG A;  4YXD B;  3AE9 B;  3AM9 A;  4N58 A;  2QJL A;  2WP9 B;  1SIJ A;  3CF4 A;  1FFV A;  1ROE A;  3AE7 B;  2WDQ B;  2BS2 B;  1QOF A;  1PDX A;  2JX5 A;  2K22 A;  3AH7 A;  3B2G A;  4HRS A;  4HRO A;  1H7W A;  4ZHO A;  1IUE A;  4N59 A;  3SFE B;  5H8Y E;  3P1M A;  3AEG B;  4US9 A;  1NVI D;  3NVY A;  1FM0 D;  2CU3 A;  1OFF A;  1KRH A;  5H92 C;  1KFY B;  4YTN B;  4C80 A;  3AEB B;  1ZP0 B;  1E7P B;  1GT8 A;  1H7X A;  1TKE A;  2DWQ A;  2B76 B;  1J7C A;  2BS4 B;  3AED B;  1XLQ A;  2WU2 B;  2MJ3 A;  1V97 A;  3FC4 A;  1FMA D;  1WRI A;  3NVV A;  1FO4 A;  1JQ4 A;  3P4S B;  4JWS C;  3W9C B;  1YQ4 B;  2BT6 A;  5AUK A;  4C7Y A;  3W5V B; 
#chains in the Genus database with same CATH topology
 2OOB B;  1STE A;  1WM2 A;  1E8Y A;  4RGM A;  2KDE B;  2D11 A;  3A9K B;  3AE8 B;  3M63 B;  4ANW A;  5IA7 A;  2WX1 A;  2XBB C;  5AEK B;  1KM7 A;  1V6E A;  5AUI A;  1Z2M A;  3B1L X;  3L4P A;  5I4D A;  2MQJ A;  3I63 C;  2NVU I;  3NS1 A;  3OJ3 A;  2AWT A;  4XE0 A;  1WMH A;  2MBQ A;  1H4R A;  2BW2 A;  2IBI B;  1ZXI A;  2XK5 B;  1JRU A;  4C7Z A;  1CQV A;  3HVD A;  4KGT A;  4MM3 A;  1UWM A;  5C1Z A;  4KGR A;  1FEH A;  2KN5 A;  3VUW A;  2JQR B;  4ARC A;  1E9M A;  1UUP A;  3LB8 C;  1WX9 A;  3PVL A;  3TIX A;  2L3Z A;  4W9I A;  4K3B A;  1XF5 L;  4PS8 A;  1MJD A;  2M56 B;  1GNU A;  3ENE A;  2C7N B;  5HKH A;  2DHZ A;  4YL8 A;  2J53 A;  2ON8 A;  3KUZ A;  2INP E;  1PFD A;  2LJI A;  3IG3 A;  2MCN B;  1TBE A;  2JSV X;  1QOA A;  5D3D A;  3Q6B A;  3IT4 B;  3MTN B;  4JLC A;  3UQB A;  2ZNV C;  3ZIM A;  3ZNI D;  3PLU A;  1WYG A;  3U2S C;  2CHW A;  1ROE A;  1P9D U;  1JWM D;  1WJU A;  2BGF A;  1XXG A;  1M94 A;  1ZP0 B;  2FNJ B;  5LLI A;  2WU2 B;  4KSL C;  4IM2 A;  3RZW C;  2BT6 A;  1LFD A;  1E8W A;  3L54 A;  2BQQ A;  4CHK A;  3I5J C;  3VFK A;  1WJN A;  4JGH B;  1I4G A;  2FIF A;  4ASW C;  4ITK A;  1I4R A;  2DYO A;  2IO1 B;  2IDY A;  2O2V A;  4HWI B;  3K9P B;  5KHQ A;  2L7R A;  1YJI A;  4YTM B;  2ZW0 A;  1QOG A;  2LRW A;  1JW9 D;  1EWY C;  4MDK E;  3V6E B;  3AEF B;  3NHE B;  3WIM A;  1KF6 B;  2C7M B;  2QIE B;  4KKI A;  4WH4 A;  3VDZ A;  1KTK A;  2IGD A;  3N1Y C;  4NQK E;  2WX0 A;  4HVB A;  3U8Z A;  3MFG A;  2ASQ A;  2DX5 B;  5IOI A;  3PT2 B;  1WGH A;  2HJ8 A;  2VH2 A;  3DPD A;  3DVN U;  1QOB A;  5HI1 A;  2YEP B;  2E6X A;  1YN3 A;  2FUG 1;  4L1B A;  1AYF A;  3JVZ X;  2MA9 B;  1JWU D;  4ZYS A;  3KUD B;  1YN5 A;  5CHW A;  3AE5 B;  1WE7 A;  2XNA C;  3NVW A;  3RNA C;  1RWS A;  2INC C;  2UYZ B;  2W54 A;  2PW9 A;  2JRI B;  3T3O A;  5KHO A;  2X8X X;  2M0A A;  1YQB A;  2KN4 A;  2KWD A;  3PS6 A;  1JCK B;  1RAX A;  2VZK B;  3P2B A;  2R2Q A;  5JHA A;  4H2A A;  3QX1 A;  2WXR A;  4W9E A;  3W5U B;  2XEW A;  1V80 A;  4HPM B;  4E74 A;  1QQR A;  4DWF A;  1QLB B;  2MLB A;  3A9K A;  2QJL A;  1FCC C;  1V5O A;  4WJN A;  2GBM A;  2M8S A;  4PYU A;  4NAW A;  2FCN A;  1ZKH A;  3PGE A;  2AYO B;  2GBR A;  1P3Q U;  2Y5P A;  1GT8 A;  1TKE A;  2NCN A;  2HD5 B;  3FC4 A;  1V97 A;  3R66 C;  3P4S B;  3QC8 B;  2RMM A;  4B0M A;  2PIA A;  1E5W A;  4PYZ A;  