2WQYB

Remodelling of carboxin binding to the q-site of avian respiratory complex ii
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
239
Chain Sequence
TSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Remodelling of Carboxin Binding to the Q-Site of Avian Respiratory Complex II
rcsb
molecule tags Oxidoreductase
total genus 69
structure length 239
sequence length 239
chains with identical sequence O
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wqyB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wqyB01
1RM6C 1H7WA 1VLBA 3SFEB 3W5UB 3AE6B 1NEKB 4YXDB 1AYFA 1WWTA 1XLPA 1FXAA 1AWDA 1FO4A 1JALA 2LEKA 1J7CA 3P4QB 1N62A 1NYRA 3AECB 2E3TA 2PIAA 1T3QA 2K22A 2CJNA 2M56B 2HTME 1DOIA 1SB3C 1L6UA 1QOGA 1N5WA 1SF0A 3P4SB 1WXQA 3CF4A 4C7ZA 3AE3B 1F0ZA 3AEFB 1VJKA 3CIRB 1QOBA 1GTHA 1R7SA 2N0SB 2PVOD 1QF6A 2Y5CA 2EKIA 5G5HA 3AE5B 1WGKA 2WU2B 3AEEB 2CU3A 5C2TB 2JQRB 4ITKA 2JX5A 1JWBD 1PDXA 3B2GA 1NYQA 3AB5A 1QLBB 1YQ4B 2WS3B 2W3RA 1E0ZA 4YTPB 1E9MA 3ABVB 3AEAB 1GAQB 2BT6A 2PVGC 4P6VF 4US8A 1DOYA 1ZOYB 1TKYA 2AX5A 1JROA 2WLBA 3DWMA 3AE7B 3AN1A 3LB8C 3AE9B 2KAJA 1FIQA 3AM9A 2Q5WD 4HROA 1TJEA 4N59A 1JQ4A 1XLNA 5MPOA 1V8CA 3DWGC 1OQRA 3AH7A 3AV8A 3ZYYX 4LTUA 3AE4B 1L6VA 2KMMA 3BIID 3P4PB 5G5GA 3B9JA 3PO0A 1N61A 1TKEA 1YQ3B 3KWLA 3EUB2 4HRSA 4YTMB 1E7PB 1WRIA 4N58A 2B76B 1PFDA 3AE2B 3P4RB 3VR9B 4FXCA 1XO3A 1FMAD 2CJOA 1QT9A 3NVWA 2BS4B 4A9AA 2PKOA 4YSZB 2K9XA 1KRHA 2M19A 4ZOHC 2BS3B 1IUEA 3NVVA 2K5PA 5EE1A 5AUKA 4C80A 3VRAB 4KX6B 2WDRB 1A70A 3AE1B 1KFYB 1RYJA 3AMZA 1TKGA 3NS1A 1H7XA 4YSYB 1TYGB 1J7AA 3HVZA 2W3SA 1OQQA 3SR6A 5EE0A 1FFVA 2OHFA 1E10A 1DGJA 1JWAD 3AE8B 1YJJA 4US9A 1RFKA 1DOXA 3P63A 5GXGB 2MJ3A 3NVYA 4YT0B 3LXFA 2L83A 1ZUD2 3FAHA 1PUTA 3AEDB 3HRDD 4JWSC 1RWSA 1L5PA 2WQYB 1N63A 5EE9A 1QOFA 3VRBB 5C3JB 1JW9D 2L52A 1ROEA 1GT8A 1E6EB 1FFUA 4ZHOA 2WU5B 1CZPA 2H88B 4JWUC 1J7BA 5EE3A 3VR8B 3AEBB 5H8YE 1B9RA 2WDQB 1FRDA 1ZP0B 1XLQA 1VDVA 3NVZA 2MJDA 2ACZB 1UWMA 1WYGA 4C7YA 1L0VB 5AUIA 3B2FA 1I7HA 2BS2B 1CJEA 4YTNB 1GPXA 1XLOA 3CWIA 4WQMA 1V97A 1FRRA 1NI3A 1NVID 3W5VB 2H89B 1KF6B 4JX1C 2MJEA 3P1MA 3SFDB 4ZHPA 1FM0D 4USAA 5H92C 2WDVB 2DBYA 2W54A 1SIJA 1NENB 3L4PA 1N60A 1JRPA 1GTEA 4IDIA 2DWQA 3WCQA 1YJIA 4YSXB 1EWYC 1N5XA 2W55A 4N6EB 3HUIA 3W9CB 3NRZA 3AEGB 2QIEB 1OFFA 1QOAA 2G1EA 2QJLA 3FC4A 2MH7A 4WWMA 2WP9B 1FXIA 3RPFC 2FBWB 3ETRA 1ZXIA
chains in the Genus database with same CATH superfamily
4IWPA 1VLBA 3SFEB 4C56C 2E3TA 2KC1A 4RH6A 2TSSA 4EOYA 2LRUA 3DBSA 4MH0E 2NTTA 2PPHA 3E56A 2PVOD 2J0KA 2WNMA 1FD6A 4MM3B 5G5HA 3AE5B 4C4VA 2WU2B 2JQRB 4EZJA 3P2BA 1JWBD 1YQ4B 2INPE 1KTKA 2PTLA 4A90A 4RCOA 1R4MB 5HI1A 4DDID 1E9MA 4DHJD 3ZJTA 2WLBA 2FCQA 2MEKA 5HKHA 1J0GA 1P7FA 4GDLB 1YNTE 4P16A 3MC8A 1EWCA 2LHDA 2WGSA 2O2VA 3B9JA 3RI7C 1JWMD 3EUB2 5IO9A 3O65B 3RCZA 1E8WA 2BS4B 2WXLA 2M19A 2AQ3B 2WXGA 5AUKA 4OZCA 5D94A 5BO4B 2K3UA 3IT6B 2O6VB 5LXHA 1ENFA 4FA6A 3NS1A 1NDDA 3M3JA 2IBIB 2LZ6A 3Q2AC 2Z0EB 3MP9A 2UU7A 1RFKA 5LXIB 1UGJA 4PS8A 4IOIE 1J19A 1RWSA 4ZDVA 3C19A 1WGDA 4AS1A 4CYEA 2W82A 1UWMA 3I9V1 4C7YA 2KQ7A 2JU6X 2ZPYA 3PLUA 2I1JA 3ZVVA 3NS8A 4YL8A 1LFDA 3V3XA 1E8ZA 2DZIA 1C4CA 4EUTA 4B9KA 2ZCBA 1GTEA 4W9DA 1K53A 3Q3OC 1LGRA 4MEMA 4IKGA 2JRHA 3NZUA 3BYTB 2FBWB 2MRPA 3AULA 1RM6C 1WGHA 2FIDA 1WWTA 1JALA 3P4QB 3AI5A 4IM0A 2HD5B 2D3CA 2N0SB 4M0WB 1GTHA 4BBNF 3ZTDA 3KUZA 4B0EA 4BKSA 1VR9A 4ARIA 3ZXVA 3EFCA 1GUAB 1DOYA 2IO2B 4RFBA 3ZJUA 1WY8A 2J7QB 5J17A 2LFIA 5D3IB 2N9KA 2O6VD 1KH0A 3T3NA 4ZRPA 2Y3AA 5DCNA 4BOSC 2KMAA 4C4VB 1QT9A 2JF5A 2KLCA 1KRHA 4M01A 3NZ3A 1C77A 3KUCB 4NPNA 3PVLA 3DVGX 3RNEC 4RGOS 1H7XA 2N1WA 3URYA 2DYOA 2DENB 1P3QU 1CQVA 5EE0A 2BYFA 2MA9B 3AE8B 2KJ6A 3DDCB 4US9A 1H8CA 1WJUA 1ZUD2 1L5PA 2KMCA 2RPQA 1JW9D 2MCNB 2O2VB 3VR8B 2KFKA 2SAKA 5C23A 1K50A 1JRUA 1GPXA 4EZKA 1P98A 3ZLZA 2LGXA 2LWPA 3PZDA 4LNOA 4MH8A 2FNJB 1EWYC 1OFFA 2WP9B 1WFYA 3Q8AA 4GSWA 1FXAA 1Q1OA 3JSVA 1TT5B 2LMCA 1L4ZB 3ML8A 1SF0A 1N5WA 2KNBA 2HE7A 3VH4B 2OOBB 1WGKA 1IBXA 2WXIA 1V2YA 3R2IA 3GZNI 2KHWB 1D3ZA 4HPPA 1JROA 4A20A 5CHFA 2IGGA 4N59A 1JQ4A 1XLNA 5MPOA 1T6BX 3DBHB 1I4QA 3BK1A 1S1QB 2NS5A 3MC0B 4HLEA 4GIVA 4P1BC 4EEWA 1UF0A 3ZXRA 2M17A 1KLVA 3AE2B 5JH5C 1LXDA 3PZ7A 4ZRQA 4RGMA 2DYBA 2QHOA 4NJCA 3HVZA 2CU1A 2W3SA 3RNAC 1DGJA 4E74A 2CKHB 4UDUC 2L8JA 4B0MA 3P42A 2CHZA 1E6EB 3HK0A 2D5GA 3L10B 4JWUC 3I3TB 1B9RA 1VDVA 2PW9A 1C1YB 1E5WA 2WYQA 4WQMA 1MHHE 2FCNA 4NNJB 1MG4A 4JX1C 3W2DA 5E6NA 2BWFA 2N9PC 1MFWA 1WH3A 2OJWA 4K3BA 2MH7A 2GBNA 1GG3A 3WAOA 3ETRA 1ACCA 2KDMA 2KFKB 1KOTA 3JVZX 4W9KA 1XLPA 2D3GA 3N1ZC 3AECB 1TZ1A 1P1AA 3NG0A 3VXWA 1UBQA 1D5XC 1DYQA 2VZKB 2BVCA 2ZJDA 4HKQA 2J0MA 2OEDA 1EF1A 2AQ2B 4W9CA 2JY6A 2Q5WD 3GZNB 4BKSD 2CR5A 2Z59B 3JSVB 4BKTA 3DHGC 1ISNA 2JVCA 3ZJVA 1IP9A 3BVMA 2WXFA 1VZ8A 1L6VA 1F1HA 2FUG1 2LXCA 3PO0A 4BVUC 1TS4A 1IGCA 4CQNA 2KT7A 2K39A 1IUEA 4TKNA 2BKRB 1SE2A 4XZ4A 4KX6B 2WDRB 1RYJA 3WA0A 4YSYB 1TYGB 1ET6A 3SR6A 2YEPB 1VZ6A 2OHFA 2I1KA 3U7ZA 1YJJA 1DOXA 2ZCCA 2WQYB 2D2QA 4JLCA 2KACA 1PGAA 1TY2A 3U2SC 2FE8A 3QIJA 4JE3B 1Q10A 3KLSX 1MPEA 2FIFA 1PQSA 4HJGE 2DZJA 1CJEA 2N7EA 4MGZE 1FRRA 2L05A 1I4RA 3R3MA 3RMKC 4FHJA 4MT5A 1KJTA 4J6IA 1WR1A 2KDIA 4G50A 1WSPA 1XEEA 3FKYA 3N1YC 1FEHA 1WJ4A 2ONQA 3OG5A 1DOIA 4ICUA 1E8XA 4K81A 4KIKA 4MDKE 4W9LA 3ML9A 2ASQA 2WXKA 1WXQA 3TBLD 1C9FA 3VHTC 1SGHA 3TMPB 1YMHE 5IOIA 3VVWB 2W3RA 5BYQA 1ZOYB 3DWMA 4GGQA 2DZMA 2MHJA 2R2QA 3ZYYX 1T0SC 5IN7A 4HDOA 4MGKE 1EM7A 4KZ0A 1YQ3B 3DBLB 2B76B 2JWZA 1UH6A 5FR6A 2BS3B 2K5PA 4M02A 2WXMA 3RNBC 2IO0B 3RUIB 1P9DU 2R61A 5E6JA 2KN5A 3WANA 2RGFA 2FCSA 1EUVB 1V49A 4HJKA 3ZTCA 2BGFA 4WWPA 