2CJN A;  1X1M A;  1YJ1 A;  3P42 A;  4GB9 A;  1TKY A;  4PK1 A;  4GXB A;  1V81 A;  4MGK E;  3RN9 C;  2IZV B;  3PZ8 A;  3ZDM C;  3L0W B;  3BY4 B;  2NPT B;  3QHT A;  4WQO B;  1WXS A;  1UBI A;  2VZK D;  3A4R A;  1GC7 A;  2BB6 A;  4DXG A;  1FRD A;  4KIK A;  3WAN A;  3EFU A;  1J0G A;  2GLS A;  1DOY A;  3IXS A;  2BYF A;  2WXJ A;  2AQ2 B;  4YSX B;  2MX2 A;  2W82 A;  1F2R I;  1HQR D;  2OHF A;  4GIV A;  3TL5 A;  2BVC A;  2JVC A;  2KFK A;  4IDI A;  1N63 A;  3E56 A;  3PRP B;  2ZW1 A;  2BF8 B;  1T0R C;  2C7H A;  3C19 A;  1FNU A;  3IAS 1;  3RYT A;  1DYQ A;  3TBL D;  1SBB B;  2BKF A;  3UQA A;  2K5P A;  4JE3 B;  1E7U A;  2JF5 A;  2JT4 B;  3DCG A;  2ZVO A;  2MEK A;  4MT5 A;  4W9C A;  5C2T B;  4HXD A;  4ICU A;  4XGA B;  1EM7 A;  3VTW A;  1Y56 A;  4IWO A;  4XYC A;  1EUV B;  2I1J A;  3ZKJ C;  2E3T A;  2EEL A;  3AE2 B;  2GBJ A;  2EKI A;  1OTR B;  1MG8 A;  1C77 A;  3WAL A;  4LJP B;  2RDB C;  2WNM A;  2MBB B;  2FCS A;  3HK0 A;  4QAY A;  4K7U A;  3RUI B;  4F8C B;  1CK1 A;  1E8Z A;  1V1P A;  1J7C A;  3AED B;  3U7Z A;  1WRI A;  1GB4 A;  2KDB A;  1JML A;  1OQR A;  2NBW B;  1RYJ A;  1N5W A;  1Q0W B;  4HLE A;  1VDV A;  4BVU C;  3EUB 2;  2WLB A;  1F1H A;  3BYT B;  5BYS A;  1K53 A;  5JZE B;  4DHJ B;  1WJ6 A;  2Y3A A;  3OLM D;  2WDV B;  2FID A;  4BKG A;  4HCN B;  4OHJ A;  4BKT A;  2KJR A;  2ZCC A;  3FIL B;  4US8 A;  2DAJ A;  2D3A A;  1ISN A;  2LI5 A;  2V3N A;  2NBU A;  5BMH A;  1XD3 B;  4ZHP A;  4RCO A;  3Q3J A;  1V2Y A;  3R7Q A;  1FXI A;  3PLV A;  3ZNG C;  1D5X C;  4RGO S;  1FFU A;  1PGB A;  1WZ0 A;  3P4Q B;  4FUL A;  1L6V A;  2K3U A;  2J0K A;  1MI0 A;  3AN1 A;  4WWP A;  1WSP A;  3OG5 A;  4FLH A;  4IC7 B;  2N7D A;  5BMG A;  1J7B A;  4B95 A;  2HTM E;  4EFO A;  4ICV A;  3H7P B;  3X0W A;  4RGT A;  3DBL B;  2REX A;  3HVZ A;  5BO4 B;  3L16 A;  3Q3O C;  1I4H A;  2KX3 A;  2V9H A;  2QDF A;  4YWG G;  4A55 A;  3H6N A;  4N58 A;  1WMH B;  3BVG A;  2L8J A;  4GU2 A;  2ZNV B;  4MH0 E;  2Z0E B;  2CU1 A;  3AEG B;  1NVI D;  4WWO A;  3TSS A;  4MGI E;  2NPT A;  5HFY A;  1XLQ A;  3B08 A;  5IN7 A;  2CHX A;  1SE9 A;  1ZDV A;  3NZ3 A;  1ZDX A;  4NJC A;  2LWP A;  1OEY A;  3KUC B;  5CHV C;  3ZRC A;  1WGY A;  1LO5 D;  5JH5 C;  1AW7 A;  1L0Y B;  1L4D B;  1LM8 B;  1WXV A;  2H89 B;  1A5R A;  2D2Q A;  2GBN A;  4FJZ A;  1R4M I;  1HA5 A;  2N4F A;  2CS4 A;  5E6N A;  2K39 A;  2N9E B;  3APF A;  1N5X A;  2HE7 A;  4J6I A;  1NI2 A;  1MFW A;  2ZCB A;  3B2F A;  2ZVN A;  2HTH A;  2FAZ A;  3MC9 A;  2CJO A;  2NTT A;  2PVO D;  4NZL B;  4ZRQ A;  3M3J A;  4FHK A;  5CX3 A;  3AUL A;  4FXC A;  5CTR C;  3RNE C;  2LHD A;  4MJS A;  2JU6 X;  2R61 A;  1UF0 A;  4AP4 C;  3SFD B;  3TUO A;  1SXT A;  2JWU A;  2O2V B;  1RRB A;  4DXF A;  5D7G A;  2PE6 B;  4ARI A;  1IYF A;  1HZ6 A;  3U52 E;  1ZXH A;  3OWE B;  1HZ5 A;  4KZ0 A;  2EKE C;  4L23 A;  1V9J A;  3RT3 B;  3MJ5 A;  1SE2 A;  3N30 A;  3KH0 A;  5IO9 A;  1JWS D;  4IW0 A;  1Q1O A;  4MGY E;  2JUO A;  1E7P B;  4OVV A;  1G6J A;  4FHJ A;  3W2D A;  1YMH E;  4A20 A;  1MHX A;  2KFJ A;  4HKQ A;  2FCQ A;  1JQ4 A;  2Z59 B;  2D3C A;  4URK A;  1WX8 A;  3FIL A;  1L4Z B;  1TTN A;  3B0A A;  3SU8 X;  4DHZ B;  3BIN A;  2KLG A;  3H7S A;  1WXM A;  4A90 A;  3GE8 C;  1CMX B;  2N7J A;  2JYT A;  1MG4 A;  1OQQ A;  4HDO A;  4HKZ E;  2MBH A;  3O65 B;  4IWP A;  1ET9 A;  3J9C A;  4DBG A;  4G0N B;  4XX5 A;  2H88 B;  4GGQ A;  1I42 A;  2DZJ A;  4LCD E;  3DBH B;  3CWI A;  1Q10 A;  4NAW B;  1P0R A;  3ETR A;  3DQV A;  3H7P A;  3SEB A;  1TS4 A;  4ANV A;  3CIR B;  1CZP A;  1WYW B;  4BZA A;  1EF5 A;  4L2Y A;  1QF6 A;  1VR9 A;  2JXT A;  3WCQ A;  2J0J A;  1L6U A;  5DPW A;  2FCM A;  5G55 A;  3CF6 E;  3AI5 A;  2WS3 B;  3AE6 B;  2XN9 C;  4MH8 A;  1C4A A;  1RFK A;  2BS3 B;  1UGM A;  2CKH B;  2LVQ A;  3UI3 A;  3ZNH B;  2MJE A;  4D2K A;  2ICI A;  4USA A;  2K8C A;  2WGS A;  2K8B A;  3N32 A;  4AQ7 A;  3ZRF A;  4AWJ A;  5DPT A;  3QQ8 B;  3GZN I;  1MVK A;  3KWL A;  4IM0 A;  1VJK A;  3Q8C A;  1WE6 A;  2KC2 A;  2DYM A;  4J3O D;  4B6W A;  3KLS X;  4RF0 A;  4WWM A;  2LGD A;  3NRZ A;  4II2 B;  1GTH A;  4KIK B;  1SJH D;  4MGZ E;  1T0S C;  5D94 A;  4XDC A;  4GMV A;  1KLG D;  4W9H A;  1WX7 A;  3LJ3 A;  2WDQ B;  3AH7 A;  2MRP A;  2CU3 A;  1WGR A;  1D6E C;  2WXP A;  2PE9 A;  1R4N I;  2IGH A;  2LUE A;  2KFK B;  2J52 A;  2LUM A;  4FJY A;  5AUK A;  3W5V B;  4F1S A;  1JAL A;  1FNW A;  4RH6 A;  4LNF A;  4GDK B;  5J17 A;  2LGS A;  1DOI A;  5C23 A;  2LEK A;  4KKJ A;  3WAP A;  4X57 B;  3KWV A;  4EKU A;  3H1U A;  2QHO A;  2V3P A;  2KXJ A;  2WDR B;  3U7D A;  4XWT A;  2Y5C A;  1UZX B;  2WXL A;  4W9F A;  3UF8 A;  3VTU A;  4KGS A;  2KZR A;  2LZ6 A;  2Z0D B;  1DGJ A;  1A70 A;  1ENF A;  1T0Q C;  5EE3 A;  4AUQ C;  4ZOH C;  1PUT A;  1MHH E;  1V1P B;  3TJP A;  3Q3N C;  3AMZ A;  2KYW A;  1PYW D;  5DCN A;  1P98 A;  1E90 A;  4A6Q A;  2LHE A;  3DVG X;  3U4E G;  1WGK A;  3BZD B;  2YEP F;  5TR5 A;  3DBR B;  4HJK A;  1TZO A;  3W1Y A;  4DDI D;  4ACF A;  1FCL A;  3IHP C;  1I35 A;  3ZGZ A;  2FE8 A;  2L52 A;  1C79 A;  3FAH A;  2DEN B;  1SSN A;  4C4V B;  1V49 A;  2KQ7 A;  5D3I B;  3NY5 A;  1T0Y A;  3VHT C;  1IUE A;  2IYD B;  4JIO U;  2G9H D;  2AQ1 B;  5GMV A;  3W9C B;  4ZYN A;  4AOF A;  2BB5 A;  1SIF A;  3U30 A;  4XZ4 A;  3ZXV A;  2LMC A;  4IOI E;  1KLV A;  1QT9 A;  2M19 A;  2G3Q B;  4EZL A;  2BPS A;  3EFC A;  3KQ4 A;  1XLO A;  4TSS A;  4Q2J A;  2EMT A;  2PLP A;  2BYE A;  3L17 A;  1GUA B;  3BK1 A;  2WWZ A;  5BYQ A;  4P1B C;  1WJ4 A;  4BBN C;  3SHQ A;  1C1Y B;  1VLB A;  2WQY B;  3PRE A;  1D5M C;  2L0F A;  1SB3 C;  4JPS A;  2RPV A;  2JZ3 B;  2IO3 B;  1WY8 A;  2Z8L A;  1I4P A;  2ZPN A;  1WXQ A;  3HIZ A;  3Q69 A;  1DOX A;  1GPX A;  2J0M A;  4YTP B;  4P16 A;  4C56 C;  1JWB D;  3H9D A;  5GXG B;  1T3Q A;  4W9K A;  1IGD A;  1ZE3 D;  3TEZ A;  1SGH A;  1N60 A;  2LGX A;  3ML9 A;  2QC8 A;  1B9R A;  3K9O B;  1WIA A;  2RSU A;  1E10 A;  3PZ7 A;  2IJ0 A;  1SIJ A;  2JY6 A;  1FFV A;  2K22 A;  3B2G A;  3DVN V;  3ML8 A;  4GDK A;  4GDL A;  4TQ1 A;  1F2R C;  5LXI B;  3RNB C;  4S17 A;  5CHF A;  3MC8 A;  4KDL B;  3ZXR A;  3Q14 C;  4FBJ B;  2BS4 B;  4EUT A;  1FO4 A;  3NVV A;  