1I4GA 4JWSC 4ZYSA 3EHVA 2LHEA 2K8HA 2WU5B 3Q3NC 1ZP0B 2GMIC 1V1PA 2DNFA 2KYWA 3VAWA 3ZO5B 1G6JA 1Q5WB 2NBWB 1VD2A 4IW0A 1D5MC 5L83A 3UI3A 3CF6E 2IGDA 3L4PA 1JWSD 3IFWB 3Q8BA 2DLBA 3WCQA 3DHHC 2V0GA 3DQVA 4WWMA 3R2TA 3PPAA 4HCNB 2WXNA 2ZEQA 3VUYA 1FO4A 5CHVC 4HCPB 3ZUNA 2LVOA 3QQ8B 3PGEA 4KDIC 5LLIA 1L6UA 4AP4C 3MJWA 3OJ3A 2MBOA 2M1MA 2MLBA 1MHXA 3TJPA 1IGDA 2KTFA 2ZZPB 3Q69A 2MBQA 4LNKA 1NYQA 2HDEA 1UBIA 4W9IA 4EFOA 3AE9B 4II3B 3IHPC 4G3XB 4AWJA 4JQWC 5JZEB 4KIKB 3AV8A 1WM2A 3JW0X 2D3BA 1C4PA 3RNGC 3X0WA 1UZXB 3KQ4A 3VH3B 3P4RB 1PGXA 3UQBA 2PKOA 1CK1A 5BMIA 1KFYB 2QSDA 2G4SA 2CHXA 2B3AA 2KFJA 2ON8A 3QARA 3APFA 5KHQA 1PYWD 2GRIA 2YEPF 2ZPNA 1GJZA 1FFUA 2LVPA 4XE0A 2FCMA 4AQ7A 1TS3A 3OJ4B 3QAQA 5AZFA 1I4XA 1E7VA 4RGTA 5HG2A 3LYYA 4M8NA 2MJDA 2WWZA 3R7RA 3MTNB 1KLUD 2L00B 1WYWB 4FJVB 1WJ6A 3RNFC 1OQYA 2MJEA 3O13A 2J42A 4NAMA 3N9YC 4WH4A 4IDIA 2KJRA 4HDQA 2K0PA 2JXXA 4IUMB 5DPTA 3S2AA 2XBBC 3I57A 4MSQB 3NRZA 3Q3JA 3AEGB 3UQAA 2YVCA 2RR9A 1ZXIA 4KVGB 3TCAA 3AE6B 1I4PA 2XK5A 1V1PB 1NYRA 2KVRA 2PIAA 3TEYA 3RFZB 1B1ZA 2BW2A 2AEHA 4REZA 2KWCA 3W1YA 3CIRB 3NZSA 1OEYJ 3RULA 3APCA 4KSKC 2JZPA 4IWQA 2JX5A 2WXOA 2J4XA 1BT0A 4IM3A 2L1AA 3ZIMA 1TZOA 3TIXA 2N7DA 3AN1A 2ICIA 4TQ0A 1RAXA 4LCDE 3RN9C 2DZKA 4TMAB 3N1XC 3AE4B 2V4LA 3IT4B 3ZKJC 2ZVOA 1XO3A 2FUHB 1FMAD 4MGYE 4MACA 1N6ZA 4EKUA 3PTFC 1WE6A 3GOEA 4E3CA 3ZGZA 3PSEB 1FNWA 2KN4A 2JUOA 2IY1B 3R66C 4DHZE 1WIAA 3ZDMC 1Y56A 1YN4A 3M63B 4ANVA 1ESFA 4FHKA 2JSVX 2BPSA 2AL6A 3NVZA 4NY0A 3JYUA 4RF1A 3ZW3A 5AUIA 1Z5SB 3RYTA 2WXPA 4J3OD 2CS4A 1XLOA 3VTVA 2C9WB 3W5VB 4A3PA 1SEBD 1T0YA 2KLGA 3J9CA 2N9EB 2NCNA 4AJYB 4W9HA 1NENB 5T8IA 4YWGG 4WWOA 2L0TA 2W55A 2K8CA 3KYDD 2QJLA 1WRDB 2MX2A 2LJIA 1FXIA 2MBEA 4K7SA 3T3OA 2V4IB 5DPWA 2DAJA 3QX1A 2NBVB 1WGYA 2GB1A 4XWTA 4FADA 2Y5BB 2J52A 2HTME 2K8BA 1KLGD 3MHSD 1T5XD 3TSSA 3TEXA 3MHZA 1EO6A 3AB5A 1ET9A 2KDEB 1E0ZA 3IVFA 2BQQA 4KKJA 1YN3A 2N9LA 2BYEA 1HQRD 3U4EG 4HROA 4MGIE 2XK5B 1HTOA 1L0YB 2L7RA 1AW7A 1SSNA 2LGIA 4URKA 1VRAB 1N61A 1YOVB 1TKEA 2GOWA 3QWZB 3DPDA 4YTMB 1E7PB 1M4VA 1CMXB 4B95A 1JWUD 3RT3B 3VRAB 1T0RC 1IPGA 1J7AA 2BF8B 2L76A 1C79A 2PE6B 2VH2A 3DCGA 1V80A 1JMLA 2M0XA 3M62B 1E90A 3VRBB 3EFUA 5CX3A 5FR3A 4K3CA 4ARCA 4KGTA 4M00A 5G2NA 1HEZE 1NVID 2G4DB 4ZRJA 5C1ZA 3ZNID 3TL5A 2G9HD 2W54A 3BYYB 3M95A 3OAWA 3WALA 1TBEA 3R7QA 2G45B 3HUIA 2NVUI 3NOBA 5BYSA 2WXHA 4WAFA 1I42A 4YXDB 3GP7A 4FJZA 4OZAA 2Z8LA 2LJ5A 4NJ7A 4W9EA 1KM7A 3AE3B 4ZRIA 2MSED 3R8BA 1Q0WB 4KZCA 2MW5A 2KO3A 1RLFA 1WR6E 4ANXA 4L1BA 3AEAB 3SDLC 3LDZE 2KK8A 4A3OA 3IAM1 4S0RA 3H1UA 3L16A 1RRBA 2D3AA 4BAXA 2L3ZA 5G5GA 3PT2B 3DVNV 3H6NA 4RM9A 1PFDA 1SE9A 1L0XB 1K52A 3PHWB 1F52A 2JZ3B 4WIPA 2WX0A 4OVUA 4K7UA 2V3NA 1JCKB 3NHEB 3P63A 3HVDA 4ZRKA 3LXFA 1WXSA 4W9GA 4HWIB 4ICVA 1F77A 4ANWA 2IO3B 5C3JB 3QCAA 4FLHA 2NR2A 1HXYD 3AU4A 4L23A 3ZRCA 2QEJC 1WYGA 2NTSA 4HPMB 3H7SA 4IM2A 3BVGA 1KF6B 3N32A 2MWSB 2MQJA 1EU4A 3SEBA 2IYDB 1N5XA 2KWDA 2QIEB 2UYZB 4M8MA 4WJQA 2M4NA 1E7UA 2GI9A 1NEKB 3HHMA 1GC7A 1SB3C 2D10A 3Q8EA 1L2NA 3CF4A 1U4AA 3AEFB 1H4RA 2Y5CA 1K8RB 1V5TA 3Q3FA 2K6DB 1GC6A 1NBFC 3IG3A 2VZKD 4JPSA 1SIFA 1XXGA 1ZDXA 2X38A 2KMMA 3BIID 4A6QA 3K9PB 1Y8RC 1ZE3D 2KJHB 2SEBD 1V5OA 4FXCA 2K9XA 2RDGA 2LD9A 1Z2MA 3PV1A 1A70A 3APDA 3B0AA 4ANUA 1FFVA 3RZWC 3V62A 1V81A 3C0RB 3FAHA 1ROEA 1GT8A 1M94A 4HKZE 2WDQB 4WQOB 1LO5D 4DXAB 3VDZA 4DDGD 1I7HA 2J0JA 1VCBA 5J18A 1UNSA 3Q3MC 2OJRA 4WAAA 5H92C 3KW5B 2DWQA 1XCQL 1WX9A 4OW0A 4YSXB 2JWUA 3BVZA 1R4MI 1FCLA 3BINA 1HZ5A 3SU8X 2C7MB 4G0NB 3VTUA 5EDSA 2Y5PA 1AYFA 1LQBA 4A55A 2NMQA 2EELA 3N3KB 1L4DB 4B6WA 2CJNA 2N4FA 2IZVB 3T8MA 1ZXHA 3KVFB 2E6XA 4OHJA 2EKIA 4XX5A 3HM3A 4RNAA 3PHXB 4BOZB 1V86A 4NZLB 4PS7A 1UWXA 2BT6A 4P6VF 3ABVB 2RD0A 3RZFA 3PREA 3LB8C 4HK2A 4AOFA 3L13A 2KAJA 1FIQA 2KZRA 5JHAA 1YX5B 2HTHA 3PRZA 4LTUA 2LUMA 3MJ5A 4H2AA 5D7GA 4LJOB 4BFRA 3NY5A 3EGRA 3KWLA 1WRIA 1T0QC 3WIMA 4QAYA 3A33B 4YSZB 4RMAA 3U52E 1C4AA 3QK0A 1YN5A 1WGGA 5L95C 4N9F4 2GBKA 2IGHA 4KGRA 3N20C 1JWAD 4Q2JA 4DXGA 1WX8A 4RGNA 4YT0B 2L83A 1UD7A 5CHWA 4DQOC 3A4SC 1OGWA 2A4ZA 1CZPA 2LVQA 1D4BA 2WX1A 1D5ZC 4PK1A 3KWVA 1NI2A 4F1SA 2I2YA 4TSSA 5E6OA 1FNUA 3SFDB 1MJDA 3U7DA 4MELA 3GS2A 4FN2A 3BWUD 3IAS1 1WJNA 2AL3A 1V6EA 2MBBB 3V05A 3QC8B 3QHTA 2K1FA 4MJSA 4XDCA 2L0FA 4AJWA 1OEYA 1T3QA 2BB5A 3ZNZB 1GOZA 1QOGA 3UIPB 1VJKA 1QF6A 3H7PA 4IC7B 5DPSA 1J8CA 1WZ0A 4JL9A 3DVGY 3PRMB 3AEEB 3Q14C 1FNVA 4LDTB 2PLPA 4DXFA 1PDXA 3EECA 2C7NB 1A5RA 3DVNU 3DBRI 4XDDA 1GAQB 4LNNA 4JIOU 1WGRA 3AE7B 2V9HA 2Z0DB 1TJEA 3NJTA 1OQRA 3PZ8A 2BBCA 4XGAB 2ZVNA 1K51A 2IO1B 2KDFB 4HRSA 4N58A 2GBJA 2CJOA 2RDHA 4C80A 2LRWA 1TKGA 2VH1A 1AN8A 5KHOA 1ZPSA 3I63C 5G55A 2PMVA 3HRDD 1LM8B 4I6PA 5EE9A 2L52A 2KKCA 5EE3A 3V6CB 3PS6A 1FRDA 5J2RA 2JRIB 2AQ1B 3C8YA 3SD5A 2IPKD 4EE2A 1R4NI 2MP2A 4P7IA 1XD3B 1NI3A 3RNCC 2D07B 2PE9A 2HJ8A 3W1SC 3BK2A 2EMSA 1SIJA 1N60A 3DHIC 1WMHA 1MVKA 3EA6A 1RFAA 4FULA 5CTRC 1WM3A 4KGSA 3ZNHB 2KX0A 3DBHI 2LGDA 4GN1A 5BMGA 4LDTD 2FAZA 3ZRFA 2EKEC 3HIZA 3MFGA 4C7ZA 1XQQA 1QOBA 1R7SA 3ZQ4A 1WXMA 2R2OA 4AUQC 1WXAA 3IBEA 3V6EB 4BKGA 2KXJA 1FCCC 3KH0A 4NQLB 2N7JA 2LGSA 3B2GA 4WJOA 1P0RA 1QLBB 2LXAA 2RMMA 1QILA 4RM8A 2WS3B 3OLMD 4PYUA 2KX3A 3EC8A 2PVGC 4PYZA 2AX5A 4HXDA 3DBRB 4GU2A 1GNUA 4MJSB 2KANA 4A8XC 4I6NB 4IWOA 2PJHA 1HE8A 4WWNA 4R3DA 3ENEA 1MG8A 3H7PB 2IDYA 3IXSA 3A9JA 2INDC 3Q6BA 4ZOHC 4GOCA 3U8ZA 3X23A 1PGBA 2XEWA 1L7YA 1STEA 1P7EA 4OZBA 1TY0A 2KOXA 1UUPA 4GXBA 2LASA 4OVZA 5FKAC 4CO7A 3B08A 3KYCD 3H9DA 4TUUA 4LK0M 1V9JA 3GE3C 2G3QB 1PUTA 3DOWA 1SE3A 1SBBB 1N63A 4ASWC 4XYCA 1SXTA 2KVZA 4G11A 2QMTA 4NJ6A 3D32A 2EMTA 1ZW7A 4WURA 