1ZW7 A;  4P7I A;  1GOZ A;  1WXA A;  3IAM 1;  4HDQ A;  1HEZ E;  3EC8 A;  3VUY A;  3PHX B;  1QKZ A;  4MJS B;  3ECI A;  4A9A A;  3V6C B;  1YD8 U;  4M8M A;  3ABV B;  2V3S A;  3PRM B;  4KVG B;  2HJ1 A;  4M00 A;  3C8Y A;  2L76 A;  1ESF A;  1XT9 B;  3AEC B;  5T8I A;  1BML C;  2G1E A;  3VTV A;  2W9N A;  1OEY J;  1RFA A;  3R2I A;  2I38 A;  1U4A A;  3A1Q B;  2N0S B;  3DBS A;  2L00 B;  3UGB B;  3BII D;  4RM9 A;  4WJO A;  1S1Q B;  3RNC C;  4C4V A;  4ZRI A;  4K1R B;  2N1W A;  3VXW A;  2FBW B;  4I6N B;  4FJV B;  2N7E A;  4M01 A;  3LDZ E;  2L32 A;  2DZM A;  3RNF C;  2W55 A;  2RD0 A;  5IP4 D;  2KWV B;  3BYY B;  5L95 C;  1XCQ L;  4HEA 1;  1C76 A;  2J4X A;  1SJE D;  4K81 A;  4ZRP A;  2WDT B;  3AE9 B;  1K52 A;  3BK2 A;  4LNI A;  2JX5 A;  1ACC A;  1FNV A;  1H7W A;  3WAM A;  2NMQ A;  5LXH A;  2WXF A;  4N9F 4;  2QMT A;  3RMK C;  2GI9 A;  3DDC B;  1C3T A;  2KC1 A;  3QJZ A;  3IFW B;  3P4R B;  4LNK A;  2KD0 A;  3ONS A;  1JRP A;  2C5L C;  1EF1 A;  2K6Q A;  3Q8B A;  2KDF B;  4YT0 B;  3VRB B;  3R8B A;  2M1M A;  3V61 A;  3R3M A;  4A3O A;  2UU7 A;  3I3T B;  1TGZ B;  5EDS A;  1SE4 A;  4FN2 A;  1VZ6 A;  3HRD D;  3PTF C;  1XEE A;  5HHD G;  5FR3 A;  2LD9 A;  1WFY A;  1N6Z A;  3URY A;  1VD2 A;  3P63 A;  3QAR A;  4IUM B;  3OAW A;  3EHV A;  2N9P C;  2A5U A;  5J18 A;  2Y5B B;  3CMM B;  3FKY A;  5E6P A;  3DHG C;  2KDM A;  4RNA A;  3T3N A;  2WU5 B;  5L83 A;  5FK9 C;  1E8X A;  2K1F A;  3AEA B;  1F77 A;  3Q2A C;  4C00 A;  1HXY D;  3VH3 B;  3CSF A;  2VH1 A;  3I57 A;  4EZK A;  4DHZ E;  1HTQ A;  4EEW A;  1TS3 A;  4CQN A;  1IPG A;  2DNF A;  1KLU D;  1TS2 A;  5D2M B;  5IKC M;  2WYQ A;  5IAA C;  5TSS A;  1BT0 A;  1KOT A;  3MHS D;  3ZDT A;  4EZJ A;  1HTO A;  3ZW3 A;  1XQQ A;  1FXT B;  5J2R A;  1D3Z A;  3KVF B;  3Q8F A;  4LLG M;  4M0W A;  2SEB D;  3P1M A;  3NVY A;  4GN1 A;  4BKS D;  2MP2 B;  1Q5W B;  3AEB B;  1D5Z C;  4TMA B;  4M02 A;  3HM6 X;  4OVZ A;  5G2N A;  1UH6 A;  1SEB D;  4MEL A;  4LNN A;  2O6V B;  1PGX A;  2K9X A;  3ZQ4 A;  3JSV A;  3MC0 B;  1AN8 A;  1XLN A;  4HK2 A;  2CHZ A;  3KW5 B;  2KTF A;  2D07 B;  2M4N A;  1WI0 A;  3NOB A;  2IO2 B;  4DK5 A;  2RDG A;  3AXC A;  4DQO C;  4FAD A;  3HUI A;  2J7Q B;  2DLB A;  4ZDV A;  2QSD A;  4BBN F;  1N62 A;  1TT5 B;  2GBK A;  2IY1 B;  3V3X A;  1L2N A;  3A1Q A;  2DBY A;  4N6E B;  3ZO5 B;  1C9F A;  3D32 A;  4PT5 A;  5HG2 A;  2L0T A;  2ZPY A;  3DWM A;  2W3R A;  2L1A A;  2ZJD A;  1GAQ B;  2M17 A;  3TEY A;  4RM8 A;  1CJE A;  2ZEQ A;  1BUI C;  3GOE A;  1OQY A;  1P7F A;  4BAX A;  1JRO A;  2LGI A;  3SDL C;  2O6V D;  1AWD A;  3LYY A;  2NTS A;  4DXA B;  3V05 A;  3LXF A;  5AZG A;  2QCZ A;  3VVW B;  2MBE A;  1VZ7 A;  4NPN A;  5D6J B;  3L08 A;  1L7Y A;  3RFZ B;  1I4X A;  2WXI A;  2PMV A;  4EE2 A;  4YXD B;  4EOY A;  2QIL A;  1EO6 A;  2X38 A;  1V86 A;  4HRS A;  1NDD A;  4TV3 A;  5LNK 1;  4N59 A;  4I6L B;  2IPK D;  3NUH B;  1FM0 D;  4REZ A;  1OFF A;  2OED A;  4B9K A;  4YTN B;  1LGR A;  4C80 A;  2DWQ A;  1H7X A;  2KTR B;  3GE3 C;  3PV1 A;  3ZJU A;  4JWS C;  2MBO A;  4ZRJ A;  5EE9 A;  1PGA A;  1T5X D;  5BYR A;  2K25 A;  3VUX A;  2KAJ A;  1I7H A;  2J42 A;  4YSY B;  4BKS A;  3DBL I;  3A33 B;  2JRH A;  2GB1 A;  3RCZ A;  3BWU D;  3TMP B;  3KYD D;  2LJ5 A;  2KQ4 X;  3ZVV A;  3UIP B;  1GB1 A;  2KWC A;  4HPP A;  2LFI A;  2D10 A;  3AV8 A;  4XWW A;  2KDI A;  1ZUD 2;  4RGN A;  2K8H A;  3V60 A;  1IBX A;  1TKG A;  3OJ4 B;  4O1N A;  4WAF A;  2N9X A;  3TEX A;  4IWQ A;  4GDL B;  1YQ3 B;  1ZPS A;  1TIF A;  1UEL A;  1WRD B;  1KJT A;  2BWF A;  2RPQ A;  2V1Y A;  4OVU A;  3JW0 X;  4KX6 B;  2KO3 A;  2KAC A;  2BTE A;  3VR8 B;  2OJR A;  4GSW A;  1FIQ A;  2GOW A;  1F9J A;  4WJP A;  5DPR A;  3ZLZ A;  2YLM A;  4PS3 A;  5H92 C;  1FXA A;  2NR2 A;  1TY2 A;  3L13 A;  1WF9 A;  5C3J B;  1WZ3 A;  2MW5 A;  2MH7 A;  4PS7 A;  5E6J A;  2JXX A;  3Q3F A;  3SR6 A;  2MP2 A;  4MSQ B;  2V0G A;  2AEH A;  2DZK A;  3IT6 B;  2D3G A;  4WUR A;  2KVZ A;  4LJO B;  2O6V A;  4XDD A;  2YVC A;  3AM9 A;  2WP9 B;  1VCB A;  3AE7 B;  1QOF A;  4HRO A;  4ZHO A;  5H8Y E;  3A4S C;  4OZA A;  4NAM A;  3ZTD A;  3T9L A;  1TS5 A;  5JXV A;  3HHM A;  2IO0 B;  3N3K B;  1KFY B;  3T8M A;  4HCP B;  1V5T A;  2G4S A;  2R2O A;  1QIL A;  2BWE S;  4AJY B;  1LQB A;  4K7W A;  3PZD A;  4JL9 A;  3MJW A;  1NBF C;  4IM3 A;  4R3D A;  4LNO A;  5FKA C;  2KJH B;  2KHW B;  1I4Q A;  3PO0 A;  1NYQ A;  4P1C C;  3ZJV A;  3DHI C;  4LK0 M;  3GP7 A;  3QCA A;  2W3S A;  2LRU A;  3BVM A;  4NQL B;  2IND C;  3RNG C;  4AS1 A;  3UIO B;  1QZE A;  4TKN A;  2KX0 A;  2HDE A;  4WWN A;  4G50 A;  1YOV B;  4NNJ B;  2N1V A;  2V4I B;  1GTE A;  1R7S A;  4LDT B;  2WXN A;  5JHB A;  3HM3 A;  4HPL B;  3QA8 A;  2ACZ B;  3Q8E A;  3H8H A;  3IBE A;  2DAF A;  4KZC A;  2M0X A;  2DZI A;  4G11 A;  4WIP A;  2KTR A;  1WGG A;  3DBH I;  2KQS A;  1WGD A;  2FUH B;  1R4M B;  2AQ3 B;  1ZGU B;  3O13 A;  2JZZ A;  1UWX A;  1E7V A;  2RR9 A;  2XK5 A;  2PPH A;  2KK8 A;  2LXC A;  1UGJ A;  3M95 A;  1EU4 A;  3RUL A;  4CYE A;  3RD2 A;  4F7Z A;  3A9J B;  4W9D A;  2LVP A;  3X23 A;  4C7Y A;  1J7A A;  4WJQ A;  1H8C A;  3C0R B;  2VRR B;  3B9J A;  3WAO A;  4E71 A;  2ZZP B;  1TYG B;  3W1S A;  2RGF A;  2WXO A;  2IY0 B;  4GOC A;  3AB5 A;  4LDT D;  4OZC A;  2N9K A;  2L05 A;  1L0V B;  1Z5S B;  4OZB A;  4OW0 A;  2OJW A;  3EEC A;  1YX5 B;  2LVO A;  2I1K A;  3JYU A;  1Y8R C;  4RF1 A;  4W9G A;  3SD5 A;  1E0Z A;  3MHZ A;  2KMC A;  1ZOY B;  1AAR A;  4M0W B;  1FRR A;  4JWU C;  1EWC A;  1XO3 A;  2GMI C;  2UWQ A;  4II3 B;  1VRA B;  2DYB A;  2K0P A;  4BOZ B;  1FPY A;  3Q3M C;  3ZYY X;  4G3X B;  3MP9 A;  2JWZ A;  1L0X B;  3W1S C;  3VR9 B;  1GC6 A;  3WA0 A;  1E6E B;  1J19 A;  1V8C A;  1XCT L;  3JSV B;  3QAQ A;  4M8N A;  3NG0 A;  4ANU A;  2WXH A;  2WXK A;  1C4C A;  1RLF A;  3UIN B;  5G5G A;  1B1Z A;  3NVZ A;  1K51 A;  1EU3 A;  2RDH A;  2WHI A;  4YSZ B;  4E3C A;  1F52 A;  4ZRK A;  2KOX A;  4TUU A;  5E6O A;  1UD7 A;  3EGR A;  1TJE A;  4JQW C;  3ZTC A;  1WM3 A;  4I6P A;  3RI7 C;  2AX5 A;  3TEW A;  2WXM A;  2D5G A;  1K50 A;  1TY0 A;  3S2A A;  1FD6 A;  2C9W B;  1GJZ A;  2A4Z A;  1UNS A;  2KKC A;  1KH0 A;  1WR1 A;  