2ACZB 2IY0B 4YTNB 3U30A 2DHZA 4GB9A 2H89B 1BXTA 1R4NB 3L54A 2DBYA 5JHBA 3T9LA 4MSMB 3QA8A 2VRRB 2A5UA 1YJIA 2BYTA 1TIFA 5IP4D 1ZGUB 3ECIA 3ZDTA 4GLSC 3N30A 1FXTB 4W9FA 4I6LB 1ZKHA 2J53A 3A1QA 2PEAA 5I4DA 5D6JB 3VUXA 1J7CA 1MI0A 2K22A 2W9NA 3ZNGC 2MP2B 2BTEA 3E9SA 1F0ZA 1YJ1A 4GMVA 2RSUA 2AYOB 1I35A 3KUDB 4TV3A 5C2TB 1WMHB 4LLGM 2KWUB 1YIWA 4YTPB 4P1CC 3PLVA 4L2YA 1TKYA 2ZW0A 2C7HA 2WXQA 1GB4A 2ZW1A 1C76A 1SJHD 1E8YA 1V8CA 2JYEA 3DWGC 2V1YA 2WXRA 4ZYNA 5IKCM 5E6PA 4LNIA 1EF5A 2DYMA 4HPLB 2V3PA 3VUWA 4W9JA 3HM6X 3TUOA 2INNE 1OTRB 3ONSA 2RDBC 2XN9C 1WXVA 2K6QA 1HTQA 2NPTA 5HFYA 5DPRA 1AARA 4K7WA 5D3DA 4K1RB 3GB1A 3BY4B 5LNK1 1SJED 3AEDB 1QOFA 3UGBB 1XF5L 3I5JC 4NAWA 4KSLC 3AEBB 4FJYA 4S17A 3A9JB 2LI5A 1WX7A 2QILA 5IA7A 1F2RI 2JYTA 1UGMA 1V97A 4HVBA 1FM0D 2BWES 1WF9A 1TTNA 3UIOB 2RPVA 3W9CB 1QZEA 2QDFA 1GB1A 2BYVE 3AXCA 4NQKE 5TSSA 1WE7A 4F8CB 1H7WA 3W5UB 3L17A 1AWDA 5AEKB 2LEKA 5BMHA 4C00A 3P4SB 3DBLI 3TEZA 4HEA1 1QKZA 1ZDVA 4KDLB 2WDTB 1XCTL 2CU3A 3L08A 3K9OB 2JXTA 1F9JA 1IBXB 1V1OA 2C60A 2V3SA 2REXA 1QQRA 2QC8A 3Q8FA 3A1QB 3TEWA 3A9KA 2KTRA 2AWTA 1XT9B 1IYFA 3AH7A 2KDBA 3P4PB 2BB6A 2ZNVB 4XWWA 2WHIA 3WAMA 5FK9C 2INCC 2KC2A 3FILA 4GDKA 3VFKA 5EE1A 2M8SA 3AE1B 3VTWA 4LJPB 3A4RA 1FPYA 2JT4B 1E10A 2UWQA 2MJ3A 1S3SG 3NVYA 2KWVB 3LJ3A 3NUHB 1WZ3A 4KV2A 2H88B 5H8YE 2XNAC 4DK5A 4LNFA 1VZ7A 3H8HA 4O1NA 3B2FA 1UELA 4F7ZA 4IG7B 4CHKA 1YD8U 2NPTB 2GLSA 2C5LC 4ZHPA 4USAA 2WDVB 4DHZB 4MM3A 4DWFA 2HJ1A 3WAPA 1C3TA 2I38A 3W1SA 5GMVA 3B1LX 1X1MA 2CHWA 2DX5B 2QCZA 3RPFC 4NAWB 4WJPA 3FC4A 5IAAC 4WJNA 1N62A 5AZGA 4GDLA 5TR5A 2M56B 3AU5A 4RF0A 3CSFA 3GE8C 4ITKA 3RD2A 5HHDG 2LUEA 2O6VA 2M0AA 2WXJA 1SE4A 4OVVA 4US8A 2JZZA 2ZNVC 4DBGA 3AM9A 1TS5A 2GBMA 2L32A 3L0WB 4EZLA 2NBUA 3Q8CA 4X57B 1HA5A 1BUIC 3UF8A 3CSTA 4DHJB 1D6EC 3V60A 3VR9B 3CMMB 1YQBA 3NVWA 4PS3A 4A9AA 1C78A 2BKFA 3QJZA 3NVVA 2MBHA 3AMZA 3ALBA 2N1VA 4D2KA 2D11A 1BMLC 4II2B 1OQQA 2GBRA 1WI0A 3PRPB 3OWEB 1HZ6A 3A9KB 5GXGB 3SHQA 2KTRB 1I4HA 2KD0A 5D2MB 3V61A 4PT5A 2KQSA 1YX6B 4XC2A 4ZHOA 4BZAA 1J7BA 2X8XX 1F2RC 1XLQA 2YLMA 2K25A 1L0VB 3FILB 2IJ0A 2JPHA 2BS2B 4GDKB 3CWIA 1TS2A 4TQ1A 4E71A 4M0WA 3P1MA 2KQ4X 3BZDB 5AZHA 3UINB 2DAFA 5BYRA 4KKIA 2N9XA 1EU3A 1JRPA 3VQIA 4FBJB 5JXVA 1TGZB 4BBNC 4N6EB 2LGYA 4ACFA 1QOAA 2G1EA 4JGHB 3MC9A
chains in the Genus database with same CATH topology
1VLBA 3SFEB 4YXDB 1WSPA 1XEEA 3GP7A 5BMGA 4C56C 2E3TA 4OZAA 4RH6A 2TSSA 2Z8LA 1FEHA 2ONQA 1DOIA 2NTTA 2WXKA 3MFGA 1WXQA 4C7ZA 3AE3B 1QOBA 1R7SA 1C9FA 3E56A 2PVOD 3ZQ4A 2WNMA 3R8BA 1FD6A 4MM3B 5G5HA 3AE5B 2WU2B 2JQRB 1FCCC 1YMHE 1JWBD 2N7JA 3B2GA 1QLBB 1YQ4B 1KTKA 2INPE 1QILA 2PTLA 2WS3B 2RMMA 4RCOA 4A90A 4L1BA 2W3RA 5HI1A 1E9MA 3AEAB 2PVGC 3ZJTA 5BYQA 1ZOYB 2AX5A 2WLBA 3DWMA 3IAM1 2MEKA 4A8XC 1P7FA 4GDLB 1YNTE 4P16A 3ZYYX 1EWCA 2LHDA 5G5GA 1EM7A 3B9JA 4R3DA 1YQ3B 1JWMD 2IDYA 3EUB2 3IXSA 2B76B 1PFDA 2BS4B 2WXLA 2M19A 1L0XB 2AQ3B 4ZOHC 2WXGA 2BS3B 1K52A 5AUKA 1PGBA 2K5PA 4OZCA 2K3UA 3IT6B 1ENFA 2WXMA 1STEA 3NS1A 4WIPA 1P7EA 4OZBA 1TY0A 2R61A 1UUPA 5E6JA 5FKAC 4OVZA 3MP9A 2V3NA 1JCKB 1RFKA 3P63A 4LK0M 3HVDA 3LXFA 1UGJA 1PUTA 1I4GA 1SE3A 1SBBB 4IOIE 1F77A 1RWSA 4JWSC 1N63A 4ZYSA 2LHEA 5C3JB 1SXTA 4AS1A 2WU5B 1HXYD 2QMTA 4L23A 1ZP0B 2W82A 4WURA 2ACZB 1UWMA 3I9V1 2QEJC 1WYGA 4C7YA 1V1PA 2JU6X 2NTSA 4YTNB 3V3XA 3BVGA 2H89B 1KF6B 1BXTA 1D5MC 1C4CA 3UI3A 2DBYA 2IGDA 1EU4A 3L4PA 1JWSD 1GTEA 3SEBA 1K53A 3Q8BA 2DLBA 1YJIA 3WCQA 1N5XA 2V0GA 2KWDA 2BYTA 2QIEB 4IKGA 4WWMA 3R2TA 4GLSC 3BYTB 2FBWB 2J53A 2WXNA 1RM6C 2GI9A 1NEKB 1WWTA 5I4DA 1FO4A 1JALA 1J7CA 3P4QB 1MI0A 2K22A 1SB3C 2BTEA 1L6UA 3E9SA 3Q8EA 1F0ZA 3CF4A 3AEFB 2N0SB 1GTHA 2Y5CA 1MHXA 1IGDA 4B0EA 1VR9A 4ARIA 5C2TB 3Q69A 4LLGM 1NYQA 2HDEA 4YTPB 1DOYA 4L2YA 1TKYA 4RFBA 3ZJUA 3AE9B 2ZW0A 2WXQA 1GB4A 2ZW1A 2VZKD 1C76A 1SJHD 2JYEA 1V8CA 3DWGC 2LFIA 2WXRA 4JPSA 5D3IB 2N9KA 3AV8A 1XXGA 1KH0A 1ZDXA 2X38A 2DYMA 2KMMA 3BIID 4ZRPA 4A6QA 3T3NA 1ZE3D 2SEBD 2Y3AA 2V3PA 1C4PA 3KQ4A 3TUOA 3P4RB 4FXCA 1PGXA 1QT9A 2INNE 2PKOA 2K9XA 1KRHA 2RDGA 3NZ3A 1CK1A 1C77A 2XN9C 1A70A 5BMIA 1KFYB 2QSDA 5HFYA 4RGOS 1H7XA 3URYA 5D3DA 2DYOA 3GB1A 1CQVA 5EE0A 2ON8A 1FFVA 5LNK1 1SJED 3AE8B 4US9A 1ZUD2 3FAHA 3AEDB 1PYWD 1L5PA 2GRIA 2YEPF 1QOFA 1XF5L 1JW9D 1ROEA 1GT8A 1FFUA 4AQ7A 4XE0A 1TS3A 4HKZE 3VR8B 3AEBB 1I4XA 2WDQB 4RGTA 1LO5D 5HG2A 3LYYA 2SAKA 2MJDA 1K50A 1KLUD 1I7HA 1GPXA 2QILA 1F2RI 2JYTA 1UNSA 1V97A 2MJEA 1FM0D 2J42A 3O13A 4NAMA 5H92C 4MH8A 3N9YC 4WH4A 4IDIA 2DWQA 1XCQL 2RPVA 4OW0A 2K0PA 4YSXB 1EWYC 3W9CB 3I57A 2JWUA 3BVZA 3NRZA 1FCLA 3AEGB 1GB1A 1OFFA 2WP9B 1HZ5A 5TSSA 1ZXIA 3Q8AA 1H7WA 2Y5PA 3W5UB 3AE6B 1AYFA 1I4PA 2NMQA 4A55A 1FXAA 1AWDA 2EELA 2LEKA 1L4DB 1V1PB 1NYRA 2PIAA 3TEYA 3RFZB 2CJNA 1L4ZB 2LMCA 1B1ZA 5BMHA 2BW2A 4REZA 1SF0A 1N5WA 3P4SB 3TEZA 3CIRB 4HEA1 1ZXHA 1QKZA 2E6XA 4OHJA 2EKIA 4RNAA 1ZDVA 2JZPA 1WGKA 1XCTL 2CU3A 2JX5A 1IBXA 2WXOA 4NZLB 2WXIA 2JXTA 2J4XA 1IBXB 2L1AA 1UWXA 1V1OA 1TZOA 2BT6A 3ABVB 3R2IA 4P6VF 1QQRA 3AN1A 1JROA 3LB8C 3Q8FA 2ICIA 2KAJA 1FIQA 4TQ0A 3TEWA 2IGGA 4N59A 1JQ4A 1XLNA 4TMAB 5MPOA 1T6BX 1I4QA 3BK1A 3AH7A 3MC0B 4LTUA 3AE4B 2LUMA 3P4PB 3MJ5A 2BB6A 4H2AA 5D7GA 4XWWA 3EGRA 3KWLA 5FK9C 1WRIA 3AE2B 3IT4B 1XO3A 3FILA 1FMAD 4YSZB 4MACA 3PZ7A 4ZRQA 4RGMA 5EE1A 3U52E 3AE1B 1C4AA 1YN5A 4NJCA 3HVZA 2IGHA 3ZGZA 2W3SA 4KGRA 1E10A 1FNWA 1DGJA 1JWAD 2KN4A 4Q2JA 4DXGA 4RGNA 2MJ3A 3NVYA 4UDUC 4YT0B 2L83A 1Y56A 1YN4A 4DQOC 3NUHB 4B0MA 3P42A 1E6EB 1ESFA 1CZPA 2D5GA 2H88B 4JWUC 5H8YE 2JSVX 2XNAC 1B9RA 1D4BA 3NVZA 1VDVA 2PW9A 1VZ7A 3H8HA 1D5ZC 4RF1A 5AUIA 3KWVA 2WXPA 3B2FA 4O1NA 2I2YA 4J3OD 1XLOA 4WQMA 1MHHE 3W5VB 4TSSA 1SEBD 4JX1C 1FNUA 4ZHPA 3SFDB 3J9CA 4USAA 3W2DA 2WDVB 1NENB 3GS2A 5T8IA 4YWGG 2I38A 2W55A 3BWUD 3IAS1 3W1SA 2QJLA 2MH7A 2LJIA 1FXIA 3RPFC 4NAWB 3T3OA 3ETRA 1ACCA 2KDMA 3FC4A 3V05A 2V4IB 1XLPA 2GB1A 4XDCA 4XWTA 1N62A 3AECB 1T3QA 2J52A 2BB5A 2M56B 2HTME 1KLGD 1GOZA 1QOGA 1VJKA 1QF6A 1T5XD 4RF0A 3TSSA 3TEXA 3MHZA 3AEEB 4ITKA 1FNVA 1D5XC 1DYQA 5HHDG 2PLPA 2VZKB 4DXFA 1PDXA 2M0AA 2WXJA 4HKQA 3AB5A 1ET9A 1SE4A 2OEDA 4XDDA 1E0ZA 2AQ2B 1GAQB 4US8A 4KKJA 1YN3A 2N9LA 3AE7B 1HQRD 3U4EG 3AM9A 2Q5WD 4HROA 1TJEA 1TS5A 2L32A 1OQRA 1L0YB 3PZ8A 2BBCA 1AW7A 1K51A 2WXFA 1HA5A 1SSNA 2LGIA 3BVMA 3Q8CA 1VZ8A 1BUIC 1L6VA 2FUG1 3PO0A 1D6EC 1N61A 1VRAB 1TKEA 1TS4A 1IGCA 4HRSA 4YTMB 1E7PB 1M4VA 4N58A 4CQNA 3VR9B 2CJOA 3NVWA 1JWUD 4A9AA 1C78A 3NVVA 1IUEA 1SE2A 2RDHA 4C80A 3VRAB 4KX6B 2WDRB 1RYJA 3AMZA 4D2KA 1TKGA 4YSYB 1BMLC 1TYGB 1J7AA 1AN8A 1ET6A 1OQQA 3SR6A 2YEPB 1C79A 1VZ6A 2OHFA 3OWEB 3U7ZA 1YJJA 1HZ6A 1ZPSA 1DOXA 5GXGB 1JMLA 1I4HA 2PMVA 3HRDD 5EE9A 2WQYB 3VRBB 2L52A 2KACA 1PGAA 4PT5A 1TY2A 3U2SC 4ZHOA 2FE8A 5EE3A 1J7BA 4JE3B 1Q10A 3KLSX 1F2RC 5FR3A 1FRDA 1XLQA 1MPEA 4ARCA 4KGTA 2AQ1B 3C8YA 4HJGE 1L0VB 1HEZE 2IJ0A 3FILB 2BS2B 2IPKD 1CJEA 4EE2A 4GDKB 3CWIA 1TS2A 1FRRA 1NI3A 1NVID 4TQ1A 1I4RA 4M0WA 3P1MA 2KQ4X 3BZDB 2G9HD 5BYRA 2W54A 3BK2A 3BYYB 4KKIA 1SIJA 1N60A 1EU3A 1JRPA 3VQIA 1MVKA 3EA6A 5JXVA 4N6EB 3HUIA 3ZJVA 1QOAA 2G1EA 4MT5A 5BYSA 2WXHA 4WAFA 4KGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RM6 C;  1H7W A;  1VLB A;  3SFE B;  3W5U B;  3AE6 B;  1NEK B;  4YXD B;  1AYF A;  1WWT A;  1XLP A;  1FXA A;  1AWD A;  1FO4 A;  1JAL A;  2LEK A;  1J7C A;  3P4Q B;  1N62 A;  1NYR A;  3AEC B;  2E3T A;  2PIA A;  1T3Q A;  2K22 A;  2CJN A;  2M56 B;  2HTM E;  1DOI A;  1SB3 C;  1L6U A;  1QOG A;  1N5W A;  1SF0 A;  3P4S B;  1WXQ A;  3CF4 A;  4C7Z A;  3AE3 B;  1F0Z A;  3AEF B;  1VJK A;  3CIR B;  1QOB A;  1GTH A;  1R7S A;  2N0S B;  2PVO D;  1QF6 A;  2Y5C A;  2EKI A;  5G5H A;  3AE5 B;  1WGK A;  2WU2 B;  3AEE B;  2CU3 A;  5C2T B;  2JQR B;  4ITK A;  2JX5 A;  1JWB D;  1PDX A;  3B2G A;  1NYQ A;  3AB5 A;  1QLB B;  1YQ4 B;  2WS3 B;  2W3R A;  1E0Z A;  4YTP B;  1E9M A;  3ABV B;  3AEA B;  1GAQ B;  2BT6 A;  2PVG C;  4P6V F;  4US8 A;  1DOY A;  1ZOY B;  1TKY A;  2AX5 A;  1JRO A;  2WLB A;  3DWM A;  3AE7 B;  3AN1 A;  3LB8 C;  3AE9 B;  2KAJ A;  1FIQ A;  3AM9 A;  2Q5W D;  4HRO A;  1TJE A;  4N59 A;  1JQ4 A;  1XLN A;  5MPO A;  1V8C A;  3DWG C;  1OQR A;  3AH7 A;  3AV8 A;  3ZYY X;  4LTU A;  3AE4 B;  1L6V A;  2KMM A;  3BII D;  3P4P B;  5G5G A;  3B9J A;  3PO0 A;  1N61 A;  1TKE A;  1YQ3 B;  3KWL A;  3EUB 2;  4HRS A;  4YTM B;  1E7P B;  1WRI A;  4N58 A;  2B76 B;  1PFD A;  3AE2 B;  3P4R B;  3VR9 B;  4FXC A;  1XO3 A;  1FMA D;  2CJO A;  1QT9 A;  3NVW A;  2BS4 B;  4A9A A;  2PKO A;  4YSZ B;  2K9X A;  1KRH A;  2M19 A;  4ZOH C;  2BS3 B;  1IUE A;  3NVV A;  2K5P A;  5EE1 A;  5AUK A;  4C80 A;  3VRA B;  4KX6 B;  2WDR B;  1A70 A;  3AE1 B;  1KFY B;  1RYJ A;  3AMZ A;  1TKG A;  3NS1 A;  1H7X A;  4YSY B;  1TYG B;  1J7A A;  3HVZ A;  2W3S A;  1OQQ A;  3SR6 A;  5EE0 A;  1FFV A;  2OHF A;  1E10 A;  1DGJ A;  1JWA D;  3AE8 B;  1YJJ A;  4US9 A;  1RFK A;  1DOX A;  3P63 A;  5GXG B;  2MJ3 A;  3NVY A;  4YT0 B;  3LXF A;  2L83 A;  1ZUD 2;  3FAH A;  1PUT A;  3AED B;  3HRD D;  4JWS C;  1RWS A;  1L5P A;  2WQY B;  1N63 A;  5EE9 A;  1QOF A;  3VRB B;  5C3J B;  1JW9 D;  2L52 A;  1ROE A;  1GT8 A;  1E6E B;  1FFU A;  4ZHO A;  2WU5 B;  1CZP A;  2H88 B;  4JWU C;  1J7B A;  5EE3 A;  3VR8 B;  3AEB B;  5H8Y E;  1B9R A;  2WDQ B;  1FRD A;  1ZP0 B;  1XLQ A;  1VDV A;  3NVZ A;  2MJD A;  2ACZ B;  1UWM A;  1WYG A;  4C7Y A;  1L0V B;  5AUI A;  3B2F A;  1I7H A;  2BS2 B;  1CJE A;  4YTN B;  1GPX A;  1XLO A;  3CWI A;  4WQM A;  1V97 A;  1FRR A;  1NI3 A;  1NVI D;  3W5V B;  2H89 B;  1KF6 B;  4JX1 C;  2MJE A;  3P1M A;  3SFD B;  4ZHP A;  1FM0 D;  4USA A;  5H92 C;  2WDV B;  2DBY A;  2W54 A;  1SIJ A;  1NEN B;  3L4P A;  1N60 A;  1JRP A;  1GTE A;  4IDI A;  2DWQ A;  3WCQ A;  1YJI A;  4YSX B;  1EWY C;  1N5X A;  2W55 A;  4N6E B;  3HUI A;  3W9C B;  3NRZ A;  3AEG B;  2QIE B;  1OFF A;  1QOA A;  2G1E A;  2QJL A;  3FC4 A;  2MH7 A;  4WWM A;  2WP9 B;  1FXI A;  3RPF C;  2FBW B;  3ETR A;  1ZXI A; 
#chains in the Genus database with same CATH topology
 4IWP A;  1VLB A;  3SFE B;  4C56 C;  2E3T A;  2KC1 A;  4RH6 A;  2TSS A;  4EOY A;  2LRU A;  3DBS A;  4MH0 E;  2NTT A;  2PPH A;  3E56 A;  2PVO D;  2J0K A;  2WNM A;  1FD6 A;  4MM3 B;  5G5H A;  3AE5 B;  4C4V A;  2WU2 B;  2JQR B;  4EZJ A;  3P2B A;  1JWB D;  1YQ4 B;  2INP E;  1KTK A;  2PTL A;  4A90 A;  4RCO A;  1R4M B;  5HI1 A;  4DDI D;  1E9M A;  4DHJ D;  3ZJT A;  2WLB A;  2FCQ A;  2MEK A;  5HKH A;  1J0G A;  1P7F A;  4GDL B;  1YNT E;  4P16 A;  3MC8 A;  1EWC A;  2LHD A;  2WGS A;  2O2V A;  3B9J A;  3RI7 C;  1JWM D;  3EUB 2;  5IO9 A;  3O65 B;  3RCZ A;  1E8W A;  2BS4 B;  2WXL A;  2M19 A;  2AQ3 B;  2WXG A;  5AUK A;  4OZC A;  5D94 A;  5BO4 B;  2K3U A;  3IT6 B;  2O6V B;  5LXH A;  1ENF A;  4FA6 A;  3NS1 A;  1NDD A;  3M3J A;  2IBI B;  2LZ6 A;  3Q2A C;  2Z0E B;  3MP9 A;  2UU7 A;  1RFK A;  5LXI B;  1UGJ A;  4PS8 A;  4IOI E;  1J19 A;  1RWS A;  4ZDV A;  3C19 A;  1WGD A;  4AS1 A;  4CYE A;  2W82 A;  1UWM A;  3I9V 1;  4C7Y A;  2KQ7 A;  2JU6 X;  2ZPY A;  3PLU A;  2I1J A;  3ZVV A;  3NS8 A;  4YL8 A;  1LFD A;  3V3X A;  1E8Z A;  2DZI A;  1C4C A;  4EUT A;  4B9K A;  2ZCB A;  1GTE A;  4W9D A;  1K53 A;  3Q3O C;  1LGR A;  4MEM A;  4IKG A;  2JRH A;  3NZU A;  3BYT B;  2FBW B;  2MRP A;  3AUL A;  1RM6 C;  1WGH A;  2FID A;  1WWT A;  1JAL A;  3P4Q B;  3AI5 A;  4IM0 