2IGG A;  3GS2 A;  2MJ3 A;  2QEJ C;  5AZH A;  4B0E A;  2LXA A;  1VZ8 A;  3L10 B;  3APD A;  3DBR I;  5AZF A;  4W9J A;  2KWU B;  4WQM A;  3DWG C;  4TQ0 A;  1N61 A;  3N1X C;  4NJ6 A;  3PPA A;  2GRI A;  2B3A A;  2BYV E;  4S0R A;  1ET6 A;  3R7R A;  5MPO A;  1YNT E;  2MHJ A;  2NBV B;  2PEA A;  3GZN B;  2PKO A;  4NJ7 A;  4MAC A;  3IVF A;  4A3P A;  1XLP A;  2SAK A;  1YIW A;  4UDU C;  2PVG C;  4HJG E;  1IP9 A;  4K3C A;  4CO7 A;  1P7E A;  2V4L A;  3AE1 B;  2MWS B;  3ZNZ B;  3E9S A;  1YN4 A;  4JX1 C;  1WR6 E;  4DHJ D;  3N9Y C;  3PSE B;  3VRA B;  3AE4 B;  4W9L A;  2INN E;  1R4N B;  2KNB A;  4RFB A;  3NZU A;  5EE1 A;  3AEE B;  2LGY A;  3N1Z C;  3APC A;  4K7S A;  2KT7 A;  1NEK B;  4XC2 A;  5G5H A;  2G4D B;  2Q5W D;  4KSK C;  4MM3 B;  1WWT A;  3ALB A;  4KDI C;  2MSE D;  1OGW A;  2KMA A;  3KYC D;  4NY0 A;  2C60 A;  4ANX A;  3V62 A;  3Q8A A;  4DDG D;  3A9J A;  1GG3 A;  2NS5 A;  1IBX B;  4AJW A;  1M4V A;  2K6D B;  4MEM A;  2BYT A;  2G45 B;  3CF4 A;  3BVZ A;  1PDX A;  3SFE B;  1K8R B;  4WAA A;  3AU5 A;  1KRH A;  3NS8 A;  1HE8 A;  3CST A;  1YX6 B;  2KVR A;  2KLC A;  3I9V 1;  1T6B X;  1FMA D;  3NZS A;  2ONQ A;  4KV2 A;  1PQS A;  4BFR A;  1WH3 A;  3DVG Y;  1D4B A;  2PTL A;  1L5P A;  4IG7 B;  3QIJ A;  2KJ6 A;  1P1A A;  4MSM B;  3QK0 A;  3PRZ A;  1TZ1 A;  3AU4 A;  3PHW B;  3M62 B;  3RZF A;  2EMS A;  1F0Z A;  1YJJ A;  2JZP A;  5EE0 A;  3TCA A;  1NI3 A;  2KMM A;  5DPS A;  1SF0 A;  2TSS A;  5BMI A;  1RM6 C;  2BBC A;  1C4P A;  2MJD A;  3QWZ B;  4A8X C;  4LTU A;  5FR6 A;  2WXQ A;  2LAS A;  1IGC A;  4P6V F;  1NEN B;  1S3S G;  2N9L A;  3DOW A;  1NYR A;  3VAW A;  1V1O A;  4GLS C;  3ZUN A;  3AE3 B;  2L83 A;  3R2T A;  3DHH C;  2JPH A;  3VH4 B;  1SE3 A;  1JWA D;  1BXT A;  2AL6 A;  4IKG A;  3RPF C;  2AL3 A;  3P4P B;  3GB1 A;  1C78 A;  2BKR B;  2JYE A;  3ZJT A;  2BS2 B;  1MPE A;  1LXD A;  3VQI A;  4US9 A;  2WXG A;  1UBQ A;  3EA6 A;  2KAN A;  2CR5 A;  2D3B A;  1J8C A;  3NJT A;  2B76 B;  2I2Y A;  4BOS C;  3N20 C;  4RMA A;  2PJH A;  1YQ4 B;  4FA6 A; 
#chains in the Genus database with same CATH homology
 1GOZ A;  1ZDX A;  4NJC A;  1STE A;  3IAM 1;  4RGM A;  1HEZ E;  3AE8 B;  4R3D A;  1LO5 D;  5FKA C;  1QKZ A;  1AW7 A;  1L0Y B;  1L4D B;  2H89 B;  1I4Q A;  4A9A A;  3PO0 A;  5AUI A;  3ABV B;  1NYQ A;  3L4P A;  3ZJV A;  5I4D A;  4LK0 M;  3GP7 A;  1HA5 A;  2W3S A;  3C8Y A;  3BVM A;  1ESF A;  3AEC B;  3NS1 A;  5T8I A;  4AS1 A;  4XE0 A;  1BML C;  2BW2 A;  2G1E A;  1ZXI A;  1N5X A;  4C7Z A;  1CQV A;  3HVD A;  4KGT A;  1UWM A;  2HDE A;  3B2F A;  4KGR A;  1FEH A;  2JQR B;  3R2I A;  2I38 A;  4ARC A;  2N0S B;  1E9M A;  1UUP A;  3LB8 C;  2CJO A;  2NTT A;  3BII D;  2V4I B;  1GTE A;  2PVO D;  1R7S A;  4NZL B;  4ZRQ A;  1XF5 L;  2WXN A;  4FXC A;  2FBW B;  2LHD A;  2ACZ B;  3Q8E A;  3H8H A;  2JU6 X;  2R61 A;  2M56 B;  3SFD B;  3TUO A;  1SXT A;  2JWU A;  2L32 A;  4DXF A;  2J53 A;  2ON8 A;  5D7G A;  2INP E;  1PFD A;  2LJI A;  2W55 A;  4WIP A;  4ARI A;  2JSV X;  1QOA A;  3BYY B;  5D3D A;  1XCQ L;  3IT4 B;  4HEA 1;  1C76 