A;  2HD5 B;  2D3C A;  2N0S B;  4M0W B;  1GTH A;  4BBN F;  3ZTD A;  3KUZ A;  4B0E A;  4BKS A;  1VR9 A;  4ARI A;  3ZXV A;  3EFC A;  1GUA B;  1DOY A;  2IO2 B;  4RFB A;  3ZJU A;  1WY8 A;  2J7Q B;  5J17 A;  2LFI A;  5D3I B;  2N9K A;  2O6V D;  1KH0 A;  3T3N A;  4ZRP A;  2Y3A A;  5DCN A;  4BOS C;  2KMA A;  4C4V B;  1QT9 A;  2JF5 A;  2KLC A;  1KRH A;  4M01 A;  3NZ3 A;  1C77 A;  3KUC B;  4NPN A;  3PVL A;  3DVG X;  3RNE C;  4RGO S;  1H7X A;  2N1W A;  3URY A;  2DYO A;  2DEN B;  1P3Q U;  1CQV A;  5EE0 A;  2BYF A;  2MA9 B;  3AE8 B;  2KJ6 A;  3DDC B;  4US9 A;  1H8C A;  1WJU A;  1ZUD 2;  1L5P A;  2KMC A;  2RPQ A;  1JW9 D;  2MCN B;  2O2V B;  3VR8 B;  2KFK A;  2SAK A;  5C23 A;  1K50 A;  1JRU A;  1GPX A;  4EZK A;  1P98 A;  3ZLZ A;  2LGX A;  2LWP A;  3PZD A;  4LNO A;  4MH8 A;  2FNJ B;  1EWY C;  1OFF A;  2WP9 B;  1WFY A;  3Q8A A;  4GSW A;  1FXA A;  1Q1O A;  3JSV A;  1TT5 B;  2LMC A;  1L4Z B;  3ML8 A;  1SF0 A;  1N5W A;  2KNB A;  2HE7 A;  3VH4 B;  2OOB B;  1WGK A;  1IBX A;  2WXI A;  1V2Y A;  3R2I A;  3GZN I;  2KHW B;  1D3Z A;  4HPP A;  1JRO A;  4A20 A;  5CHF A;  2IGG A;  4N59 A;  1JQ4 A;  1XLN A;  5MPO A;  1T6B X;  3DBH B;  1I4Q A;  3BK1 A;  1S1Q B;  2NS5 A;  3MC0 B;  4HLE A;  4GIV A;  4P1B C;  4EEW A;  1UF0 A;  3ZXR A;  2M17 A;  1KLV A;  3AE2 B;  5JH5 C;  1LXD A;  3PZ7 A;  4ZRQ A;  4RGM A;  2DYB A;  2QHO A;  4NJC A;  3HVZ A;  2CU1 A;  2W3S A;  3RNA C;  1DGJ A;  4E74 A;  2CKH B;  4UDU C;  2L8J A;  4B0M A;  3P42 A;  2CHZ A;  1E6E B;  3HK0 A;  2D5G A;  3L10 B;  4JWU C;  3I3T B;  1B9R A;  1VDV A;  2PW9 A;  1C1Y B;  1E5W A;  2WYQ A;  4WQM A;  1MHH E;  2FCN A;  4NNJ B;  1MG4 A;  4JX1 C;  3W2D A;  5E6N A;  2BWF A;  2N9P C;  1MFW A;  1WH3 A;  2OJW A;  4K3B A;  2MH7 A;  2GBN A;  1GG3 A;  3WAO A;  3ETR A;  1ACC A;  2KDM A;  2KFK B;  1KOT A;  3JVZ X;  4W9K A;  1XLP A;  2D3G A;  3N1Z C;  3AEC B;  1TZ1 A;  1P1A A;  3NG0 A;  3VXW A;  1UBQ A;  1D5X C;  1DYQ A;  2VZK B;  2BVC A;  2ZJD A;  4HKQ A;  2J0M A;  2OED A;  1EF1 A;  2AQ2 B;  4W9C A;  2JY6 A;  2Q5W D;  3GZN B;  4BKS D;  2CR5 A;  2Z59 B;  3JSV B;  4BKT A;  3DHG C;  1ISN A;  2JVC A;  3ZJV A;  1IP9 A;  3BVM A;  2WXF A;  1VZ8 A;  1L6V A;  1F1H A;  2FUG 1;  2LXC A;  3PO0 A;  4BVU C;  1TS4 A;  1IGC A;  4CQN A;  2KT7 A;  2K39 A;  1IUE A;  4TKN A;  2BKR B;  1SE2 A;  4XZ4 A;  4KX6 B;  2WDR B;  1RYJ A;  3WA0 A;  4YSY B;  1TYG B;  1ET6 A;  3SR6 A;  2YEP B;  1VZ6 A;  2OHF A;  2I1K A;  3U7Z A;  1YJJ A;  1DOX A;  2ZCC A;  2WQY B;  2D2Q A;  4JLC A;  2KAC A;  1PGA A;  1TY2 A;  3U2S C;  2FE8 A;  3QIJ A;  4JE3 B;  1Q10 A;  3KLS X;  1MPE A;  2FIF A;  1PQS A;  4HJG E;  2DZJ A;  1CJE A;  2N7E A;  4MGZ E;  1FRR A;  2L05 A;  1I4R A;  3R3M A;  3RMK C;  4FHJ A;  4MT5 A;  1KJT A;  4J6I A;  1WR1 A;  2KDI A;  4G50 A;  1WSP A;  1XEE A;  3FKY A;  3N1Y C;  1FEH A;  1WJ4 A;  2ONQ A;  3OG5 A;  1DOI A;  4ICU A;  1E8X A;  4K81 A;  4KIK A;  4MDK E;  4W9L A;  3ML9 A;  2ASQ A;  2WXK A;  1WXQ A;  3TBL D;  1C9F A;  3VHT C;  1SGH A;  3TMP B;  1YMH E;  5IOI A;  3VVW B;  2W3R A;  5BYQ A;  1ZOY B;  3DWM A;  4GGQ A;  2DZM A;  2MHJ A;  2R2Q A;  3ZYY X;  1T0S C;  5IN7 A;  4HDO A;  4MGK E;  1EM7 A;  4KZ0 A;  1YQ3 B;  3DBL B;  2B76 B;  2JWZ A;  1UH6 A;  5FR6 A;  2BS3 B;  2K5P A;  4M02 A;  2WXM A;  3RNB C;  2IO0 B;  3RUI B;  1P9D U;  2R61 A;  5E6J A;  2KN5 A;  3WAN A;  2RGF A;  2FCS A;  1EUV B;  1V49 A;  4HJK A;  3ZTC A;  2BGF A;  4WWP A;  1I4G A;  4JWS C;  4ZYS A;  3EHV A;  2LHE A;  2K8H A;  2WU5 B;  3Q3N C;  1ZP0 B;  2GMI C;  1V1P A;  2DNF A;  2KYW A;  3VAW A;  3ZO5 B;  1G6J A;  1Q5W B;  2NBW B;  1VD2 A;  4IW0 A;  1D5M C;  5L83 A;  3UI3 A;  3CF6 E;  2IGD A;  3L4P A;  1JWS D;  3IFW B;  3Q8B A;  2DLB A;  3WCQ A;  3DHH C;  2V0G A;  3DQV A;  4WWM A;  3R2T A;  3PPA A;  4HCN B;  2WXN A;  2ZEQ A;  3VUY A;  1FO4 A;  5CHV C;  4HCP B;  3ZUN A;  2LVO A;  3QQ8 B;  3PGE A;  4KDI C;  5LLI A;  1L6U A;  4AP4 C;  3MJW A;  3OJ3 A;  2MBO A;  2M1M A;  2MLB A;  1MHX A;  3TJP A;  1IGD A;  2KTF A;  2ZZP B;  3Q69 A;  2MBQ A;  4LNK A;  1NYQ A;  2HDE A;  1UBI A;  4W9I A;  4EFO A;  3AE9 B;  4II3 B;  3IHP C;  4G3X B;  4AWJ A;  4JQW C;  5JZE B;  4KIK B;  3AV8 A;  1WM2 A;  3JW0 X;  2D3B A;  1C4P A;  3RNG C;  3X0W A;  1UZX B;  3KQ4 A;  3VH3 B;  3P4R B;  1PGX A;  3UQB A;  2PKO A;  1CK1 A;  5BMI A;  1KFY B;  2QSD A;  2G4S A;  2CHX A;  2B3A A;  2KFJ A;  2ON8 A;  3QAR A;  3APF A;  5KHQ A;  1PYW D;  2GRI A;  2YEP F;  2ZPN A;  1GJZ A;  1FFU A;  2LVP A;  4XE0 A;  2FCM A;  4AQ7 A;  1TS3 A;  3OJ4 B;  3QAQ A;  5AZF A;  1I4X A;  1E7V A;  4RGT A;  5HG2 A;  3LYY A;  4M8N A;  2MJD A;  2WWZ A;  3R7R A;  3MTN B;  1KLU D;  2L00 B;  1WYW B;  4FJV B;  1WJ6 A;  3RNF C;  1OQY A;  2MJE A;  3O13 A;  2J42 A;  4NAM A;  3N9Y C;  4WH4 A;  4IDI A;  2KJR A;  4HDQ A;  2K0P A;  2JXX A;  4IUM B;  5DPT A;  3S2A A;  2XBB C;  3I57 A;  4MSQ B;  3NRZ A;  3Q3J A;  3AEG B;  3UQA A;  2YVC A;  2RR9 A;  1ZXI A;  4KVG B;  3TCA A;  3AE6 B;  1I4P A;  2XK5 A;  1V1P B;  1NYR A;  2KVR A;  2PIA A;  3TEY A;  3RFZ B;  1B1Z A;  2BW2 A;  2AEH A;  4REZ A;  2KWC A;  3W1Y A;  3CIR B;  3NZS A;  1OEY J;  3RUL A;  3APC A;  4KSK C;  2JZP A;  4IWQ A;  2JX5 A;  2WXO A;  2J4X A;  1BT0 A;  4IM3 A;  2L1A A;  3ZIM A;  1TZO A;  3TIX A;  2N7D A;  3AN1 A;  2ICI A;  4TQ0 A;  1RAX A;  4LCD E;  3RN9 C;  2DZK A;  4TMA B;  3N1X C;  3AE4 B;  2V4L A;  3IT4 B;  3ZKJ C;  2ZVO A;  1XO3 A;  2FUH B;  1FMA D;  4MGY E;  4MAC A;  1N6Z A;  4EKU A;  3PTF C;  1WE6 A;  3GOE A;  4E3C A;  3ZGZ A;  3PSE B;  1FNW A;  2KN4 A;  2JUO A;  2IY1 B;  3R66 C;  4DHZ E;  1WIA A;  3ZDM C;  1Y56 A;  1YN4 A;  