A;  1HZ6 A;  3U52 E;  2J4X A;  1SJE D;  1ZXH A;  3OWE B;  1HZ5 A;  2AQ3 B;  3O13 A;  4ZRP A;  1WYG A;  3U2S C;  4L23 A;  3AE9 B;  1K52 A;  3BK2 A;  1UWX A;  1ROE A;  2JX5 A;  1ACC A;  1SE2 A;  3MJ5 A;  1JWM D;  1FNV A;  1H7W A;  2NMQ A;  1JWS D;  1UGJ A;  1XXG A;  1EU4 A;  2WXF A;  1ZP0 B;  1E7P B;  2QMT A;  3W2D A;  1YMH E;  1MHX A;  2WU2 B;  4HKQ A;  1JQ4 A;  2GI9 A;  2BT6 A;  4C7Y A;  1J7A A;  3FIL A;  1L4Z B;  3B9J A;  1I4G A;  1TYG B;  3W1S A;  3P4R B;  4ITK A;  1JRP A;  1I4R A;  2WXO A;  4A90 A;  2DYO A;  3AB5 A;  2N7J A;  2JYT A;  3Q8B A;  2N9K A;  4OZC A;  1OQQ A;  2IDY A;  1L0V B;  4OZB A;  4YT0 B;  3VRB B;  1YJI A;  4YTM B;  2ZW0 A;  4OW0 A;  1QOG A;  1JW9 D;  3R8B A;  1EWY C;  3AEF B;  4HKZ E;  1KF6 B;  1ET9 A;  3J9C A;  4RF1 A;  1SE4 A;  2QIE B;  2H88 B;  4KKI A;  4WH4 A;  1VZ6 A;  3HRD D;  1KTK A;  2IGD A;  1E0Z A;  1XEE A;  3MHZ A;  3CWI A;  5HHD G;  1ZOY B;  5FR3 A;  1FRR A;  1Q10 A;  4JWU C;  4NAW B;  3MFG A;  3URY A;  1EWC A;  1XO3 A;  5HI1 A;  3P63 A;  1QOB A;  3ETR A;  2YEP B;  2E6X A;  1YN3 A;  1VRA B;  2FUG 1;  4L1B A;  3SEB A;  1AYF A;  1TS4 A;  3CIR B;  1CZP A;  1JWU D;  4L2Y A;  2K0P A;  4ZYS A;  1QF6 A;  3ZYY X;  1VR9 A;  2JXT A;  3WCQ A;  1YN5 A;  1L6U A;  3MP9 A;  1L0X B;  3VR9 B;  3AE5 B;  1E6E B;  2XNA C;  3NVW A;  2WS3 B;  1XCT L;  3AE6 B;  1RWS A;  1V8C A;  1C4A A;  2KDM A;  2XN9 C;  2W54 A;  1RFK A;  2PW9 A;  4MH8 A;  4RNA A;  2WU5 B;  2BS3 B;  2WXH A;  2WXK A;  3T3O A;  3UI3 A;  1C4C A;  5FK9 C;  3AEA B;  2MJE A;  2M0A A;  4D2K A;  1F77 A;  2ICI A;  5G5G A;  4USA A;  1HXY D;  2KN4 A;  1B1Z A;  3NVZ A;  2KWD A;  1K51 A;  4AQ7 A;  3I57 A;  1JCK B;  1EU3 A;  2VZK B;  1TS3 A;  4CQN A;  2RDH A;  4YSZ B;  1KLU D;  4H2A A;  1MVK A;  1TS2 A;  3KWL A;  1VJK A;  2WXR A;  3Q8C A;  3W5U B;  5TSS A;  2DYM A;  4J3O D;  3KLS X;  4RF0 A;  4WWM A;  3EGR A;  1TJE A;  3NRZ A;  1QQR A;  1GTH A;  1QLB B;  1SJH D;  2AX5 A;  3TEW A;  2WXM A;  3Q8F A;  1KLG D;  4XDC A;  2D5G A;  2QJL A;  1FCC C;  1K50 A;  1TY0 A;  4LLG M;  4M0W A;  2WDQ B;  3AH7 A;  2SEB D;  3P1M A;  1FD6 A;  3NVY A;  2CU3 A;  1UNS A;  2Y5P A;  1KH0 A;  3AEB B;  1D5Z C;  4TMA B;  1GT8 A;  1D6E C;  1TKE A;  2WXP A;  2IGG A;  4OVZ A;  2IGH A;  3GS2 A;  2MJ3 A;  3FC4 A;  1V97 A;  2J52 A;  1SEB D;  2QEJ C;  3P4S B;  2LUM A;  5AUK A;  4B0E A;  3W5V B;  1PGX A;  1JAL A;  2K9X A;  2RMM A;  3ZQ4 A;  2PIA A;  4B0M A;  1VZ8 A;  3MC0 B;  1AN8 A;  1XLN A;  1FNW A;  4RH6 A;  2CJN A;  4WQM A;  4GDK B;  3DWG C;  4TQ0 A;  1N61 A;  3P42 A;  1DOI A;  1TKY A;  2GRI A;  2LEK A;  1ET6 A;  2RDG A;  3PZ8 A;  4KKJ A;  4DQO C;  3HUI A;  5MPO A;  1YNT E;  2DLB A;  2QSD A;  1N62 A;  3KWV A;  2V3P A;  2WDR B;  2VZK D;  4XWT A;  3V3X A;  2BB6 A;  2PKO A;  2DBY A;  2Y5C A;  4MAC A;  4DXG A;  4N6E B;  2WXL A;  1FRD A;  1C9F A;  4KGS A;  1XLP A;  2SAK A;  4PT5 A;  4UDU C;  5HG2 A;  3IXS A;  1DOY A;  2WXJ A;  1DGJ A;  2PVG C;  4HJG E;  2AQ2 B;  4YSX B;  1A70 A;  2W82 A;  1ENF A;  5EE3 A;  4ZOH C;  1F2R I;  1P7E A;  1HQR