3M63 B;  4ANV A;  1ESF A;  4FHK A;  2JSV X;  2BPS A;  2AL6 A;  3NVZ A;  4NY0 A;  3JYU A;  4RF1 A;  3ZW3 A;  5AUI A;  1Z5S B;  3RYT A;  2WXP A;  4J3O D;  2CS4 A;  1XLO A;  3VTV A;  2C9W B;  3W5V B;  4A3P A;  1SEB D;  1T0Y A;  2KLG A;  3J9C A;  2N9E B;  2NCN A;  4AJY B;  4W9H A;  1NEN B;  5T8I A;  4YWG G;  4WWO A;  2L0T A;  2W55 A;  2K8C A;  3KYD D;  2QJL A;  1WRD B;  2MX2 A;  2LJI A;  1FXI A;  2MBE A;  4K7S A;  3T3O A;  2V4I B;  5DPW A;  2DAJ A;  3QX1 A;  2NBV B;  1WGY A;  2GB1 A;  4XWT A;  4FAD A;  2Y5B B;  2J52 A;  2HTM E;  2K8B A;  1KLG D;  3MHS D;  1T5X D;  3TSS A;  3TEX A;  3MHZ A;  1EO6 A;  3AB5 A;  1ET9 A;  2KDE B;  1E0Z A;  3IVF A;  2BQQ A;  4KKJ A;  1YN3 A;  2N9L A;  2BYE A;  1HQR D;  3U4E G;  4HRO A;  4MGI E;  2XK5 B;  1HTO A;  1L0Y B;  2L7R A;  1AW7 A;  1SSN A;  2LGI A;  4URK A;  1VRA B;  1N61 A;  1YOV B;  1TKE A;  2GOW A;  3QWZ B;  3DPD A;  4YTM B;  1E7P B;  1M4V A;  1CMX B;  4B95 A;  1JWU D;  3RT3 B;  3VRA B;  1T0R C;  1IPG A;  1J7A A;  2BF8 B;  2L76 A;  1C79 A;  2PE6 B;  2VH2 A;  3DCG A;  1V80 A;  1JML A;  2M0X A;  3M62 B;  1E90 A;  3VRB B;  3EFU A;  5CX3 A;  5FR3 A;  4K3C A;  4ARC A;  4KGT A;  4M00 A;  5G2N A;  1HEZ E;  1NVI D;  2G4D B;  4ZRJ A;  5C1Z A;  3ZNI D;  3TL5 A;  2G9H D;  2W54 A;  3BYY B;  3M95 A;  3OAW A;  3WAL A;  1TBE A;  3R7Q A;  2G45 B;  3HUI A;  2NVU I;  3NOB A;  5BYS A;  2WXH A;  4WAF A;  1I42 A;  4YXD B;  3GP7 A;  4FJZ A;  4OZA A;  2Z8L A;  2LJ5 A;  4NJ7 A;  4W9E A;  1KM7 A;  3AE3 B;  4ZRI A;  2MSE D;  3R8B A;  1Q0W B;  4KZC A;  2MW5 A;  2KO3 A;  1RLF A;  1WR6 E;  4ANX A;  4L1B A;  3AEA B;  3SDL C;  3LDZ E;  2KK8 A;  4A3O A;  3IAM 1;  4S0R A;  3H1U A;  3L16 A;  1RRB A;  2D3A A;  4BAX A;  2L3Z A;  5G5G A;  3PT2 B;  3DVN V;  3H6N A;  4RM9 A;  1PFD A;  1SE9 A;  1L0X B;  1K52 A;  3PHW B;  1F52 A;  2JZ3 B;  4WIP A;  2WX0 A;  4OVU A;  4K7U A;  2V3N A;  1JCK B;  3NHE B;  3P63 A;  3HVD A;  4ZRK A;  3LXF A;  1WXS A;  4W9G A;  4HWI B;  4ICV A;  1F77 A;  4ANW A;  2IO3 B;  5C3J B;  3QCA A;  4FLH A;  2NR2 A;  1HXY D;  3AU4 A;  4L23 A;  3ZRC A;  2QEJ C;  1WYG A;  2NTS A;  4HPM B;  3H7S A;  4IM2 A;  3BVG A;  1KF6 B;  3N32 A;  2MWS B;  2MQJ A;  1EU4 A;  3SEB A;  2IYD B;  1N5X A;  2KWD A;  2QIE B;  2UYZ B;  4M8M A;  4WJQ A;  2M4N A;  1E7U A;  2GI9 A;  1NEK B;  3HHM A;  1GC7 A;  1SB3 C;  2D10 A;  3Q8E A;  1L2N A;  3CF4 A;  1U4A A;  3AEF B;  1H4R A;  2Y5C A;  1K8R B;  1V5T A;  3Q3F A;  2K6D B;  1GC6 A;  1NBF C;  3IG3 A;  2VZK D;  4JPS A;  1SIF A;  1XXG A;  1ZDX A;  2X38 A;  2KMM A;  3BII D;  4A6Q A;  3K9P B;  1Y8R C;  1ZE3 D;  2KJH B;  2SEB D;  1V5O A;  4FXC A;  2K9X A;  2RDG A;  2LD9 A;  1Z2M A;  3PV1 A;  1A70 A;  3APD A;  3B0A A;  4ANU A;  1FFV A;  3RZW C;  3V62 A;  1V81 A;  3C0R B;  3FAH A;  1ROE A;  1GT8 A;  1M94 A;  4HKZ E;  2WDQ B;  4WQO B;  1LO5 D;  4DXA B;  3VDZ A;  4DDG D;  1I7H A;  2J0J A;  1VCB A;  5J18 A;  1UNS A;  3Q3M C;  2OJR A;  4WAA A;  5H92 C;  3KW5 B;  2DWQ A;  1XCQ L;  1WX9 A;  4OW0 A;  4YSX B;  2JWU A;  3BVZ A;  1R4M I;  1FCL A;  3BIN A;  1HZ5 A;  3SU8 X;  2C7M B;  4G0N B;  3VTU A;  5EDS A;  2Y5P A;  1AYF A;  1LQB A;  4A55 A;  2NMQ A;  2EEL A;  3N3K B;  1L4D B;  4B6W A;  2CJN A;  2N4F A;  2IZV B;  3T8M A;  1ZXH A;  3KVF B;  2E6X A;  4OHJ A;  2EKI A;  4XX5 A;  3HM3 A;  4RNA A;  3PHX B;  4BOZ B;  1V86 A;  4NZL B;  4PS7 A;  1UWX A;  2BT6 A;  4P6V F;  3ABV B;  2RD0 A;  3RZF A;  3PRE A;  3LB8 C;  4HK2 A;  4AOF A;  3L13 A;  2KAJ A;  1FIQ A;  2KZR A;  5JHA A;  1YX5 B;  2HTH A;  3PRZ A;  4LTU A;  2LUM A;  3MJ5 A;  4H2A A;  5D7G A;  4LJO B;  4BFR A;  3NY5 A;  3EGR A;  3KWL A;  1WRI A;  1T0Q C;  3WIM A;  4QAY A;  3A33 B;  4YSZ B;  4RMA A;  3U52 E;  1C4A A;  3QK0 A;  1YN5 A;  1WGG A;  5L95 C;  4N9F 4;  2GBK A;  2IGH A;  4KGR A;  3N20 C;  1JWA D;  4Q2J A;  4DXG A;  1WX8 A;  4RGN A;  4YT0 B;  2L83 A;  1UD7 A;  5CHW A;  4DQO C;  3A4S C;  1OGW A;  2A4Z A;  1CZP A;  2LVQ A;  1D4B A;  2WX1 A;  1D5Z C;  4PK1 A;  3KWV A;  1NI2 A;  4F1S A;  2I2Y A;  4TSS A;  5E6O A;  1FNU A;  3SFD B;  1MJD A;  3U7D A;  4MEL A;  3GS2 A;  4FN2 A;  3BWU D;  3IAS 1;  1WJN A;  2AL3 A;  1V6E A;  2MBB B;  3V05 A;  3QC8 B;  3QHT A;  2K1F A;  4MJS A;  4XDC A;  2L0F A;  4AJW A;  1OEY A;  1T3Q A;  2BB5 A;  3ZNZ B;  1GOZ A;  1QOG A;  3UIP B;  1VJK A;  1QF6 A;  3H7P A;  4IC7 B;  5DPS A;  1J8C A;  1WZ0 A;  4JL9 A;  3DVG Y;  3PRM B;  3AEE B;  3Q14 C;  1FNV A;  4LDT B;  2PLP A;  4DXF A;  1PDX A;  3EEC A;  2C7N B;  1A5R A;  3DVN U;  3DBR I;  4XDD A;  1GAQ B;  4LNN A;  4JIO U;  1WGR A;  3AE7 B;  2V9H A;  2Z0D B;  1TJE A;  3NJT A;  1OQR A;  3PZ8 A;  2BBC A;  4XGA B;  2ZVN A;  1K51 A;  2IO1 B;  2KDF B;  4HRS A;  4N58 A;  2GBJ A;  2CJO A;  2RDH A;  4C80 A;  2LRW A;  1TKG A;  2VH1 A;  1AN8 A;  5KHO A;  1ZPS A;  3I63 C;  5G55 A;  2PMV A;  3HRD D;  1LM8 B;  4I6P A;  5EE9 A;  2L52 A;  2KKC A;  5EE3 A;  3V6C B;  3PS6 A;  1FRD A;  5J2R A;  2JRI B;  2AQ1 B;  3C8Y A;  3SD5 A;  2IPK D;  4EE2 A;  1R4N I;  2MP2 A;  4P7I A;  1XD3 B;  1NI3 A;  3RNC C;  2D07 B;  2PE9 A;  2HJ8 A;  3W1S C;  3BK2 A;  2EMS A;  1SIJ A;  1N60 A;  3DHI C;  1WMH A;  1MVK A;  3EA6 A;  1RFA A;  4FUL A;  5CTR C;  1WM3 A;  4KGS A;  3ZNH B;  2KX0 A;  3DBH I;  2LGD A;  4GN1 A;  5BMG A;  4LDT D;  2FAZ A;  3ZRF A;  2EKE C;  3HIZ A;  3MFG A;  4C7Z A;  1XQQ A;  1QOB A;  1R7S A;  3ZQ4 A;  1WXM A;  2R2O A;  4AUQ C;  1WXA A;  3IBE A;  3V6E B;  4BKG A;  2KXJ A;  1FCC C;  3KH0 A;  4NQL B;  2N7J A;  2LGS A;  3B2G A;  4WJO A;  1P0R A;  1QLB B;  2LXA A;  2RMM A;  1QIL A;  4RM8 A;  2WS3 B;  3OLM D;  4PYU A;  2KX3 A;  3EC8 A;  