D;  1PUT A;  2L1A A;  2OHF A;  2W3R A;  3AE1 B;  1MHH E;  3DWM A;  1GAQ B;  1V1P B;  3AMZ A;  3E9S A;  1YN4 A;  4JX1 C;  3T3N A;  3N9Y C;  3TEY A;  3VRA B;  4IDI A;  1CJE A;  1PYW D;  1N63 A;  3AE4 B;  1BUI C;  2INN E;  2LHE A;  3E56 A;  4A6Q A;  3U4E G;  1WGK A;  4RFB A;  2ZW1 A;  3BZD B;  5EE1 A;  1P7F A;  2YEP F;  3AEE B;  1JRO A;  1FNU A;  3IAS 1;  1DYQ A;  2LGI A;  1SBB B;  1AWD A;  2K5P A;  3LYY A;  4JE3 B;  1TZO A;  2NTS A;  1NEK B;  2MEK A;  3V05 A;  4MT5 A;  3LXF A;  5G5H A;  1FCL A;  5C2T B;  2Q5W D;  4MM3 B;  1WWT A;  1EM7 A;  3ZGZ A;  1Y56 A;  1VZ7 A;  2FE8 A;  2L52 A;  1C79 A;  3FAH A;  3Q8A A;  2E3T A;  2EEL A;  3AE2 B;  3RFZ B;  1I4X A;  1SSN A;  2EKI A;  2WXI A;  2PMV A;  4EE2 A;  1IBX B;  1M4V A;  4YXD B;  1C77 A;  2QIL A;  2BYT A;  5D3I B;  3CF4 A;  3BVZ A;  2X38 A;  4HRS A;  1PDX A;  2WNM A;  5LNK 1;  1IUE A;  4N59 A;  3SFE B;  2IPK D;  3NUH B;  1FM0 D;  4REZ A;  1OFF A;  2OED A;  1KRH A;  4YTN B;  1CK1 A;  2G9H D;  1V1P A;  4C80 A;  2DWQ A;  1H7X A;  2AQ1 B;  1J7C A;  3AED B;  3U7Z A;  3I9V 1;  1T6B X;  1FMA D;  1WRI A;  3ZJU A;  1GB4 A;  4JWS C;  2ONQ A;  3W9C B;  2BB5 A;  1JML A;  5EE9 A;  1OQR A;  2LMC A;  1PGA A;  1T5X D;  5BYR A;  1RYJ A;  1N5W A;  4IOI E;  2KAJ A;  1I7H A;  1VDV A;  3EUB 2;  2WLB A;  1QT9 A;  2M19 A;  3BYT B;  1D4B A;  2J42 A;  5BYS A;  4YSY B;  1K53 A;  1XLO A;  3KQ4 A;  4TSS A;  4Q2J A;  2GB1 A;  1L5P A;  2PTL A;  2Y3A A;  2PLP A;  3BWU D;  2WDV B;  3BK1 A;  4OHJ A;  2KQ4 X;  5BYQ A;  1GB1 A;  2LFI A;  1VLB A;  3AV8 A;  2WQY B;  4XWW A;  1D5M C;  1ZUD 2;  4RGN A;  3FIL B;  4US8 A;  1SB3 C;  1IBX A;  2V3N A;  4JPS A;  1TKG A;  2RPV A;  4O1N A;  4WAF A;  5BMH A;  4ZHP A;  1YJJ A;  4RCO A;  1F0Z A;  2JZP A;  3TEX A;  5EE0 A;  4GDL B;  1YQ3 B;  1NI3 A;  1ZPS A;  1FXI A;  2KMM A;  1D5X C;  4RGO S;  1FFU A;  1PGB A;  1I4P A;  2Z8L A;  3P4Q B;  1SF0 A;  1L6V A;  2TSS A;  1WXQ A;  2K3U A;  1MI0 A;  3AN1 A;  5BMI A;  4KX6 B;  1RM6 C;  2KAC A;  2BTE A;  3VR8 B;  1WSP A;  2BBC A;  3Q69 A;  1C4P A;  2MJD A;  1FIQ A;  1DOX A;  1GPX A;  4A8X C;  4LTU A;  5H92 C;  1FXA A;  1TY2 A;  2WXQ A;  5C3J B;  1IGC A;  2MH7 A;  4P6V F;  4YTP B;  5BMG A;  1J7B A;  1NEN B;  4P16 A;  4C56 C;  1JWB D;  5E6J A;  5GXG B;  2HTM E;  1T3Q A;  1IGD A;  2N9L A;  1ZE3 D;  3TEZ A;  1NYR A;  1N60 A;  4RGT A;  1V1O A;  4GLS C;  3SR6 A;  3AE3 B;  3HVZ A;  2V0G A;  2L83 A;  3R2T A;  1B9R A;  1I4H A;  3IT6 B;  4WUR A;  1SE3 A;  1JWA D;  1BXT A;  4IKG A;  4YWG G;  3PZ7 A;  3RPF C;  3P4P B;  3GB1 A;  4A55 A;  1E10 A;  2IJ0 A;  1C78 A;  4XDD A;  3AM9 A;  4N58 A;  2JYE A;  1SIJ A;  2WP9 B;  1FFV A;  3ZJT A;  3AE7 B;  2K22 A;  2BS2 B;  1QOF A;  3B2G A;  3BVG A;  4HRO A;  1MPE A;  4ZHO A;  5H8Y E;  4TQ1 A;  3VQI A;  1F2R C;  3AEG B;  4OZA A;  4NAM A;  1NVI D;  4US9 A;  1TS5 A;  2WXG A;  5JXV A;  3EA6 A;  1KFY B;  3TSS A;  2B76 B;  2I2Y A;  2BS4 B;  5HFY A;  1XLQ A;  1QIL A;  1FO4 A;  3NVV A;  1YQ4 B;  1ZDV A;  3NZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...