2PVG C;  4PYZ A;  2AX5 A;  4HXD A;  3DBR B;  4GU2 A;  1GNU A;  4MJS B;  2KAN A;  4A8X C;  4I6N B;  4IWO A;  2PJH A;  1HE8 A;  4WWN A;  4R3D A;  3ENE A;  1MG8 A;  3H7P B;  2IDY A;  3IXS A;  3A9J A;  2IND C;  3Q6B A;  4ZOH C;  4GOC A;  3U8Z A;  3X23 A;  1PGB A;  2XEW A;  1L7Y A;  1STE A;  1P7E A;  4OZB A;  1TY0 A;  2KOX A;  1UUP A;  4GXB A;  2LAS A;  4OVZ A;  5FKA C;  4CO7 A;  3B08 A;  3KYC D;  3H9D A;  4TUU A;  4LK0 M;  1V9J A;  3GE3 C;  2G3Q B;  1PUT A;  3DOW A;  1SE3 A;  1SBB B;  1N63 A;  4ASW C;  4XYC A;  1SXT A;  2KVZ A;  4G11 A;  2QMT A;  4NJ6 A;  3D32 A;  2EMT A;  1ZW7 A;  4WUR A;  2ACZ B;  2IY0 B;  4YTN B;  3U30 A;  2DHZ A;  4GB9 A;  2H89 B;  1BXT A;  1R4N B;  3L54 A;  2DBY A;  5JHB A;  3T9L A;  4MSM B;  3QA8 A;  2VRR B;  2A5U A;  1YJI A;  2BYT A;  1TIF A;  5IP4 D;  1ZGU B;  3ECI A;  3ZDT A;  4GLS C;  3N30 A;  1FXT B;  4W9F A;  4I6L B;  1ZKH A;  2J53 A;  3A1Q A;  2PEA A;  5I4D A;  5D6J B;  3VUX A;  1J7C A;  1MI0 A;  2K22 A;  2W9N A;  3ZNG C;  2MP2 B;  2BTE A;  3E9S A;  1F0Z A;  1YJ1 A;  4GMV A;  2RSU A;  2AYO B;  1I35 A;  3KUD B;  4TV3 A;  5C2T B;  1WMH B;  4LLG M;  2KWU B;  1YIW A;  4YTP B;  4P1C C;  3PLV A;  4L2Y A;  1TKY A;  2ZW0 A;  2C7H A;  2WXQ A;  1GB4 A;  2ZW1 A;  1C76 A;  1SJH D;  1E8Y A;  1V8C A;  2JYE A;  3DWG C;  2V1Y A;  2WXR A;  4ZYN A;  5IKC M;  5E6P A;  4LNI A;  1EF5 A;  2DYM A;  4HPL B;  2V3P A;  3VUW A;  4W9J A;  3HM6 X;  3TUO A;  2INN E;  1OTR B;  3ONS A;  2RDB C;  2XN9 C;  1WXV A;  2K6Q A;  1HTQ A;  2NPT A;  5HFY A;  5DPR A;  1AAR A;  4K7W A;  5D3D A;  4K1R B;  3GB1 A;  3BY4 B;  5LNK 1;  1SJE D;  3AED B;  1QOF A;  3UGB B;  1XF5 L;  3I5J C;  4NAW A;  4KSL C;  3AEB B;  4FJY A;  4S17 A;  3A9J B;  2LI5 A;  1WX7 A;  2QIL A;  5IA7 A;  1F2R I;  2JYT A;  1UGM A;  1V97 A;  4HVB A;  1FM0 D;  2BWE S;  1WF9 A;  1TTN A;  3UIO B;  2RPV A;  3W9C B;  1QZE A;  2QDF A;  1GB1 A;  2BYV E;  3AXC A;  4NQK E;  5TSS A;  1WE7 A;  4F8C B;  1H7W A;  3W5U B;  3L17 A;  1AWD A;  5AEK B;  2LEK A;  5BMH A;  4C00 A;  3P4S B;  3DBL I;  3TEZ A;  4HEA 1;  1QKZ A;  1ZDV A;  4KDL B;  2WDT B;  1XCT L;  2CU3 A;  3L08 A;  3K9O B;  2JXT A;  1F9J A;  1IBX B;  1V1O A;  2C60 A;  2V3S A;  2REX A;  1QQR A;  2QC8 A;  3Q8F A;  3A1Q B;  3TEW A;  3A9K A;  2KTR A;  2AWT A;  1XT9 B;  1IYF A;  3AH7 A;  2KDB A;  3P4P B;  2BB6 A;  2ZNV B;  4XWW A;  2WHI A;  3WAM A;  5FK9 C;  2INC C;  2KC2 A;  3FIL A;  4GDK A;  3VFK A;  5EE1 A;  2M8S A;  3AE1 B;  3VTW A;  4LJP B;  3A4R A;  1FPY A;  2JT4 B;  1E10 A;  2UWQ A;  2MJ3 A;  1S3S G;  3NVY A;  2KWV B;  3LJ3 A;  3NUH B;  1WZ3 A;  4KV2 A;  2H88 B;  5H8Y E;  2XNA C;  4DK5 A;  4LNF A;  1VZ7 A;  3H8H A;  4O1N A;  3B2F A;  1UEL A;  4F7Z A;  4IG7 B;  4CHK A;  1YD8 U;  2NPT B;  2GLS A;  2C5L C;  4ZHP A;  4USA A;  2WDV B;  4DHZ B;  4MM3 A;  4DWF A;  2HJ1 A;  3WAP A;  1C3T A;  2I38 A;  3W1S A;  5GMV A;  3B1L X;  1X1M A;  2CHW A;  2DX5 B;  2QCZ A;  3RPF C;  4NAW B;  4WJP A;  3FC4 A;  5IAA C;  4WJN A;  1N62 A;  5AZG A;  4GDL A;  5TR5 A;  2M56 B;  3AU5 A;  4RF0 A;  3CSF A;  3GE8 C;  4ITK A;  3RD2 A;  5HHD G;  2LUE A;  2O6V A;  2M0A A;  2WXJ A;  1SE4 A;  4OVV A;  4US8 A;  2JZZ A;  2ZNV C;  4DBG A;  3AM9 A;  1TS5 A;  2GBM A;  2L32 A;  3L0W B;  4EZL A;  2NBU A;  3Q8C A;  4X57 B;  1HA5 A;  1BUI C;  3UF8 A;  3CST A;  4DHJ B;  1D6E C;  3V60 A;  3VR9 B;  3CMM B;  1YQB A;  3NVW A;  4PS3 A;  4A9A A;  1C78 A;  2BKF A;  3QJZ A;  3NVV A;  2MBH A;  3AMZ A;  3ALB A;  2N1V A;  4D2K A;  2D11 A;  1BML C;  4II2 B;  1OQQ A;  2GBR A;  1WI0 A;  3PRP B;  3OWE B;  1HZ6 A;  3A9K B;  5GXG B;  3SHQ A;  2KTR B;  1I4H A;  2KD0 A;  5D2M B;  3V61 A;  4PT5 A;  2KQS A;  1YX6 B;  4XC2 A;  4ZHO A;  4BZA A;  1J7B A;  2X8X X;  1F2R C;  1XLQ A;  2YLM A;  2K25 A;  1L0V B;  3FIL B;  2IJ0 A;  2JPH A;  2BS2 B;  4GDK B;  3CWI A;  1TS2 A;  4TQ1 A;  4E71 A;  4M0W A;  3P1M A;  2KQ4 X;  3BZD B;  5AZH A;  3UIN B;  2DAF A;  5BYR A;  4KKI A;  2N9X A;  1EU3 A;  1JRP A;  3VQI A;  4FBJ B;  5JXV A;  1TGZ B;  4BBN C;  4N6E B;  2LGY A;  4ACF A;  1QOA A;  2G1E A;  4JGH B;  3MC9 A; 
#chains in the Genus database with same CATH homology
 1VLB A;  3SFE B;  4YXD B;  1WSP A;  1XEE A;  3GP7 A;  5BMG A;  4C56 C;  2E3T A;  4OZA A;  4RH6 A;  2TSS A;  2Z8L A;  1FEH A;  2ONQ A;  1DOI A;  2NTT A;  2WXK A;  3MFG A;  1WXQ A;  4C7Z A;  3AE3 B;  1QOB A;  1R7S A;  1C9F A;  3E56 A;  2PVO D;  3ZQ4 A;  2WNM A;  3R8B A;  1FD6 A;  4MM3 B;  5G5H A;  3AE5 B;  2WU2 B;  2JQR B;  1FCC C;  1YMH E;  1JWB D;  2N7J A;  3B2G A;  1QLB B;  1YQ4 B;  1KTK A;  2INP E;  1QIL A;  2PTL A;  2WS3 B;  2RMM A;  4RCO A;  4A90 A;  4L1B A;  2W3R A;  5HI1 A;  1E9M A;  3AEA B;  2PVG C;  3ZJT A;  5BYQ A;  1ZOY B;  2AX5 A;  2WLB A;  3DWM A;  3IAM 1;  2MEK A;  4A8X C;  1P7F A;  4GDL B;  1YNT E;  4P16 A;  3ZYY X;  1EWC A;  2LHD A;  5G5G A;  1EM7 A;  3B9J A;  4R3D A;  1YQ3 B;  1JWM D;  2IDY A;  3EUB 2;  3IXS A;  2B76 B;  1PFD A;  2BS4 B;  2WXL A;  2M19 A;  1L0X B;  2AQ3 B;  4ZOH C;  2WXG A;  2BS3 B;  1K52 A;  5AUK A;  1PGB A;  2K5P A;  4OZC A;  2K3U A;  3IT6 B;  1ENF A;  2WXM A;  1STE A;  3NS1 A;  4WIP A;  1P7E A;  4OZB A;  1TY0 A;  2R61 A;  1UUP A;  5E6J A;  5FKA C;  4OVZ A;  3MP9 A;  2V3N A;  1JCK B;  1RFK A;  3P63 A;  4LK0 M;  3HVD A;  3LXF A;  1UGJ A;  1PUT A;  1I4G A;  1SE3 A;  1SBB B;  4IOI E;  1F77 A;  1RWS A;  4JWS C;  1N63 A;  4ZYS A;  2LHE A;  5C3J B;  1SXT A;  4AS1 A;  2WU5 B;  1HXY D;  2QMT A;  4L23 A;  1ZP0 B;  2W82 A;  4WUR A;  2ACZ B;  1UWM A;  3I9V 1;  2QEJ C;  1WYG A;  4C7Y A;  1V1P A;  2JU6 X;  2NTS A;  4YTN B;  3V3X A;  3BVG A;  2H89 B;  1KF6 B;  1BXT A;  1D5M C;  1C4C A;  3UI3 A;  2DBY A;  2IGD A;  1EU4 A;  3L4P A;  1JWS D;  1GTE A;  3SEB A;  1K53 A;  3Q8B A;  2DLB A;  1YJI A;  3WCQ A;  1N5X A;  2V0G A;  2KWD A;  2BYT A;  2QIE B;  4IKG A;  4WWM A;  3R2T A;  4GLS C;  3BYT B;  2FBW B;  2J53 A;  2WXN A;  1RM6 C;  2GI9 A;  1NEK B;  1WWT A;  5I4D A;  1FO4 A;  1JAL A;  1J7C A;  3P4Q B;  1MI0 A;  2K22 A;  1SB3 C;  2BTE A;  1L6U A;  3E9S A;  3Q8E A;  1F0Z A;  3CF4 A;  3AEF B;  2N0S B;  1GTH A;  2Y5C A;  1MHX A;  1IGD A;  4B0E A;  1VR9 A;  4ARI A;  5C2T B;  3Q69 A;  4LLG M;  1NYQ A;  2HDE A;  4YTP B;  1DOY A;  4L2Y A;  1TKY A;  4RFB A;  3ZJU A;  3AE9 B;  2ZW0 A;  2WXQ A;  1GB4 A;  2ZW1 A;  2VZK D;  1C76 A;  1SJH D;  2JYE A;  1V8C A;  3DWG C;  2LFI A;  2WXR A;  4JPS A;  5D3I B;  2N9K A;  3AV8 A;  1XXG A;  1KH0 A;  1ZDX A;  2X38 A;  2DYM A;  2KMM A;  3BII D;  4ZRP A;  4A6Q A;  3T3N A;  1ZE3 D;  2SEB D;  2Y3A A;  2V3P A;  1C4P A;  3KQ4 A;  3TUO A;  3P4R B;  4FXC A;  1PGX A;  1QT9 A;  2INN E;  2PKO A;  2K9X A;  1KRH A;  2RDG A;  3NZ3 A;  1CK1 A;  1C77 A;  2XN9 C;  1A70 A;  5BMI A;  1KFY B;  2QSD A;  5HFY A;  4RGO S;  1H7X A;  3URY A;  5D3D A;  2DYO A;  3GB1 A;  1CQV A;  5EE0 A;  2ON8 A;  1FFV A;  5LNK 1;  1SJE D;  3AE8 B;  4US9 A;  1ZUD 2;  3FAH A;  3AED B;  1PYW D;  1L5P A;  2GRI A;  2YEP F;  1QOF A;  1XF5 L;  1JW9 D;  1ROE A;  1GT8 A;  1FFU A;  4AQ7 A;  4XE0 A;  1TS3 A;  4HKZ E;  3VR8 B;  3AEB B;  1I4X A;  2WDQ B;  4RGT A;  1LO5 D;  5HG2 A;  3LYY A;  2SAK A;  2MJD A;  1K50 A;  1KLU D;  1I7H A;  1GPX A;  2QIL A;  1F2R I;  2JYT A;  1UNS A;  1V97 A;  2MJE A;  1FM0 D;  2J42 A;  3O13 A;  4NAM A;  5H92 C;  4MH8 A;  3N9Y C;  4WH4 A;  4IDI A;  2DWQ A;  1XCQ L;  2RPV A;  4OW0 A;  2K0P A;  4YSX B;  1EWY C;  3W9C B;  3I57 A;  2JWU A;  3BVZ A;  3NRZ A;  1FCL A;  3AEG B;  1GB1 A;  1OFF A;  2WP9 B;  1HZ5 A;  5TSS A;  1ZXI A;  3Q8A A;  1H7W A;  2Y5P A;  3W5U B;  3AE6 B;  1AYF A;  1I4P A;  2NMQ A;  4A55 A;  1FXA A;  1AWD A;  2EEL A;  2LEK A;  1L4D B;  1V1P B;  1NYR A;  2PIA A;  3TEY A;  3RFZ B;  2CJN A;  1L4Z B;  2LMC A;  1B1Z A;  5BMH A;  2BW2 A;  4REZ A;  1SF0 A;  1N5W A;  3P4S B;  3TEZ A;  3CIR B;  4HEA 1;  1ZXH A;  1QKZ A;  2E6X A;  4OHJ A;  2EKI A;  4RNA A;  1ZDV A;  2JZP A;  1WGK A;  1XCT L;  2CU3 A;  2JX5 A;  1IBX A;  2WXO A;  4NZL B;  2WXI A;  2JXT A;  2J4X A;  1IBX B;  2L1A A;  1UWX A;  1V1O A;  1TZO A;  2BT6 A;  3ABV B;  3R2I A;  4P6V F;  1QQR A;  3AN1 A;  1JRO A;  3LB8 C;  3Q8F A;  2ICI A;  2KAJ A;  1FIQ A;  4TQ0 A;  3TEW A;  2IGG A;  4N59 A;  1JQ4 A;  1XLN A;  4TMA B;  5MPO A;  1T6B X;  1I4Q A;  3BK1 A;  3AH7 A;  3MC0 B;  4LTU A;  3AE4 B;  2LUM A;  3P4P B;  3MJ5 A;  2BB6 A;  4H2A A;  5D7G A;  4XWW A;  3EGR A;  3KWL A;  5FK9 C;  1WRI A;  3AE2 B;  3IT4 B;  1XO3 A;  3FIL A;  1FMA D;  4YSZ B;  4MAC A;  3PZ7 A;  4ZRQ A;  4RGM A;  5EE1 A;  3U52 E;  3AE1 B;  1C4A A;  1YN5 A;  4NJC A;  3HVZ A;  2IGH A;  3ZGZ A;  2W3S A;  4KGR A;  1E10 A;  1FNW A;  1DGJ A;  1JWA D;  2KN4 A;  4Q2J A;  4DXG A;  4RGN A;  2MJ3 A;  3NVY A;  4UDU C;  4YT0 B;  2L83 A;  1Y56 A;  1YN4 A;  4DQO C;  3NUH B;  4B0M A;  3P42 A;  1E6E B;  1ESF A;  1CZP A;  2D5G A;  2H88 B;  4JWU C;  5H8Y E;  2JSV X;  2XNA C;  1B9R A;  1D4B A;  3NVZ A;  1VDV A;  2PW9 A;  1VZ7 A;  3H8H A;  1D5Z C;  4RF1 A;  5AUI A;  3KWV A;  2WXP A;  3B2F A;  4O1N A;  2I2Y A;  4J3O D;  1XLO A;  4WQM A;  1MHH E;  3W5V B;  4TSS A;  1SEB D;  4JX1 C;  1FNU A;  4ZHP A;  3SFD B;  3J9C A;  4USA A;  3W2D A;  2WDV B;  1NEN B;  3GS2 A;  5T8I A;  4YWG G;  2I38 A;  2W55 A;  3BWU D;  3IAS 1;  3W1S A;  2QJL A;  2MH7 A;  2LJI A;  1FXI A;  3RPF C;  4NAW B;  3T3O A;  3ETR A;  1ACC A;  2KDM A;  3FC4 A;  3V05 A;  2V4I B;  1XLP A;  2GB1 A;  4XDC A;  4XWT A;  1N62 A;  3AEC B;  1T3Q A;  2J52 A;  2BB5 A;  2M56 B;  2HTM E;  1KLG D;  1GOZ A;  1QOG A;  1VJK A;  1QF6 A;  1T5X D;  4RF0 A;  3TSS A;  3TEX A;  3MHZ A;  3AEE B;  4ITK A;  1FNV A;  1D5X C;  1DYQ A;  5HHD G;  2PLP A;  2VZK B;  4DXF A;  1PDX A;  2M0A A;  2WXJ A;  4HKQ A;  3AB5 A;  1ET9 A;  1SE4 A;  2OED A;  4XDD A;  1E0Z A;  2AQ2 B;  1GAQ B;  4US8 A;  4KKJ A;  1YN3 A;  2N9L A;  3AE7 B;  1HQR D;  3U4E G;  3AM9 A;  2Q5W D;  4HRO A;  1TJE A;  1TS5 A;  2L32 A;  1OQR A;  1L0Y B;  3PZ8 A;  2BBC A;  1AW7 A;  1K51 A;  2WXF A;  1HA5 A;  1SSN A;  2LGI A;  3BVM A;  3Q8C A;  1VZ8 A;  1BUI C;  1L6V A;  2FUG 1;  3PO0 A;  1D6E C;  1N61 A;  1VRA B;  1TKE A;  1TS4 A;  1IGC A;  4HRS A;  4YTM B;  1E7P B;  1M4V A;  4N58 A;  4CQN A;  3VR9 B;  2CJO A;  3NVW A;  1JWU D;  4A9A A;  1C78 A;  3NVV A;  1IUE A;  1SE2 A;  2RDH A;  4C80 A;  3VRA B;  4KX6 B;  2WDR B;  1RYJ A;  3AMZ A;  4D2K A;  1TKG A;  4YSY B;  1BML C;  1TYG B;  1J7A A;  1AN8 A;  1ET6 A;  1OQQ A;  3SR6 A;  2YEP B;  1C79 A;  1VZ6 A;  2OHF A;  3OWE B;  3U7Z A;  1YJJ A;  1HZ6 A;  1ZPS A;  1DOX A;  5GXG B;  1JML A;  1I4H A;  2PMV A;  3HRD D;  5EE9 A;  2WQY B;  3VRB B;  2L52 A;  2KAC A;  1PGA A;  4PT5 A;  1TY2 A;  3U2S C;  4ZHO A;  2FE8 A;  5EE3 A;  1J7B A;  4JE3 B;  1Q10 A;  3KLS X;  1F2R C;  5FR3 A;  1FRD A;  1XLQ A;  1MPE A;  4ARC A;  4KGT A;  2AQ1 B;  3C8Y A;  4HJG E;  1L0V B;  1HEZ E;  2IJ0 A;  3FIL B;  2BS2 B;  2IPK D;  1CJE A;  4EE2 A;  4GDK B;  3CWI A;  1TS2 A;  1FRR A;  1NI3 A;  1NVI D;  4TQ1 A;  1I4R A;  4M0W A;  3P1M A;  2KQ4 X;  3BZD B;  2G9H D;  5BYR A;  2W54 A;  3BK2 A;  3BYY B;  4KKI A;  1SIJ A;  1N60 A;  1EU3 A;  1JRP A;  3VQI A;  1MVK A;  3EA6 A;  5JXV A;  4N6E B;  3HUI A;  3ZJV A;  1QOA A;  2G1E A;  4MT5 A;  5BYS A;  2WXH A;  4WAF A;  4KGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...